4A75A

The lin28b cold shock domain in complex with hexathymidine.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
89
structure length
89
Chain Sequence
GSDPQVLRGSGHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYMEGFRSLKEGEPVEFTFKKSSKGFESLRVTGPGGNPCLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIN28 COLD SHOCK DOMAIN
publication title The Lin28 Cold-Shock Domain Remodels Pre-Let-7 Microrna.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
molecule tags Chaperone/dna
total genus 18
structure length 89
sequence length 89
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2011-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a75A00
1WCMH 3FP9A 1MJEA 4DV3Q 1J5EQ 2ZTCA 4RMFA 3J80i 1VQ6A 1HNXQ 2UXCQ 4AH6A 1CKOA 4LF6Q 1XTDA 4A75A 3TRZA 3CCJA 1DGSA 3T1HQ 3M7NA 4EQ5A 4BY7H 1N36L 4POGA 1KRSA 3DM3A 4LWCA 1VQ5A 4B3RL 4WJ4A 1UE7A 5FLMH 3K0XA 1NTGA 4BXXG 2WB1G 4AQYQ 1XMOQ 4PG3A 1XPRA 1Y1VH 4A3KH 2UXCL 2E5LL 1IBKQ 2Y0SE 2ZJQA 4LF8Q 1IZ6A 2JEAI 1UE5A 5C4XH 1KD1C 2UU9L 4X64Q 3A5ZB 3UE1A 1CKNA 2QEXA 1NY4A 4KHPL 2KHJA 1HZ9A 1OXTA 1SR3A 3M9BA 2R7ZG 1HR0L 1IBLQ 2K52A 4Y7NH 1NE3A 4GLVB 4DV4Q 4LF9L 1X54A 4AQYL 1XMOL 1HZBA 2Q2TA 1X6OA 4MNOA 4YY3Q 1OXSC 1IBKL 1JE5A 3RR5A 3S2DH 4X62Q 2HIXA 5IT9c 4BBSH 3I4MH 4UPAA 5ELNA 3GTQH 4A3LH 1VQMA 1TWFH 2JA9A 3J80c 3HOXG 4JI7Q 1FJGQ 4DAMA 3HOUG 1Y14B 1YITA 3KLWA 1HZCA 1IXRA 2MFIA 3PUXA 4DV4L 4C3IH 4R4CA 2MQHA 5M3MG 4GLAC 3B6YA 4YY3L 2I5HA 1BBUA 3K8AA 4JI6L 3CAMA 1Q82C 3I55A 3PCOB 2JA5H 1N32Q 4DR1Q 3BZKA 3D0FA 2PMZE 3A0JA 3GDEA 1Q7YC 3TEHB 2R92G 1FJGL 4B3TL 1NMGA 2NVYH 1NBWA 4J15A 1M1KC 2JJQA 4JI5L 4DR4Q 4BXXH 3ER0A 1OXUA 2ZTDA 2JE6I 1X55A 1Z9FA 4A3MH 4KLKA 4OXPA 1PH3A 1XPUA 1YEZA 2IHFA 2CQOA 2UXBQ 1E1OA 2KBNA 1HH2P 5J3BA 4Y52H 3T1YQ 1VQNA 4PMWA 3HOYH 2WFWA 3GTMH 3CD6A 2A1AA 2F4VL 4HIOA 1EOVA 2R7ZH 4PZ8A 3U4ZA 1BKBA 4FDBA 5AJ3Q 4HIKA 3BU2A 1UEBA 3ERSX 4DR7Q 5DLQE 1PV4A 1YJ9A 1NMFA 3S1MH 2UXBL 1I6HH 2UUBL 1YBYA 1RIPA 3BZCA 4OWTB 4YCUA 5M3FG 4GKKL 3M4QA 1VQFA 3S1NH 4GKJQ 2WB1E 4LFAL 2F52A 4A3EG 1VQEA 3HOXH 2DGYA 5AJ3L 4HJ5A 1HZAA 2FXQA 3HOUH 4BBRG 3H3VI 1N34Q 4H02A 3ZJYC 3E9IA 5M3MH 2BH2A 1TWGH 5JJLA 4JYAQ 4HJ8A 1WI5A 2D62A 1E22A 3RLOA 3TQYA 5IYCG 4OX9L 4NPSA 2A8VA 4HJ9A 3KFUA 1L1OC 1JT8A 4R4IA 3Q8DA 1LTLA 4EX5A 1K73C 2R92H 2NVTH 4POFA 2MO0A 4UP9A 3I4NG 1ASYA 3I56A 3PSIA 2IY5B 4OWXB 4JI8Q 3RN2A 1B70B 4ME3A 1UE1A 2E2JH 3FKIG 1CSPA 4A4IA 1VQKA 4LF5Q 2AHOB 2UUAQ 4DV5L 5LMNL 4JYAL 3DLLA 4X6AH 4DV0Q 4MTNA 4YCWA 3S1QH 5HY6A 3E0EA 2N3SA 5IP9G 3ULJA 4DUYL 1SRUA 1C9OA 4DUZL 1SFOH 3CPFA 3S2HH 1J6QA 3GO5A 2JQOA 3PUVA 1X3FA 3UDXA 4NB3A 3GTPH 2YYZA 1Q81C 2UUAL 4LF4Q 3PF5A 4C3JH 4B3RQ 1N36Q 5C0XJ 4DR2L 4JBMA 4DV0L 5IYBH 4OONA 2LXKA 1FVIA 1PYBA 3G48A 5M3FH 4X66Q 4DR3L 4A3DG 2R6GA 4A3IH 1A8VA 2BA0A 1K8GA 3U58A 4KHZA 4A3EH 2E5LQ 2ASBA 1VQHA 4GNXA 2NVQH 2ZM6L 2YTVA 1S72A 3A74A 1K8AC 4GN3B 4LF4L 3CP0A 2UU9Q 1XNQL 1XMQL 2Q2UA 3S1RH 3H0GG 2VY3A 1YIJA 4NXMQ 2B29A 1TWAH 4KHPQ 1VQGA 3NELA 1K83H 4LFBQ 1PVOA 1HR0Q 2AWNA 5IYCH 4IFDJ 4JCVE 4X66L 2VS1A 4B3SQ 5LMUL 2B3GA 3KF6A 1EYGA 1HNZQ 2OWOA 3PUWA 3PUYA 4LF9Q 3I4NH 4LUZA 3STBC 2XGTA 1TWHH 2YU9H 4DV1L 1SLJA 2D0OA 2Q2IA 2VZAA 1I5FA 1B7YB 1IBML 3PF4A 1OXXK 4PZ6A 1L1OB 1EWIA 1YHAA 3BJUA 1L2FA 3TS0A 4PZ7A 4A3FH 5K36G 1MIUA 3PIPA 4NXML 4IO9A 1JJGA 1VCIA 5C4JH 4LFBL 2ES2A 3AQQA 1KXLA 1LYLA 4B3SL 4HIDA 1T9HA 1HNZL 4JOIC 2KENA 1VQ8A 3KJPA 2R93G 2V1CC 1YJNA 2YTXA 4JI6Q 4OWWB 1LM0A 1TXYA 1VQCA 4IJLA 4IPHA 4QL5A 4NXNL 3D31A 2PQAB 3I7FA 4XIGS 5GAEC 2JA6G 4LUOA 1BBWA 1AE3A 5ELOA 1PH6A 1L1OA 2PNHA 5C44H 4A3CG 4B3TQ 3PUZA 3G71A 2H5XA 2IT1A 3EBEA 2JA7G 2NZOA 4JI5Q 3HKZE 2OQ0A 3K7UC 4IJHA 1TWCH 4JBWA 1AE2A 4DK6C 2HHHL 3F2BA 1O7IA 1HNWQ 4QGUA 1VQ7A 3S24A 1C7YA 2Z6KC 1N34L 2VNUD 4JG2A 1S40A 1HR0W 4ALPA 1N8RC 2F4VQ 3KJOA 4QIWE 2GVAA 1P8LA 2PQAA 2IX1A 3M4OH 5M5XH 3AFQA 3KDFB 4YWLA 1V1QA 4L5QA 4GLXA 3RZOH 3UDGA 2R7FA 1HNWL 3I2ZA 4DR6Q 2PI2E 1YJWA 2UUBQ 1H95A 4P75A 2UXDQ 4GKKQ 1FGUA 2QGQA 1I3QH 1V9PA 3NEMA 5C3EG 4LFAQ 2E2IH 1A0IA 4DK3C 3CCRA 4DV7Q 1KL9A 2K14A 1G6PA 2I5LX 4DV6Q 2ZJPA 2A19A 3ICEA 2R93H 1XPOA 3RN5A 3HFZB 1PH5A 1MKHA 2AWOA 3K7AH 4YHHL 1I50H 1P16A 4JI4L 3EIVA 1EUJA 4DR6L 3W1GA 4BA1I 2E8GA 4OX9Q 4RG1A 2UXDL 2HT1A 2JA6H 2L15A 1MJCA 2I5MX 5IYDG 3PV0A 4GN5A 3K81C 1N33L 4DV7L 4A3CH 3JAMi 2OQKA 3EN2A 4DV6L 2JA7H 1VQAA 5FJ8G 2QA4A 1Q8KA 4DV5Q 1Y1WG 5LMNQ 3OYYA 1VQPA 4QJFA 4UP8A 3OW2A 1PHJA 3W1BA 3CF5A 4DAYB 1QZGA 5GAHC 4JBJA 4DUYQ 2JK8A 4DUZQ 1E3PA 4P71A 4DKAC 5FLXc 4DV2L 1JJ2A 2EIFA 3S15H 1Z47A 5JJIA 4JOIA 4IPDA 3HOZG 2NN6G 3S16H 1WCMG 4GOPC 1A63A 4P73A 3HKZG 1PFSA 3J7ZC 2VQFL 4IOAA 3PGZA 1WFQA 3E9HA 4UP7A 1A62A 2VQEL 4DR2Q 4OO1I 1X3EA 1VQOA 5C0XG 1XNRQ 3ULPA 4DR5L 1Q1EA 3TS2A 1U0LA 4DR3Q 2BA1A 3I4OA 2YTYA 4UY8C 3JC66 1KHIA 1X56A 5C3EH 5FLMG 1Q1BA 1SN8A 3M3YH 1FL0A 4LNQA 1JMCA 2KHIA 5GAGC 3UDFA 1R9TH 2ZM6Q 1XNQQ 1E1TA 1XMQQ 4DPGA 2RF4A 4C2MH 1LUZA 2Z6KA 2NZHA 4A76A 3CMEA 1XNRL 3GTLH 3G4SA 3PIOA 3AFPA 3JAMc 5IE8A 1EFWA 3ULLA 4JI3L 1VQJA 5LMUQ 4LUVA 4A3JG 1I94Q 4IFDG 2MNAA 1EQQA 1WJJA 5IYDH 3LGJA 4AYBE 5BR8Q 4DV1Q 5E7NA 1IBMQ 2RHQB 4BBRH 3WWVA 5LMNW 2AKWB 2VW9A 4IOCA 5FJ8H 1UWVA 1VQBA 4JI1L 1BVSA 1Y1WH 5EAYA 4BY1G 3F2CA 3CCUA 3CMAA 2R7DA 3F1ZA 3CCVA 2LXJA 4BBSG 2ALYB 2E2HH 3J81i 1PH1A 1I94L 4X65Q 1NJIC 1X65A 1VQ9A 1VQLA 4R4OA 4B3ML 1GKHA 1YZ6A 1G291 5BR8L 3CCMA 1VS0A 2KCMA 3RZDH 1K9MC 1E7ZA 4JI0L 3HOZH 2BH8A 3FKIH 4GN4B 2OTJA 1ASZA 5JEAJ 4NXNQ 1CKNB 4A3BG 5JJKA 2JA5G 4GOPB 3J81j 5IP9H 1E24A 4X65L 2Z0SA 1GVPA 1QVCA 2HHHQ 2PI2A 4TVAB 3AYHB 4DV3L 1PH8A 1J5EL 1EQRA 1X3GA 5GADC 2WP8J 1U5KA 1YHBA 2YV5A 3STBD 4A3MG 2K5NA 1CUKA 1HNXL 3J7A5 3M85A 3FHWA 4IPGA 4LF6L 1OXVA 1GD7A 4O2DA 1D7QA 5IP7G 3T1HL 2VUMG 3HOYG 4A3DH 2C35B 4A3JH 1M90C 4LF7Q 1SROA 2MO1A 2JEBI 3NENA 4GOPA 1OTCA 1RL2A 4K0KQ 1N32L 4A3GG 4DNIA 2EXDA 2DUDA 2XTIA 1IL2A 3H0GH 1PH7A 2HQLA 3J81c 2OCEA 2UUCQ 3HOWG 5HGQA 4BY1H 3F8TA 4JC0A 4LF8L 3G6EA 5GQOA 4XTCS 4X64L 4L5TA 1B8AA 3GD7A 4R4QA 2AMCB 4YWKA 4LF7L 4AYBG 1VQDA 1IBLL 4K0KL 5M5WH 4YHHQ 3CC7A 1L0WA 2NVXH 4JI4Q 3KYHC 3TREA 5IWAQ 2UUCL 3AEVA 4WJ3M 1PYSB 1KRTA 3KF8B 3RLNA 1SMXA 4MZ9A 4X62L 1KAWA 1VQIA 2K5HA 1JJCB 3CC4A 1N33Q 2JA8G 1QVFA 2K4KA 3S14H 4A3BH 1C0AA 3S17H 3CCSA 2Q2HA 3L7ZC 3U4VA 2B63G 2RHSB 4A93G 3CW2C 1SE8A 1WOCA 4R1JA 4JI7L 3PO3G 2K50A 3PO2G 4L5RC 4P72A 2CKZB 2N78A 2WAQE 1CSQA 1YVCA 3KDFA 5IWAL 4GNXC 1JB7A 4P74A 4KI0A 3GTOH 4DV2Q 2ID0A 3CQZH 1EIYB 1YI2A 5IP7H 4R4TA 4DR1L 1N9WA 1GM5A 1HJPA 3RLFA 4APVA 3L2PA 3F2DA 4LFCQ 2VUMH 1IYJB 2CWAA 3M4PA 2VQFQ 1X9NA 1KIXA 3W5OA 3CCEA 3GTKH 2VQEQ 1G51A 4A3GH 4HIMA 4DR4L 2D0PA 4QQBX 1S3OA 2N49A 3CPWA 1AH9A 2KCTA 3MEFA 3HKSA 3CCQA 4DR5Q 4LW1A 5GROA 3CC2A 3CCLA 4IPCA 3HOVG 3SGIA 2Y0SG 1XJVA 3HOWH 3NBHB 5IYBG 2IHEA 3L0OA 3GTJH 4YWMA 1Q86C 3T1YL 1YHQA 4LFCL 4A3IG 2IX0A 2CWPA 1EIFA 2K75A 3OTOQ 1YNXA 2I0QA 3KOJA 4BA2I 5IY0A 3GTGH 2GVBA 1Q12A 1UE6A 4YCVA 2OTLA 3K80C 2ATWA 4BY7G 4DR7L 1K3RA 3A5UA 4JI3Q 4OO1G 4GS3A 5C44G 4JBKA 3H15A 4HJ7A 3CXCA 1QUQB 1D8LA 4JI2Q 2JA8H 1PA6A 4GKJL 2NN6I 4AIMA 2GN5A 3OTOL 1W3SA 2F3IA 2B63H 3UE0A 4A93H 2LSSA 1Y1VG 4A3KG 4JI1Q 2HIVA 3PO2H 3PO3H 4JV5Q 4C3HH 2K5VA 1PH4A 1KC8C 1GO3E 5C4XG 5C0XI 4A3FG 2CFMA 4QY7A 1PH9A 1V43A 4B3MQ 4JI2L 3VDYA 1VQ4A 1QVGA 1PH2A 4TQUS 4JI0Q 2RCNA 2ZTEA 4GNXB 1WYDA 1K0RA 1W2BA 3U50C 1CKMA 1QUQA 5H1SE 4L5SA 3RNUA 4JV5L 2CCZA 4JI8L 2WAQG 1QZHA 5JEAG 3H3VH 2N8NA 3MXNB 4LF5L 3I4MG 2VL6A 3UDIA 4O0AA 5M5YH 3HOVH 4A3LG 3IRBA 3KF6B 1KQSA 4IFDI 2EQSA 1Q46A 4HJAA 2ZJRA
chains in the Genus database with same CATH superfamily
5D14A 1X3QA 1WCMH 1MJEA 1J5EQ 2M9VA 1OO9B 4RMFA 3J80i 1HNXQ 1RD9D 5CV8A 3J7YW 3T1HQ 4B3RL 2E2DC 3CRLC 2EYJA 5ELCA 1D5XC 3KK7A 3K0XA 4BXXG 4EQNA 4N8X1 1E2ZA 1XPRA 2UXCL 4H13C 4RCOA 5J22A 3Q0AA 2E5LL 3H09A 1UE5A 2UU9L 1KD1C 5I2XA 1BXTA 1OXTA 1SR3A 1HCZA 2R7ZG 1CHQD 1WTOA 3SHLA 1HR0L 1IBLQ 1SNOA 4KMUC 4AQYL 1HZBA 4RAUC 4MNOA 4YY3Q 4HR7B 3S2DH 1VMPA 5DNFA 4X62Q 1BCPC 3D6WA 1A2UA 4CJ2C 4L8JA 4TKOB 3HOUG 1I3QB 1YITA 2L1BA 3KLWA 1K0SA 4DV4L 3A56A 2CW0C 2MQHA 2PW5A 4GLAC 4JI6L 4PV1C 4WJWA 3QO2A 1STYA 5ELDA 2NBFA 4DR1Q 3D0FA 1I50B 1FGBD 2KEDA 4C1NI 2JA6B 2WKCA 2JJQA 3DWQA 2ZTDA 2ICIA 3HOXB 1PTOD 4KLKA 4OXPA 3IFDA 1YEZA 3J7AF 2UXBQ 1HH2P 1LTRD 5EKLA 3T1YQ 3HOYH 3MXGA 1EOVA 3U4ZA 4FDBA 2R92B 1LTID 5D3IB 3BU2A 1CQVA 4CBVA 4B08A 1CA5A 4K8IA 1NMFA 2F0KA 5DM63 1PFBA 2F0JA 1DYQA 3M4QA 2SEBD 3HG9A 1CHPD 2F52A 3SEBA 4RHSA 3A7LA 3HOXH 5AJ3L 1BCPB 2D2CC 2FXQA 3S2HB 5C3EB 4P2CB 2BH2A 4LMQD 4JYAQ 1E22A 5IYCG 4FNFA 3OOCA 4HJ9A 1K3BC 1L1OC 3Q8DA 1K73C 2R92H 2MO0A 5KYLA 5M3FB 2IY5B 3HZXA 1B70B 3FKIG 4A4IA 1F2LA 4LF5Q 4DV5L 1RDPD 1A3VA 4DV0Q 3S1RB 5EPLA 5HY6A 5CV5A 1TWAB 3MWYW 1EL0A 1E2VA 3S2HH 2O4XA 1BCPF 4KN7C 2UUAL 3RZDB 1BOSA 2PPBC 4LF4Q 4C3JH 4DR2L 4JBMA 5IYBH 3D8GA 4HCEA 2LXKA 1PRTD 1GHKA 5M3FH 4X66Q 4DR3L 4A3DG 2RKSA 4A3IH 1A8VA 3H94A 1NSNS 4KHZA 1H9KA 4Q0FA 4GNXA 1K8AC 2HQEA 3OW7A 4QIWB 1LACA 1Q8IA 3S1RH 3H0GG 1XMQL 3PIP3 1TWAH 4KHPQ 3SK6A 3UI2A 4IFDJ 2QW7A 1EYGA 3KF6A 1HNZQ 1JE4A 1LT3D 2E74C 1D5ZC 3TDQA 3TP7A 2F0SA 2ZT9C 1B7YB 3K5NA 3K5MA 1B2TA 1L1OB 1F2MA 3BJUA 5KRUA 1EFID 2X69A 4KV6A 2A68C 4HCSA 1KXLA 2XNAC 4CDFC 4JOIC 5J1ZA 1VQ8A 1KLUD 1DOLA 1Y8OB 1YJNA 1LM0A 1VQCA 1LTSD 2G5DA 3NWSA 4QUFA 4NXNL 3I7FA 2K33A 4LUOA 2L0CA 4FXDA 3D4WA 5FO8B 1TKWB 2IT1A 3K57A 1AP0A 3HKZE 1XXGA 1D1KA 1EZ6A 3A7AB 1U9RA 3BZDB 1VQ7A 3S24A 2VNUD 2CHBD 1N34L 1TR5A 1HR0W 4ALPA 5CR3A 3JAME 2F4VQ 2MP1A 1I4RA 4QIWE 3M4OH 3GTOB 1F9SA 3AFQA 3KDFB 4L5QA 3RZOH 2B2WC 2EE1A 2XSCA 5IGEA 2EYOA 1YJWA 2UUBQ 1H95A 2FJ2A 4GKKQ 1FGUA 3NEMA 1Q90A 1GXDC 4CDDC 2E2IH 2PW7A 4DV7Q 1KL9A 2R3ZA 1G6PA 4IUVA 4IUUA 4DV6Q 2A19A 3ICEA 4RKBA 5KNDA 1NUCA 3RN5A 2AWOA 1LO5D 4YHHL 1EY9A 4EGVA 1P16A 3CRKC 3EIVA 4JI4L 1WTVA 3W1GA 1LT4D 1D2BA 2L15A 1SBBB 4GN5A 5IGDA 3K81C 4M1UB 3SXHA 3MVVA 2E75C 2QEJC 1WTRA 2QA4A 5C3XA 5LMNQ 1PHJA 3AB9A 1I4GA 3CF5A 5LL6X 3PO2B 5FOBB 4DUYQ 1B44D 1E3PA 3C1FA 5FLXc 1PZID 1JJ2A 1TY0A 4IPDA 1O7ZA 3EQLC 2VQFL 4IOAA 5FO7B 1HTPA 4UP7A 5C0XG 4DAPA 1Q1EA 4ZAIA 4UY8C 2YTYA 3D6CA 3JC66 4K5WA 1X56A 1LTBD 5FLMG 3QOJA 3M3YH 1FL0A 2D9UA 1JMCA 1H9SB 2D5DA 2L11A 2ZM6Q 1XNQQ 2Q8TA 1EQVA 1LUZA 2GA4B 2NZHA 1B50A 1VQJA 5A35A 2Z6BA 4A3JG 4BY7B 5BR8Q 2O2LD 1IBMQ 1ESRA 4KJNA 1A2TA 4JI1L 4I7AA 5KGUA 4TSSA 2ALYB 1YZ6A 1K9MC 4RKLA 1VS0A 2KCMA 1E7ZA 2NN6H 2BH8A 4MN3A 3FKIH 2NTSA 4C56C 1HUNA 4KY7A 1KDAA 1CKNB 2F0MA 2JA5G 2RDGA 1SNMA 4HMJA 4BBSB 4QCLA 5G3LF 2Z0SA 1GVPA 3GV6A 3C2PA 1PZJD 5M5WB 1X3GA 5GADC 4A3MG 3J7A5 2K5NA 1CUKA 3CHBD 3SK8A 3FHWA 5M9OA 4O2DA 2B2VA 5IP7G 4A3DH 1J9OA 1NNXA 4GOPA 1RL2A 4K0KQ 4WRDA 4K14A 4DNIA 2NVYB 3H0GH 5FKAC 3J81c 5HGQA 4JC0A 4LF8L 3CQZB 4YWKA 2XRQD 4AYBG 5M5WH 4ZKCB 1L0WA 4WJ3M 5IWAQ 4A3GB 1PYSB 1KRTA 3KF8B 1SMXA 1KAWA 3ITPA 1BBXC 2JA8G 1C0AA 1N33Q 3HOWB 1M4VA 4U673 1EIHA 4H44C 4A93G 2DJFC 2HDLA 2KOLA 4DF7A 1CSQA 3EVQA 1YVCA 2L5TA 2XRSD 3NPPA 3CQZH 3Q6SA 1SXTA 1EIYB 3RLFA 4APVA 3M4PA 1K8OA 2KJXA 4A3GH 2D0PA 3MFGA 1S3OA 2KCTA 4DU9A 5KNCA 3HOWH 1F9RA 2IHEA 3JAML 4YWMA 5D65A 1Q86C 1EY4A 1F9PA 1SE3A 2F0UA 3RUZA 3TMEA 1LTGD 1CI3M 3QB3A 4CDEC 1FNUA 5IY0A 2N55A 4YCVA 3K80C 5I6YA 4OO1G 4JBKA 1ZYRD 3H15A 4HJ7A 3CXCA 4JI2Q 1PA6A 1Z7TA 2GN5A 2JXMB 1VDZA 2K03A 3A8KE 1AFPA 2K5VA 4XYQA 1PRTC 5C0XI 1STHA 2CFMA 3R3OA 4BS9A 1CQFA 2L9HA 4B3MQ 5L37A 4TQUS 4RFBA 1WYDA 2IJ0A 2LMCB 3OMCA 1CKMA 3MFYA 1AZQA 4JI8L 2A5HA 1L0YB 4A3KB 4IALA 4O0AA 2A6HC 5JVH3 1KQSA 4A3FB 1Q46A 2ZJRA 1EWHA 4XYOA 5IGGA 4BWGB 5IGFA 5C4JB 2ZTCA 4DV3Q 3TP8A 5EJWA 1VQ6A 2UXCQ 1CKOA 1S4ZA 4ZQ3A 4A75A 1N36L 3DM3A 3BVGA 1HA5A 3I4MB 5FLMH 2EYMA 2F0QA 4E6IA 2NYZD 1TT2A 3P75A 5C44B 1H9RA 4AQYQ 1DONA 1VF5C 4A3KH 2TSSA 1SYFA 4C3IB 1IZ6A 3WDNA 3BVMA 4X64Q 3UE1A 1HZ9A 3M9BA 1KDBA 1UAPA 5CYUA 2K52A 4Y7NH 1NE3A 1PRTB 4GLVB 4X3UA 2HCIA 4DV4Q 4LF9L 1XMOL 5J39A 5M5XB 1IBKL 4I7ZC 2WB1B 4ME5A 5KIXA 2EJMA 4UPAA 3I4MH 5ELNA 4PNYA 4A3LH 2JA9A 1STBA 3HOXG 2A6ED 4DAMA 3IAYA 5I9PA 1PLFA 2ZXOA 1G2TA 1IXRA 4C3IH 2BDNA 2K5WA 1YNND 1BBUA 5I6WA 2JA5H 4RWSC 3S1MB 2RDFA 3TEHB 2R92G 1STEA 3MZ5A 1GUNA 1QOHA 1M1KC 4JI5L 4DR4Q 3MEHA 3ER0A 4A3MH 2PQEA 4L63B 1XPUA 4K2LA 2IHFA 2KBNA 3TP6A 5M3MB 2EY5A 2MHVA 2WFWA 3CD6A 3NXWA 4HIOA 3I90A 3DHQA 4PZ8A 4C1NK 5AJ3Q 1RJTA 1UEBA 1PZKD 4K5VA 2F0GA 5KEEA 2Q8RE 3S1MH 5KNBA 1EYCA 4F87A 1RIPA 5M3FG 4GKJQ 1STGA 5FK9C 3TP5A 2WB1E 4LFAL 3MXUA 1MHWC 3Q24A 1B1ZA 2DGYA 4HJ5A 1HZAA 3H3VI 4KKTA 3E9IA 3ZJYC 1SYBA 5M3MH 2O5IC 2EY6A 5EPKA 3TQYA 1JT8A 1EY0A 3I56A 3K5LA 2HCCA 2RSOA 3OWEB 1VQKA 2AUJD 4A3EB 2AHOB 2UUAQ 5CORA 3DLLA 4X6AH 4MTNA 2L55A 5C5MA 4YCWA 5JVG3 1RHPA 1O7YA 1Y1WB 3E0EA 3ULJA 1SRUA 2DN8A 4DUZL 3CPFA 1VF7A 4ILWA 1J6QA 2QDLA 4DN4M 2E2HB 1X3FA 1E0BA 4ZK9B 3I4NB 4G7HC 2YYZA 1I4PA 3LWUA 3DWAA 1Q81C 4I65A 4GZYC 1GUWA 3QIAA 1FVIA 1XTCD 3R2TA 1S5CD 2BA0A 3RD4A 2N88A 4A3EH 2AUKA 3LX0A 2K04A 4UDUC 2Z8LA 1WTXA 1S72A 2NVQH 2Q2UA 2CH4A 2VY3A 5JJZA 2B29A 4OO1H 1VQGA 3NELA 4NDXA 4KKSA 1PVOA 4JCVE 2VS1A 2DY7A 2MPMA 3I4NH 1ZKOA 2YU9H 1TWHH 2B8FA 4DV1L 2D0OA 1I5FA 3PF4A 1EWIA 5C4ZA 4NXML 2CVRA 4KKUA 1BF4A 4RGNA 5DAUA 5FLXE 4B3SL 4BY1B 3DM1A 1T9HA 2F0NA 2KENA 3URYA 4ZKBB 4H0LC 1G2SA 3VA7A 2YTXA 1A3TA 3X3MA 4QL5A 1C8CA 1BBWA 1L1OA 2PNHA 4B3TQ 2F0VA 3G71A 2H5XA 4DNRB 2NZOA 3S14B 1U4MA 2FHTA 4DNTB 3MAQA 2HHHL 3R93A 1O7IA 3DUZA 4QGUA 2F0PA 1TS4A 1C7YA 2JN4A 1S40A 2F3WA 1JB3A 1L0XB 1P8LA 2IX1A 4FF4A 2IWHA 1V1QA 4GLXA 2JA7B 3NQTA 1LTAD 3UDGA 4HN7A 1HNWL 1ONLA 4P75A 5K36H 1I3QH 2P5ZX 5E3FA 3CCRA 3OSOA 1HHVA 2I5LX 2ZJPA 2B2YA 1G6ZA 1DXMA 1PYWD 5BN4A 1PH5A 3HFZB 1I50H 4DR6L 1EUJA 4OX9Q 2UXDL 4RG1A 2JA6H 1X32A 1MJCA 4HSPA 2I5MX 4ZUJA 3JAMi 3FRPB 2JA7H 1JC7A 1Q8KA 1R9TB 1ILPA 3OYYA 3OW2A 4FXGC 1JCKB 1ZYRC 5ELFA 3I3CA 1A15A 4JBJA 3GTLB 4P71A 4DKAC 1W6JA 2K7VA 4JOIA 1FD7D 4RCNA 2K32A 2NN6G 2AQ1B 3J7ZC 1CM9A 1WFQA 1SYCA 3E9HA 4KJOA 3VR4A 4DXFA 2VQEL 3E3XA 4O42A 2K6AA 3J81E 4DR5L 3PIO3 3ND9A 4QB4A 2F0LA 1KHIA 2SNSA 5C3EH 2E76C 2VB2X 4KN4C 1SN8A 1B9MA 3UDFA 1R9TH 4J6HA 3SE0A 4DPGA 3FVQA 2RF4A 3HKZB 3TSSA 3GTLH 5LMUQ 4LUVA 1IKLA 2MNAA 1EQQA 1FYCA 4XQJA 1V1PB 1G91A 2RHQB 2AKWB 2B2WA 5FJ8H 3EJIA 2DY8A 4IZ8A 3K0YA 1BVSA 3W3AA 3F2CA 3CCUA 1H9SA 5IT9L 2SOBA 3CMAA 1T5XD 2LXJA 4BBSG 4CKBA 1CK1A 5HURA 1SEBD 1PH1A 1QNUA 1VQLA 4R4OA 3NHHA 1GKHA 2L4NA 3RZDH 1G291 3KBXA 4JI0L 2HD3A 4K2KA 1F77A 2PNRC 1ASZA 2M00A 2SDFA 5JEAJ 3BDCA 1D6EC 3GP7A 5I4DA 2OEOA 1WTWA 1HXYD 3J81j 4MTKA 3MTSA 4XXEA 4X65L 3DMUA 1R4QB 1QVCA 4V0BA 2PI2A 4TVAB 1J5EL 3C1EA 1EQRA 2WP8J 3STBD 2F0WA 3TN2A 1HNXL 1PDQA 3M85A 1GD7A 2A6EC 3T1HL 2EPBA 1I4HA 2B39A 1M90C 4IFDH 2MO1A 2JEBI 3NENA 4A3GG 2RCFA 2XTIA 1IL2A 2HQLA 3HOWG 5CBEE 3K6OA 5IOCA 3E0JA 1B8AA 3AU7A 1SMYD 1ENFA 4LF7L 2VUMB 2DNCA 1VQDA 2PCFB 3LNNA 1IBLL 3GTMB 5CMDA 1D1IA 3CC7A 3GTKB 1YNJD 3RLNA 2K5DA 4X62L 2K5HA 1JJCB 3GTJB 1AN8A 2EOTA 3L7ZC 5CV9A 1JQYD 1WOCA 3CW2C 2WKDA 2WAQE 4B9WA 4GNXC 1JB7A 5DM73 4P74A 4KI0A 3GTOH 4DV2Q 1TWGB 4DR1L 1W6KA 4XT3B 2Z1CA 1GM5A 3KF8A 2VUMH 3F2DA 1Y8PB 2A73B 1X9NA 1GUTA 4NP5A 3GTKH 1G51A 2B63B 1JWMD 4CKEA 3CPWA 1WTHA 3MEFA 3VYUA 3PO3B 4C3HB 3NBHB 3GTJH 3G6JB 3T1YL 2F0DA 4LFCL 2IX0A 1HFGA 4BA2I 1TVXA 2DNEA 4JW0A 2OTLA 1JICA 2ATWA 3RMHA 4ABNA 1E2WA 3A5UA 4JI3Q 4GS3A 5C3WA 3HRZC 3ERQA 3KBGA 3DEPA 1DOKA 2NN6I 3OTOL 2B63H 1CZGA 4A3KG 3PO2H 3PO3H 5EGTA 2XN9C 4C3HH 1SYGA 3A8IE 1KC8C 1PH4A 4A3FG 4QY7A 1CFMA 1VQ4A 2F0TA 4GNXB 1EY7A 4Z9CB 4JV5L 4ZUIA 2N8NA 1WTQA 4LF5L 3I4MG 4A3LG 3IRBA 3KF6B 4JVZA 3VR6A 1HQRD 5C44G 4RGMA 1WD0A 5E1FA 4C3IG 2LFNA 4S3SA 2PMZB 3MHBA 2K28A 4LF6Q 3CCJA 3M7NA 4EQ5A 4BY7H 4POGA 5E4XA 1KRSA 4LWCA 5T1IA 3NWTA 4WFN3 1VQ5A 4HAEA 2PO4A 2CQAA 3NSWA 2XIWA 3N6RA 1TWFB 3NP8A 2FMCA 1NTGA 4MIUA 2WB1G 1IYVA 1XMOQ 4FXKC 3NTIA 1IBKQ 5IIFA 3S9WA 4HMIA 1MI2A 2JEAI 1KAAA 1TWCB 4KHPL 2KHJA 4CKCA 1V8QA 4FP5D 1EIGA 3FDTA 1EU4A 2L12A 1X54A 2Q2TA 3C46A 3BVZA 1OXSC 1JE5A 3RR5A 4BBSH 1LTTD 2X6LA 4ZYSA 3FMCA 1VQMA 1TWFH 5JPMC 4KD4A 3L3OC 3J80c 1PTOC 4JI7Q 4R4CA 3T13A 5M3MG 1XX8A 3K8AA 4XQQA 2EYHA 1J8IA 1Q82C 3I55A 3NBIA 4F8MA 1N32Q 2PZWA 3BZKA 2PMZE 3A0JA 3GDEA 4F7XA 1I6HB 5DEHA 1FJGL 1BCPD 1NMGA 3BDOA 1C48A 2NVYH 4J15A 1ENCA 1LT5D 2JE6I 1LV9A 1X55A 2BE5D 2CQOA 5J3BA 1O7LA 4Y52H 2CW0D 3A8JE 1XWEA 4PMWA 3SDZA 1U4LA 4HEDA 2A1AA 2F4VL 4IUTA 3S15B 1IYUA 3ERSX 2BDOA 4IUNA 4DR7Q 5DLQE 1PV4A 1I6HH 1HA6A 2UUBL 1YBYA 4FYDA 3BZCA 4YCUA 4GKKL 1DD2A 3S1QB 5IGBA 4A3EG 1VQEA 1SFOB 4M8AA 2AQ3B 2QDBA 1SE2A 1JOOA 4HJ8A 1PTOB 1WI5A 2D62A 3DXJC 4EQPA 3RLOA 3SVMA 2A8VA 3KFUA 3T56B 1KDCA 4EX5A 3I4NG 4POFA 2B2UA 5NUCA 3PSIA 4OWXB 3RN2A 1UE1A 2G9HD 2KCNA 4QUCA 5LMNL 4BBRB 1ET9A 3S1QH 1MSGA 2N3SA 4DUYL 3SK4A 1SFOH 1STNA 1K83B 2F4IA 2JQOA 3PUVA 4QMGA 3UDXA 3VR3A 2J7ZA 4OELB 1PTOH 3PF5A 4B3RQ 4EVOA 1A3UA 1RTNA 5C0XJ 2XVSA 4K5XA 1PTOF 4OONA 4ODGA 3P1HA 3QG1A 3G48A 2M2LA 1Y69U 2F03A 2B8GA 2R6GA 1GUSA 4RGTA 5CGKA 1SNDA 1K8GA 2HUGA 2E5LQ 1VQHA 4XQNA 2WINB 3P20A 4V190 2ZM6L 2YTVA 1XNQL 4GN3B 1BQQT 3CP0A 3I8ZA 2UU9Q 5C4HA 1BO0A 4NXMQ 2KA7A 3KUPA 3MXNA 1K83H 3KLSX 1HR0Q 2AWNA 3TZUA 1AW7A 4RH6A 5T1GA 4B3SQ 4FVMA 2KUMA 3BG3A 3PUYA 1GUGA 4O1NA 4LUZA 3STBC 2XGTA 1SLJA 2VZAA 1LT6D 1IBML 4PZ6A 1YHAA 5K36G 1L2FA 3TS0A 4A3FH 2RDHA 1C4QA 1MIUA 3PIPA 4CJ0B 1JJGA 5C4JH 1RTOA 4LFBL 3H91A 3AQQA 4HIDA 3C3LA 1GUOA 1DCZA 1KNEA 1SSOA 4JI6Q 5BN5A 2V4DA 4OWWB 1TXYA 4IPHA 4N8FA 1EYAA 2PQAB 2JA6G 5GAEC 1SMYC 2NVXB 5ELOA 1PH6A 5C44H 4DXGA 3PUZA 1BDOA 2JA7G 3K7UC 2OQ0A 1TS3A 4FF3A 1YNJC 2A68D 3F2BA 3WOEA 1HNWQ 2R93B 2F0FA 2Z6KC 5EBDA 4JG2A 1JOQA 1F2YA 3KJOA 5M5XH 1EY5A 1PRTF 2K01A 2R7FA 1GHJA 4DR6Q 1R4PB 1AZPA 1Q3LA 2UXDQ 1F9QA 1BNZA 2PYKA 1V9PA 5LL6S 5C3EG 3ZYYX 1A0IA 4DK3C 2K14A 5TSSA 2R93H 5CC4A 2ENBA 1AEXA 1WVLA 4BA1I 2E8GA 3GTGB 1SE4A 3PV0A 3QJYA 1N33L 4A3CH 3EN2A 1SJED 5FJ8G 2A69D 2IX3A 4DV5Q 1VQPA 4QJFA 4UP8A 1DZ1A 3HGBA 4ZRZA 4DAYB 2JK8A 5G3LD 1RF2D 1ZEQX 3TZDA 3HP3A 2EXZA 1Z47A 5JJIA 4P73A 3HKZG 5EBCA 2JYOA 2TMPA 3BS1A 4DR2Q 4OO1I 1X3EA 4OIKA 3ULPA 2Z4IA 1B53A 3TS2A 1U0LA 4DR3Q 1HFNA 1Q1BA 4LNQA 4DAVA 2KHIA 4KK7A 5GAGC 2C5CA 1EY8A 2KQ3A 1XMQQ 1I4XA 3HOZB 1WCMB 5FO9B 1XNRL 3G4SA 4XT1B 2ZXPA 4R8NA 3ULLA 1IL8A 1WTPA 4DFAA 4IFDG 1HPCA 3OWFA 1B3AA 1WJJA 3OPOA 3LGJA 5IYDH 4AYBE 3WWVA 5LMNW 1UWVA 1VQBA 3PQIA 2ZXRA 5EAYA 1Y1WH 1ESFA 3GV3A 3CCVA 4DK0A 3MC0B 1TQOA 2WACA 2DJGC 2E2HH 3J81i 1I94L 4X65Q 1X65A 4UHVA 4B3ML 3CCMA 1NAPA 3HOZH 1LLRD 1DOMA 1EEFD 5E4WC 4J1MA 4GN4B 2OTJA 2XWBB 4NXNQ 2IPKD 2F0OA 1V1PA 5I9OA 2AQ2B 3U9SA 1VMCA 2EZVA 3S2DB 1E24A 3EFXD 1S5FD 5EQ0A 3VYRA 2X6GA 1UNSA 3KLRA 2QILA 4OGQC 2A74C 2RSNA 4DV3L 2XWJB 1N34Q 4UAIA 1YHBA 1TY2A 5JOBA 1FNWA 2LKVA 4IPGA 1OXVA 1Y8NB 3DEOA 2VUMG 2B2TC 3NUCA 4A3BB 4LF7Q 1SROA 1S5BD 3S17B 1U4RA 4DK1A 1JWSD 3VYTA 1M8AA 4FO2A 2EXDA 1PH7A 2OCEA 4BY1H 3F8TA 3G6EA 5GQOA 3M7GA 4XTCS 4X64L 4L5TA 1XYIA 3GD7A 3QWNA 3HOYB 2BE5C 4YHHQ 3OMGA 4JI4Q 4Q5VA 2UUCL 1JOKA 3VA5A 4MZ9A 1NR2A 1VQIA 1TS2A 3S14H 4A3BH 1QNKA 2RBMA 3S17H 3CCSA 3OIQA 2Q2HA 2B63G 3U4VA 2RHSB 1SE8A 1V1OA 2Z9HA 4R1JA 3PO2G 3PO3G 4C3HG 4P72A 2CKZB 3KDFA 2K1BA 2QF7A 1UUPA 2ID0A 5COYA 2NZ1D 2F0IA 3L2PA 4LFCQ 2VQFQ 3NK9A 4PQXA 5KYIA 5EKKA 4DR4L 3CCQA 4LW1A 4IPCA 1NR4A 3M4YA 1EY6A 3Q23A 4HSVA 2CWPA 1EIFA 2K75A 3OTOQ 1S5ED 1YNXA 2LS01 3KOJA 2I0QA 4OIJA 1Q12A 3V2TA 1UE6A 3P7JA 4BY7G 1TS5A 1CT1D 1HUMA 1ML0D 2KVMA 1RODA 1QJOA 4C3JB 3EA6A 1QUQB 1D8LA 3HOVB 2Y0SB 1SNCA 4FF2A 4GKJL 4AIMA 5EKIA 3NBHA 2VXWA 3N52A 3J80E 1W3SA 1KTKA 3UE0A 2LSSA 1RCVD 1ICWA 2HIVA 2WIIB 4JI1Q 4A3IB 4JV5Q 1GO3E 3D3RA 3I70A 1EQTA 1V43A 3OIPA 1PH2A 1QVGA 2RCNA 1B9NA 3I72A 3K5OA 1CTMA 3RNUA 3AMUA 1ET6A 1QZHA 1O80A 1Y1VB 3J7AV 3HOVH 1I6VC 4G7ZC 5C4XB 3BYYB 4IUQA 4IFDI 2EQSA 4OL7A 1EZ8A 2NUCA 2PZUA 3FP9A 3BYTB 4OHJA 4AH6A 2B2YC 2F3VA 1XTDA 3TRZA 1DGSA 2WAQB 4WJ4A 1X3PA 2EY2A 3NTKA 1UE7A 3GTQB 2A6HD 3D4RA 4JPBW 2H4OA 5CV7A 4PG3A 1Y1VH 2Y0SE 4TRDA 2ZJQA 4LF8Q 5C4XH 3A5ZB 4KTAA 1CKNA 2QEXA 1NY4A 2FFKB 1H9MA 3NE5B 1YNNC 4LAAA 3I73A 3M4OB 1X6OA 1K28A 3V05A 3F2UA 5JEAH 2HIXA 5IT9c 1PXUA 2F0HA 3RZOB 4N9TA 3GTQH 2JSOA 4PMCA 1FJGQ 4IUPA 1Y14B 1HZCA 2MFIA 3PUXA 1ILQA 1I4QA 2LY7A 3QR8A 2R7ZB 2E2IB 1JR0D 3B6YA 4YY3L 2I5HA 3CAMA 5ELBA 3QOLA 4RA8A 3PCOB 1G8ZD 5FLXL 1ENAA 1DJRD 1Q7YC 2EY1A 3D4DA 4B3TL 3S1NB 1NBWA 4BXXH 1OXUA 1Z9FA 3HOUB 1PH3A 2KCCA 4HTHA 2KECA 1E1OA 1VQNA 3GTMH 1QB5D 2A69C 2R7ZH 1STAA 4ULLA 4G7OC 1BKBA 4HIKA 2NVTB 3Q22A 4IQZA 2FMMA 1YJ9A 2E2JB 2UXBL 4OWTB 2BCOA 1VQFA 3S1NH 2EDGA 2Z4HA 2I07B 3HOUH 4BBRG 3M3YB 4H02A 3GTPB 1TWGH 5JJLA 4YIJA 4OX9L 4NPSA 3SR1A 1NCVA 1JORA 4R4IA 1LTLA 1EEID 3IL8A 4J8QA 2NVTH 4UP9A 1ASYA 4JI8Q 3NQIA 4ME3A 4EQOA 2E2JH 1CSPA 1MD2D 5IGCA 3PMFA 3I91A 4JYAL 3IFTA 3K58A 2K5QA 5C6AA 5IP9G 1C9OA 3GO5A 4NB3A 3GTPH 3VR5A 2RVLA 1IW7D 1SYEA 1N36Q 4CJ1B 3FEWX 3FKIB 4OEMB 3U9OA 4DV0L 1SJHD 4H7BA 1PYBA 1A6XA 3U58A 2ASBA 3K59A 3A74A 4KY5A 5A2QE 4LF4L 3J81L 4CGYB 1YIJA 4PMBA 4LFBQ 1SAPA 5IYCH 4X66L 2KEEA 5LMUL 3I4LA 2B3GA 3J80L 2OWOA 3PUWA 4LF9Q 3LWEA 4A3DB 2Q2IA 2EYFA 1MSHA 1OXXK 2EJFC 4R9WA 4PZ7A 5C5LA 4IN3A 4IO9A 1VCIA 2ES2A 3H0GB 1RKNA 1LYLA 1UEAB 1HNZL 3KJPA 2R93G 3G7LA 2V1CC 1WD1A 3R2IA 1D5MC 1GOZA 4IJLA 4NMZA 3D31A 4XIGS 1F2ZA 1AE3A 4XDXA 4A3CG 3HEJA 3EBEA 5F2DA 4JI5Q 4DK6C 4IJHA 1TWCH 4JBWA 1AE2A 2EYPA 2MUYA 3A55A 3K7AB 1N8RC 2GVAA 2IW3A 2PQAA 1SYDA 3O13A 4YWLA 3I2ZA 2PI2E 4IURA 4ZLTF 3T53B 2QGQA 5AFWA 3TBIB 3VR2A 4LFAQ 1SNPA 1B3QA 1PMRA 1BUVT 5K5PA 1CA6A 4U68A 3S16B 1XPOA 1MKHA 3K7AH 4F88A 1MGSA 3E5SA 2Q8IB 2OXPA 2QKIC 1JWUD 2HT1A 5IYDG 4N9PA 3L9AX 1LABA 1U4PA 5LHY1 4DV7L 1S5DD 2OQKA 2J0TD 4DV6L 4X3KA 1VQAA 3ONAB 1Y1WG 5CBAE 3W1BA 2J4XA 4R8IA 1QZGA 4C2MB 5GAHC 4DUZQ 2B2VC 3X3NA 4DV2L 2EIFA 4X3SA 3S15H 1QE6A 1EU3A 2RQXA 1EOTA 4K8JA 1KLGD 1WCMG 3HOZG 4GOPC 3S16H 1A63A 1PFSA 4ID6A 3OHXC 3PGZA 1A62A 1VQOA 1XNRQ 3MA2B 5ISRA 2BA1A 3I4OA 1O78A 4DAYA 3EROA 5I2YA 1IHZA 4FF1A 1E1TA 1KNAA 4C2MH 1DM0B 2EJGC 2Z6KA 4A76A 5JPNC 3CMEA 3PIOA 3AFPA 3JAMc 5IE8A 1EFWA 3IKJA 1ICFB 4JI3L 3FPUB 4KY6A 1I94Q 1HQMC 2G9DA 2EYLA 4DV1Q 5E7NA 5BN3A 4BBRH 4IOCA 2VW9A 2I46A 1H9JA 3HS0C 4BY1G 1HTLD 1PFNA 2R7DA 3F1ZA 2RA4A 1IKMA 4G57A 4NW2A 4KHVA 2R61A 1NJIC 1VQ9A 1EWCA 3GQBA 5BR8L 4LJZC 4A3JB 2SNMA 1CZWA 4JK1C 3R8BA 4K6LA 5JAVA 4Y7NB 2C9OA 4K6DA 3T16A 5IODA 4A3BG 5JJKA 5C0XH 4GOPB 5IP9H 3MXPA 3WOFA 2HHHQ 4G4KA 3AYHB 1PH8A 3KLSA 4RGOS 1U5KA 2YV5A 3DWPA 4LF6L 3E6ZX 1D7QA 2IL8A 2FINB 3BDLA 3HOYG 2PZTA 5ELEA 1EYDA 2C35B 2JP1A 4B9XA 4A3JH 2JA5B 3NTHA 3CU7A 1OTCA 1HRJA 2KHSA 2B2UC 2BOSA 5A2QL 4WORA 1BR9A 1II3A 2DUDA 2UUCQ 3FPPA 2ICEC 4QF4A 4A3MB 1FNVA 1SDFA 4R4QA 2AMCB 3H3VC 4DGZA 1QILA 2MGSA 4K0KL 4X3TA 3A54A 3H6MA 2NVXH 3KYHC 2NWGA 3TREA 3AEVA 2MJ8A 2QCPX 3CC4A 1QVFA 1K8MA 2K4KA 2O5JC 4ZCKA 3V96A 3W2DA 4JI7L 2K50A 4L5RC 2N78A 4AYBB 5IWAL 5EPJA 1KABA 4RHRA 1N32L 1YI2A 5IP7H 4R4TA 1N9WA 4LK1C 1HJPA 1IYJB 2CWAA 1KIXA 2JA8B 1TIID 3W5OA 3CCEA 2H1EA 2EVBA 3T51B 2VQEQ 1MBYA 4HIMA 4A93B 4QQBX 1AH9A 2N49A 2OT2A 4CHTB 3CC2A 3HKSA 4NKLA 4C3JG 4DR5Q 5GROA 3HOVG 3CCLA 2F1MA 3SGIA 2Y0SG 1XJVA 5IYBG 4L6TB 3L0OA 2VB3X 3VYSA 2F0EA 1YHQA 2HDMA 4A3IG 3SK5A 1SNQA 2OF1A 2NB0A 5HGTA 4DA2A 3GTGH 2GVBA 1PFMA 2CH4W 4DR7L 1K3RA 1ZXTA 5IT9E 4MHEA 2B2TA 5M5YB 2JA8H 1T5EA 1Z6HA 1IW7C 2F3IA 5D3DA 3T4AC 4A93H 1Y1VG 1B4OA 4CDCC 1TU2B 2K05A 2WV6D 5C4XG 2NVQB 1PH9A 1QG7A 4JI2L 3VDYA 4JI0Q 2ZTEA 1K0RA 4KD3A 1W2BA 3U50C 1QUQA 5H1SE 4L5SA 3ND8A 5CV6A 2CCZA 2WAQG 1FR3A 5JEAG 5CV4A 1QWYA 2NTTA 3CKIB 3H3VH 3MXNB 2YU9B 1TWHB 2VL6A 3UDIA 1QCBD 5M5YH 1GJXA 4HJAA
chains in the Genus database with same CATH topology
1WCMH 3FP9A 1MJEA 4DV3Q 1J5EQ 2ZTCA 4RMFA 3J80i 1VQ6A 1HNXQ 2UXCQ 4AH6A 1CKOA 4LF6Q 1XTDA 4A75A 3TRZA 3CCJA 1DGSA 3T1HQ 3M7NA 4EQ5A 4BY7H 1N36L 4POGA 1KRSA 3DM3A 4LWCA 1VQ5A 4B3RL 4WJ4A 1UE7A 5FLMH 3K0XA 1NTGA 4BXXG 2WB1G 4AQYQ 1XMOQ 4PG3A 1XPRA 1Y1VH 4A3KH 2UXCL 2E5LL 1IBKQ 2Y0SE 2ZJQA 4LF8Q 1IZ6A 2JEAI 1UE5A 5C4XH 1KD1C 2UU9L 4X64Q 3A5ZB 3UE1A 1CKNA 2QEXA 1NY4A 4KHPL 2KHJA 1HZ9A 1OXTA 1SR3A 3M9BA 2R7ZG 1HR0L 1IBLQ 2K52A 4Y7NH 1NE3A 4GLVB 4DV4Q 4LF9L 1X54A 4AQYL 1XMOL 1HZBA 2Q2TA 1X6OA 4MNOA 4YY3Q 1OXSC 1IBKL 1JE5A 3RR5A 3S2DH 4X62Q 2HIXA 5IT9c 4BBSH 3I4MH 4UPAA 5ELNA 3GTQH 4A3LH 1VQMA 1TWFH 2JA9A 3J80c 3HOXG 4JI7Q 1FJGQ 4DAMA 3HOUG 1Y14B 1YITA 3KLWA 1HZCA 1IXRA 2MFIA 3PUXA 4DV4L 4C3IH 4R4CA 2MQHA 5M3MG 4GLAC 3B6YA 4YY3L 2I5HA 1BBUA 3K8AA 4JI6L 3CAMA 1Q82C 3I55A 3PCOB 2JA5H 1N32Q 4DR1Q 3BZKA 3D0FA 2PMZE 3A0JA 3GDEA 1Q7YC 3TEHB 2R92G 1FJGL 4B3TL 1NMGA 2NVYH 1NBWA 4J15A 1M1KC 2JJQA 4JI5L 4DR4Q 4BXXH 3ER0A 1OXUA 2ZTDA 2JE6I 1X55A 1Z9FA 4A3MH 4KLKA 4OXPA 1PH3A 1XPUA 1YEZA 2IHFA 2CQOA 2UXBQ 1E1OA 2KBNA 1HH2P 5J3BA 4Y52H 3T1YQ 1VQNA 4PMWA 3HOYH 2WFWA 3GTMH 3CD6A 2A1AA 2F4VL 4HIOA 1EOVA 2R7ZH 4PZ8A 3U4ZA 1BKBA 4FDBA 5AJ3Q 4HIKA 3BU2A 1UEBA 3ERSX 4DR7Q 5DLQE 1PV4A 1YJ9A 1NMFA 3S1MH 2UXBL 1I6HH 2UUBL 1YBYA 1RIPA 3BZCA 4OWTB 4YCUA 5M3FG 4GKKL 3M4QA 1VQFA 3S1NH 4GKJQ 2WB1E 4LFAL 2F52A 4A3EG 1VQEA 3HOXH 2DGYA 5AJ3L 4HJ5A 1HZAA 2FXQA 3HOUH 4BBRG 3H3VI 1N34Q 4H02A 3ZJYC 3E9IA 5M3MH 2BH2A 1TWGH 5JJLA 4JYAQ 4HJ8A 1WI5A 2D62A 1E22A 3RLOA 3TQYA 5IYCG 4OX9L 4NPSA 2A8VA 4HJ9A 3KFUA 1L1OC 1JT8A 4R4IA 3Q8DA 1LTLA 4EX5A 1K73C 2R92H 2NVTH 4POFA 2MO0A 4UP9A 3I4NG 1ASYA 3I56A 3PSIA 2IY5B 4OWXB 4JI8Q 3RN2A 1B70B 4ME3A 1UE1A 2E2JH 3FKIG 1CSPA 4A4IA 1VQKA 4LF5Q 2AHOB 2UUAQ 4DV5L 5LMNL 4JYAL 3DLLA 4X6AH 4DV0Q 4MTNA 4YCWA 3S1QH 5HY6A 3E0EA 2N3SA 5IP9G 3ULJA 4DUYL 1SRUA 1C9OA 4DUZL 1SFOH 3CPFA 3S2HH 1J6QA 3GO5A 2JQOA 3PUVA 1X3FA 3UDXA 4NB3A 3GTPH 2YYZA 1Q81C 2UUAL 4LF4Q 3PF5A 4C3JH 4B3RQ 1N36Q 5C0XJ 4DR2L 4JBMA 4DV0L 5IYBH 4OONA 2LXKA 1FVIA 1PYBA 3G48A 5M3FH 4X66Q 4DR3L 4A3DG 2R6GA 4A3IH 1A8VA 2BA0A 1K8GA 3U58A 4KHZA 4A3EH 2E5LQ 2ASBA 1VQHA 4GNXA 2NVQH 2ZM6L 2YTVA 1S72A 3A74A 1K8AC 4GN3B 4LF4L 3CP0A 2UU9Q 1XNQL 1XMQL 2Q2UA 3S1RH 3H0GG 2VY3A 1YIJA 4NXMQ 2B29A 1TWAH 4KHPQ 1VQGA 3NELA 1K83H 4LFBQ 1PVOA 1HR0Q 2AWNA 5IYCH 4IFDJ 4JCVE 4X66L 2VS1A 4B3SQ 5LMUL 2B3GA 3KF6A 1EYGA 1HNZQ 2OWOA 3PUWA 3PUYA 4LF9Q 3I4NH 4LUZA 3STBC 2XGTA 1TWHH 2YU9H 4DV1L 1SLJA 2D0OA 2Q2IA 2VZAA 1I5FA 1B7YB 1IBML 3PF4A 1OXXK 4PZ6A 1L1OB 1EWIA 1YHAA 3BJUA 1L2FA 3TS0A 4PZ7A 4A3FH 5K36G 1MIUA 3PIPA 4NXML 4IO9A 1JJGA 1VCIA 5C4JH 4LFBL 2ES2A 3AQQA 1KXLA 1LYLA 4B3SL 4HIDA 1T9HA 1HNZL 4JOIC 2KENA 1VQ8A 3KJPA 2R93G 2V1CC 1YJNA 2YTXA 4JI6Q 4OWWB 1LM0A 1TXYA 1VQCA 4IJLA 4IPHA 4QL5A 4NXNL 3D31A 2PQAB 3I7FA 4XIGS 5GAEC 2JA6G 4LUOA 1BBWA 1AE3A 5ELOA 1PH6A 1L1OA 2PNHA 5C44H 4A3CG 4B3TQ 3PUZA 3G71A 2H5XA 2IT1A 3EBEA 2JA7G 2NZOA 4JI5Q 3HKZE 2OQ0A 3K7UC 4IJHA 1TWCH 4JBWA 1AE2A 4DK6C 2HHHL 3F2BA 1O7IA 1HNWQ 4QGUA 1VQ7A 3S24A 1C7YA 2Z6KC 1N34L 2VNUD 4JG2A 1S40A 1HR0W 4ALPA 1N8RC 2F4VQ 3KJOA 4QIWE 2GVAA 1P8LA 2PQAA 2IX1A 3M4OH 5M5XH 3AFQA 3KDFB 4YWLA 1V1QA 4L5QA 4GLXA 3RZOH 3UDGA 2R7FA 1HNWL 3I2ZA 4DR6Q 2PI2E 1YJWA 2UUBQ 1H95A 4P75A 2UXDQ 4GKKQ 1FGUA 2QGQA 1I3QH 1V9PA 3NEMA 5C3EG 4LFAQ 2E2IH 1A0IA 4DK3C 3CCRA 4DV7Q 1KL9A 2K14A 1G6PA 2I5LX 4DV6Q 2ZJPA 2A19A 3ICEA 2R93H 1XPOA 3RN5A 3HFZB 1PH5A 1MKHA 2AWOA 3K7AH 4YHHL 1I50H 1P16A 4JI4L 3EIVA 1EUJA 4DR6L 3W1GA 4BA1I 2E8GA 4OX9Q 4RG1A 2UXDL 2HT1A 2JA6H 2L15A 1MJCA 2I5MX 5IYDG 3PV0A 4GN5A 3K81C 1N33L 4DV7L 4A3CH 3JAMi 2OQKA 3EN2A 4DV6L 2JA7H 1VQAA 5FJ8G 2QA4A 1Q8KA 4DV5Q 1Y1WG 5LMNQ 3OYYA 1VQPA 4QJFA 4UP8A 3OW2A 1PHJA 3W1BA 3CF5A 4DAYB 1QZGA 5GAHC 4JBJA 4DUYQ 2JK8A 4DUZQ 1E3PA 4P71A 4DKAC 5FLXc 4DV2L 1JJ2A 2EIFA 3S15H 1Z47A 5JJIA 4JOIA 4IPDA 3HOZG 2NN6G 3S16H 1WCMG 4GOPC 1A63A 4P73A 3HKZG 1PFSA 3J7ZC 2VQFL 4IOAA 3PGZA 1WFQA 3E9HA 4UP7A 1A62A 2VQEL 4DR2Q 4OO1I 1X3EA 1VQOA 5C0XG 1XNRQ 3ULPA 4DR5L 1Q1EA 3TS2A 1U0LA 4DR3Q 2BA1A 3I4OA 2YTYA 4UY8C 3JC66 1KHIA 1X56A 5C3EH 5FLMG 1Q1BA 1SN8A 3M3YH 1FL0A 4LNQA 1JMCA 2KHIA 5GAGC 3UDFA 1R9TH 2ZM6Q 1XNQQ 1E1TA 1XMQQ 4DPGA 2RF4A 4C2MH 1LUZA 2Z6KA 2NZHA 4A76A 3CMEA 1XNRL 3GTLH 3G4SA 3PIOA 3AFPA 3JAMc 5IE8A 1EFWA 3ULLA 4JI3L 1VQJA 5LMUQ 4LUVA 4A3JG 1I94Q 4IFDG 2MNAA 1EQQA 1WJJA 5IYDH 3LGJA 4AYBE 5BR8Q 4DV1Q 5E7NA 1IBMQ 2RHQB 4BBRH 3WWVA 5LMNW 2AKWB 2VW9A 4IOCA 5FJ8H 1UWVA 1VQBA 4JI1L 1BVSA 1Y1WH 5EAYA 4BY1G 3F2CA 3CCUA 3CMAA 2R7DA 3F1ZA 3CCVA 2LXJA 4BBSG 2ALYB 2E2HH 3J81i 1PH1A 1I94L 4X65Q 1NJIC 1X65A 1VQ9A 1VQLA 4R4OA 4B3ML 1GKHA 1YZ6A 1G291 5BR8L 3CCMA 1VS0A 2KCMA 3RZDH 1K9MC 1E7ZA 4JI0L 3HOZH 2BH8A 3FKIH 4GN4B 2OTJA 1ASZA 5JEAJ 4NXNQ 1CKNB 4A3BG 5JJKA 2JA5G 4GOPB 3J81j 5IP9H 1E24A 4X65L 2Z0SA 1GVPA 1QVCA 2HHHQ 2PI2A 4TVAB 3AYHB 4DV3L 1PH8A 1J5EL 1EQRA 1X3GA 5GADC 2WP8J 1U5KA 1YHBA 2YV5A 3STBD 4A3MG 2K5NA 1CUKA 1HNXL 3J7A5 3M85A 3FHWA 4IPGA 4LF6L 1OXVA 1GD7A 4O2DA 1D7QA 5IP7G 3T1HL 2VUMG 3HOYG 4A3DH 2C35B 4A3JH 1M90C 4LF7Q 1SROA 2MO1A 2JEBI 3NENA 4GOPA 1OTCA 1RL2A 4K0KQ 1N32L 4A3GG 4DNIA 2EXDA 2DUDA 2XTIA 1IL2A 3H0GH 1PH7A 2HQLA 3J81c 2OCEA 2UUCQ 3HOWG 5HGQA 4BY1H 3F8TA 4JC0A 4LF8L 3G6EA 5GQOA 4XTCS 4X64L 4L5TA 1B8AA 3GD7A 4R4QA 2AMCB 4YWKA 4LF7L 4AYBG 1VQDA 1IBLL 4K0KL 5M5WH 4YHHQ 3CC7A 1L0WA 2NVXH 4JI4Q 3KYHC 3TREA 5IWAQ 2UUCL 3AEVA 4WJ3M 1PYSB 1KRTA 3KF8B 3RLNA 1SMXA 4MZ9A 4X62L 1KAWA 1VQIA 2K5HA 1JJCB 3CC4A 1N33Q 2JA8G 1QVFA 2K4KA 3S14H 4A3BH 1C0AA 3S17H 3CCSA 2Q2HA 3L7ZC 3U4VA 2B63G 2RHSB 4A93G 3CW2C 1SE8A 1WOCA 4R1JA 4JI7L 3PO3G 2K50A 3PO2G 4L5RC 4P72A 2CKZB 2N78A 2WAQE 1CSQA 1YVCA 3KDFA 5IWAL 4GNXC 1JB7A 4P74A 4KI0A 3GTOH 4DV2Q 2ID0A 3CQZH 1EIYB 1YI2A 5IP7H 4R4TA 4DR1L 1N9WA 1GM5A 1HJPA 3RLFA 4APVA 3L2PA 3F2DA 4LFCQ 2VUMH 1IYJB 2CWAA 3M4PA 2VQFQ 1X9NA 1KIXA 3W5OA 3CCEA 3GTKH 2VQEQ 1G51A 4A3GH 4HIMA 4DR4L 2D0PA 4QQBX 1S3OA 2N49A 3CPWA 1AH9A 2KCTA 3MEFA 3HKSA 3CCQA 4DR5Q 4LW1A 5GROA 3CC2A 3CCLA 4IPCA 3HOVG 3SGIA 2Y0SG 1XJVA 3HOWH 3NBHB 5IYBG 2IHEA 3L0OA 3GTJH 4YWMA 1Q86C 3T1YL 1YHQA 4LFCL 4A3IG 2IX0A 2CWPA 1EIFA 2K75A 3OTOQ 1YNXA 2I0QA 3KOJA 4BA2I 5IY0A 3GTGH 2GVBA 1Q12A 1UE6A 4YCVA 2OTLA 3K80C 2ATWA 4BY7G 4DR7L 1K3RA 3A5UA 4JI3Q 4OO1G 4GS3A 5C44G 4JBKA 3H15A 4HJ7A 3CXCA 1QUQB 1D8LA 4JI2Q 2JA8H 1PA6A 4GKJL 2NN6I 4AIMA 2GN5A 3OTOL 1W3SA 2F3IA 2B63H 3UE0A 4A93H 2LSSA 1Y1VG 4A3KG 4JI1Q 2HIVA 3PO2H 3PO3H 4JV5Q 4C3HH 2K5VA 1PH4A 1KC8C 1GO3E 5C4XG 5C0XI 4A3FG 2CFMA 4QY7A 1PH9A 1V43A 4B3MQ 4JI2L 3VDYA 1VQ4A 1QVGA 1PH2A 4TQUS 4JI0Q 2RCNA 2ZTEA 4GNXB 1WYDA 1K0RA 1W2BA 3U50C 1CKMA 1QUQA 5H1SE 4L5SA 3RNUA 4JV5L 2CCZA 4JI8L 2WAQG 1QZHA 5JEAG 3H3VH 2N8NA 3MXNB 4LF5L 3I4MG 2VL6A 3UDIA 4O0AA 5M5YH 3HOVH 4A3LG 3IRBA 3KF6B 1KQSA 4IFDI 2EQSA 1Q46A 4HJAA 2ZJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WCM H;  3FP9 A;  1MJE A;  4DV3 Q;  1J5E Q;  2ZTC A;  4RMF A;  3J80 i;  1VQ6 A;  1HNX Q;  2UXC Q;  4AH6 A;  1CKO A;  4LF6 Q;  1XTD A;  4A75 A;  3TRZ A;  3CCJ A;  1DGS A;  3T1H Q;  3M7N A;  4EQ5 A;  4BY7 H;  1N36 L;  4POG A;  1KRS A;  3DM3 A;  4LWC A;  1VQ5 A;  4B3R L;  4WJ4 A;  1UE7 A;  5FLM H;  3K0X A;  1NTG A;  4BXX G;  2WB1 G;  4AQY Q;  1XMO Q;  4PG3 A;  1XPR A;  1Y1V H;  4A3K H;  2UXC L;  2E5L L;  1IBK Q;  2Y0S E;  2ZJQ A;  4LF8 Q;  1IZ6 A;  2JEA I;  1UE5 A;  5C4X H;  1KD1 C;  2UU9 L;  4X64 Q;  3A5Z B;  3UE1 A;  1CKN A;  2QEX A;  1NY4 A;  4KHP L;  2KHJ A;  1HZ9 A;  1OXT A;  1SR3 A;  3M9B A;  2R7Z G;  1HR0 L;  1IBL Q;  2K52 A;  4Y7N H;  1NE3 A;  4GLV B;  4DV4 Q;  4LF9 L;  1X54 A;  4AQY L;  1XMO L;  1HZB A;  2Q2T A;  1X6O A;  4MNO A;  4YY3 Q;  1OXS C;  1IBK L;  1JE5 A;  3RR5 A;  3S2D H;  4X62 Q;  2HIX A;  5IT9 c;  4BBS H;  3I4M H;  4UPA A;  5ELN A;  3GTQ H;  4A3L H;  1VQM A;  1TWF H;  2JA9 A;  3J80 c;  3HOX G;  4JI7 Q;  1FJG Q;  4DAM A;  3HOU G;  1Y14 B;  1YIT A;  3KLW A;  1HZC A;  1IXR A;  2MFI A;  3PUX A;  4DV4 L;  4C3I H;  4R4C A;  2MQH A;  5M3M G;  4GLA C;  3B6Y A;  4YY3 L;  2I5H A;  1BBU A;  3K8A A;  4JI6 L;  3CAM A;  1Q82 C;  3I55 A;  3PCO B;  2JA5 H;  1N32 Q;  4DR1 Q;  3BZK A;  3D0F A;  2PMZ E;  3A0J A;  3GDE A;  1Q7Y C;  3TEH B;  2R92 G;  1FJG L;  4B3T L;  1NMG A;  2NVY H;  1NBW A;  4J15 A;  1M1K C;  2JJQ A;  4JI5 L;  4DR4 Q;  4BXX H;  3ER0 A;  1OXU A;  2ZTD A;  2JE6 I;  1X55 A;  1Z9F A;  4A3M H;  4KLK A;  4OXP A;  1PH3 A;  1XPU A;  1YEZ A;  2IHF A;  2CQO A;  2UXB Q;  1E1O A;  2KBN A;  1HH2 P;  5J3B A;  4Y52 H;  3T1Y Q;  1VQN A;  4PMW A;  3HOY H;  2WFW A;  3GTM H;  3CD6 A;  2A1A A;  2F4V L;  4HIO A;  1EOV A;  2R7Z H;  4PZ8 A;  3U4Z A;  1BKB A;  4FDB A;  5AJ3 Q;  4HIK A;  3BU2 A;  1UEB A;  3ERS X;  4DR7 Q;  5DLQ E;  1PV4 A;  1YJ9 A;  1NMF A;  3S1M H;  2UXB L;  1I6H H;  2UUB L;  1YBY A;  1RIP A;  3BZC A;  4OWT B;  4YCU A;  5M3F G;  4GKK L;  3M4Q A;  1VQF A;  3S1N H;  4GKJ Q;  2WB1 E;  4LFA L;  2F52 A;  4A3E G;  1VQE A;  3HOX H;  2DGY A;  5AJ3 L;  4HJ5 A;  1HZA A;  2FXQ A;  3HOU H;  4BBR G;  3H3V I;  1N34 Q;  4H02 A;  3ZJY C;  3E9I A;  5M3M H;  2BH2 A;  1TWG H;  5JJL A;  4JYA Q;  4HJ8 A;  1WI5 A;  2D62 A;  1E22 A;  3RLO A;  3TQY A;  5IYC G;  4OX9 L;  4NPS A;  2A8V A;  4HJ9 A;  3KFU A;  1L1O C;  1JT8 A;  4R4I A;  3Q8D A;  1LTL A;  4EX5 A;  1K73 C;  2R92 H;  2NVT H;  4POF A;  2MO0 A;  4UP9 A;  3I4N G;  1ASY A;  3I56 A;  3PSI A;  2IY5 B;  4OWX B;  4JI8 Q;  3RN2 A;  1B70 B;  4ME3 A;  1UE1 A;  2E2J H;  3FKI G;  1CSP A;  4A4I A;  1VQK A;  4LF5 Q;  2AHO B;  2UUA Q;  4DV5 L;  5LMN L;  4JYA L;  3DLL A;  4X6A H;  4DV0 Q;  4MTN A;  4YCW A;  3S1Q H;  5HY6 A;  3E0E A;  2N3S A;  5IP9 G;  3ULJ A;  4DUY L;  1SRU A;  1C9O A;  4DUZ L;  1SFO H;  3CPF A;  3S2H H;  1J6Q A;  3GO5 A;  2JQO A;  3PUV A;  1X3F A;  3UDX A;  4NB3 A;  3GTP H;  2YYZ A;  1Q81 C;  2UUA L;  4LF4 Q;  3PF5 A;  4C3J H;  4B3R Q;  1N36 Q;  5C0X J;  4DR2 L;  4JBM A;  4DV0 L;  5IYB H;  4OON A;  2LXK A;  1FVI A;  1PYB A;  3G48 A;  5M3F H;  4X66 Q;  4DR3 L;  4A3D G;  2R6G A;  4A3I H;  1A8V A;  2BA0 A;  1K8G A;  3U58 A;  4KHZ A;  4A3E H;  2E5L Q;  2ASB A;  1VQH A;  4GNX A;  2NVQ H;  2ZM6 L;  2YTV A;  1S72 A;  3A74 A;  1K8A C;  4GN3 B;  4LF4 L;  3CP0 A;  2UU9 Q;  1XNQ L;  1XMQ L;  2Q2U A;  3S1R H;  3H0G G;  2VY3 A;  1YIJ A;  4NXM Q;  2B29 A;  1TWA H;  4KHP Q;  1VQG A;  3NEL A;  1K83 H;  4LFB Q;  1PVO A;  1HR0 Q;  2AWN A;  5IYC H;  4IFD J;  4JCV E;  4X66 L;  2VS1 A;  4B3S Q;  5LMU L;  2B3G A;  3KF6 A;  1EYG A;  1HNZ Q;  2OWO A;  3PUW A;  3PUY A;  4LF9 Q;  3I4N H;  4LUZ A;  3STB C;  2XGT A;  1TWH H;  2YU9 H;  4DV1 L;  1SLJ A;  2D0O A;  2Q2I A;  2VZA A;  1I5F A;  1B7Y B;  1IBM L;  3PF4 A;  1OXX K;  4PZ6 A;  1L1O B;  1EWI A;  1YHA A;  3BJU A;  1L2F A;  3TS0 A;  4PZ7 A;  4A3F H;  5K36 G;  1MIU A;  3PIP A;  4NXM L;  4IO9 A;  1JJG A;  1VCI A;  5C4J H;  4LFB L;  2ES2 A;  3AQQ A;  1KXL A;  1LYL A;  4B3S L;  4HID A;  1T9H A;  1HNZ L;  4JOI C;  2KEN A;  1VQ8 A;  3KJP A;  2R93 G;  2V1C C;  1YJN A;  2YTX A;  4JI6 Q;  4OWW B;  1LM0 A;  1TXY A;  1VQC A;  4IJL A;  4IPH A;  4QL5 A;  4NXN L;  3D31 A;  2PQA B;  3I7F A;  4XIG S;  5GAE C;  2JA6 G;  4LUO A;  1BBW A;  1AE3 A;  5ELO A;  1PH6 A;  1L1O A;  2PNH A;  5C44 H;  4A3C G;  4B3T Q;  3PUZ A;  3G71 A;  2H5X A;  2IT1 A;  3EBE A;  2JA7 G;  2NZO A;  4JI5 Q;  3HKZ E;  2OQ0 A;  3K7U C;  4IJH A;  1TWC H;  4JBW A;  1AE2 A;  4DK6 C;  2HHH L;  3F2B A;  1O7I A;  1HNW Q;  4QGU A;  1VQ7 A;  3S24 A;  1C7Y A;  2Z6K C;  1N34 L;  2VNU D;  4JG2 A;  1S40 A;  1HR0 W;  4ALP A;  1N8R C;  2F4V Q;  3KJO A;  4QIW E;  2GVA A;  1P8L A;  2PQA A;  2IX1 A;  3M4O H;  5M5X H;  3AFQ A;  3KDF B;  4YWL A;  1V1Q A;  4L5Q A;  4GLX A;  3RZO H;  3UDG A;  2R7F A;  1HNW L;  3I2Z A;  4DR6 Q;  2PI2 E;  1YJW A;  2UUB Q;  1H95 A;  4P75 A;  2UXD Q;  4GKK Q;  1FGU A;  2QGQ A;  1I3Q H;  1V9P A;  3NEM A;  5C3E G;  4LFA Q;  2E2I H;  1A0I A;  4DK3 C;  3CCR A;  4DV7 Q;  1KL9 A;  2K14 A;  1G6P A;  2I5L X;  4DV6 Q;  2ZJP A;  2A19 A;  3ICE A;  2R93 H;  1XPO A;  3RN5 A;  3HFZ B;  1PH5 A;  1MKH A;  2AWO A;  3K7A H;  4YHH L;  1I50 H;  1P16 A;  4JI4 L;  3EIV A;  1EUJ A;  4DR6 L;  3W1G A;  4BA1 I;  2E8G A;  4OX9 Q;  4RG1 A;  2UXD L;  2HT1 A;  2JA6 H;  2L15 A;  1MJC A;  2I5M X;  5IYD G;  3PV0 A;  4GN5 A;  3K81 C;  1N33 L;  4DV7 L;  4A3C H;  3JAM i;  2OQK A;  3EN2 A;  4DV6 L;  2JA7 H;  1VQA A;  5FJ8 G;  2QA4 A;  1Q8K A;  4DV5 Q;  1Y1W G;  5LMN Q;  3OYY A;  1VQP A;  4QJF A;  4UP8 A;  3OW2 A;  1PHJ A;  3W1B A;  3CF5 A;  4DAY B;  1QZG A;  5GAH C;  4JBJ A;  4DUY Q;  2JK8 A;  4DUZ Q;  1E3P A;  4P71 A;  4DKA C;  5FLX c;  4DV2 L;  1JJ2 A;  2EIF A;  3S15 H;  1Z47 A;  5JJI A;  4JOI A;  4IPD A;  3HOZ G;  2NN6 G;  3S16 H;  1WCM G;  4GOP C;  1A63 A;  4P73 A;  3HKZ G;  1PFS A;  3J7Z C;  2VQF L;  4IOA A;  3PGZ A;  1WFQ A;  3E9H A;  4UP7 A;  1A62 A;  2VQE L;  4DR2 Q;  4OO1 I;  1X3E A;  1VQO A;  5C0X G;  1XNR Q;  3ULP A;  4DR5 L;  1Q1E A;  3TS2 A;  1U0L A;  4DR3 Q;  2BA1 A;  3I4O A;  2YTY A;  4UY8 C;  3JC6 6;  1KHI A;  1X56 A;  5C3E H;  5FLM G;  1Q1B A;  1SN8 A;  3M3Y H;  1FL0 A;  4LNQ A;  1JMC A;  2KHI A;  5GAG C;  3UDF A;  1R9T H;  2ZM6 Q;  1XNQ Q;  1E1T A;  1XMQ Q;  4DPG A;  2RF4 A;  4C2M H;  1LUZ A;  2Z6K A;  2NZH A;  4A76 A;  3CME A;  1XNR L;  3GTL H;  3G4S A;  3PIO A;  3AFP A;  3JAM c;  5IE8 A;  1EFW A;  3ULL A;  4JI3 L;  1VQJ A;  5LMU Q;  4LUV A;  4A3J G;  1I94 Q;  4IFD G;  2MNA A;  1EQQ A;  1WJJ A;  5IYD H;  3LGJ A;  4AYB E;  5BR8 Q;  4DV1 Q;  5E7N A;  1IBM Q;  2RHQ B;  4BBR H;  3WWV A;  5LMN W;  2AKW B;  2VW9 A;  4IOC A;  5FJ8 H;  1UWV A;  1VQB A;  4JI1 L;  1BVS A;  1Y1W H;  5EAY A;  4BY1 G;  3F2C A;  3CCU A;  3CMA A;  2R7D A;  3F1Z A;  3CCV A;  2LXJ A;  4BBS G;  2ALY B;  2E2H H;  3J81 i;  1PH1 A;  1I94 L;  4X65 Q;  1NJI C;  1X65 A;  1VQ9 A;  1VQL A;  4R4O A;  4B3M L;  1GKH A;  1YZ6 A;  1G29 1;  5BR8 L;  3CCM A;  1VS0 A;  2KCM A;  3RZD H;  1K9M C;  1E7Z A;  4JI0 L;  3HOZ H;  2BH8 A;  3FKI H;  4GN4 B;  2OTJ A;  1ASZ A;  5JEA J;  4NXN Q;  1CKN B;  4A3B G;  5JJK A;  2JA5 G;  4GOP B;  3J81 j;  5IP9 H;  1E24 A;  4X65 L;  2Z0S A;  1GVP A;  1QVC A;  2HHH Q;  2PI2 A;  4TVA B;  3AYH B;  4DV3 L;  1PH8 A;  1J5E L;  1EQR A;  1X3G A;  5GAD C;  2WP8 J;  1U5K A;  1YHB A;  2YV5 A;  3STB D;  4A3M G;  2K5N A;  1CUK A;  1HNX L;  3J7A 5;  3M85 A;  3FHW A;  4IPG A;  4LF6 L;  1OXV A;  1GD7 A;  4O2D A;  1D7Q A;  5IP7 G;  3T1H L;  2VUM G;  3HOY G;  4A3D H;  2C35 B;  4A3J H;  1M90 C;  4LF7 Q;  1SRO A;  2MO1 A;  2JEB I;  3NEN A;  4GOP A;  1OTC A;  1RL2 A;  4K0K Q;  1N32 L;  4A3G G;  4DNI A;  2EXD A;  2DUD A;  2XTI A;  1IL2 A;  3H0G H;  1PH7 A;  2HQL A;  3J81 c;  2OCE A;  2UUC Q;  3HOW G;  5HGQ A;  4BY1 H;  3F8T A;  4JC0 A;  4LF8 L;  3G6E A;  5GQO A;  4XTC S;  4X64 L;  4L5T A;  1B8A A;  3GD7 A;  4R4Q A;  2AMC B;  4YWK A;  4LF7 L;  4AYB G;  1VQD A;  1IBL L;  4K0K L;  5M5W H;  4YHH Q;  3CC7 A;  1L0W A;  2NVX H;  4JI4 Q;  3KYH C;  3TRE A;  5IWA Q;  2UUC L;  3AEV A;  4WJ3 M;  1PYS B;  1KRT A;  3KF8 B;  3RLN A;  1SMX A;  4MZ9 A;  4X62 L;  1KAW A;  1VQI A;  2K5H A;  1JJC B;  3CC4 A;  1N33 Q;  2JA8 G;  1QVF A;  2K4K A;  3S14 H;  4A3B H;  1C0A A;  3S17 H;  3CCS A;  2Q2H A;  3L7Z C;  3U4V A;  2B63 G;  2RHS B;  4A93 G;  3CW2 C;  1SE8 A;  1WOC A;  4R1J A;  4JI7 L;  3PO3 G;  2K50 A;  3PO2 G;  4L5R C;  4P72 A;  2CKZ B;  2N78 A;  2WAQ E;  1CSQ A;  1YVC A;  3KDF A;  5IWA L;  4GNX C;  1JB7 A;  4P74 A;  4KI0 A;  3GTO H;  4DV2 Q;  2ID0 A;  3CQZ H;  1EIY B;  1YI2 A;  5IP7 H;  4R4T A;  4DR1 L;  1N9W A;  1GM5 A;  1HJP A;  3RLF A;  4APV A;  3L2P A;  3F2D A;  4LFC Q;  2VUM H;  1IYJ B;  2CWA A;  3M4P A;  2VQF Q;  1X9N A;  1KIX A;  3W5O A;  3CCE A;  3GTK H;  2VQE Q;  1G51 A;  4A3G H;  4HIM A;  4DR4 L;  2D0P A;  4QQB X;  1S3O A;  2N49 A;  3CPW A;  1AH9 A;  2KCT A;  3MEF A;  3HKS A;  3CCQ A;  4DR5 Q;  4LW1 A;  5GRO A;  3CC2 A;  3CCL A;  4IPC A;  3HOV G;  3SGI A;  2Y0S G;  1XJV A;  3HOW H;  3NBH B;  5IYB G;  2IHE A;  3L0O A;  3GTJ H;  4YWM A;  1Q86 C;  3T1Y L;  1YHQ A;  4LFC L;  4A3I G;  2IX0 A;  2CWP A;  1EIF A;  2K75 A;  3OTO Q;  1YNX A;  2I0Q A;  3KOJ A;  4BA2 I;  5IY0 A;  3GTG H;  2GVB A;  1Q12 A;  1UE6 A;  4YCV A;  2OTL A;  3K80 C;  2ATW A;  4BY7 G;  4DR7 L;  1K3R A;  3A5U A;  4JI3 Q;  4OO1 G;  4GS3 A;  5C44 G;  4JBK A;  3H15 A;  4HJ7 A;  3CXC A;  1QUQ B;  1D8L A;  4JI2 Q;  2JA8 H;  1PA6 A;  4GKJ L;  2NN6 I;  4AIM A;  2GN5 A;  3OTO L;  1W3S A;  2F3I A;  2B63 H;  3UE0 A;  4A93 H;  2LSS A;  1Y1V G;  4A3K G;  4JI1 Q;  2HIV A;  3PO2 H;  3PO3 H;  4JV5 Q;  4C3H H;  2K5V A;  1PH4 A;  1KC8 C;  1GO3 E;  5C4X G;  5C0X I;  4A3F G;  2CFM A;  4QY7 A;  1PH9 A;  1V43 A;  4B3M Q;  4JI2 L;  3VDY A;  1VQ4 A;  1QVG A;  1PH2 A;  4TQU S;  4JI0 Q;  2RCN A;  2ZTE A;  4GNX B;  1WYD A;  1K0R A;  1W2B A;  3U50 C;  1CKM A;  1QUQ A;  5H1S E;  4L5S A;  3RNU A;  4JV5 L;  2CCZ A;  4JI8 L;  2WAQ G;  1QZH A;  5JEA G;  3H3V H;  2N8N A;  3MXN B;  4LF5 L;  3I4M G;  2VL6 A;  3UDI A;  4O0A A;  5M5Y H;  3HOV H;  4A3L G;  3IRB A;  3KF6 B;  1KQS A;  4IFD I;  2EQS A;  1Q46 A;  4HJA A;  2ZJR A; 
#chains in the Genus database with same CATH topology
 5D14 A;  1X3Q A;  1WCM H;  1MJE A;  1J5E Q;  2M9V A;  1OO9 B;  4RMF A;  3J80 i;  1HNX Q;  1RD9 D;  5CV8 A;  3J7Y W;  3T1H Q;  4B3R L;  2E2D C;  3CRL C;  2EYJ A;  5ELC A;  1D5X C;  3KK7 A;  3K0X A;  4BXX G;  4EQN A;  4N8X 1;  1E2Z A;  1XPR A;  2UXC L;  4H13 C;  4RCO A;  5J22 A;  3Q0A A;  2E5L L;  3H09 A;  1UE5 A;  2UU9 L;  1KD1 C;  5I2X A;  1BXT A;  1OXT A;  1SR3 A;  1HCZ A;  2R7Z G;  1CHQ D;  1WTO A;  3SHL A;  1HR0 L;  1IBL Q;  1SNO A;  4KMU C;  4AQY L;  1HZB A;  4RAU C;  4MNO A;  4YY3 Q;  4HR7 B;  3S2D H;  1VMP A;  5DNF A;  4X62 Q;  1BCP C;  3D6W A;  1A2U A;  4CJ2 C;  4L8J A;  4TKO B;  3HOU G;  1I3Q B;  1YIT A;  2L1B A;  3KLW A;  1K0S A;  4DV4 L;  3A56 A;  2CW0 C;  2MQH A;  2PW5 A;  4GLA C;  4JI6 L;  4PV1 C;  4WJW A;  3QO2 A;  1STY A;  5ELD A;  2NBF A;  4DR1 Q;  3D0F A;  1I50 B;  1FGB D;  2KED A;  4C1N I;  2JA6 B;  2WKC A;  2JJQ A;  3DWQ A;  2ZTD A;  2ICI A;  3HOX B;  1PTO D;  4KLK A;  4OXP A;  3IFD A;  1YEZ A;  3J7A F;  2UXB Q;  1HH2 P;  1LTR D;  5EKL A;  3T1Y Q;  3HOY H;  3MXG A;  1EOV A;  3U4Z A;  4FDB A;  2R92 B;  1LTI D;  5D3I B;  3BU2 A;  1CQV A;  4CBV A;  4B08 A;  1CA5 A;  4K8I A;  1NMF A;  2F0K A;  5DM6 3;  1PFB A;  2F0J A;  1DYQ A;  3M4Q A;  2SEB D;  3HG9 A;  1CHP D;  2F52 A;  3SEB A;  4RHS A;  3A7L A;  3HOX H;  5AJ3 L;  1BCP B;  2D2C C;  2FXQ A;  3S2H B;  5C3E B;  4P2C B;  2BH2 A;  4LMQ D;  4JYA Q;  1E22 A;  5IYC G;  4FNF A;  3OOC A;  4HJ9 A;  1K3B C;  1L1O C;  3Q8D A;  1K73 C;  2R92 H;  2MO0 A;  5KYL A;  5M3F B;  2IY5 B;  3HZX A;  1B70 B;  3FKI G;  4A4I A;  1F2L A;  4LF5 Q;  4DV5 L;  1RDP D;  1A3V A;  4DV0 Q;  3S1R B;  5EPL A;  5HY6 A;  5CV5 A;  1TWA B;  3MWY W;  1EL0 A;  1E2V A;  3S2H H;  2O4X A;  1BCP F;  4KN7 C;  2UUA L;  3RZD B;  1BOS A;  2PPB C;  4LF4 Q;  4C3J H;  4DR2 L;  4JBM A;  5IYB H;  3D8G A;  4HCE A;  2LXK A;  1PRT D;  1GHK A;  5M3F H;  4X66 Q;  4DR3 L;  4A3D G;  2RKS A;  4A3I H;  1A8V A;  3H94 A;  1NSN S;  4KHZ A;  1H9K A;  4Q0F A;  4GNX A;  1K8A C;  2HQE A;  3OW7 A;  4QIW B;  1LAC A;  1Q8I A;  3S1R H;  3H0G G;  1XMQ L;  3PIP 3;  1TWA H;  4KHP Q;  3SK6 A;  3UI2 A;  4IFD J;  2QW7 A;  1EYG A;  3KF6 A;  1HNZ Q;  1JE4 A;  1LT3 D;  2E74 C;  1D5Z C;  3TDQ A;  3TP7 A;  2F0S A;  2ZT9 C;  1B7Y B;  3K5N A;  3K5M A;  1B2T A;  1L1O B;  1F2M A;  3BJU A;  5KRU A;  1EFI D;  2X69 A;  4KV6 A;  2A68 C;  4HCS A;  1KXL A;  2XNA C;  4CDF C;  4JOI C;  5J1Z A;  1VQ8 A;  1KLU D;  1DOL A;  1Y8O B;  1YJN A;  1LM0 A;  1VQC A;  1LTS D;  2G5D A;  3NWS A;  4QUF A;  4NXN L;  3I7F A;  2K33 A;  4LUO A;  2L0C A;  4FXD A;  3D4W A;  5FO8 B;  1TKW B;  2IT1 A;  3K57 A;  1AP0 A;  3HKZ E;  1XXG A;  1D1K A;  1EZ6 A;  3A7A B;  1U9R A;  3BZD B;  1VQ7 A;  3S24 A;  2VNU D;  2CHB D;  1N34 L;  1TR5 A;  1HR0 W;  4ALP A;  5CR3 A;  3JAM E;  2F4V Q;  2MP1 A;  1I4R A;  4QIW E;  3M4O H;  3GTO B;  1F9S A;  3AFQ A;  3KDF B;  4L5Q A;  3RZO H;  2B2W C;  2EE1 A;  2XSC A;  5IGE A;  2EYO A;  1YJW A;  2UUB Q;  1H95 A;  2FJ2 A;  4GKK Q;  1FGU A;  3NEM A;  1Q90 A;  1GXD C;  4CDD C;  2E2I H;  2PW7 A;  4DV7 Q;  1KL9 A;  2R3Z A;  1G6P A;  4IUV A;  4IUU A;  4DV6 Q;  2A19 A;  3ICE A;  4RKB A;  5KND A;  1NUC A;  3RN5 A;  2AWO A;  1LO5 D;  4YHH L;  1EY9 A;  4EGV A;  1P16 A;  3CRK C;  3EIV A;  4JI4 L;  1WTV A;  3W1G A;  1LT4 D;  1D2B A;  2L15 A;  1SBB B;  4GN5 A;  5IGD A;  3K81 C;  4M1U B;  3SXH A;  3MVV A;  2E75 C;  2QEJ C;  1WTR A;  2QA4 A;  5C3X A;  5LMN Q;  1PHJ A;  3AB9 A;  1I4G A;  3CF5 A;  5LL6 X;  3PO2 B;  5FOB B;  4DUY Q;  1B44 D;  1E3P A;  3C1F A;  5FLX c;  1PZI D;  1JJ2 A;  1TY0 A;  4IPD A;  1O7Z A;  3EQL C;  2VQF L;  4IOA A;  5FO7 B;  1HTP A;  4UP7 A;  5C0X G;  4DAP A;  1Q1E A;  4ZAI A;  4UY8 C;  2YTY A;  3D6C A;  3JC6 6;  4K5W A;  1X56 A;  1LTB D;  5FLM G;  3QOJ A;  3M3Y H;  1FL0 A;  2D9U A;  1JMC A;  1H9S B;  2D5D A;  2L11 A;  2ZM6 Q;  1XNQ Q;  2Q8T A;  1EQV A;  1LUZ A;  2GA4 B;  2NZH A;  1B50 A;  1VQJ A;  5A35 A;  2Z6B A;  4A3J G;  4BY7 B;  5BR8 Q;  2O2L D;  1IBM Q;  1ESR A;  4KJN A;  1A2T A;  4JI1 L;  4I7A A;  5KGU A;  4TSS A;  2ALY B;  1YZ6 A;  1K9M C;  4RKL A;  1VS0 A;  2KCM A;  1E7Z A;  2NN6 H;  2BH8 A;  4MN3 A;  3FKI H;  2NTS A;  4C56 C;  1HUN A;  4KY7 A;  1KDA A;  1CKN B;  2F0M A;  2JA5 G;  2RDG A;  1SNM A;  4HMJ A;  4BBS B;  4QCL A;  5G3L F;  2Z0S A;  1GVP A;  3GV6 A;  3C2P A;  1PZJ D;  5M5W B;  1X3G A;  5GAD C;  4A3M G;  3J7A 5;  2K5N A;  1CUK A;  3CHB D;  3SK8 A;  3FHW A;  5M9O A;  4O2D A;  2B2V A;  5IP7 G;  4A3D H;  1J9O A;  1NNX A;  4GOP A;  1RL2 A;  4K0K Q;  4WRD A;  4K14 A;  4DNI A;  2NVY B;  3H0G H;  5FKA C;  3J81 c;  5HGQ A;  4JC0 A;  4LF8 L;  3CQZ B;  4YWK A;  2XRQ D;  4AYB G;  5M5W H;  4ZKC B;  1L0W A;  4WJ3 M;  5IWA Q;  4A3G B;  1PYS B;  1KRT A;  3KF8 B;  1SMX A;  1KAW A;  3ITP A;  1BBX C;  2JA8 G;  1C0A A;  1N33 Q;  3HOW B;  1M4V A;  4U67 3;  1EIH A;  4H44 C;  4A93 G;  2DJF C;  2HDL A;  2KOL A;  4DF7 A;  1CSQ A;  3EVQ A;  1YVC A;  2L5T A;  2XRS D;  3NPP A;  3CQZ H;  3Q6S A;  1SXT A;  1EIY B;  3RLF A;  4APV A;  3M4P A;  1K8O A;  2KJX A;  4A3G H;  2D0P A;  3MFG A;  1S3O A;  2KCT A;  4DU9 A;  5KNC A;  3HOW H;  1F9R A;  2IHE A;  3JAM L;  4YWM A;  5D65 A;  1Q86 C;  1EY4 A;  1F9P A;  1SE3 A;  2F0U A;  3RUZ A;  3TME A;  1LTG D;  1CI3 M;  3QB3 A;  4CDE C;  1FNU A;  5IY0 A;  2N55 A;  4YCV A;  3K80 C;  5I6Y A;  4OO1 G;  4JBK A;  1ZYR D;  3H15 A;  4HJ7 A;  3CXC A;  4JI2 Q;  1PA6 A;  1Z7T A;  2GN5 A;  2JXM B;  1VDZ A;  2K03 A;  3A8K E;  1AFP A;  2K5V A;  4XYQ A;  1PRT C;  5C0X I;  1STH A;  2CFM A;  3R3O A;  4BS9 A;  1CQF A;  2L9H A;  4B3M Q;  5L37 A;  4TQU S;  4RFB A;  1WYD A;  2IJ0 A;  2LMC B;  3OMC A;  1CKM A;  3MFY A;  1AZQ A;  4JI8 L;  2A5H A;  1L0Y B;  4A3K B;  4IAL A;  4O0A A;  2A6H C;  5JVH 3;  1KQS A;  4A3F B;  1Q46 A;  2ZJR A;  1EWH A;  4XYO A;  5IGG A;  4BWG B;  5IGF A;  5C4J B;  2ZTC A;  4DV3 Q;  3TP8 A;  5EJW A;  1VQ6 A;  2UXC Q;  1CKO A;  1S4Z A;  4ZQ3 A;  4A75 A;  1N36 L;  3DM3 A;  3BVG A;  1HA5 A;  3I4M B;  5FLM H;  2EYM A;  2F0Q A;  4E6I A;  2NYZ D;  1TT2 A;  3P75 A;  5C44 B;  1H9R A;  4AQY Q;  1DON A;  1VF5 C;  4A3K H;  2TSS A;  1SYF A;  4C3I B;  1IZ6 A;  3WDN A;  3BVM A;  4X64 Q;  3UE1 A;  1HZ9 A;  3M9B A;  1KDB A;  1UAP A;  5CYU A;  2K52 A;  4Y7N H;  1NE3 A;  1PRT B;  4GLV B;  4X3U A;  2HCI A;  4DV4 Q;  4LF9 L;  1XMO L;  5J39 A;  5M5X B;  1IBK L;  4I7Z C;  2WB1 B;  4ME5 A;  5KIX A;  2EJM A;  4UPA A;  3I4M H;  5ELN A;  4PNY A;  4A3L H;  2JA9 A;  1STB A;  3HOX G;  2A6E D;  4DAM A;  3IAY A;  5I9P A;  1PLF A;  2ZXO A;  1G2T A;  1IXR A;  4C3I H;  2BDN A;  2K5W A;  1YNN D;  1BBU A;  5I6W A;  2JA5 H;  4RWS C;  3S1M B;  2RDF A;  3TEH B;  2R92 G;  1STE A;  3MZ5 A;  1GUN A;  1QOH A;  1M1K C;  4JI5 L;  4DR4 Q;  3MEH A;  3ER0 A;  4A3M H;  2PQE A;  4L63 B;  1XPU A;  4K2L A;  2IHF A;  2KBN A;  3TP6 A;  5M3M B;  2EY5 A;  2MHV A;  2WFW A;  3CD6 A;  3NXW A;  4HIO A;  3I90 A;  3DHQ A;  4PZ8 A;  4C1N K;  5AJ3 Q;  1RJT A;  1UEB A;  1PZK D;  4K5V A;  2F0G A;  5KEE A;  2Q8R E;  3S1M H;  5KNB A;  1EYC A;  4F87 A;  1RIP A;  5M3F G;  4GKJ Q;  1STG A;  5FK9 C;  3TP5 A;  2WB1 E;  4LFA L;  3MXU A;  1MHW C;  3Q24 A;  1B1Z A;  2DGY A;  4HJ5 A;  1HZA A;  3H3V I;  4KKT A;  3E9I A;  3ZJY C;  1SYB A;  5M3M H;  2O5I C;  2EY6 A;  5EPK A;  3TQY A;  1JT8 A;  1EY0 A;  3I56 A;  3K5L A;  2HCC A;  2RSO A;  3OWE B;  1VQK A;  2AUJ D;  4A3E B;  2AHO B;  2UUA Q;  5COR A;  3DLL A;  4X6A H;  4MTN A;  2L55 A;  5C5M A;  4YCW A;  5JVG 3;  1RHP A;  1O7Y A;  1Y1W B;  3E0E A;  3ULJ A;  1SRU A;  2DN8 A;  4DUZ L;  3CPF A;  1VF7 A;  4ILW A;  1J6Q A;  2QDL A;  4DN4 M;  2E2H B;  1X3F A;  1E0B A;  4ZK9 B;  3I4N B;  4G7H C;  2YYZ A;  1I4P A;  3LWU A;  3DWA A;  1Q81 C;  4I65 A;  4GZY C;  1GUW A;  3QIA A;  1FVI A;  1XTC D;  3R2T A;  1S5C D;  2BA0 A;  3RD4 A;  2N88 A;  4A3E H;  2AUK A;  3LX0 A;  2K04 A;  4UDU C;  2Z8L A;  1WTX A;  1S72 A;  2NVQ H;  2Q2U A;  2CH4 A;  2VY3 A;  5JJZ A;  2B29 A;  4OO1 H;  1VQG A;  3NEL A;  4NDX A;  4KKS A;  1PVO A;  4JCV E;  2VS1 A;  2DY7 A;  2MPM A;  3I4N H;  1ZKO A;  2YU9 H;  1TWH H;  2B8F A;  4DV1 L;  2D0O A;  1I5F A;  3PF4 A;  1EWI A;  5C4Z A;  4NXM L;  2CVR A;  4KKU A;  1BF4 A;  4RGN A;  5DAU A;  5FLX E;  4B3S L;  4BY1 B;  3DM1 A;  1T9H A;  2F0N A;  2KEN A;  3URY A;  4ZKB B;  4H0L C;  1G2S A;  3VA7 A;  2YTX A;  1A3T A;  3X3M A;  4QL5 A;  1C8C A;  1BBW A;  1L1O A;  2PNH A;  4B3T Q;  2F0V A;  3G71 A;  2H5X A;  4DNR B;  2NZO A;  3S14 B;  1U4M A;  2FHT A;  4DNT B;  3MAQ A;  2HHH L;  3R93 A;  1O7I A;  3DUZ A;  4QGU A;  2F0P A;  1TS4 A;  1C7Y A;  2JN4 A;  1S40 A;  2F3W A;  1JB3 A;  1L0X B;  1P8L A;  2IX1 A;  4FF4 A;  2IWH A;  1V1Q A;  4GLX A;  2JA7 B;  3NQT A;  1LTA D;  3UDG A;  4HN7 A;  1HNW L;  1ONL A;  4P75 A;  5K36 H;  1I3Q H;  2P5Z X;  5E3F A;  3CCR A;  3OSO A;  1HHV A;  2I5L X;  2ZJP A;  2B2Y A;  1G6Z A;  1DXM A;  1PYW D;  5BN4 A;  1PH5 A;  3HFZ B;  1I50 H;  4DR6 L;  1EUJ A;  4OX9 Q;  2UXD L;  4RG1 A;  2JA6 H;  1X32 A;  1MJC A;  4HSP A;  2I5M X;  4ZUJ A;  3JAM i;  3FRP B;  2JA7 H;  1JC7 A;  1Q8K A;  1R9T B;  1ILP A;  3OYY A;  3OW2 A;  4FXG C;  1JCK B;  1ZYR C;  5ELF A;  3I3C A;  1A15 A;  4JBJ A;  3GTL B;  4P71 A;  4DKA C;  1W6J A;  2K7V A;  4JOI A;  1FD7 D;  4RCN A;  2K32 A;  2NN6 G;  2AQ1 B;  3J7Z C;  1CM9 A;  1WFQ A;  1SYC A;  3E9H A;  4KJO A;  3VR4 A;  4DXF A;  2VQE L;  3E3X A;  4O42 A;  2K6A A;  3J81 E;  4DR5 L;  3PIO 3;  3ND9 A;  4QB4 A;  2F0L A;  1KHI A;  2SNS A;  5C3E H;  2E76 C;  2VB2 X;  4KN4 C;  1SN8 A;  1B9M A;  3UDF A;  1R9T H;  4J6H A;  3SE0 A;  4DPG A;  3FVQ A;  2RF4 A;  3HKZ B;  3TSS A;  3GTL H;  5LMU Q;  4LUV A;  1IKL A;  2MNA A;  1EQQ A;  1FYC A;  4XQJ A;  1V1P B;  1G91 A;  2RHQ B;  2AKW B;  2B2W A;  5FJ8 H;  3EJI A;  2DY8 A;  4IZ8 A;  3K0Y A;  1BVS A;  3W3A A;  3F2C A;  3CCU A;  1H9S A;  5IT9 L;  2SOB A;  3CMA A;  1T5X D;  2LXJ A;  4BBS G;  4CKB A;  1CK1 A;  5HUR A;  1SEB D;  1PH1 A;  1QNU A;  1VQL A;  4R4O A;  3NHH A;  1GKH A;  2L4N A;  3RZD H;  1G29 1;  3KBX A;  4JI0 L;  2HD3 A;  4K2K A;  1F77 A;  2PNR C;  1ASZ A;  2M00 A;  2SDF A;  5JEA J;  3BDC A;  1D6E C;  3GP7 A;  5I4D A;  2OEO A;  1WTW A;  1HXY D;  3J81 j;  4MTK A;  3MTS A;  4XXE A;  4X65 L;  3DMU A;  1R4Q B;  1QVC A;  4V0B A;  2PI2 A;  4TVA B;  1J5E L;  3C1E A;  1EQR A;  2WP8 J;  3STB D;  2F0W A;  3TN2 A;  1HNX L;  1PDQ A;  3M85 A;  1GD7 A;  2A6E C;  3T1H L;  2EPB A;  1I4H A;  2B39 A;  1M90 C;  4IFD H;  2MO1 A;  2JEB I;  3NEN A;  4A3G G;  2RCF A;  2XTI A;  1IL2 A;  2HQL A;  3HOW G;  5CBE E;  3K6O A;  5IOC A;  3E0J A;  1B8A A;  3AU7 A;  1SMY D;  1ENF A;  4LF7 L;  2VUM B;  2DNC A;  1VQD A;  2PCF B;  3LNN A;  1IBL L;  3GTM B;  5CMD A;  1D1I A;  3CC7 A;  3GTK B;  1YNJ D;  3RLN A;  2K5D A;  4X62 L;  2K5H A;  1JJC B;  3GTJ B;  1AN8 A;  2EOT A;  3L7Z C;  5CV9 A;  1JQY D;  1WOC A;  3CW2 C;  2WKD A;  2WAQ E;  4B9W A;  4GNX C;  1JB7 A;  5DM7 3;  4P74 A;  4KI0 A;  3GTO H;  4DV2 Q;  1TWG B;  4DR1 L;  1W6K A;  4XT3 B;  2Z1C A;  1GM5 A;  3KF8 A;  2VUM H;  3F2D A;  1Y8P B;  2A73 B;  1X9N A;  1GUT A;  4NP5 A;  3GTK H;  1G51 A;  2B63 B;  1JWM D;  4CKE A;  3CPW A;  1WTH A;  3MEF A;  3VYU A;  3PO3 B;  4C3H B;  3NBH B;  3GTJ H;  3G6J B;  3T1Y L;  2F0D A;  4LFC L;  2IX0 A;  1HFG A;  4BA2 I;  1TVX A;  2DNE A;  4JW0 A;  2OTL A;  1JIC A;  2ATW A;  3RMH A;  4ABN A;  1E2W A;  3A5U A;  4JI3 Q;  4GS3 A;  5C3W A;  3HRZ C;  3ERQ A;  3KBG A;  3DEP A;  1DOK A;  2NN6 I;  3OTO L;  2B63 H;  1CZG A;  4A3K G;  3PO2 H;  3PO3 H;  5EGT A;  2XN9 C;  4C3H H;  1SYG A;  3A8I E;  1KC8 C;  1PH4 A;  4A3F G;  4QY7 A;  1CFM A;  1VQ4 A;  2F0T A;  4GNX B;  1EY7 A;  4Z9C B;  4JV5 L;  4ZUI A;  2N8N A;  1WTQ A;  4LF5 L;  3I4M G;  4A3L G;  3IRB A;  3KF6 B;  4JVZ A;  3VR6 A;  1HQR D;  5C44 G;  4RGM A;  1WD0 A;  5E1F A;  4C3I G;  2LFN A;  4S3S A;  2PMZ B;  3MHB A;  2K28 A;  4LF6 Q;  3CCJ A;  3M7N A;  4EQ5 A;  4BY7 H;  4POG A;  5E4X A;  1KRS A;  4LWC A;  5T1I A;  3NWT A;  4WFN 3;  1VQ5 A;  4HAE A;  2PO4 A;  2CQA A;  3NSW A;  2XIW A;  3N6R A;  1TWF B;  3NP8 A;  2FMC A;  1NTG A;  4MIU A;  2WB1 G;  1IYV A;  1XMO Q;  4FXK C;  3NTI A;  1IBK Q;  5IIF A;  3S9W A;  4HMI A;  1MI2 A;  2JEA I;  1KAA A;  1TWC B;  4KHP L;  2KHJ A;  4CKC A;  1V8Q A;  4FP5 D;  1EIG A;  3FDT A;  1EU4 A;  2L12 A;  1X54 A;  2Q2T A;  3C46 A;  3BVZ A;  1OXS C;  1JE5 A;  3RR5 A;  4BBS H;  1LTT D;  2X6L A;  4ZYS A;  3FMC A;  1VQM A;  1TWF H;  5JPM C;  4KD4 A;  3L3O C;  3J80 c;  1PTO C;  4JI7 Q;  4R4C A;  3T13 A;  5M3M G;  1XX8 A;  3K8A A;  4XQQ A;  2EYH A;  1J8I A;  1Q82 C;  3I55 A;  3NBI A;  4F8M A;  1N32 Q;  2PZW A;  3BZK A;  2PMZ E;  3A0J A;  3GDE A;  4F7X A;  1I6H B;  5DEH A;  1FJG L;  1BCP D;  1NMG A;  3BDO A;  1C48 A;  2NVY H;  4J15 A;  1ENC A;  1LT5 D;  2JE6 I;  1LV9 A;  1X55 A;  2BE5 D;  2CQO A;  5J3B A;  1O7L A;  4Y52 H;  2CW0 D;  3A8J E;  1XWE A;  4PMW A;  3SDZ A;  1U4L A;  4HED A;  2A1A A;  2F4V L;  4IUT A;  3S15 B;  1IYU A;  3ERS X;  2BDO A;  4IUN A;  4DR7 Q;  5DLQ E;  1PV4 A;  1I6H H;  1HA6 A;  2UUB L;  1YBY A;  4FYD A;  3BZC A;  4YCU A;  4GKK L;  1DD2 A;  3S1Q B;  5IGB A;  4A3E G;  1VQE A;  1SFO B;  4M8A A;  2AQ3 B;  2QDB A;  1SE2 A;  1JOO A;  4HJ8 A;  1PTO B;  1WI5 A;  2D62 A;  3DXJ C;  4EQP A;  3RLO A;  3SVM A;  2A8V A;  3KFU A;  3T56 B;  1KDC A;  4EX5 A;  3I4N G;  4POF A;  2B2U A;  5NUC A;  3PSI A;  4OWX B;  3RN2 A;  1UE1 A;  2G9H D;  2KCN A;  4QUC A;  5LMN L;  4BBR B;  1ET9 A;  3S1Q H;  1MSG A;  2N3S A;  4DUY L;  3SK4 A;  1SFO H;  1STN A;  1K83 B;  2F4I A;  2JQO A;  3PUV A;  4QMG A;  3UDX A;  3VR3 A;  2J7Z A;  4OEL B;  1PTO H;  3PF5 A;  4B3R Q;  4EVO A;  1A3U A;  1RTN A;  5C0X J;  2XVS A;  4K5X A;  1PTO F;  4OON A;  4ODG A;  3P1H A;  3QG1 A;  3G48 A;  2M2L A;  1Y69 U;  2F03 A;  2B8G A;  2R6G A;  1GUS A;  4RGT A;  5CGK A;  1SND A;  1K8G A;  2HUG A;  2E5L Q;  1VQH A;  4XQN A;  2WIN B;  3P20 A;  4V19 0;  2ZM6 L;  2YTV A;  1XNQ L;  4GN3 B;  1BQQ T;  3CP0 A;  3I8Z A;  2UU9 Q;  5C4H A;  1BO0 A;  4NXM Q;  2KA7 A;  3KUP A;  3MXN A;  1K83 H;  3KLS X;  1HR0 Q;  2AWN A;  3TZU A;  1AW7 A;  4RH6 A;  5T1G A;  4B3S Q;  4FVM A;  2KUM A;  3BG3 A;  3PUY A;  1GUG A;  4O1N A;  4LUZ A;  3STB C;  2XGT A;  1SLJ A;  2VZA A;  1LT6 D;  1IBM L;  4PZ6 A;  1YHA A;  5K36 G;  1L2F A;  3TS0 A;  4A3F H;  2RDH A;  1C4Q A;  1MIU A;  3PIP A;  4CJ0 B;  1JJG A;  5C4J H;  1RTO A;  4LFB L;  3H91 A;  3AQQ A;  4HID A;  3C3L A;  1GUO A;  1DCZ A;  1KNE A;  1SSO A;  4JI6 Q;  5BN5 A;  2V4D A;  4OWW B;  1TXY A;  4IPH A;  4N8F A;  1EYA A;  2PQA B;  2JA6 G;  5GAE C;  1SMY C;  2NVX B;  5ELO A;  1PH6 A;  5C44 H;  4DXG A;  3PUZ A;  1BDO A;  2JA7 G;  3K7U C;  2OQ0 A;  1TS3 A;  4FF3 A;  1YNJ C;  2A68 D;  3F2B A;  3WOE A;  1HNW Q;  2R93 B;  2F0F A;  2Z6K C;  5EBD A;  4JG2 A;  1JOQ A;  1F2Y A;  3KJO A;  5M5X H;  1EY5 A;  1PRT F;  2K01 A;  2R7F A;  1GHJ A;  4DR6 Q;  1R4P B;  1AZP A;  1Q3L A;  2UXD Q;  1F9Q A;  1BNZ A;  2PYK A;  1V9P A;  5LL6 S;  5C3E G;  3ZYY X;  1A0I A;  4DK3 C;  2K14 A;  5TSS A;  2R93 H;  5CC4 A;  2ENB A;  1AEX A;  1WVL A;  4BA1 I;  2E8G A;  3GTG B;  1SE4 A;  3PV0 A;  3QJY A;  1N33 L;  4A3C H;  3EN2 A;  1SJE D;  5FJ8 G;  2A69 D;  2IX3 A;  4DV5 Q;  1VQP A;  4QJF A;  4UP8 A;  1DZ1 A;  3HGB A;  4ZRZ A;  4DAY B;  2JK8 A;  5G3L D;  1RF2 D;  1ZEQ X;  3TZD A;  3HP3 A;  2EXZ A;  1Z47 A;  5JJI A;  4P73 A;  3HKZ G;  5EBC A;  2JYO A;  2TMP A;  3BS1 A;  4DR2 Q;  4OO1 I;  1X3E A;  4OIK A;  3ULP A;  2Z4I A;  1B53 A;  3TS2 A;  1U0L A;  4DR3 Q;  1HFN A;  1Q1B A;  4LNQ A;  4DAV A;  2KHI A;  4KK7 A;  5GAG C;  2C5C A;  1EY8 A;  2KQ3 A;  1XMQ Q;  1I4X A;  3HOZ B;  1WCM B;  5FO9 B;  1XNR L;  3G4S A;  4XT1 B;  2ZXP A;  4R8N A;  3ULL A;  1IL8 A;  1WTP A;  4DFA A;  4IFD G;  1HPC A;  3OWF A;  1B3A A;  1WJJ A;  3OPO A;  3LGJ A;  5IYD H;  4AYB E;  3WWV A;  5LMN W;  1UWV A;  1VQB A;  3PQI A;  2ZXR A;  5EAY A;  1Y1W H;  1ESF A;  3GV3 A;  3CCV A;  4DK0 A;  3MC0 B;  1TQO A;  2WAC A;  2DJG C;  2E2H H;  3J81 i;  1I94 L;  4X65 Q;  1X65 A;  4UHV A;  4B3M L;  3CCM A;  1NAP A;  3HOZ H;  1LLR D;  1DOM A;  1EEF D;  5E4W C;  4J1M A;  4GN4 B;  2OTJ A;  2XWB B;  4NXN Q;  2IPK D;  2F0O A;  1V1P A;  5I9O A;  2AQ2 B;  3U9S A;  1VMC A;  2EZV A;  3S2D B;  1E24 A;  3EFX D;  1S5F D;  5EQ0 A;  3VYR A;  2X6G A;  1UNS A;  3KLR A;  2QIL A;  4OGQ C;  2A74 C;  2RSN A;  4DV3 L;  2XWJ B;  1N34 Q;  4UAI A;  1YHB A;  1TY2 A;  5JOB A;  1FNW A;  2LKV A;  4IPG A;  1OXV A;  1Y8N B;  3DEO A;  2VUM G;  2B2T C;  3NUC A;  4A3B B;  4LF7 Q;  1SRO A;  1S5B D;  3S17 B;  1U4R A;  4DK1 A;  1JWS D;  3VYT A;  1M8A A;  4FO2 A;  2EXD A;  1PH7 A;  2OCE A;  4BY1 H;  3F8T A;  3G6E A;  5GQO A;  3M7G A;  4XTC S;  4X64 L;  4L5T A;  1XYI A;  3GD7 A;  3QWN A;  3HOY B;  2BE5 C;  4YHH Q;  3OMG A;  4JI4 Q;  4Q5V A;  2UUC L;  1JOK A;  3VA5 A;  4MZ9 A;  1NR2 A;  1VQI A;  1TS2 A;  3S14 H;  4A3B H;  1QNK A;  2RBM A;  3S17 H;  3CCS A;  3OIQ A;  2Q2H A;  2B63 G;  3U4V A;  2RHS B;  1SE8 A;  1V1O A;  2Z9H A;  4R1J A;  3PO2 G;  3PO3 G;  4C3H G;  4P72 A;  2CKZ B;  3KDF A;  2K1B A;  2QF7 A;  1UUP A;  2ID0 A;  5COY A;  2NZ1 D;  2F0I A;  3L2P A;  4LFC Q;  2VQF Q;  3NK9 A;  4PQX A;  5KYI A;  5EKK A;  4DR4 L;  3CCQ A;  4LW1 A;  4IPC A;  1NR4 A;  3M4Y A;  1EY6 A;  3Q23 A;  4HSV A;  2CWP A;  1EIF A;  2K75 A;  3OTO Q;  1S5E D;  1YNX A;  2LS0 1;  3KOJ A;  2I0Q A;  4OIJ A;  1Q12 A;  3V2T A;  1UE6 A;  3P7J A;  4BY7 G;  1TS5 A;  1CT1 D;  1HUM A;  1ML0 D;  2KVM A;  1ROD A;  1QJO A;  4C3J B;  3EA6 A;  1QUQ B;  1D8L A;  3HOV B;  2Y0S B;  1SNC A;  4FF2 A;  4GKJ L;  4AIM A;  5EKI A;  3NBH A;  2VXW A;  3N52 A;  3J80 E;  1W3S A;  1KTK A;  3UE0 A;  2LSS A;  1RCV D;  1ICW A;  2HIV A;  2WII B;  4JI1 Q;  4A3I B;  4JV5 Q;  1GO3 E;  3D3R A;  3I70 A;  1EQT A;  1V43 A;  3OIP A;  1PH2 A;  1QVG A;  2RCN A;  1B9N A;  3I72 A;  3K5O A;  1CTM A;  3RNU A;  3AMU A;  1ET6 A;  1QZH A;  1O80 A;  1Y1V B;  3J7A V;  3HOV H;  1I6V C;  4G7Z C;  5C4X B;  3BYY B;  4IUQ A;  4IFD I;  2EQS A;  4OL7 A;  1EZ8 A;  2NUC A;  2PZU A;  3FP9 A;  3BYT B;  4OHJ A;  4AH6 A;  2B2Y C;  2F3V A;  1XTD A;  3TRZ A;  1DGS A;  2WAQ B;  4WJ4 A;  1X3P A;  2EY2 A;  3NTK A;  1UE7 A;  3GTQ B;  2A6H D;  3D4R A;  4JPB W;  2H4O A;  5CV7 A;  4PG3 A;  1Y1V H;  2Y0S E;  4TRD A;  2ZJQ A;  4LF8 Q;  5C4X H;  3A5Z B;  4KTA A;  1CKN A;  2QEX A;  1NY4 A;  2FFK B;  1H9M A;  3NE5 B;  1YNN C;  4LAA A;  3I73 A;  3M4O B;  1X6O A;  1K28 A;  3V05 A;  3F2U A;  5JEA H;  2HIX A;  5IT9 c;  1PXU A;  2F0H A;  3RZO B;  4N9T A;  3GTQ H;  2JSO A;  4PMC A;  1FJG Q;  4IUP A;  1Y14 B;  1HZC A;  2MFI A;  3PUX A;  1ILQ A;  1I4Q A;  2LY7 A;  3QR8 A;  2R7Z B;  2E2I B;  1JR0 D;  3B6Y A;  4YY3 L;  2I5H A;  3CAM A;  5ELB A;  3QOL A;  4RA8 A;  3PCO B;  1G8Z D;  5FLX L;  1ENA A;  1DJR D;  1Q7Y C;  2EY1 A;  3D4D A;  4B3T L;  3S1N B;  1NBW A;  4BXX H;  1OXU A;  1Z9F A;  3HOU B;  1PH3 A;  2KCC A;  4HTH A;  2KEC A;  1E1O A;  1VQN A;  3GTM H;  1QB5 D;  2A69 C;  2R7Z H;  1STA A;  4ULL A;  4G7O C;  1BKB A;  4HIK A;  2NVT B;  3Q22 A;  4IQZ A;  2FMM A;  1YJ9 A;  2E2J B;  2UXB L;  4OWT B;  2BCO A;  1VQF A;  3S1N H;  2EDG A;  2Z4H A;  2I07 B;  3HOU H;  4BBR G;  3M3Y B;  4H02 A;  3GTP B;  1TWG H;  5JJL A;  4YIJ A;  4OX9 L;  4NPS A;  3SR1 A;  1NCV A;  1JOR A;  4R4I A;  1LTL A;  1EEI D;  3IL8 A;  4J8Q A;  2NVT H;  4UP9 A;  1ASY A;  4JI8 Q;  3NQI A;  4ME3 A;  4EQO A;  2E2J H;  1CSP A;  1MD2 D;  5IGC A;  3PMF A;  3I91 A;  4JYA L;  3IFT A;  3K58 A;  2K5Q A;  5C6A A;  5IP9 G;  1C9O A;  3GO5 A;  4NB3 A;  3GTP H;  3VR5 A;  2RVL A;  1IW7 D;  1SYE A;  1N36 Q;  4CJ1 B;  3FEW X;  3FKI B;  4OEM B;  3U9O A;  4DV0 L;  1SJH D;  4H7B A;  1PYB A;  1A6X A;  3U58 A;  2ASB A;  3K59 A;  3A74 A;  4KY5 A;  5A2Q E;  4LF4 L;  3J81 L;  4CGY B;  1YIJ A;  4PMB A;  4LFB Q;  1SAP A;  5IYC H;  4X66 L;  2KEE A;  5LMU L;  3I4L A;  2B3G A;  3J80 L;  2OWO A;  3PUW A;  4LF9 Q;  3LWE A;  4A3D B;  2Q2I A;  2EYF A;  1MSH A;  1OXX K;  2EJF C;  4R9W A;  4PZ7 A;  5C5L A;  4IN3 A;  4IO9 A;  1VCI A;  2ES2 A;  3H0G B;  1RKN A;  1LYL A;  1UEA B;  1HNZ L;  3KJP A;  2R93 G;  3G7L A;  2V1C C;  1WD1 A;  3R2I A;  1D5M C;  1GOZ A;  4IJL A;  4NMZ A;  3D31 A;  4XIG S;  1F2Z A;  1AE3 A;  4XDX A;  4A3C G;  3HEJ A;  3EBE A;  5F2D A;  4JI5 Q;  4DK6 C;  4IJH A;  1TWC H;  4JBW A;  1AE2 A;  2EYP A;  2MUY A;  3A55 A;  3K7A B;  1N8R C;  2GVA A;  2IW3 A;  2PQA A;  1SYD A;  3O13 A;  4YWL A;  3I2Z A;  2PI2 E;  4IUR A;  4ZLT F;  3T53 B;  2QGQ A;  5AFW A;  3TBI B;  3VR2 A;  4LFA Q;  1SNP A;  1B3Q A;  1PMR A;  1BUV T;  5K5P A;  1CA6 A;  4U68 A;  3S16 B;  1XPO A;  1MKH A;  3K7A H;  4F88 A;  1MGS A;  3E5S A;  2Q8I B;  2OXP A;  2QKI C;  1JWU D;  2HT1 A;  5IYD G;  4N9P A;  3L9A X;  1LAB A;  1U4P A;  5LHY 1;  4DV7 L;  1S5D D;  2OQK A;  2J0T D;  4DV6 L;  4X3K A;  1VQA A;  3ONA B;  1Y1W G;  5CBA E;  3W1B A;  2J4X A;  4R8I A;  1QZG A;  4C2M B;  5GAH C;  4DUZ Q;  2B2V C;  3X3N A;  4DV2 L;  2EIF A;  4X3S A;  3S15 H;  1QE6 A;  1EU3 A;  2RQX A;  1EOT A;  4K8J A;  1KLG D;  1WCM G;  3HOZ G;  4GOP C;  3S16 H;  1A63 A;  1PFS A;  4ID6 A;  3OHX C;  3PGZ A;  1A62 A;  1VQO A;  1XNR Q;  3MA2 B;  5ISR A;  2BA1 A;  3I4O A;  1O78 A;  4DAY A;  3ERO A;  5I2Y A;  1IHZ A;  4FF1 A;  1E1T A;  1KNA A;  4C2M H;  1DM0 B;  2EJG C;  2Z6K A;  4A76 A;  5JPN C;  3CME A;  3PIO A;  3AFP A;  3JAM c;  5IE8 A;  1EFW A;  3IKJ A;  1ICF B;  4JI3 L;  3FPU B;  4KY6 A;  1I94 Q;  1HQM C;  2G9D A;  2EYL A;  4DV1 Q;  5E7N A;  5BN3 A;  4BBR H;  4IOC A;  2VW9 A;  2I46 A;  1H9J A;  3HS0 C;  4BY1 G;  1HTL D;  1PFN A;  2R7D A;  3F1Z A;  2RA4 A;  1IKM A;  4G57 A;  4NW2 A;  4KHV A;  2R61 A;  1NJI C;  1VQ9 A;  1EWC A;  3GQB A;  5BR8 L;  4LJZ C;  4A3J B;  2SNM A;  1CZW A;  4JK1 C;  3R8B A;  4K6L A;  5JAV A;  4Y7N B;  2C9O A;  4K6D A;  3T16 A;  5IOD A;  4A3B G;  5JJK A;  5C0X H;  4GOP B;  5IP9 H;  3MXP A;  3WOF A;  2HHH Q;  4G4K A;  3AYH B;  1PH8 A;  3KLS A;  4RGO S;  1U5K A;  2YV5 A;  3DWP A;  4LF6 L;  3E6Z X;  1D7Q A;  2IL8 A;  2FIN B;  3BDL A;  3HOY G;  2PZT A;  5ELE A;  1EYD A;  2C35 B;  2JP1 A;  4B9X A;  4A3J H;  2JA5 B;  3NTH A;  3CU7 A;  1OTC A;  1HRJ A;  2KHS A;  2B2U C;  2BOS A;  5A2Q L;  4WOR A;  1BR9 A;  1II3 A;  2DUD A;  2UUC Q;  3FPP A;  2ICE C;  4QF4 A;  4A3M B;  1FNV A;  1SDF A;  4R4Q A;  2AMC B;  3H3V C;  4DGZ A;  1QIL A;  2MGS A;  4K0K L;  4X3T A;  3A54 A;  3H6M A;  2NVX H;  3KYH C;  2NWG A;  3TRE A;  3AEV A;  2MJ8 A;  2QCP X;  3CC4 A;  1QVF A;  1K8M A;  2K4K A;  2O5J C;  4ZCK A;  3V96 A;  3W2D A;  4JI7 L;  2K50 A;  4L5R C;  2N78 A;  4AYB B;  5IWA L;  5EPJ A;  1KAB A;  4RHR A;  1N32 L;  1YI2 A;  5IP7 H;  4R4T A;  1N9W A;  4LK1 C;  1HJP A;  1IYJ B;  2CWA A;  1KIX A;  2JA8 B;  1TII D;  3W5O A;  3CCE A;  2H1E A;  2EVB A;  3T51 B;  2VQE Q;  1MBY A;  4HIM A;  4A93 B;  4QQB X;  1AH9 A;  2N49 A;  2OT2 A;  4CHT B;  3CC2 A;  3HKS A;  4NKL A;  4C3J G;  4DR5 Q;  5GRO A;  3HOV G;  3CCL A;  2F1M A;  3SGI A;  2Y0S G;  1XJV A;  5IYB G;  4L6T B;  3L0O A;  2VB3 X;  3VYS A;  2F0E A;  1YHQ A;  2HDM A;  4A3I G;  3SK5 A;  1SNQ A;  2OF1 A;  2NB0 A;  5HGT A;  4DA2 A;  3GTG H;  2GVB A;  1PFM A;  2CH4 W;  4DR7 L;  1K3R A;  1ZXT A;  5IT9 E;  4MHE A;  2B2T A;  5M5Y B;  2JA8 H;  1T5E A;  1Z6H A;  1IW7 C;  2F3I A;  5D3D A;  3T4A C;  4A93 H;  1Y1V G;  1B4O A;  4CDC C;  1TU2 B;  2K05 A;  2WV6 D;  5C4X G;  2NVQ B;  1PH9 A;  1QG7 A;  4JI2 L;  3VDY A;  4JI0 Q;  2ZTE A;  1K0R A;  4KD3 A;  1W2B A;  3U50 C;  1QUQ A;  5H1S E;  4L5S A;  3ND8 A;  5CV6 A;  2CCZ A;  2WAQ G;  1FR3 A;  5JEA G;  5CV4 A;  1QWY A;  2NTT A;  3CKI B;  3H3V H;  3MXN B;  2YU9 B;  1TWH B;  2VL6 A;  3UDI A;  1QCB D;  5M5Y H;  1GJX A;  4HJA A; 
#chains in the Genus database with same CATH homology
 1WCM H;  3FP9 A;  1MJE A;  4DV3 Q;  1J5E Q;  2ZTC A;  4RMF A;  3J80 i;  1VQ6 A;  1HNX Q;  2UXC Q;  4AH6 A;  1CKO A;  4LF6 Q;  1XTD A;  4A75 A;  3TRZ A;  3CCJ A;  1DGS A;  3T1H Q;  3M7N A;  4EQ5 A;  4BY7 H;  1N36 L;  4POG A;  1KRS A;  3DM3 A;  4LWC A;  1VQ5 A;  4B3R L;  4WJ4 A;  1UE7 A;  5FLM H;  3K0X A;  1NTG A;  4BXX G;  2WB1 G;  4AQY Q;  1XMO Q;  4PG3 A;  1XPR A;  1Y1V H;  4A3K H;  2UXC L;  2E5L L;  1IBK Q;  2Y0S E;  2ZJQ A;  4LF8 Q;  1IZ6 A;  2JEA I;  1UE5 A;  5C4X H;  1KD1 C;  2UU9 L;  4X64 Q;  3A5Z B;  3UE1 A;  1CKN A;  2QEX A;  1NY4 A;  4KHP L;  2KHJ A;  1HZ9 A;  1OXT A;  1SR3 A;  3M9B A;  2R7Z G;  1HR0 L;  1IBL Q;  2K52 A;  4Y7N H;  1NE3 A;  4GLV B;  4DV4 Q;  4LF9 L;  1X54 A;  4AQY L;  1XMO L;  1HZB A;  2Q2T A;  1X6O A;  4MNO A;  4YY3 Q;  1OXS C;  1IBK L;  1JE5 A;  3RR5 A;  3S2D H;  4X62 Q;  2HIX A;  5IT9 c;  4BBS H;  3I4M H;  4UPA A;  5ELN A;  3GTQ H;  4A3L H;  1VQM A;  1TWF H;  2JA9 A;  3J80 c;  3HOX G;  4JI7 Q;  1FJG Q;  4DAM A;  3HOU G;  1Y14 B;  1YIT A;  3KLW A;  1HZC A;  1IXR A;  2MFI A;  3PUX A;  4DV4 L;  4C3I H;  4R4C A;  2MQH A;  5M3M G;  4GLA C;  3B6Y A;  4YY3 L;  2I5H A;  1BBU A;  3K8A A;  4JI6 L;  3CAM A;  1Q82 C;  3I55 A;  3PCO B;  2JA5 H;  1N32 Q;  4DR1 Q;  3BZK A;  3D0F A;  2PMZ E;  3A0J A;  3GDE A;  1Q7Y C;  3TEH B;  2R92 G;  1FJG L;  4B3T L;  1NMG A;  2NVY H;  1NBW A;  4J15 A;  1M1K C;  2JJQ A;  4JI5 L;  4DR4 Q;  4BXX H;  3ER0 A;  1OXU A;  2ZTD A;  2JE6 I;  1X55 A;  1Z9F A;  4A3M H;  4KLK A;  4OXP A;  1PH3 A;  1XPU A;  1YEZ A;  2IHF A;  2CQO A;  2UXB Q;  1E1O A;  2KBN A;  1HH2 P;  5J3B A;  4Y52 H;  3T1Y Q;  1VQN A;  4PMW A;  3HOY H;  2WFW A;  3GTM H;  3CD6 A;  2A1A A;  2F4V L;  4HIO A;  1EOV A;  2R7Z H;  4PZ8 A;  3U4Z A;  1BKB A;  4FDB A;  5AJ3 Q;  4HIK A;  3BU2 A;  1UEB A;  3ERS X;  4DR7 Q;  5DLQ E;  1PV4 A;  1YJ9 A;  1NMF A;  3S1M H;  2UXB L;  1I6H H;  2UUB L;  1YBY A;  1RIP A;  3BZC A;  4OWT B;  4YCU A;  5M3F G;  4GKK L;  3M4Q A;  1VQF A;  3S1N H;  4GKJ Q;  2WB1 E;  4LFA L;  2F52 A;  4A3E G;  1VQE A;  3HOX H;  2DGY A;  5AJ3 L;  4HJ5 A;  1HZA A;  2FXQ A;  3HOU H;  4BBR G;  3H3V I;  1N34 Q;  4H02 A;  3ZJY C;  3E9I A;  5M3M H;  2BH2 A;  1TWG H;  5JJL A;  4JYA Q;  4HJ8 A;  1WI5 A;  2D62 A;  1E22 A;  3RLO A;  3TQY A;  5IYC G;  4OX9 L;  4NPS A;  2A8V A;  4HJ9 A;  3KFU A;  1L1O C;  1JT8 A;  4R4I A;  3Q8D A;  1LTL A;  4EX5 A;  1K73 C;  2R92 H;  2NVT H;  4POF A;  2MO0 A;  4UP9 A;  3I4N G;  1ASY A;  3I56 A;  3PSI A;  2IY5 B;  4OWX B;  4JI8 Q;  3RN2 A;  1B70 B;  4ME3 A;  1UE1 A;  2E2J H;  3FKI G;  1CSP A;  4A4I A;  1VQK A;  4LF5 Q;  2AHO B;  2UUA Q;  4DV5 L;  5LMN L;  4JYA L;  3DLL A;  4X6A H;  4DV0 Q;  4MTN A;  4YCW A;  3S1Q H;  5HY6 A;  3E0E A;  2N3S A;  5IP9 G;  3ULJ A;  4DUY L;  1SRU A;  1C9O A;  4DUZ L;  1SFO H;  3CPF A;  3S2H H;  1J6Q A;  3GO5 A;  2JQO A;  3PUV A;  1X3F A;  3UDX A;  4NB3 A;  3GTP H;  2YYZ A;  1Q81 C;  2UUA L;  4LF4 Q;  3PF5 A;  4C3J H;  4B3R Q;  1N36 Q;  5C0X J;  4DR2 L;  4JBM A;  4DV0 L;  5IYB H;  4OON A;  2LXK A;  1FVI A;  1PYB A;  3G48 A;  5M3F H;  4X66 Q;  4DR3 L;  4A3D G;  2R6G A;  4A3I H;  1A8V A;  2BA0 A;  1K8G A;  3U58 A;  4KHZ A;  4A3E H;  2E5L Q;  2ASB A;  1VQH A;  4GNX A;  2NVQ H;  2ZM6 L;  2YTV A;  1S72 A;  3A74 A;  1K8A C;  4GN3 B;  4LF4 L;  3CP0 A;  2UU9 Q;  1XNQ L;  1XMQ L;  2Q2U A;  3S1R H;  3H0G G;  2VY3 A;  1YIJ A;  4NXM Q;  2B29 A;  1TWA H;  4KHP Q;  1VQG A;  3NEL A;  1K83 H;  4LFB Q;  1PVO A;  1HR0 Q;  2AWN A;  5IYC H;  4IFD J;  4JCV E;  4X66 L;  2VS1 A;  4B3S Q;  5LMU L;  2B3G A;  3KF6 A;  1EYG A;  1HNZ Q;  2OWO A;  3PUW A;  3PUY A;  4LF9 Q;  3I4N H;  4LUZ A;  3STB C;  2XGT A;  1TWH H;  2YU9 H;  4DV1 L;  1SLJ A;  2D0O A;  2Q2I A;  2VZA A;  1I5F A;  1B7Y B;  1IBM L;  3PF4 A;  1OXX K;  4PZ6 A;  1L1O B;  1EWI A;  1YHA A;  3BJU A;  1L2F A;  3TS0 A;  4PZ7 A;  4A3F H;  5K36 G;  1MIU A;  3PIP A;  4NXM L;  4IO9 A;  1JJG A;  1VCI A;  5C4J H;  4LFB L;  2ES2 A;  3AQQ A;  1KXL A;  1LYL A;  4B3S L;  4HID A;  1T9H A;  1HNZ L;  4JOI C;  2KEN A;  1VQ8 A;  3KJP A;  2R93 G;  2V1C C;  1YJN A;  2YTX A;  4JI6 Q;  4OWW B;  1LM0 A;  1TXY A;  1VQC A;  4IJL A;  4IPH A;  4QL5 A;  4NXN L;  3D31 A;  2PQA B;  3I7F A;  4XIG S;  5GAE C;  2JA6 G;  4LUO A;  1BBW A;  1AE3 A;  5ELO A;  1PH6 A;  1L1O A;  2PNH A;  5C44 H;  4A3C G;  4B3T Q;  3PUZ A;  3G71 A;  2H5X A;  2IT1 A;  3EBE A;  2JA7 G;  2NZO A;  4JI5 Q;  3HKZ E;  2OQ0 A;  3K7U C;  4IJH A;  1TWC H;  4JBW A;  1AE2 A;  4DK6 C;  2HHH L;  3F2B A;  1O7I A;  1HNW Q;  4QGU A;  1VQ7 A;  3S24 A;  1C7Y A;  2Z6K C;  1N34 L;  2VNU D;  4JG2 A;  1S40 A;  1HR0 W;  4ALP A;  1N8R C;  2F4V Q;  3KJO A;  4QIW E;  2GVA A;  1P8L A;  2PQA A;  2IX1 A;  3M4O H;  5M5X H;  3AFQ A;  3KDF B;  4YWL A;  1V1Q A;  4L5Q A;  4GLX A;  3RZO H;  3UDG A;  2R7F A;  1HNW L;  3I2Z A;  4DR6 Q;  2PI2 E;  1YJW A;  2UUB Q;  1H95 A;  4P75 A;  2UXD Q;  4GKK Q;  1FGU A;  2QGQ A;  1I3Q H;  1V9P A;  3NEM A;  5C3E G;  4LFA Q;  2E2I H;  1A0I A;  4DK3 C;  3CCR A;  4DV7 Q;  1KL9 A;  2K14 A;  1G6P A;  2I5L X;  4DV6 Q;  2ZJP A;  2A19 A;  3ICE A;  2R93 H;  1XPO A;  3RN5 A;  3HFZ B;  1PH5 A;  1MKH A;  2AWO A;  3K7A H;  4YHH L;  1I50 H;  1P16 A;  4JI4 L;  3EIV A;  1EUJ A;  4DR6 L;  3W1G A;  4BA1 I;  2E8G A;  4OX9 Q;  4RG1 A;  2UXD L;  2HT1 A;  2JA6 H;  2L15 A;  1MJC A;  2I5M X;  5IYD G;  3PV0 A;  4GN5 A;  3K81 C;  1N33 L;  4DV7 L;  4A3C H;  3JAM i;  2OQK A;  3EN2 A;  4DV6 L;  2JA7 H;  1VQA A;  5FJ8 G;  2QA4 A;  1Q8K A;  4DV5 Q;  1Y1W G;  5LMN Q;  3OYY A;  1VQP A;  4QJF A;  4UP8 A;  3OW2 A;  1PHJ A;  3W1B A;  3CF5 A;  4DAY B;  1QZG A;  5GAH C;  4JBJ A;  4DUY Q;  2JK8 A;  4DUZ Q;  1E3P A;  4P71 A;  4DKA C;  5FLX c;  4DV2 L;  1JJ2 A;  2EIF A;  3S15 H;  1Z47 A;  5JJI A;  4JOI A;  4IPD A;  3HOZ G;  2NN6 G;  3S16 H;  1WCM G;  4GOP C;  1A63 A;  4P73 A;  3HKZ G;  1PFS A;  3J7Z C;  2VQF L;  4IOA A;  3PGZ A;  1WFQ A;  3E9H A;  4UP7 A;  1A62 A;  2VQE L;  4DR2 Q;  4OO1 I;  1X3E A;  1VQO A;  5C0X G;  1XNR Q;  3ULP A;  4DR5 L;  1Q1E A;  3TS2 A;  1U0L A;  4DR3 Q;  2BA1 A;  3I4O A;  2YTY A;  4UY8 C;  3JC6 6;  1KHI A;  1X56 A;  5C3E H;  5FLM G;  1Q1B A;  1SN8 A;  3M3Y H;  1FL0 A;  4LNQ A;  1JMC A;  2KHI A;  5GAG C;  3UDF A;  1R9T H;  2ZM6 Q;  1XNQ Q;  1E1T A;  1XMQ Q;  4DPG A;  2RF4 A;  4C2M H;  1LUZ A;  2Z6K A;  2NZH A;  4A76 A;  3CME A;  1XNR L;  3GTL H;  3G4S A;  3PIO A;  3AFP A;  3JAM c;  5IE8 A;  1EFW A;  3ULL A;  4JI3 L;  1VQJ A;  5LMU Q;  4LUV A;  4A3J G;  1I94 Q;  4IFD G;  2MNA A;  1EQQ A;  1WJJ A;  5IYD H;  3LGJ A;  4AYB E;  5BR8 Q;  4DV1 Q;  5E7N A;  1IBM Q;  2RHQ B;  4BBR H;  3WWV A;  5LMN W;  2AKW B;  2VW9 A;  4IOC A;  5FJ8 H;  1UWV A;  1VQB A;  4JI1 L;  1BVS A;  1Y1W H;  5EAY A;  4BY1 G;  3F2C A;  3CCU A;  3CMA A;  2R7D A;  3F1Z A;  3CCV A;  2LXJ A;  4BBS G;  2ALY B;  2E2H H;  3J81 i;  1PH1 A;  1I94 L;  4X65 Q;  1NJI C;  1X65 A;  1VQ9 A;  1VQL A;  4R4O A;  4B3M L;  1GKH A;  1YZ6 A;  1G29 1;  5BR8 L;  3CCM A;  1VS0 A;  2KCM A;  3RZD H;  1K9M C;  1E7Z A;  4JI0 L;  3HOZ H;  2BH8 A;  3FKI H;  4GN4 B;  2OTJ A;  1ASZ A;  5JEA J;  4NXN Q;  1CKN B;  4A3B G;  5JJK A;  2JA5 G;  4GOP B;  3J81 j;  5IP9 H;  1E24 A;  4X65 L;  2Z0S A;  1GVP A;  1QVC A;  2HHH Q;  2PI2 A;  4TVA B;  3AYH B;  4DV3 L;  1PH8 A;  1J5E L;  1EQR A;  1X3G A;  5GAD C;  2WP8 J;  1U5K A;  1YHB A;  2YV5 A;  3STB D;  4A3M G;  2K5N A;  1CUK A;  1HNX L;  3J7A 5;  3M85 A;  3FHW A;  4IPG A;  4LF6 L;  1OXV A;  1GD7 A;  4O2D A;  1D7Q A;  5IP7 G;  3T1H L;  2VUM G;  3HOY G;  4A3D H;  2C35 B;  4A3J H;  1M90 C;  4LF7 Q;  1SRO A;  2MO1 A;  2JEB I;  3NEN A;  4GOP A;  1OTC A;  1RL2 A;  4K0K Q;  1N32 L;  4A3G G;  4DNI A;  2EXD A;  2DUD A;  2XTI A;  1IL2 A;  3H0G H;  1PH7 A;  2HQL A;  3J81 c;  2OCE A;  2UUC Q;  3HOW G;  5HGQ A;  4BY1 H;  3F8T A;  4JC0 A;  4LF8 L;  3G6E A;  5GQO A;  4XTC S;  4X64 L;  4L5T A;  1B8A A;  3GD7 A;  4R4Q A;  2AMC B;  4YWK A;  4LF7 L;  4AYB G;  1VQD A;  1IBL L;  4K0K L;  5M5W H;  4YHH Q;  3CC7 A;  1L0W A;  2NVX H;  4JI4 Q;  3KYH C;  3TRE A;  5IWA Q;  2UUC L;  3AEV A;  4WJ3 M;  1PYS B;  1KRT A;  3KF8 B;  3RLN A;  1SMX A;  4MZ9 A;  4X62 L;  1KAW A;  1VQI A;  2K5H A;  1JJC B;  3CC4 A;  1N33 Q;  2JA8 G;  1QVF A;  2K4K A;  3S14 H;  4A3B H;  1C0A A;  3S17 H;  3CCS A;  2Q2H A;  3L7Z C;  3U4V A;  2B63 G;  2RHS B;  4A93 G;  3CW2 C;  1SE8 A;  1WOC A;  4R1J A;  4JI7 L;  3PO3 G;  2K50 A;  3PO2 G;  4L5R C;  4P72 A;  2CKZ B;  2N78 A;  2WAQ E;  1CSQ A;  1YVC A;  3KDF A;  5IWA L;  4GNX C;  1JB7 A;  4P74 A;  4KI0 A;  3GTO H;  4DV2 Q;  2ID0 A;  3CQZ H;  1EIY B;  1YI2 A;  5IP7 H;  4R4T A;  4DR1 L;  1N9W A;  1GM5 A;  1HJP A;  3RLF A;  4APV A;  3L2P A;  3F2D A;  4LFC Q;  2VUM H;  1IYJ B;  2CWA A;  3M4P A;  2VQF Q;  1X9N A;  1KIX A;  3W5O A;  3CCE A;  3GTK H;  2VQE Q;  1G51 A;  4A3G H;  4HIM A;  4DR4 L;  2D0P A;  4QQB X;  1S3O A;  2N49 A;  3CPW A;  1AH9 A;  2KCT A;  3MEF A;  3HKS A;  3CCQ A;  4DR5 Q;  4LW1 A;  5GRO A;  3CC2 A;  3CCL A;  4IPC A;  3HOV G;  3SGI A;  2Y0S G;  1XJV A;  3HOW H;  3NBH B;  5IYB G;  2IHE A;  3L0O A;  3GTJ H;  4YWM A;  1Q86 C;  3T1Y L;  1YHQ A;  4LFC L;  4A3I G;  2IX0 A;  2CWP A;  1EIF A;  2K75 A;  3OTO Q;  1YNX A;  2I0Q A;  3KOJ A;  4BA2 I;  5IY0 A;  3GTG H;  2GVB A;  1Q12 A;  1UE6 A;  4YCV A;  2OTL A;  3K80 C;  2ATW A;  4BY7 G;  4DR7 L;  1K3R A;  3A5U A;  4JI3 Q;  4OO1 G;  4GS3 A;  5C44 G;  4JBK A;  3H15 A;  4HJ7 A;  3CXC A;  1QUQ B;  1D8L A;  4JI2 Q;  2JA8 H;  1PA6 A;  4GKJ L;  2NN6 I;  4AIM A;  2GN5 A;  3OTO L;  1W3S A;  2F3I A;  2B63 H;  3UE0 A;  4A93 H;  2LSS A;  1Y1V G;  4A3K G;  4JI1 Q;  2HIV A;  3PO2 H;  3PO3 H;  4JV5 Q;  4C3H H;  2K5V A;  1PH4 A;  1KC8 C;  1GO3 E;  5C4X G;  5C0X I;  4A3F G;  2CFM A;  4QY7 A;  1PH9 A;  1V43 A;  4B3M Q;  4JI2 L;  3VDY A;  1VQ4 A;  1QVG A;  1PH2 A;  4TQU S;  4JI0 Q;  2RCN A;  2ZTE A;  4GNX B;  1WYD A;  1K0R A;  1W2B A;  3U50 C;  1CKM A;  1QUQ A;  5H1S E;  4L5S A;  3RNU A;  4JV5 L;  2CCZ A;  4JI8 L;  2WAQ G;  1QZH A;  5JEA G;  3H3V H;  2N8N A;  3MXN B;  4LF5 L;  3I4M G;  2VL6 A;  3UDI A;  4O0A A;  5M5Y H;  3HOV H;  4A3L G;  3IRB A;  3KF6 B;  1KQS A;  4IFD I;  2EQS A;  1Q46 A;  4HJA A;  2ZJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...