4A75A

The lin28b cold shock domain in complex with hexathymidine.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
89
structure length
89
Chain Sequence
b'GSDPQVLRGSGHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYMEGFRSLKEGEPVEFTFKKSSKGFESLRVTGPGGNPCLGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIN28 COLD SHOCK DOMAIN
molecule tags Chaperone/dna
source organism Xenopus (silurana) tropicalis
publication title The Lin28 Cold-Shock Domain Remodels Pre-Let-7 Microrna.
pubmed doi rcsb
total genus 18
structure length 89
sequence length 89
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2011-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a75A00
2NZHA 3CPFA 4DUYQ 1S40A 4OO1I 3CC4A 2UXBQ 1CSQA 4L5TA 1PFSA 3FKIG 5LMUL 1K9MC 1X6OA 5FLXc 4L5QA 4JBJA 1KC8C 4X62Q 3J81j 2K5NA 3G6EA 2ZJQA 1X56A 1GD7A 3VDYA 1HZ9A 1SFOH 3AQQA 3SGIA 4HIMA 1X55A 5ELOA 4Y7NH 3D31A 4A76A 1CSPA 5FJ8H 3CQZH 2VS1A 4EQ5A 4DV7Q 2JEBI 1N9WA 2MO1A 1CKNB 4HJ5A 2AWNA 3HFZB 3U4ZA 2HHHQ 2I5HA 1HNWQ 3UE0A 4JI2L 4L5SA 1IL2A 4R4TA 4LUVA 5JEAG 3F8TA 3F2CA 4YCVA 5IP9G 1L2FA 2EIFA 1W3SA 3DM3A 3TEHB 5IWAQ 1PH5A 2JEAI 3AFQA 1VQBA 4X65L 2A8VA 1UE6A 2A1AA 2OCEA 1PH7A 3S2DH 5FLMG 5C4JH 4R4OA 4A3IG 2I5LX 1TXYA 3G4SA 3W1BA 1FJGQ 1YVCA 1PV4A 4DR3Q 5JEAJ 4YCUA 3L2PA 2UU9Q 3WWVA 4IJHA 3T1HL 4L5RC 2EQSA 3GO5A 4JBKA 1KRTA 2KBNA 4DR2Q 3A0JA 4HJ8A 3K80C 2GVBA 2IX0A 3KF6A 3CCSA 4OX9Q 3GTQH 2F3IA 1VQNA 4DV2L 3BU2A 3S1MH 2K4KA 3RLOA 4LUOA 4UP9A 3GTMH 3CW2C 1P16A 4LFAL 1BKBA 1XNQQ 4LFBQ 1Q81C 2RCNA 4DV4L 4R4CA 2CFMA 2NVQH 4HIOA 3HOUG 5FJ8G 3U4VA 5IP9H 4JYAQ 1HNZL 1QVCA 2HQLA 3J81i 2R6GA 3CMAA 1U5KA 4LF8Q 1OXXK 4DV4Q 4NXNL 4JI4L 4NB3A 1XNQL 1J5EQ 3HKSA 3CCQA 4HIDA 1Q7YC 3UDIA 1MJCA 4GNXA 2NVTH 2NN6I 1N36L 2WB1G 2E2IH 4HJ7A 2I5MX 1H95A 4JCVE 1WOCA 2RHSB 1EYGA 1QVFA 1PH3A 1YHBA 4DR7L 2HT1A 2UUCL 3CCVA 4B3SL 3HOWG 1T9HA 3CCRA 2E5LQ 4P74A 1WJJA 1N32Q 2K5VA 4IPGA 4P71A 1V43A 4A75A 4DV3Q 4C3IH 1BVSA 1VQFA 1QZHA 1SMXA 2PI2A 3EBEA 1W2BA 5H1SE 2VUMH 4BBSH 3KJPA 1UEBA 2K75A 1VQLA 3PV0A 3Q8DA 3AYHB 3STBD 4X66Q 4YHHL 2KCTA 4HJAA 1E24A 4BBRH 1N34L 1HNXQ 4BXXG 4JOIC 3ULJA 1CKMA 1CUKA 2HIVA 4FDBA 5GQOA 1AE3A 5IYBH 2C35B 3G71A 5IYBG 3GD7A 2D0OA 1XPRA 1CKNA 2OTJA 3IRBA 2UUAL 2B29A 5C3EH 1R9TH 2K5HA 4GOPA 5C44H 3S1QH 5J3BA 1WCMH 1IBML 4B3TL 3HOVH 3GTPH 4B3RL 4IFDG 3ULPA 4YCWA 5M3FH 2KCMA 2Z6KC 4LF7Q 2JA7G 2CKZB 4O2DA 1YJ9A 2QEXA 4PMWA 4DAYB 4KI0A 4X62L 1C9OA 4MTNA 1G51A 2FXQA 4A3IH 1IXRA 4DV5Q 5LMUQ 3PIOA 4IO9A 4DNIA 4AYBE 1E3PA 1ASZA 1HH2P 3S16H 3CCEA 4JI6Q 4A3LH 1KXLA 1QUQA 1VQDA 1XTDA 3EN2A 2UUBL 3ICEA 4BXXH 3T1YL 1LYLA 2LXKA 1YBYA 4GN5A 3HOZG 4GLAC 3M9BA 3M4QA 4GLXA 3RNUA 2I0QA 1YZ6A 1FL0A 2KHIA 1JB7A 5M5YH 4DR1L 3I4OA 4POFA 3T1YQ 4UY8C 1G6PA 3KDFA 1HR0L 1OXTA 1EQRA 5BR8L 1BBWA 3I4MH 4DV1Q 4DR6Q 2UXDL 3AFPA 1K83H 4NXML 1N33L 1I50H 1LTLA 2IHEA 2WAQE 3HOXH 1X65A 4A3CG 1HJPA 3I56A 2JA6H 1S3OA 2A19A 2OQ0A 5IT9c 1N8RC 4A3DG 4IPDA 1HNXL 4JG2A 4BA1I 2IY5B 2D62A 3HKZE 4X66L 3F2BA 3S1NH 1K73C 1Z47A 1XNRQ 1Q46A 3JC66 1VQIA 1VQJA 4A3JH 1Y1VG 3LGJA 1YITA 3AEVA 2UXCL 3FP9A 1B7YB 1SRUA 3TQYA 5GADC 4BY7G 1Q12A 3FKIH 4B3RQ 2K50A 5IYCG 3KJOA 1KD1C 4YY3Q 1IBMQ 4XTCS 4K0KQ 2CWAA 3RZOH 4YWLA 1Z9FA 3HOYG 3MXNB 2YU9H 2F4VQ 4AQYL 2AHOB 3CPWA 1I5FA 1A63A 4APVA 1B70B 4GS3A 4TQUS 1VQ5A 4LWCA 1NE3A 3FHWA 1PYBA 2JA9A 3K7UC 3PF4A 4A93H 1IBKQ 4OONA 4BBSG 1YIJA 4IJLA 2WP8J 2UXCQ 2DUDA 4NXNQ 4ME3A 2YTVA 2JE6I 4JI1L 4LF8L 5EAYA 2N49A 4IOAA 1HNZQ 3PO3G 3U58A 3E9HA 2AWOA 4LF4Q 3CD6A 2ZM6L 2MO0A 2K52A 5ELNA 3W5OA 2F4VL 4KHPQ 3BJUA 4LFAQ 3G48A 5BR8Q 3CXCA 1ASYA 2VNUD 1HR0Q 2R93H 1PYSB 3RR5A 3PUYA 2MQHA 1X54A 1V1QA 5LMNW 2E2JH 4B3ML 1SE8A 2JK8A 3CP0A 1XNRL 4A3GG 2AKWB 4DR3L 5AJ3Q 1IYJB 1FJGL 1Q8KA 1K8AC 2BA1A 4PZ8A 1QVGA 1OXVA 1IBLL 4JI3L 4GNXC 1TWGH 2ES2A 4X6AH 4C3HH 3OTOL 2JJQA 4UPAA 4J15A 1VQEA 1NBWA 4LF5L 2F52A 3K7AH 4GN4B 2R92G 1B8AA 2KENA 1D7QA 1XJVA 1UWVA 3NEMA 3M3YH 4JI2Q 1LUZA 1KIXA 4RG1A 4OWXB 1P8LA 1UE5A 5M3MG 1KRSA 3UE1A 3K0XA 1XMQL 3K8AA 2UUAQ 3CCJA 2WFWA 5M3FG 3KFUA 1VQOA 2KHJA 2YV5A 1A8VA 1NMGA 2JA8H 3H3VI 1L1OA 2BH8A 4QGUA 1X3GA 3MEFA 3KLWA 3W1GA 5IP7H 4A3MG 1QZGA 4JC0A 4BY1G 3S17H 2WB1E 2VUMG 1Q82C 5E7NA 2YTYA 4BY1H 4POGA 1PH8A 3J80i 1VS0A 2H5XA 1KQSA 2VQEL 2HHHL 4DV3L 3A74A 4QIWE 1C0AA 4GKKL 2YTXA 2N8NA 1VQPA 2Q2HA 4MNOA 4QY7A 4DV7L 1VQKA 3I55A 3CC7A 2ZJPA 1XMQQ 3B6YA 2E5LL 2Q2TA 3HOZH 5JJIA 3PCOB 4A3EG 2ZTCA 2EXDA 4LF9Q 1X3EA 3S2HH 4A3LG 4JOIA 5M3MH 2VW9A 1YHQA 4JI5Q 1HNWL 3H3VH 2Z0SA 1RL2A 2R92H 3PO3H 1M90C 3I4MG 2IT1A 3ERSX 4XIGS 1SN8A 1NY4A 1NJIC 1RIPA 5FLMH 1VQMA 1J5EL 1K8GA 4JI3Q 1YEZA 1WCMG 4NPSA 2ASBA 4DPGA 3J7A5 3NBHB 5JJKA 3S15H 1KL9A 4JI7Q 3A5UA 3KF6B 1GM5A 2UUCQ 1JJCB 3HOUH 4DR7Q 5K36G 2MNAA 1BBUA 1IZ6A 1M1KC 3HOYH 2QGQA 3M4PA 1EUJA 3CMEA 4DV2Q 2NVXH 2N3SA 4OX9L 1NMFA 3J80c 3OW2A 1GVPA 3J81c 1UE7A 1PH4A 1Y1WG 2R7FA 4H02A 5GAGC 4A3FG 4JI4Q 4LF6L 1CKOA 5IY0A 1PH9A 1HR0W 4OO1G 4X64L 4DV0Q 1E22A 2LXJA 3F1ZA 4GKJL 2NN6G 4JYAL 4AIMA 4A3DH 2E8GA 1PVOA 3PSIA 3TS0A 4R4IA 1DGSA 1HZCA 4WJ3M 2Y0SG 4B3MQ 4YWMA 1VQ9A 2OQKA 3CAMA 4X65Q 3STBC 4A93G 3U50C 5C4XH 4A3FH 1YHAA 1YJWA 5GAHC 4UP7A 3CCMA 1J6QA 2JQOA 1XMOQ 2DGYA 2B3GA 2V1CC 4P73A 3RN2A 4IFDJ 4C3JH 3ER0A 3UDXA 4JI5L 1WI5A 4KHPL 1MIUA 3T1HQ 1KHIA 2ZM6Q 2Z6KA 1D8LA 4LF4L 4AH6A 4PZ7A 2QA4A 5M5XH 3CC2A 2PQAB 1WYDA 1VQAA 3TREA 1Q1BA 1EQQA 2ZTEA 1EFWA 3ZJYC 2R93G 1TWFH 4RMFA 5IWAL 4WJ4A 5M5WH 2LSSA 5LMNL 4LW1A 1JJ2A 3S24A 1TWCH 4LFCQ 2R7ZH 4GOPB 3CCUA 1JMCA 3PUZA 1VQ8A 1E7ZA 3KOJA 3PUWA 3CCLA 3EIVA 2UXBL 1OXSC 2R7DA 4DV1L 3GTKH 4DUYL 3S14H 4DR6L 2GN5A 3ULLA 5C3EG 4IPHA 2ATWA 4DV6Q 4GKKQ 4JV5L 4DUZL 2VQEQ 4IOCA 3NELA 4C2MH 2PMZE 4JBWA 4KLKA 4JI8Q 4A3KG 1PH6A 4GN3B 3OYYA 4LNQA 4OWWB 5JJLA 1JE5A 4HJ9A 3PUVA 1Y14B 4A3MH 1PH1A 2UUBQ 5C0XG 3OTOQ 2JA8G 5IYDH 2B63H 1HZAA 5IP7G 1EIFA 4PZ6A 4DKAC 4DV5L 1XPUA 4BY7H 1K3RA 2N78A 4MZ9A 5HY6A 5IYCH 3H0GH 4QL5A 5AJ3L 1X3FA 2PNHA 2JA5H 4EX5A 4PG3A 3L7ZC 1PA6A 4QJFA 3H0GG 2ZJRA 1LM0A 2R7ZG 4JBMA 3E9IA 3GTLH 1I94Q 4DR1Q 4GLVB 4UP8A 4JI8L 1AE2A 2K14A 2BA0A 3K81C 4TVAB 3RZDH 3KF8B 4O0AA 4DR5Q 4JV5Q 4B3TQ 3JAMi 3L0OA 2WAQG 5IE8A 3PUXA 4LF5Q 4DAMA 2VQFL 2JA5G 4JI0Q 3E0EA 4ALPA 1IBLQ 1TWHH 1VQGA 3I2ZA 3HKZG 4DR4Q 4IFDI 3HOXG 3RLNA 1E1TA 3RN5A 2MFIA 2XGTA 4LF9L 4LFCL 3GTOH 2AMCB 2ID0A 1K0RA 1A0IA 1FGUA 4LF7L 4A3GH 1OXUA 2HIXA 4A3KH 4A3JG 3GTGH 2ALYB 2RF4A 4IPCA 5GROA 4DUZQ 3S1RH 1OTCA 1SROA 5HGQA 4DV6L 1YJNA 2Q2UA 4R1JA 4AYBG 3PF5A 2VZAA 4KHZA 1VQCA 2PI2E 4AQYQ 3I7FA 1PH2A 2PQAA 3JAMc 1Y1VH 1HZBA 1I3QH 2Q2IA 4A3EH 1GO3E 2B63G 1VQHA 3D0FA 4YHHQ 1E1OA 2ZTDA 3J7ZC 1N34Q 1EIYB 3TS2A 2IHFA 1YNXA 4JI1Q 1L1OC 4A3BG 1EWIA 2GVAA 5C0XI 5LMNQ 1N36Q 4A3CH 2JA6G 4P75A 3BZKA 1X9NA 1IBKL 5C44G 2OWOA 4QQBX 4YWKA 2RHQB 1V9PA 3BZCA 3H15A 1Q1EA 2D0PA 3I4NG 3UDFA 4GKJQ 1N32L 3I4NH 4DV0L 4X64Q 4B3SQ 4DR4L 1YI2A 1SR3A 2Y0SE 1WFQA 2IX1A 1AH9A 1N33Q 1QUQB 3M4OH 2JA7H 1VCIA 4BA2I 2VY3A 2VQFQ 1PHJA 1O7IA 1U0LA 2CWPA 4A4IA 4K0KL 3DLLA 1NTGA 1XMOL 2NZOA 4YY3L 1Q86C 1JJGA 1L0WA 4DK6C 4DR5L 4GOPC 1VQ4A 4R4QA 1MJEA 3M7NA 1MKHA 4HIKA 1G291 4DR2L 5C4XG 2YYZA 1GKHA 3A5ZB 4LUZA 4OWTB 3UDGA 4Y52H 3KDFB 3KYHC 1Y1WH 1SLJA 2E2HH 1EOVA 3F2DA 4A3BH 3PGZA 2NVYH 3GDEA 1I6HH 4JI7L 3GTJH 5C0XJ 4JI0L 1S72A 4JI6L 2CCZA 2CQOA 1TWAH 3HOWH 1UE1A 4LF6Q 2BH2A 1JT8A 4OXPA 4BBRG 4NXMQ 3HOVG 4DK3C 4LFBL 3CF5A 3PIPA 2OTLA 2UXDQ 2VL6A 3M85A 1FVIA 1KAWA 2XTIA 4P72A 3NENA 5GAEC 3PO2G 1A62A 2L15A 4GNXB 3TRZA 3RLFA 5IYDG 1I94L 5DLQE 3PO2H 1XPOA 1VQ7A 2UU9L 1C7YA 1L1OB 1VQ6A
chains in the Genus database with same CATH superfamily
1S5ED 2NZHA 1CSQA 4KD4A 1QWYA 5KYIA 1Q3LA 5C3WA 3GV3A 3K5MA 3OMGA 5KNCA 4HCSA 2ZJQA 1PRTF 4UDUC 1GD7A 2DNCA 3CQZB 2QW7A 2WINB 3VDYA 3SGIA 1X55A 3FDTA 1SXTA 3K0YA 4Y7NH 2BE5D 1HTLD 2XSCA 5IT9L 5FO7B 4A76A 2F0QA 2VS1A 4CKBA 2MO1A 1JOKA 3HFZB 1ESFA 2KHSA 2EIFA 3TEHB 1BCPC 3AFQA 1I4GA 1VQBA 2A8VA 1HPCA 1PTOF 1UE6A 1PH7A 4R4OA 2F0VA 4A3IG 2EYPA 3LNNA 1K3BC 4IUUA 1FJGQ 2EXZA 4YCUA 2UU9Q 4ZUIA 5CV6A 4L5RC 1E2ZA 3GO5A 1XX8A 5IGEA 3A0JA 2EE1A 1W6JA 2CW0D 2GVBA 2IX0A 3K80C 5COYA 2F3IA 1IL8A 3I90A 3S9WA 1WTXA 2F0TA 3S1NB 4UP9A 5JAVA 2E76C 1V8QA 5KIXA 2L4NA 5IP9H 1HNZL 4ID6A 4H44C 5I6WA 2F0DA 3S14B 1K8MA 4LF8Q 3FPUB 1SYEA 4NXNL 5CC4A 3A55A 1E0BA 1Q7YC 1MJCA 2EOTA 2B2UA 3KF8A 4H13C 2FFKB 2WB1G 2E2IH 4JCVE 4M1UB 2X69A 4B9WA 4H7BA 5EKIA 1WD1A 4IFDH 2HT1A 1LABA 1SSOA 1T9HA 2MUYA 4IUVA 1N32Q 4IPGA 3KBGA 1Z7TA 3A56A 4A75A 2EJFC 2N55A 1VQFA 2ENBA 1SMXA 2PI2A 1EEFD 3H6MA 1DCZA 5KRUA 4HJAA 1GM5A 1F2LA 1R9TB 1HNXQ 4BBRH 1SFOB 4JOIC 4PMBA 1CKMA 5CV5A 1NUCA 5GQOA 1AE3A 3G71A 2F0PA 2L55A 4IUNA 2B29A 3N52A 5C44H 2AUJD 1CQFA 4G7ZC 1FD7D 1IBML 4B3RL 2E2JB 3OSOA 4XXEA 4JK1C 2O5JC 1F9SA 1G51A 2D5DA 2C5CA 4AYBE 3J80L 1HH2P 1KXLA 5EBCA 3CCEA 4JI6Q 3ICEA 4V190 1KAAA 4C3HG 1LYLA 2FINB 2F0HA 3CHBD 4GN5A 5FLXL 2JA5B 3M4QA 3RNUA 1LTID 1RF2D 3QG1A 1JB7A 3Q6SA 4R9WA 5E1FA 3I4OA 3HGBA 3T1YQ 3KDFA 1HR0L 1OXTA 1C8CA 4PV1C 5JOBA 3I4MH 2MHVA 2B2TC 5C4HA 1N33L 1HTPA 1Q90A 1N8RC 4A3DG 4BA1I 2D62A 5JJZA 1Q46A 1YITA 1VQIA 5M5YB 3FKIB 1KNAA 1SRUA 1GXDC 2X6LA 4B3RQ 3T16A 5IYCG 1KD1C 2B2WC 2CWAA 2NWGA 3T51B 3HOYG 3MXNB 2YU9H 3ERQA 1G91A 2BE5C 1VQ5A 1NE3A 3FHWA 1PYBA 5KNBA 4CGYB 1I4RA 3NWTA 4BBSG 4IJLA 3D6CA 2YTVA 4ZRZA 2G9HD 4JI1L 3E9HA 2ZM6L 3NTHA 5C4XB 4RCNA 3G48A 3GTOB 2Q8TA 3RR5A 1ML0D 4RHSA 3A7LA 3KK7A 1KLGD 5M3FB 4RFBA 4KY6A 1WTWA 1HXYD 1FNVA 2XRQD 1JC7A 1PFNA 5AJ3Q 1SYGA 1IYVA 4Q0FA 1IBLL 4JI3L 1STBA 4X6AH 1SJED 2F52A 3K7AH 2R92G 2KENA 3EA6A 4G4KA 4ILWA 3SR1A 4KY7A 4MTKA 5M3MG 1UE5A 2NYZD 3J7AV 3IFTA 3TZDA 1SNOA 5EPKA 1XMQL 3K8AA 2K6AA 1U4LA 5M3FG 1IW7C 1VQOA 2A6HC 3J81E 2E75C 1A8VA 2EJMA 2BH8A 4QGUA 1PFMA 1X3GA 4C2MB 4G7HC 4A3MG 2LKVA 2YTYA 4OIJA 2JSOA 3BDLA 1SNDA 1KQSA 1VMPA 4QIWE 1MGSA 1QNKA 5DAUA 1C0AA 4GKKL 2N8NA 1ESRA 4MNOA 1GUTA 4QY7A 2MPMA 3HOZH 3I55A 2PPBC 1FR3A 3PCOB 4LF9Q 2F0NA 5LHY1 4LMQD 3U9OA 1HNWL 3WOFA 2Z0SA 5IGGA 1SN8A 4FP5D 1NJIC 5FLMH 4JI3Q 2EDGA 1YEZA 1RHPA 3J7A5 1EY4A 5JJKA 4QB4A 2ZXRA 1HUNA 1JJCB 4TSSA 4DR7Q 5K36G 1BBUA 1DJRD 1M1KC 2F0LA 3J80c 1TQOA 3OW2A 5KYLA 3J81c 2ZT9C 1RDPD 1DOKA 4A3FG 3HOVB 1HR0W 4X64L 4DV0Q 5IIFA 1E22A 2LXJA 4GKJL 4JYAL 3T4AC 1AZPA 2E8GA 1PVOA 2IPKD 4XQNA 3TS0A 2EYMA 2KJXA 4B3MQ 5D3IB 1GUNA 3FEWX 1YHAA 5IGFA 1ET9A 1A2UA 5AFWA 4X3TA 4IFDJ 2EYLA 3UDXA 1WI5A 1JB3A 3QB3A 1H9MA 2Z6KA 5FLXE 4LF4L 4QUCA 4AH6A 4PZ7A 4A93B 2RDHA 1WYDA 1VQAA 5HURA 1WVLA 1EFWA 1LT6D 3SK5A 1PZID 4LK1C 5M5WH 4J1MA 3S24A 4BWGB 1TWCH 3HOZB 1ET6A 2P5ZX 3CCUA 1JMCA 3PUZA 2KUMA 1VQ8A 1KDBA 2J0TD 3PUWA 5FO9B 2K7VA 1OXSC 4HSVA 1HQMC 4JW0A 3ULLA 5C3EG 4CDCC 4JV5L 1PZJD 2NVQB 3NELA 4C2MH 2R3ZA 2PMZE 4M8AA 5J39A 3OYYA 4LNQA 3JAML 1JE5A 1Y14B 4A3MH 1PH1A 3GTQB 1RTNA 4CHTB 4EQOA 1RD9D 4WFN3 5I6YA 4TKOB 1EIFA 2F0GA 4DKAC 4DV5L 4BY7H 1K3RA 4JI0Q 5IYCH 4QL5A 4PG3A 4QJFA 2ZJRA 1BQQT 2I07B 1I94Q 4JI8L 1L0XB 4HEDA 4TVAB 3KF8B 5FO8B 3VYRA 4A3DB 2WAQG 4LF5Q 1I4HA 2TMPA 4ALPA 3I2ZA 3HKZG 4DR4Q 4IFDI 3M7GA 3RLNA 3JAME 2K1BA 5C0XH 2AMCB 5CV4A 1X3QA 1ZKOA 3OIPA 4LF7L 4RA8A 3HOYB 4A3KH 5JPMC 3GTGH 1BOSA 4IALA 4KJOA 5GROA 4DUZQ 5D3DA 1OTCA 1SROA 2B2TA 2Q2UA 4OO1H 1G6ZA 3NQTA 4RCOA 4AYBG 4EQPA 2VZAA 4KHZA 2NB0A 4AQYQ 3I7FA 4BY7B 3VR2A 1JICA 2PQAA 2Q2IA 2K04A 4K6LA 1KNEA 1N34Q 2ZTDA 3TS2A 1A3TA 1E2WA 4K14A 4A3BG 2IHFA 1NR4A 1YNXA 1L1OC 3L3OC 3SK4A 2GVAA 5HGTA 5C0XI 3AMUA 1BCPD 3W2DA 4ZKBB 2V4DA 2DN8A 5I9PA 4QQBX 5E4XA 2F0SA 5CGKA 5JPNC 1UUPA 2HCIA 2IL8A 4NW2A 3SHLA 4B3SQ 1S5DD 4RGOS 3DWAA 2L1BA 2XRSD 1N33Q 3NBHA 1PYWD 4BA2I 1EEID 1O7IA 1TWCB 1D1KA 5JVH3 1XMOL 2NZOA 2XIWA 4YY3L 1L0WA 4DAYA 1SYFA 4DK6C 1VQ4A 5EKKA 1Y8PB 2E74C 4LUZA 3KDFB 1SLJA 1SNPA 2E2HH 3PGZA 4ZYSA 1EY5A 3DXJC 4JI6L 2CQOA 2KEEA 1TWAH 1UE1A 4LFBL 4BBRG 2UXDQ 3M85A 1FVIA 1KAWA 3NPPA 1ENFA 4CJ1B 2K33A 3RLFA 4EVOA 2CHBD 1VQ7A 2R61A 1TKWB 1SE3A 1L1OB 3SDZA 1VQ6A 4OO1I 3TN2A 3CC4A 3L9AX 1PFSA 3G6JB 3DUZA 2MP1A 5LMUL 1K9MC 3K58A 4J8QA 2IWHA 1KC8C 2QDLA 4ZQ3A 4X62Q 3G6EA 3R93A 1LT4D 3PIO3 4IN3A 1HZ9A 3ZYYX 3AQQA 4HIMA 3HG9A 4K2LA 3J7AF 4CBVA 1TS4A 4IQZA 4KKSA 1CSPA 4EQ5A 2JEBI 1N9WA 4KD3A 1CKNB 4HJ5A 2I5HA 3P20A 1AP0A 4K5VA 4R4TA 4KHVA 3F2CA 1L2FA 3OMCA 4RGMA 1PH5A 2JEAI 1SE4A 2FHTA 2PZTA 3CRLC 3FMCA 3MA2B 2OCEA 2F03A 2A73B 1YVCA 3L2PA 3KLRA 3T1HL 4DGZA 2F3VA 5C3XA 4HJ8A 2NN6H 3GTQH 5ELEA 4DV2L 3BU2A 2K4KA 4LUOA 1P16A 4LFAL 1XNQQ 1CT1D 3HOUG 2NVQH 2CFMA 1ZYRD 1EQTA 1V1PA 1H9KA 1PTOC 1EQVA 3J81i 4KKTA 2R6GA 3K57A 3CMAA 3X3MA 5IOCA 4DV4Q 4JI4L 4LAAA 4NB3A 1XNQL 2AQ1B 3UDIA 2JXMB 1HA6A 4GNXA 2NN6I 3N6RA 4PNYA 1N36L 3MHBA 5I2YA 4HJ7A 1H95A 2RHSB 2K5DA 1DD2A 1QVFA 2MJ8A 4K5XA 1SYDA 4B3SL 2LMCB 2EVBA 4P74A 1BCPB 3VR6A 1PRTC 4DV3Q 4DU9A 1TIID 5H1SE 2D2CC 4K8JA 5T1IA 4BBSH 2K5WA 3STBD 3AYHB 5C3EB 1N34L 4X3SA 1YNJC 4Y7NB 2OTJA 2C35B 3WDNA 1T5XD 1MBYA 3J7YW 3HOVH 3GTPH 4IFDG 5L37A 3IL8A 4LF7Q 4DF7A 1M8AA 2JA7G 2CKZB 1YJ9A 2RQXA 4ZUJA 1STHA 2D9UA 4PMWA 4MTNA 1U4RA 5FKAC 5JVG3 5LMUQ 2YU9B 3S16H 1QUQA 1VQDA 3EN2A 1STGA 4BXXH 3A54A 3HOZG 4KKUA 3M9BA 2HDMA 5M5YH 4KK7A 1HRJA 1G6PA 1EQRA 2AUKA 2QDBA 3RUZA 3AFPA 1LTLA 2IHEA 3D6WA 1S4ZA 3OWFA 4IPDA 1KDCA 1RODA 3HKZE 1EFID 3S1MB 3NE5B 3TQYA 3J81L 1Y69U 2FMMA 2DY7A 1NNXA 2VB2X 2JN4A 1U4PA 4FO2A 1AN8A 3SVMA 1Z9FA 4HMJA 3CPWA 1I5FA 4APVA 1B70B 4GS3A 4DN4M 5EKLA 4LWCA 3TZUA 2Z4HA 2WP8J 3V05A 3D4DA 4ME3A 2N49A 4C3JB 2F0OA 2AWOA 3OIQA 4LF4Q 3W5OA 5ELNA 3HRZC 4KHPQ 3BJUA 1ASYA 1D5XC 2VNUD 1G2SA 2HCCA 1V1QA 1LT5D 3TMEA 3VR4A 4B3ML 2F4IA 4A3GG 1KLUD 2AKWB 3DWPA 1IYJB 4P2CB 3MWYW 4PZ8A 1QVGA 1OXVA 3HOUB 1TWGH 3OTOL 2RBMA 4J15A 1MI2A 4K5WA 1NAPA 1D7QA 1UWVA 3NEMA 4U673 1DOMA 4RG1A 1SE2A 1KRSA 3G7LA 4YIJA 3UE1A 3CCJA 2WFWA 3A8JE 2YV5A 2JA8H 3H3VI 1L1OA 2A68D 3TP7A 3KLWA 1TS5A 5IP7H 5LL6X 1I4QA 4JC0A 3S17H 3I73A 3E3XA 4BY1H 4CDDC 1PH8A 2H5XA 2M2LA 2AQ3B 2YTXA 2EZVA 4DV7L 4QCLA 2R7ZB 3CC7A 2ZJPA 3B6YA 4DA2A 1F9RA 1LTRD 3BDCA 4A3EG 4Q5VA 3S2HH 4JOIA 5G3LD 3H3VH 2R92H 1M90C 2IT1A 1R4QB 1O78A 1M4VA 2BCOA 5FK9C 2EY2A 2Y0SB 2DY8A 1EZ6A 2VXWA 1ZXTA 5EPLA 1KL9A 3A5UA 2UUCQ 1SEBD 2MNAA 1IZ6A 4C1NI 2BDOA 2QGQA 1J8IA 2N3SA 2IW3A 1F77A 4OX9L 3ONAB 1Y1WG 5GAGC 4JI4Q 4LF6L 1CKOA 5IY0A 2B63B 1G8ZD 3C3LA 2R93B 3F1ZA 2M00A 2CQAA 4HN7A 4WJ3M 4R4IA 1DGSA 2NVXB 3PO2B 2Y0SG 1BCPF 1VQ9A 3U50C 3C46A 1XMOQ 3DEPA 2V1CC 3H0GB 4P73A 3RN2A 4C3JH 2OT2A 5BN4A 2ZM6Q 4HMIA 1BR9A 3GTJB 2QA4A 5M5XH 2F0UA 1I6HB 2KEDA 1PTOB 3NP8A 2R93G 1TWFH 5IWAL 2LSSA 4LW1A 1A3VA 4FF3A 5IODA 1MHWC 3WOEA 1HA5A 2RDFA 4GOPB 1A6XA 1SNCA 1O7LA 3R3OA 4A3JB 3GQBA 3EIVA 2UXBL 2XVSA 3ND9A 3S14H 4DV1L 4DR6L 2ATWA 4IPHA 2NVYB 4ABNA 1SYCA 1AEXA 1JWMD 4KLKA 3BVGA 4A3KG 1PH6A 5JJLA 2DJGC 3PUVA 4X3KA 1H9SB 5C0XG 2HQEA 2L9HA 2QILA 2X6GA 5IYDH 1LV9A 1HZAA 1XPUA 4MZ9A 2N78A 1GUWA 2Z9HA 3H0GH 4NDXA 1X3FA 4N8FA 3I8ZA 3E9IA 4H0LC 1IW7D 4DR1Q 1CZGA 4L63B 4KMUC 4RH6A 3S16B 2K14A 3NBIA 4CJ0B 3IKJA 1WTRA 2K01A 5IT9E 1KDAA 3PUXA 3A8KE 5DM73 4DAMA 1IBLQ 4G57A 1VF5C 4UHVA 1WTOA 5BN5A 1B3AA 1E1TA 3RN5A 2XGTA 4C3JG 2PO4A 4LFCL 3GTOH 2J7ZA 4OEMB 1A0IA 1FGUA 1GJXA 3BG3A 2KA7A 4IURA 1XWEA 1YJNA 3MAQA 1VQCA 4CKEA 4RAUC 4BBSB 3Q0AA 1DONA 1VQHA 4YHHQ 1E1OA 1EIYB 4JI1Q 3VR5A 5EQ0A 1B9NA 1EWIA 1N36Q 3HKZB 4P75A 3S2HB 2OWOA 2IJ0A 2PZUA 2QEJC 3BZCA 3H15A 1RCVD 5DEHA 2NVTB 3UDFA 1N32L 2H4OA 2NTTA 3QO2A 3I4NH 4DR4L 1SR3A 1TY2A 2IX1A 1QUQB 3DWQA 2VY3A 1IHZA 1U0LA 4A4IA 1Q86C 4R4QA 4I7ZC 1MKHA 1I4PA 1EY8A 2YYZA 3A5ZB 4RWSC 4A3BH 1SNMA 3TP5A 2NVYH 3GDEA 3BS1A 4HCEA 4ZKCB 2NTSA 1S72A 1DZ1A 2FMCA 3M4OB 3HOWH 1JT8A 2EY1A 1Q8IA 3HOVG 1EU3A 3QIAA 4FXGC 4RKBA 4NKLA 5KEEA 3NENA 3E0JA 5TSSA 4F7XA 5GAEC 1TWGB 5IYDG 1XPOA 1VDZA 1IYUA 4DUYQ 2Z8LA 3CPFA 1S40A 5DM63 1II3A 4L5TA 1DXMA 1Y1VB 2K28A 4JPBW 1QILA 3AB9A 2OXPA 1X6OA 4EGVA 2ICEC 3NTKA 3J81j 3NK9A 3EJIA 2WAQB 1CFMA 3UI2A 1YNND 1MSGA 4BBRB 1SFOH 1VF7A 1IKMA 5ELOA 1XYIA 3MFGA 5ELFA 5FJ8H 1WTPA 1S5BD 2AWNA 4ZCKA 3U4ZA 4L5SA 5JEAH 2KVMA 1J9OA 1X32A 2F0IA 3F8TA 4ODGA 1CA6A 1W3SA 3PO3B 4L6TB 3OOCA 3A8IE 2K03A 5A35A 1AZQA 1T5EA 3S2DH 5C4JH 1O7YA 4DR3Q 3R8BA 5JEAJ 3WWVA 4JBKA 2KBNA 5D14A 3CCSA 2B2YC 4A3BB 1PFBA 1VQNA 3S1MH 5EJWA 2RCNA 3K5OA 4R4CA 2PW5A 4JYAQ 1SNQA 3V96A 3GTKB 1QVCA 2HQLA 1U5KA 4N9PA 1OXXK 2A69D 2HUGA 2NVTH 4HAEA 1G2TA 4FVMA 1F9QA 1WOCA 3QOJA 1EYGA 2L12A 3GV6A 1YHBA 4DR7L 1JWUD 3CCVA 3HOWG 4ME5A 3CCRA 2E5LQ 4HSPA 1WJJA 2K5VA 2WB1B 3BDOA 2G5DA 1BVSA 3GTPB 1UEBA 3HEJA 4BXXG 4YHHL 2KCTA 1HNWQ 1CUKA 4LF9L 3IFDA 3GD7A 2D0OA 3ITPA 1CKNA 5IYBG 1XPRA 1EYAA 3IRBA 4A3KB 1YNJD 5C3EH 2UUAL 2K5HA 3GTGB 4GOPA 3V2TA 2XN9C 5J3BA 3F2UA 3PQIA 4YCWA 2SNSA 2Z6KC 1PRTB 1CHQD 1PRTD 4O2DA 3I70A 2QEXA 2A6ED 4KI0A 1C9OA 3FPPA 3BVMA 3ND8A 3SK8A 4DV5Q 5C6AA 3PIOA 2EYHA 1E3PA 3RZOB 1H9SA 2UUBL 2F0EA 1JE4A 3T1YL 2LXKA 3FVQA 4GLAC 4GLXA 2I0QA 5F2DA 1YZ6A 1FL0A 2KHIA 2RVLA 4DR1L 4F8MA 1GHKA 1B1ZA 1JOQA 3DHQA 4UY8C 2RA4A 1V1PB 5BR8L 1CI3M 1K83H 4KN7C 1BBXC 1I50H 3T53B 2JA6H 1FNUA 4QIWB 4ZK9B 2A19A 1SJHD 1HNXL 4JG2A 4PQXA 4XYOA 3F2BA 1JORA 4KTAA 1XNRQ 1YNNC 4A3JH 3LGJA 4WJWA 3AEVA 2UXCL 3FP9A 4BY7G 1IBMQ 1LLRD 4XTCS 3CU7A 2WKCA 1EL0A 2F4VQ 4AQYL 2AHOB 1ILQA 4B9XA 2MGSA 5M5XB 1JCKB 4TQUS 2JA9A 3PF4A 4DXGA 1OO9B 1IBKQ 1YIJA 1LACA 2UXCQ 1HUMA 4NXNQ 1LT3D 3S1QB 2JE6I 3H09A 1QCBD 4LF8L 3C1FA 5EAYA 2IX3A 1HNZQ 1D6EC 4C3HB 3CD6A 2K52A 3S1RB 2F4VL 2NBFA 3I91A 5BR8Q 1HR0Q 2R93H 1PYSB 3D3RA 2MQHA 2F3WA 5CMDA 4C3IB 4XT3B 5LMNW 1SE8A 3CP0A 1XNRL 2RSOA 4DR3L 2HD3A 1FJGL 1GUSA 1Q8KA 1FNWA 4TRDA 3RZDB 2ES2A 1U4MA 2JA7B 2JJQA 5NUCA 1NBWA 2A6HD 4GN4B 1B8AA 2EJGC 2KQ3A 2EYJA 4PMCA 2RDGA 1LUZA 2LS01 1KIXA 1P8LA 5E4WC 1STEA 3NXWA 2R92B 3NWSA 4DK1A 1IKLA 2UUAQ 1WTQA 1QE6A 2KHJA 1EU4A 3J80E 3MTSA 4BY1G 1Q82C 4I65A 4POGA 4XDXA 4DFAA 1VS0A 2EYFA 5C4ZA 3M4YA 4JVZA 3K59A 2Q8RE 1LTTD 1LTBD 2Q2HA 1VQKA 1ENAA 1XMQQ 2E5LL 2JA8B 2ZTCA 2EXDA 1X3EA 4A3LG 1YHQA 4JI5Q 1RL2A 3TP6A 3ERSX 4OHJA 2EYOA 3E6ZX 4NPSA 2B8GA 2CVRA 2ASBA 2F0FA 3NBHB 2DJFC 3KF6B 1TU2B 3MVVA 3HOUH 4V0BA 2RCFA 4A3FB 4A3IB 3HOYH 3M4PA 1EUJA 2SEBD 3CMEA 4RKLA 3MXUA 2R7FA 4H02A 1GOZA 4OO1G 4MHEA 1XTCD 4AIMA 2PNRC 4A3DH 2QKIC 5IGDA 2L0CA 2WV6D 1WTVA 3TBIB 2OQKA 3CAMA 4A3GB 4KJNA 3STBC 4A93G 5C4XH 4A3FH 4UP7A 1PDQA 1J6QA 4OIKA 2DGYA 3QJYA 1STNA 1SAPA 2EPBA 2Q8IB 3T56B 1K0SA 3ER0A 1A3UA 4JI5L 4KHPL 1KHIA 4F88A 3W3AA 3TREA 3QWNA 1EQQA 3ZJYC 2FJ2A 4RMFA 1B9MA 4WJ4A 3PIP3 3RMHA 1VMCA 5E3FA 1JJ2A 4LFCQ 4UAIA 1I4XA 3TP8A 1BXTA 2F0MA 4DNRB 2R7DA 3T13A 4DUYL 4DV6Q 4J6HA 5J22A 1O7ZA 2VQEQ 4IOCA 4JBWA 5I4DA 4OWWB 3OHXC 4HJ9A 3PMFA 4LJZC 3H3VC 2UUBQ 2K32A 1CZWA 1HFGA 2JA8G 3M3YB 5IP7G 5HY6A 3E5SA 3C2PA 5AJ3L 2JA5H 2R7ZG 1PA6A 3H0GG 5CYUA 3GTLH 1EIHA 4KV6A 4UP8A 5I2XA 1AE2A 1B3QA 2BA0A 1PXUA 3K81C 3RZDH 4DR5Q 4QF4A 1QOHA 3L0OA 5IE8A 2Z1CA 1I6VC 1TS3A 2JA5G 3E0EA 1VQGA 2PW7A 3QR8A 3MZ5A 2MFIA 1TS2A 1K0RA 3U9SA 4K8IA 2B8FA 2Z6BA 1OXUA 4CDFC 2B2UC 2HIXA 4A3JG 2RF4A 4FF2A 2A5HA 3S1RH 4XQJA 5HGQA 2WIIB 3MC0B 4O42A 3TSSA 3KLSX 2PI2E 1PH2A 4FYDA 3JAMc 3VYSA 1HZBA 1I3QH 1SYBA 3J7ZC 4OGQC 1Z6HA 5LMNQ 2AQ2B 4Z9CB 4A3CH 3SXHA 1SMYC 3R2TA 3I4NG 2NUCA 2E2IB 3P75A 1YI2A 1TY0A 4XT1B 1U9RA 1WFQA 5FOBB 5DNFA 1VCIA 2LY7A 2VQFQ 1FGBD 1RKNA 2CWPA 4K0KL 3DLLA 1NTGA 2HDLA 4GOPC 3MEHA 4HIKA 1G291 3UDGA 4OWTB 1EOVA 1E2VA 4JI7L 2A6EC 2E2DC 2K05A 4RGNA 5C0XJ 2PQEA 4OELB 2ZXOA 2B39A 4LF6Q 2BH2A 2O4XA 1PZKD 4OXPA 4BS9A 4DAPA 4NXMQ 4MIUA 3CF5A 3PIPA 2F0WA 2OTLA 2VL6A 2XTIA 1GUOA 1ENCA 1F2YA 3PO2G 3HZXA 1A62A 2L15A 5ELBA 3TRZA 1JQYD 1FYCA 3EROA 3P7JA 2H1EA 2UXBQ 1LTAD 3BYTB 1I3QB 4L8JA 3FKIG 1WCMB 4KN4C 3NTIA 3OWEB 2WACA 5FLXc 3O13A 4L5QA 4JBJA 3VA7A 2K5NA 1X56A 2TSSA 3A7AB 4KY5A 3D4RA 2PYKA 5IGCA 2CH4W 5ELCA 3D31A 2VUMB 3I3CA 3CQZH 4DV7Q 1KTKA 3C1EA 1F2MA 1XXGA 2HHHQ 1O80A 3UE0A 2EY5A 4JI2L 1F9PA 2DNEA 1IL2A 3LWUA 1UEAB 4LUVA 5JEAG 4YCVA 5IP9G 3DM3A 5IWAQ 4X65L 3P1HA 2A1AA 3TDQA 5FLMG 2I5LX 1TXYA 3G4SA 3W1BA 2RSNA 1PV4A 1D2BA 1CTMA 4AYBB 1TT2A 3BZDB 3RD4A 1Y8NB 2CW0C 4IJHA 4FF1A 1EYDA 2EQSA 1TWAB 1CK1A 1W6KA 1ZEQX 4S3SA 1KRTA 4DR2Q 3H94A 1C7YA 3KF6A 4OX9Q 4E6IA 2E2HB 3RLOA 1MD2D 1UAPA 3GTMH 2B2YA 3CW2C 2SNMA 1BKBA 3GTMB 4LFBQ 3BVZA 1Q81C 4DV4L 5K36H 4I7AA 4HIOA 1DM0B 3DM1A 3KUPA 3U4VA 5FJ8G 3I4MB 1JR0D 5J1ZA 5BN3A 4R8IA 3HS0C 4FNFA 1EZ8A 4X3UA 5D65A 1J5EQ 3HKSA 3CCQA 3H91A 4HIDA 3OPOA 4IUTA 1NSNS 1ICWA 4FXDA 5K5PA 1UNSA 2I5MX 2XNAC 4CKCA 2SDFA 3Q22A 5C4JB 1PH3A 2UUCL 2O2LD 4N8X1 4P71A 1V43A 4C3IH 1QZHA 3EBEA 1W2BA 2F0KA 3NUCA 2KOLA 2BDNA 2VUMH 3KJPA 2EY6A 2K75A 1VQLA 3PV0A 3K7AB 3NQIA 3Q8DA 4X66Q 1E24A 1DYQA 1EY0A 3SEBA 4A3GH 5IYBH 3ULJA 2HIVA 4FDBA 3QOLA 5EGTA 1GHJA 1R9TH 2PMZB 1PLFA 3OW7A 1EWHA 4DAVA 3S1QH 4B3TL 1WCMH 3ULPA 5M3FH 2KCMA 4DAYB 1JOOA 1RJTA 3X3NA 4X62L 2FXQA 5CR3A 4A3IH 1IXRA 1CA5A 1X3PA 5CBAE 4IO9A 4DNIA 1ASZA 2A68C 1PMRA 4A3LH 1XTDA 5LL6S 1YBYA 1EOTA 3VYUA 3LWEA 3HOWB 4POFA 4A3MB 2UXDL 1BBWA 4DV1Q 4DR6Q 4G7OC 3LX0A 1D5MC 4NXML 2JA6B 2WAQE 3HOXH 1D5ZC 1X65A 1HJPA 1TVXA 3I56A 1S3OA 4A3CG 2OQ0A 5IT9c 1EY9A 5G3LF 5EPJA 2OEOA 4X66L 3S1NH 2IY5B 2BOSA 1K73C 1Z47A 5KGUA 4ZLTF 3JC66 1VQJA 1Y1VG 1B7YB 5GADC 1Q12A 3FKIH 2K50A 3KJOA 4YY3Q 4K0KQ 5M5WB 3RZOH 3AU7A 4YWLA 1WD0A 1A63A 1BF4A 4A93H 3K7UC 1V1OA 4OONA 4RGTA 2N88A 1TR5A 2DUDA 2LFNA 4RHRA 4IOAA 3PO3G 3U58A 3R2IA 2MO0A 5M9OA 4OL7A 3I4LA 4K2KA 1BUVT 4LFAQ 3CXCA 4XQQA 3PUYA 5ISRA 2PZWA 1EY7A 2QCPX 1BO0A 1X54A 3URYA 2J4XA 1BDOA 2E2JH 2JK8A 3EQLC 5A2QL 3HP3A 1D1IA 1LTSD 1K8AC 1AFPA 2BA1A 3GTLB 2L11A 2F1MA 4GNXC 5CBEE 4C3HH 4LF5L 4UPAA 2F0JA 1VQEA 1WTHA 2KECA 1XJVA 5ELDA 3M3YH 3MXGA 5I9OA 4JI2Q 2A69C 1K28A 1B53A 1H9RA 4OWXB 4DXFA 1L0YB 3D8GA 3K0XA 1EY6A 2XWBB 1CQVA 4C56C 2O5IC 1Y1WB 3KFUA 2PCFB 4R8NA 1NMGA 3MEFA 3W1GA 5M3MB 1QZGA 1R4PB 2WB1E 4F87A 2VUMG 5E7NA 2WKDA 1B2TA 3J80i 2I46A 2SOBA 2VQEL 2HHHL 4DV3L 3A74A 1KABA 1VQPA 4XYQA 2Q2TA 4CDEC 5JJIA 2XWJB 1TWFB 5M3MH 1I50B 2VW9A 1K83B 3PO3H 3I4MG 4XIGS 1NY4A 1RIPA 4A3EB 1VQMA 1J5EL 1K8GA 1QJOA 3K6OA 1WCMG 5T1GA 4DPGA 4FF4A 2A74C 1SMYD 3S15H 4JI7Q 1ONLA 4FXKC 2OF1A 3K5LA 3FRPB 2ICIA 4DNTB 4DV2Q 2B2VA 2NVXH 1NMFA 1GVPA 1PH4A 1UE7A 1B4OA 1A15A 2B63H 1LTGD 2GA4B 1TWHB 3NSWA 1PH9A 5CV9A 2NN6G 5CORA 1JWSD 3PSIA 1HZCA 2G9DA 3CRKC 4YWMA 4X65Q 1YJWA 5GAHC 3CCMA 2JQOA 2B3GA 1STAA 5CV7A 1BNZA 1MIUA 1K8OA 3T1HQ 1D8LA 2RKSA 3MXPA 2L5TA 3CC2A 2PQAB 1EYCA 1Q1BA 1CHPD 1PTOD 2ZTEA 1HQRD 3KBXA 1DOLA 1SDFA 5LMNL 5CV8A 2CH4A 2R7ZH 1LO5D 1E7ZA 3KOJA 1QG7A 3CCLA 3VA5A 3GTKH 2B2WA 1NCVA 3D4WA 1B44D 4BY1B 2GN5A 4GKKQ 3S17B 4HTHA 4QUFA 4DUZL 1HCZA 4JI8Q 4N9TA 4GN3B 1Y8OB 3HOXB 1AW7A 1NR2A 1CM9A 3OTOQ 5C5LA 4WRDA 3DMUA 4PZ6A 1B50A 4B08A 4NP5A 2JA7H 2PNHA 2ZXPA 4EX5A 1C48A 3L7ZC 1LM0A 2M9VA 4IUQA 4JBMA 3S2DB 4GLVB 1QB5D 4IZ8A 4O0AA 4MN3A 4JV5Q 4B3TQ 3JAMi 1F2ZA 1HFNA 2QF7A 2VQFL 1MSHA 1TWHH 3K5NA 1QNUA 1EWCA 4C1NK 1RTOA 2JYOA 3HOXG 1GUGA 5C44B 2ID0A 3GP7A 1STYA 1EIGA 3KLSA 5A2QE 3SK6A 4HR7B 3I72A 2ALYB 4IPCA 3MXNA 4NMZA 4IUPA 4DV6L 4R1JA 2B2VC 3PF5A 3S15B 4QMGA 1Y1VH 4CJ2C 1A2TA 4A3EH 1GO3E 2KCNA 4U68A 3D0FA 2B63G 2VB3X 3VYTA 4GZYC 3CKIB 5C5MA 1C4QA 4ZAIA 2JA6G 4EQNA 3BZKA 1X9NA 1IBKL 1ZYRC 5C44G 3Q23A 4YWKA 2RHQB 4WORA 1V9PA 1Q1EA 2D0PA 1ICFB 4GKJQ 4DK0A 4DV0L 4X64Q 2Y0SE 2JP1A 1AH9A 3M4OH 4C3IG 3Q24A 1PHJA 1JJGA 3EVQA 3NHHA 3DEOA 4DR5L 3SE0A 1MJEA 3IAYA 3M7NA 1H9JA 4DR2L 5C4XG 2KCCA 2NZ1D 1GKHA 1PTOH 4ULLA 4Y52H 3KYHC 3EFXD 1Y1WH 1I6HH 5KNDA 3F2DA 1SBBB 3MFYA 3GTJH 4JI0L 2CCZA 2C9OA 3BYYB 5IGBA 4K6DA 4DK3C 5EBDA 3I4NB 1HHVA 4P72A 3VR3A 1S5CD 4O1NA 4GNXB 1S5FD 1ILPA 3PO2H 1I94L 5DLQE 2Z4IA 2UU9L 2K5QA
chains in the Genus database with same CATH topology
2NZHA 3CPFA 4DUYQ 1S40A 4OO1I 3CC4A 2UXBQ 1CSQA 4L5TA 1PFSA 3FKIG 5LMUL 1K9MC 1X6OA 5FLXc 4L5QA 4JBJA 1KC8C 4X62Q 3J81j 2K5NA 3G6EA 2ZJQA 1X56A 1GD7A 3VDYA 1HZ9A 1SFOH 3AQQA 3SGIA 4HIMA 1X55A 5ELOA 4Y7NH 3D31A 4A76A 1CSPA 5FJ8H 3CQZH 2VS1A 4EQ5A 4DV7Q 2JEBI 1N9WA 2MO1A 1CKNB 4HJ5A 2AWNA 3HFZB 3U4ZA 2HHHQ 2I5HA 1HNWQ 3UE0A 4JI2L 4L5SA 1IL2A 4R4TA 4LUVA 5JEAG 3F8TA 3F2CA 4YCVA 5IP9G 1L2FA 2EIFA 1W3SA 3DM3A 3TEHB 5IWAQ 1PH5A 2JEAI 3AFQA 1VQBA 4X65L 2A8VA 1UE6A 2A1AA 2OCEA 1PH7A 3S2DH 5FLMG 5C4JH 4R4OA 4A3IG 2I5LX 1TXYA 3G4SA 3W1BA 1FJGQ 1YVCA 1PV4A 4DR3Q 5JEAJ 4YCUA 3L2PA 2UU9Q 3WWVA 4IJHA 3T1HL 4L5RC 2EQSA 3GO5A 4JBKA 1KRTA 2KBNA 4DR2Q 3A0JA 4HJ8A 3K80C 2GVBA 2IX0A 3KF6A 3CCSA 4OX9Q 3GTQH 2F3IA 1VQNA 4DV2L 3BU2A 3S1MH 2K4KA 3RLOA 4LUOA 4UP9A 3GTMH 3CW2C 1P16A 4LFAL 1BKBA 1XNQQ 4LFBQ 1Q81C 2RCNA 4DV4L 4R4CA 2CFMA 2NVQH 4HIOA 3HOUG 5FJ8G 3U4VA 5IP9H 4JYAQ 1HNZL 1QVCA 2HQLA 3J81i 2R6GA 3CMAA 1U5KA 4LF8Q 1OXXK 4DV4Q 4NXNL 4JI4L 4NB3A 1XNQL 1J5EQ 3HKSA 3CCQA 4HIDA 1Q7YC 3UDIA 1MJCA 4GNXA 2NVTH 2NN6I 1N36L 2WB1G 2E2IH 4HJ7A 2I5MX 1H95A 4JCVE 1WOCA 2RHSB 1EYGA 1QVFA 1PH3A 1YHBA 4DR7L 2HT1A 2UUCL 3CCVA 4B3SL 3HOWG 1T9HA 3CCRA 2E5LQ 4P74A 1WJJA 1N32Q 2K5VA 4IPGA 4P71A 1V43A 4A75A 4DV3Q 4C3IH 1BVSA 1VQFA 1QZHA 1SMXA 2PI2A 3EBEA 1W2BA 5H1SE 2VUMH 4BBSH 3KJPA 1UEBA 2K75A 1VQLA 3PV0A 3Q8DA 3AYHB 3STBD 4X66Q 4YHHL 2KCTA 4HJAA 1E24A 4BBRH 1N34L 1HNXQ 4BXXG 4JOIC 3ULJA 1CKMA 1CUKA 2HIVA 4FDBA 5GQOA 1AE3A 5IYBH 2C35B 3G71A 5IYBG 3GD7A 2D0OA 1XPRA 1CKNA 2OTJA 3IRBA 2UUAL 2B29A 5C3EH 1R9TH 2K5HA 4GOPA 5C44H 3S1QH 5J3BA 1WCMH 1IBML 4B3TL 3HOVH 3GTPH 4B3RL 4IFDG 3ULPA 4YCWA 5M3FH 2KCMA 2Z6KC 4LF7Q 2JA7G 2CKZB 4O2DA 1YJ9A 2QEXA 4PMWA 4DAYB 4KI0A 4X62L 1C9OA 4MTNA 1G51A 2FXQA 4A3IH 1IXRA 4DV5Q 5LMUQ 3PIOA 4IO9A 4DNIA 4AYBE 1E3PA 1ASZA 1HH2P 3S16H 3CCEA 4JI6Q 4A3LH 1KXLA 1QUQA 1VQDA 1XTDA 3EN2A 2UUBL 3ICEA 4BXXH 3T1YL 1LYLA 2LXKA 1YBYA 4GN5A 3HOZG 4GLAC 3M9BA 3M4QA 4GLXA 3RNUA 2I0QA 1YZ6A 1FL0A 2KHIA 1JB7A 5M5YH 4DR1L 3I4OA 4POFA 3T1YQ 4UY8C 1G6PA 3KDFA 1HR0L 1OXTA 1EQRA 5BR8L 1BBWA 3I4MH 4DV1Q 4DR6Q 2UXDL 3AFPA 1K83H 4NXML 1N33L 1I50H 1LTLA 2IHEA 2WAQE 3HOXH 1X65A 4A3CG 1HJPA 3I56A 2JA6H 1S3OA 2A19A 2OQ0A 5IT9c 1N8RC 4A3DG 4IPDA 1HNXL 4JG2A 4BA1I 2IY5B 2D62A 3HKZE 4X66L 3F2BA 3S1NH 1K73C 1Z47A 1XNRQ 1Q46A 3JC66 1VQIA 1VQJA 4A3JH 1Y1VG 3LGJA 1YITA 3AEVA 2UXCL 3FP9A 1B7YB 1SRUA 3TQYA 5GADC 4BY7G 1Q12A 3FKIH 4B3RQ 2K50A 5IYCG 3KJOA 1KD1C 4YY3Q 1IBMQ 4XTCS 4K0KQ 2CWAA 3RZOH 4YWLA 1Z9FA 3HOYG 3MXNB 2YU9H 2F4VQ 4AQYL 2AHOB 3CPWA 1I5FA 1A63A 4APVA 1B70B 4GS3A 4TQUS 1VQ5A 4LWCA 1NE3A 3FHWA 1PYBA 2JA9A 3K7UC 3PF4A 4A93H 1IBKQ 4OONA 4BBSG 1YIJA 4IJLA 2WP8J 2UXCQ 2DUDA 4NXNQ 4ME3A 2YTVA 2JE6I 4JI1L 4LF8L 5EAYA 2N49A 4IOAA 1HNZQ 3PO3G 3U58A 3E9HA 2AWOA 4LF4Q 3CD6A 2ZM6L 2MO0A 2K52A 5ELNA 3W5OA 2F4VL 4KHPQ 3BJUA 4LFAQ 3G48A 5BR8Q 3CXCA 1ASYA 2VNUD 1HR0Q 2R93H 1PYSB 3RR5A 3PUYA 2MQHA 1X54A 1V1QA 5LMNW 2E2JH 4B3ML 1SE8A 2JK8A 3CP0A 1XNRL 4A3GG 2AKWB 4DR3L 5AJ3Q 1IYJB 1FJGL 1Q8KA 1K8AC 2BA1A 4PZ8A 1QVGA 1OXVA 1IBLL 4JI3L 4GNXC 1TWGH 2ES2A 4X6AH 4C3HH 3OTOL 2JJQA 4UPAA 4J15A 1VQEA 1NBWA 4LF5L 2F52A 3K7AH 4GN4B 2R92G 1B8AA 2KENA 1D7QA 1XJVA 1UWVA 3NEMA 3M3YH 4JI2Q 1LUZA 1KIXA 4RG1A 4OWXB 1P8LA 1UE5A 5M3MG 1KRSA 3UE1A 3K0XA 1XMQL 3K8AA 2UUAQ 3CCJA 2WFWA 5M3FG 3KFUA 1VQOA 2KHJA 2YV5A 1A8VA 1NMGA 2JA8H 3H3VI 1L1OA 2BH8A 4QGUA 1X3GA 3MEFA 3KLWA 3W1GA 5IP7H 4A3MG 1QZGA 4JC0A 4BY1G 3S17H 2WB1E 2VUMG 1Q82C 5E7NA 2YTYA 4BY1H 4POGA 1PH8A 3J80i 1VS0A 2H5XA 1KQSA 2VQEL 2HHHL 4DV3L 3A74A 4QIWE 1C0AA 4GKKL 2YTXA 2N8NA 1VQPA 2Q2HA 4MNOA 4QY7A 4DV7L 1VQKA 3I55A 3CC7A 2ZJPA 1XMQQ 3B6YA 2E5LL 2Q2TA 3HOZH 5JJIA 3PCOB 4A3EG 2ZTCA 2EXDA 4LF9Q 1X3EA 3S2HH 4A3LG 4JOIA 5M3MH 2VW9A 1YHQA 4JI5Q 1HNWL 3H3VH 2Z0SA 1RL2A 2R92H 3PO3H 1M90C 3I4MG 2IT1A 3ERSX 4XIGS 1SN8A 1NY4A 1NJIC 1RIPA 5FLMH 1VQMA 1J5EL 1K8GA 4JI3Q 1YEZA 1WCMG 4NPSA 2ASBA 4DPGA 3J7A5 3NBHB 5JJKA 3S15H 1KL9A 4JI7Q 3A5UA 3KF6B 1GM5A 2UUCQ 1JJCB 3HOUH 4DR7Q 5K36G 2MNAA 1BBUA 1IZ6A 1M1KC 3HOYH 2QGQA 3M4PA 1EUJA 3CMEA 4DV2Q 2NVXH 2N3SA 4OX9L 1NMFA 3J80c 3OW2A 1GVPA 3J81c 1UE7A 1PH4A 1Y1WG 2R7FA 4H02A 5GAGC 4A3FG 4JI4Q 4LF6L 1CKOA 5IY0A 1PH9A 1HR0W 4OO1G 4X64L 4DV0Q 1E22A 2LXJA 3F1ZA 4GKJL 2NN6G 4JYAL 4AIMA 4A3DH 2E8GA 1PVOA 3PSIA 3TS0A 4R4IA 1DGSA 1HZCA 4WJ3M 2Y0SG 4B3MQ 4YWMA 1VQ9A 2OQKA 3CAMA 4X65Q 3STBC 4A93G 3U50C 5C4XH 4A3FH 1YHAA 1YJWA 5GAHC 4UP7A 3CCMA 1J6QA 2JQOA 1XMOQ 2DGYA 2B3GA 2V1CC 4P73A 3RN2A 4IFDJ 4C3JH 3ER0A 3UDXA 4JI5L 1WI5A 4KHPL 1MIUA 3T1HQ 1KHIA 2ZM6Q 2Z6KA 1D8LA 4LF4L 4AH6A 4PZ7A 2QA4A 5M5XH 3CC2A 2PQAB 1WYDA 1VQAA 3TREA 1Q1BA 1EQQA 2ZTEA 1EFWA 3ZJYC 2R93G 1TWFH 4RMFA 5IWAL 4WJ4A 5M5WH 2LSSA 5LMNL 4LW1A 1JJ2A 3S24A 1TWCH 4LFCQ 2R7ZH 4GOPB 3CCUA 1JMCA 3PUZA 1VQ8A 1E7ZA 3KOJA 3PUWA 3CCLA 3EIVA 2UXBL 1OXSC 2R7DA 4DV1L 3GTKH 4DUYL 3S14H 4DR6L 2GN5A 3ULLA 5C3EG 4IPHA 2ATWA 4DV6Q 4GKKQ 4JV5L 4DUZL 2VQEQ 4IOCA 3NELA 4C2MH 2PMZE 4JBWA 4KLKA 4JI8Q 4A3KG 1PH6A 4GN3B 3OYYA 4LNQA 4OWWB 5JJLA 1JE5A 4HJ9A 3PUVA 1Y14B 4A3MH 1PH1A 2UUBQ 5C0XG 3OTOQ 2JA8G 5IYDH 2B63H 1HZAA 5IP7G 1EIFA 4PZ6A 4DKAC 4DV5L 1XPUA 4BY7H 1K3RA 2N78A 4MZ9A 5HY6A 5IYCH 3H0GH 4QL5A 5AJ3L 1X3FA 2PNHA 2JA5H 4EX5A 4PG3A 3L7ZC 1PA6A 4QJFA 3H0GG 2ZJRA 1LM0A 2R7ZG 4JBMA 3E9IA 3GTLH 1I94Q 4DR1Q 4GLVB 4UP8A 4JI8L 1AE2A 2K14A 2BA0A 3K81C 4TVAB 3RZDH 3KF8B 4O0AA 4DR5Q 4JV5Q 4B3TQ 3JAMi 3L0OA 2WAQG 5IE8A 3PUXA 4LF5Q 4DAMA 2VQFL 2JA5G 4JI0Q 3E0EA 4ALPA 1IBLQ 1TWHH 1VQGA 3I2ZA 3HKZG 4DR4Q 4IFDI 3HOXG 3RLNA 1E1TA 3RN5A 2MFIA 2XGTA 4LF9L 4LFCL 3GTOH 2AMCB 2ID0A 1K0RA 1A0IA 1FGUA 4LF7L 4A3GH 1OXUA 2HIXA 4A3KH 4A3JG 3GTGH 2ALYB 2RF4A 4IPCA 5GROA 4DUZQ 3S1RH 1OTCA 1SROA 5HGQA 4DV6L 1YJNA 2Q2UA 4R1JA 4AYBG 3PF5A 2VZAA 4KHZA 1VQCA 2PI2E 4AQYQ 3I7FA 1PH2A 2PQAA 3JAMc 1Y1VH 1HZBA 1I3QH 2Q2IA 4A3EH 1GO3E 2B63G 1VQHA 3D0FA 4YHHQ 1E1OA 2ZTDA 3J7ZC 1N34Q 1EIYB 3TS2A 2IHFA 1YNXA 4JI1Q 1L1OC 4A3BG 1EWIA 2GVAA 5C0XI 5LMNQ 1N36Q 4A3CH 2JA6G 4P75A 3BZKA 1X9NA 1IBKL 5C44G 2OWOA 4QQBX 4YWKA 2RHQB 1V9PA 3BZCA 3H15A 1Q1EA 2D0PA 3I4NG 3UDFA 4GKJQ 1N32L 3I4NH 4DV0L 4X64Q 4B3SQ 4DR4L 1YI2A 1SR3A 2Y0SE 1WFQA 2IX1A 1AH9A 1N33Q 1QUQB 3M4OH 2JA7H 1VCIA 4BA2I 2VY3A 2VQFQ 1PHJA 1O7IA 1U0LA 2CWPA 4A4IA 4K0KL 3DLLA 1NTGA 1XMOL 2NZOA 4YY3L 1Q86C 1JJGA 1L0WA 4DK6C 4DR5L 4GOPC 1VQ4A 4R4QA 1MJEA 3M7NA 1MKHA 4HIKA 1G291 4DR2L 5C4XG 2YYZA 1GKHA 3A5ZB 4LUZA 4OWTB 3UDGA 4Y52H 3KDFB 3KYHC 1Y1WH 1SLJA 2E2HH 1EOVA 3F2DA 4A3BH 3PGZA 2NVYH 3GDEA 1I6HH 4JI7L 3GTJH 5C0XJ 4JI0L 1S72A 4JI6L 2CCZA 2CQOA 1TWAH 3HOWH 1UE1A 4LF6Q 2BH2A 1JT8A 4OXPA 4BBRG 4NXMQ 3HOVG 4DK3C 4LFBL 3CF5A 3PIPA 2OTLA 2UXDQ 2VL6A 3M85A 1FVIA 1KAWA 2XTIA 4P72A 3NENA 5GAEC 3PO2G 1A62A 2L15A 4GNXB 3TRZA 3RLFA 5IYDG 1I94L 5DLQE 3PO2H 1XPOA 1VQ7A 2UU9L 1C7YA 1L1OB 1VQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NZH A;  3CPF A;  4DUY Q;  1S40 A;  4OO1 I;  3CC4 A;  2UXB Q;  1CSQ A;  4L5T A;  1PFS A;  3FKI G;  5LMU L;  1K9M C;  1X6O A;  5FLX c;  4L5Q A;  4JBJ A;  1KC8 C;  4X62 Q;  3J81 j;  2K5N A;  3G6E A;  2ZJQ A;  1X56 A;  1GD7 A;  3VDY A;  1HZ9 A;  1SFO H;  3AQQ A;  3SGI A;  4HIM A;  1X55 A;  5ELO A;  4Y7N H;  3D31 A;  4A76 A;  1CSP A;  5FJ8 H;  3CQZ H;  2VS1 A;  4EQ5 A;  4DV7 Q;  2JEB I;  1N9W A;  2MO1 A;  1CKN B;  4HJ5 A;  2AWN A;  3HFZ B;  3U4Z A;  2HHH Q;  2I5H A;  1HNW Q;  3UE0 A;  4JI2 L;  4L5S A;  1IL2 A;  4R4T A;  4LUV A;  5JEA G;  3F8T A;  3F2C A;  4YCV A;  5IP9 G;  1L2F A;  2EIF A;  1W3S A;  3DM3 A;  3TEH B;  5IWA Q;  1PH5 A;  2JEA I;  3AFQ A;  1VQB A;  4X65 L;  2A8V A;  1UE6 A;  2A1A A;  2OCE A;  1PH7 A;  3S2D H;  5FLM G;  5C4J H;  4R4O A;  4A3I G;  2I5L X;  1TXY A;  3G4S A;  3W1B A;  1FJG Q;  1YVC A;  1PV4 A;  4DR3 Q;  5JEA J;  4YCU A;  3L2P A;  2UU9 Q;  3WWV A;  4IJH A;  3T1H L;  4L5R C;  2EQS A;  3GO5 A;  4JBK A;  1KRT A;  2KBN A;  4DR2 Q;  3A0J A;  4HJ8 A;  3K80 C;  2GVB A;  2IX0 A;  3KF6 A;  3CCS A;  4OX9 Q;  3GTQ H;  2F3I A;  1VQN A;  4DV2 L;  3BU2 A;  3S1M H;  2K4K A;  3RLO A;  4LUO A;  4UP9 A;  3GTM H;  3CW2 C;  1P16 A;  4LFA L;  1BKB A;  1XNQ Q;  4LFB Q;  1Q81 C;  2RCN A;  4DV4 L;  4R4C A;  2CFM A;  2NVQ H;  4HIO A;  3HOU G;  5FJ8 G;  3U4V A;  5IP9 H;  4JYA Q;  1HNZ L;  1QVC A;  2HQL A;  3J81 i;  2R6G A;  3CMA A;  1U5K A;  4LF8 Q;  1OXX K;  4DV4 Q;  4NXN L;  4JI4 L;  4NB3 A;  1XNQ L;  1J5E Q;  3HKS A;  3CCQ A;  4HID A;  1Q7Y C;  3UDI A;  1MJC A;  4GNX A;  2NVT H;  2NN6 I;  1N36 L;  2WB1 G;  2E2I H;  4HJ7 A;  2I5M X;  1H95 A;  4JCV E;  1WOC A;  2RHS B;  1EYG A;  1QVF A;  1PH3 A;  1YHB A;  4DR7 L;  2HT1 A;  2UUC L;  3CCV A;  4B3S L;  3HOW G;  1T9H A;  3CCR A;  2E5L Q;  4P74 A;  1WJJ A;  1N32 Q;  2K5V A;  4IPG A;  4P71 A;  1V43 A;  4A75 A;  4DV3 Q;  4C3I H;  1BVS A;  1VQF A;  1QZH A;  1SMX A;  2PI2 A;  3EBE A;  1W2B A;  5H1S E;  2VUM H;  4BBS H;  3KJP A;  1UEB A;  2K75 A;  1VQL A;  3PV0 A;  3Q8D A;  3AYH B;  3STB D;  4X66 Q;  4YHH L;  2KCT A;  4HJA A;  1E24 A;  4BBR H;  1N34 L;  1HNX Q;  4BXX G;  4JOI C;  3ULJ A;  1CKM A;  1CUK A;  2HIV A;  4FDB A;  5GQO A;  1AE3 A;  5IYB H;  2C35 B;  3G71 A;  5IYB G;  3GD7 A;  2D0O A;  1XPR A;  1CKN A;  2OTJ A;  3IRB A;  2UUA L;  2B29 A;  5C3E H;  1R9T H;  2K5H A;  4GOP A;  5C44 H;  3S1Q H;  5J3B A;  1WCM H;  1IBM L;  4B3T L;  3HOV H;  3GTP H;  4B3R L;  4IFD G;  3ULP A;  4YCW A;  5M3F H;  2KCM A;  2Z6K C;  4LF7 Q;  2JA7 G;  2CKZ B;  4O2D A;  1YJ9 A;  2QEX A;  4PMW A;  4DAY B;  4KI0 A;  4X62 L;  1C9O A;  4MTN A;  1G51 A;  2FXQ A;  4A3I H;  1IXR A;  4DV5 Q;  5LMU Q;  3PIO A;  4IO9 A;  4DNI A;  4AYB E;  1E3P A;  1ASZ A;  1HH2 P;  3S16 H;  3CCE A;  4JI6 Q;  4A3L H;  1KXL A;  1QUQ A;  1VQD A;  1XTD A;  3EN2 A;  2UUB L;  3ICE A;  4BXX H;  3T1Y L;  1LYL A;  2LXK A;  1YBY A;  4GN5 A;  3HOZ G;  4GLA C;  3M9B A;  3M4Q A;  4GLX A;  3RNU A;  2I0Q A;  1YZ6 A;  1FL0 A;  2KHI A;  1JB7 A;  5M5Y H;  4DR1 L;  3I4O A;  4POF A;  3T1Y Q;  4UY8 C;  1G6P A;  3KDF A;  1HR0 L;  1OXT A;  1EQR A;  5BR8 L;  1BBW A;  3I4M H;  4DV1 Q;  4DR6 Q;  2UXD L;  3AFP A;  1K83 H;  4NXM L;  1N33 L;  1I50 H;  1LTL A;  2IHE A;  2WAQ E;  3HOX H;  1X65 A;  4A3C G;  1HJP A;  3I56 A;  2JA6 H;  1S3O A;  2A19 A;  2OQ0 A;  5IT9 c;  1N8R C;  4A3D G;  4IPD A;  1HNX L;  4JG2 A;  4BA1 I;  2IY5 B;  2D62 A;  3HKZ E;  4X66 L;  3F2B A;  3S1N H;  1K73 C;  1Z47 A;  1XNR Q;  1Q46 A;  3JC6 6;  1VQI A;  1VQJ A;  4A3J H;  1Y1V G;  3LGJ A;  1YIT A;  3AEV A;  2UXC L;  3FP9 A;  1B7Y B;  1SRU A;  3TQY A;  5GAD C;  4BY7 G;  1Q12 A;  3FKI H;  4B3R Q;  2K50 A;  5IYC G;  3KJO A;  1KD1 C;  4YY3 Q;  1IBM Q;  4XTC S;  4K0K Q;  2CWA A;  3RZO H;  4YWL A;  1Z9F A;  3HOY G;  3MXN B;  2YU9 H;  2F4V Q;  4AQY L;  2AHO B;  3CPW A;  1I5F A;  1A63 A;  4APV A;  1B70 B;  4GS3 A;  4TQU S;  1VQ5 A;  4LWC A;  1NE3 A;  3FHW A;  1PYB A;  2JA9 A;  3K7U C;  3PF4 A;  4A93 H;  1IBK Q;  4OON A;  4BBS G;  1YIJ A;  4IJL A;  2WP8 J;  2UXC Q;  2DUD A;  4NXN Q;  4ME3 A;  2YTV A;  2JE6 I;  4JI1 L;  4LF8 L;  5EAY A;  2N49 A;  4IOA A;  1HNZ Q;  3PO3 G;  3U58 A;  3E9H A;  2AWO A;  4LF4 Q;  3CD6 A;  2ZM6 L;  2MO0 A;  2K52 A;  5ELN A;  3W5O A;  2F4V L;  4KHP Q;  3BJU A;  4LFA Q;  3G48 A;  5BR8 Q;  3CXC A;  1ASY A;  2VNU D;  1HR0 Q;  2R93 H;  1PYS B;  3RR5 A;  3PUY A;  2MQH A;  1X54 A;  1V1Q A;  5LMN W;  2E2J H;  4B3M L;  1SE8 A;  2JK8 A;  3CP0 A;  1XNR L;  4A3G G;  2AKW B;  4DR3 L;  5AJ3 Q;  1IYJ B;  1FJG L;  1Q8K A;  1K8A C;  2BA1 A;  4PZ8 A;  1QVG A;  1OXV A;  1IBL L;  4JI3 L;  4GNX C;  1TWG H;  2ES2 A;  4X6A H;  4C3H H;  3OTO L;  2JJQ A;  4UPA A;  4J15 A;  1VQE A;  1NBW A;  4LF5 L;  2F52 A;  3K7A H;  4GN4 B;  2R92 G;  1B8A A;  2KEN A;  1D7Q A;  1XJV A;  1UWV A;  3NEM A;  3M3Y H;  4JI2 Q;  1LUZ A;  1KIX A;  4RG1 A;  4OWX B;  1P8L A;  1UE5 A;  5M3M G;  1KRS A;  3UE1 A;  3K0X A;  1XMQ L;  3K8A A;  2UUA Q;  3CCJ A;  2WFW A;  5M3F G;  3KFU A;  1VQO A;  2KHJ A;  2YV5 A;  1A8V A;  1NMG A;  2JA8 H;  3H3V I;  1L1O A;  2BH8 A;  4QGU A;  1X3G A;  3MEF A;  3KLW A;  3W1G A;  5IP7 H;  4A3M G;  1QZG A;  4JC0 A;  4BY1 G;  3S17 H;  2WB1 E;  2VUM G;  1Q82 C;  5E7N A;  2YTY A;  4BY1 H;  4POG A;  1PH8 A;  3J80 i;  1VS0 A;  2H5X A;  1KQS A;  2VQE L;  2HHH L;  4DV3 L;  3A74 A;  4QIW E;  1C0A A;  4GKK L;  2YTX A;  2N8N A;  1VQP A;  2Q2H A;  4MNO A;  4QY7 A;  4DV7 L;  1VQK A;  3I55 A;  3CC7 A;  2ZJP A;  1XMQ Q;  3B6Y A;  2E5L L;  2Q2T A;  3HOZ H;  5JJI A;  3PCO B;  4A3E G;  2ZTC A;  2EXD A;  4LF9 Q;  1X3E A;  3S2H H;  4A3L G;  4JOI A;  5M3M H;  2VW9 A;  1YHQ A;  4JI5 Q;  1HNW L;  3H3V H;  2Z0S A;  1RL2 A;  2R92 H;  3PO3 H;  1M90 C;  3I4M G;  2IT1 A;  3ERS X;  4XIG S;  1SN8 A;  1NY4 A;  1NJI C;  1RIP A;  5FLM H;  1VQM A;  1J5E L;  1K8G A;  4JI3 Q;  1YEZ A;  1WCM G;  4NPS A;  2ASB A;  4DPG A;  3J7A 5;  3NBH B;  5JJK A;  3S15 H;  1KL9 A;  4JI7 Q;  3A5U A;  3KF6 B;  1GM5 A;  2UUC Q;  1JJC B;  3HOU H;  4DR7 Q;  5K36 G;  2MNA A;  1BBU A;  1IZ6 A;  1M1K C;  3HOY H;  2QGQ A;  3M4P A;  1EUJ A;  3CME A;  4DV2 Q;  2NVX H;  2N3S A;  4OX9 L;  1NMF A;  3J80 c;  3OW2 A;  1GVP A;  3J81 c;  1UE7 A;  1PH4 A;  1Y1W G;  2R7F A;  4H02 A;  5GAG C;  4A3F G;  4JI4 Q;  4LF6 L;  1CKO A;  5IY0 A;  1PH9 A;  1HR0 W;  4OO1 G;  4X64 L;  4DV0 Q;  1E22 A;  2LXJ A;  3F1Z A;  4GKJ L;  2NN6 G;  4JYA L;  4AIM A;  4A3D H;  2E8G A;  1PVO A;  3PSI A;  3TS0 A;  4R4I A;  1DGS A;  1HZC A;  4WJ3 M;  2Y0S G;  4B3M Q;  4YWM A;  1VQ9 A;  2OQK A;  3CAM A;  4X65 Q;  3STB C;  4A93 G;  3U50 C;  5C4X H;  4A3F H;  1YHA A;  1YJW A;  5GAH C;  4UP7 A;  3CCM A;  1J6Q A;  2JQO A;  1XMO Q;  2DGY A;  2B3G A;  2V1C C;  4P73 A;  3RN2 A;  4IFD J;  4C3J H;  3ER0 A;  3UDX A;  4JI5 L;  1WI5 A;  4KHP L;  1MIU A;  3T1H Q;  1KHI A;  2ZM6 Q;  2Z6K A;  1D8L A;  4LF4 L;  4AH6 A;  4PZ7 A;  2QA4 A;  5M5X H;  3CC2 A;  2PQA B;  1WYD A;  1VQA A;  3TRE A;  1Q1B A;  1EQQ A;  2ZTE A;  1EFW A;  3ZJY C;  2R93 G;  1TWF H;  4RMF A;  5IWA L;  4WJ4 A;  5M5W H;  2LSS A;  5LMN L;  4LW1 A;  1JJ2 A;  3S24 A;  1TWC H;  4LFC Q;  2R7Z H;  4GOP B;  3CCU A;  1JMC A;  3PUZ A;  1VQ8 A;  1E7Z A;  3KOJ A;  3PUW A;  3CCL A;  3EIV A;  2UXB L;  1OXS C;  2R7D A;  4DV1 L;  3GTK H;  4DUY L;  3S14 H;  4DR6 L;  2GN5 A;  3ULL A;  5C3E G;  4IPH A;  2ATW A;  4DV6 Q;  4GKK Q;  4JV5 L;  4DUZ L;  2VQE Q;  4IOC A;  3NEL A;  4C2M H;  2PMZ E;  4JBW A;  4KLK A;  4JI8 Q;  4A3K G;  1PH6 A;  4GN3 B;  3OYY A;  4LNQ A;  4OWW B;  5JJL A;  1JE5 A;  4HJ9 A;  3PUV A;  1Y14 B;  4A3M H;  1PH1 A;  2UUB Q;  5C0X G;  3OTO Q;  2JA8 G;  5IYD H;  2B63 H;  1HZA A;  5IP7 G;  1EIF A;  4PZ6 A;  4DKA C;  4DV5 L;  1XPU A;  4BY7 H;  1K3R A;  2N78 A;  4MZ9 A;  5HY6 A;  5IYC H;  3H0G H;  4QL5 A;  5AJ3 L;  1X3F A;  2PNH A;  2JA5 H;  4EX5 A;  4PG3 A;  3L7Z C;  1PA6 A;  4QJF A;  3H0G G;  2ZJR A;  1LM0 A;  2R7Z G;  4JBM A;  3E9I A;  3GTL H;  1I94 Q;  4DR1 Q;  4GLV B;  4UP8 A;  4JI8 L;  1AE2 A;  2K14 A;  2BA0 A;  3K81 C;  4TVA B;  3RZD H;  3KF8 B;  4O0A A;  4DR5 Q;  4JV5 Q;  4B3T Q;  3JAM i;  3L0O A;  2WAQ G;  5IE8 A;  3PUX A;  4LF5 Q;  4DAM A;  2VQF L;  2JA5 G;  4JI0 Q;  3E0E A;  4ALP A;  1IBL Q;  1TWH H;  1VQG A;  3I2Z A;  3HKZ G;  4DR4 Q;  4IFD I;  3HOX G;  3RLN A;  1E1T A;  3RN5 A;  2MFI A;  2XGT A;  4LF9 L;  4LFC L;  3GTO H;  2AMC B;  2ID0 A;  1K0R A;  1A0I A;  1FGU A;  4LF7 L;  4A3G H;  1OXU A;  2HIX A;  4A3K H;  4A3J G;  3GTG H;  2ALY B;  2RF4 A;  4IPC A;  5GRO A;  4DUZ Q;  3S1R H;  1OTC A;  1SRO A;  5HGQ A;  4DV6 L;  1YJN A;  2Q2U A;  4R1J A;  4AYB G;  3PF5 A;  2VZA A;  4KHZ A;  1VQC A;  2PI2 E;  4AQY Q;  3I7F A;  1PH2 A;  2PQA A;  3JAM c;  1Y1V H;  1HZB A;  1I3Q H;  2Q2I A;  4A3E H;  1GO3 E;  2B63 G;  1VQH A;  3D0F A;  4YHH Q;  1E1O A;  2ZTD A;  3J7Z C;  1N34 Q;  1EIY B;  3TS2 A;  2IHF A;  1YNX A;  4JI1 Q;  1L1O C;  4A3B G;  1EWI A;  2GVA A;  5C0X I;  5LMN Q;  1N36 Q;  4A3C H;  2JA6 G;  4P75 A;  3BZK A;  1X9N A;  1IBK L;  5C44 G;  2OWO A;  4QQB X;  4YWK A;  2RHQ B;  1V9P A;  3BZC A;  3H15 A;  1Q1E A;  2D0P A;  3I4N G;  3UDF A;  4GKJ Q;  1N32 L;  3I4N H;  4DV0 L;  4X64 Q;  4B3S Q;  4DR4 L;  1YI2 A;  1SR3 A;  2Y0S E;  1WFQ A;  2IX1 A;  1AH9 A;  1N33 Q;  1QUQ B;  3M4O H;  2JA7 H;  1VCI A;  4BA2 I;  2VY3 A;  2VQF Q;  1PHJ A;  1O7I A;  1U0L A;  2CWP A;  4A4I A;  4K0K L;  3DLL A;  1NTG A;  1XMO L;  2NZO A;  4YY3 L;  1Q86 C;  1JJG A;  1L0W A;  4DK6 C;  4DR5 L;  4GOP C;  1VQ4 A;  4R4Q A;  1MJE A;  3M7N A;  1MKH A;  4HIK A;  1G29 1;  4DR2 L;  5C4X G;  2YYZ A;  1GKH A;  3A5Z B;  4LUZ A;  4OWT B;  3UDG A;  4Y52 H;  3KDF B;  3KYH C;  1Y1W H;  1SLJ A;  2E2H H;  1EOV A;  3F2D A;  4A3B H;  3PGZ A;  2NVY H;  3GDE A;  1I6H H;  4JI7 L;  3GTJ H;  5C0X J;  4JI0 L;  1S72 A;  4JI6 L;  2CCZ A;  2CQO A;  1TWA H;  3HOW H;  1UE1 A;  4LF6 Q;  2BH2 A;  1JT8 A;  4OXP A;  4BBR G;  4NXM Q;  3HOV G;  4DK3 C;  4LFB L;  3CF5 A;  3PIP A;  2OTL A;  2UXD Q;  2VL6 A;  3M85 A;  1FVI A;  1KAW A;  2XTI A;  4P72 A;  3NEN A;  5GAE C;  3PO2 G;  1A62 A;  2L15 A;  4GNX B;  3TRZ A;  3RLF A;  5IYD G;  1I94 L;  5DLQ E;  3PO2 H;  1XPO A;  1VQ7 A;  2UU9 L;  1C7Y A;  1L1O B;  1VQ6 A; 
#chains in the Genus database with same CATH topology
 1S5E D;  2NZH A;  1CSQ A;  4KD4 A;  1QWY A;  5KYI A;  1Q3L A;  5C3W A;  3GV3 A;  3K5M A;  3OMG A;  5KNC A;  4HCS A;  2ZJQ A;  1PRT F;  4UDU C;  1GD7 A;  2DNC A;  3CQZ B;  2QW7 A;  2WIN B;  3VDY A;  3SGI A;  1X55 A;  3FDT A;  1SXT A;  3K0Y A;  4Y7N H;  2BE5 D;  1HTL D;  2XSC A;  5IT9 L;  5FO7 B;  4A76 A;  2F0Q A;  2VS1 A;  4CKB A;  2MO1 A;  1JOK A;  3HFZ B;  1ESF A;  2KHS A;  2EIF A;  3TEH B;  1BCP C;  3AFQ A;  1I4G A;  1VQB A;  2A8V A;  1HPC A;  1PTO F;  1UE6 A;  1PH7 A;  4R4O A;  2F0V A;  4A3I G;  2EYP A;  3LNN A;  1K3B C;  4IUU A;  1FJG Q;  2EXZ A;  4YCU A;  2UU9 Q;  4ZUI A;  5CV6 A;  4L5R C;  1E2Z A;  3GO5 A;  1XX8 A;  5IGE A;  3A0J A;  2EE1 A;  1W6J A;  2CW0 D;  2GVB A;  2IX0 A;  3K80 C;  5COY A;  2F3I A;  1IL8 A;  3I90 A;  3S9W A;  1WTX A;  2F0T A;  3S1N B;  4UP9 A;  5JAV A;  2E76 C;  1V8Q A;  5KIX A;  2L4N A;  5IP9 H;  1HNZ L;  4ID6 A;  4H44 C;  5I6W A;  2F0D A;  3S14 B;  1K8M A;  4LF8 Q;  3FPU B;  1SYE A;  4NXN L;  5CC4 A;  3A55 A;  1E0B A;  1Q7Y C;  1MJC A;  2EOT A;  2B2U A;  3KF8 A;  4H13 C;  2FFK B;  2WB1 G;  2E2I H;  4JCV E;  4M1U B;  2X69 A;  4B9W A;  4H7B A;  5EKI A;  1WD1 A;  4IFD H;  2HT1 A;  1LAB A;  1SSO A;  1T9H A;  2MUY A;  4IUV A;  1N32 Q;  4IPG A;  3KBG A;  1Z7T A;  3A56 A;  4A75 A;  2EJF C;  2N55 A;  1VQF A;  2ENB A;  1SMX A;  2PI2 A;  1EEF D;  3H6M A;  1DCZ A;  5KRU A;  4HJA A;  1GM5 A;  1F2L A;  1R9T B;  1HNX Q;  4BBR H;  1SFO B;  4JOI C;  4PMB A;  1CKM A;  5CV5 A;  1NUC A;  5GQO A;  1AE3 A;  3G71 A;  2F0P A;  2L55 A;  4IUN A;  2B29 A;  3N52 A;  5C44 H;  2AUJ D;  1CQF A;  4G7Z C;  1FD7 D;  1IBM L;  4B3R L;  2E2J B;  3OSO A;  4XXE A;  4JK1 C;  2O5J C;  1F9S A;  1G51 A;  2D5D A;  2C5C A;  4AYB E;  3J80 L;  1HH2 P;  1KXL A;  5EBC A;  3CCE A;  4JI6 Q;  3ICE A;  4V19 0;  1KAA A;  4C3H G;  1LYL A;  2FIN B;  2F0H A;  3CHB D;  4GN5 A;  5FLX L;  2JA5 B;  3M4Q A;  3RNU A;  1LTI D;  1RF2 D;  3QG1 A;  1JB7 A;  3Q6S A;  4R9W A;  5E1F A;  3I4O A;  3HGB A;  3T1Y Q;  3KDF A;  1HR0 L;  1OXT A;  1C8C A;  4PV1 C;  5JOB A;  3I4M H;  2MHV A;  2B2T C;  5C4H A;  1N33 L;  1HTP A;  1Q90 A;  1N8R C;  4A3D G;  4BA1 I;  2D62 A;  5JJZ A;  1Q46 A;  1YIT A;  1VQI A;  5M5Y B;  3FKI B;  1KNA A;  1SRU A;  1GXD C;  2X6L A;  4B3R Q;  3T16 A;  5IYC G;  1KD1 C;  2B2W C;  2CWA A;  2NWG A;  3T51 B;  3HOY G;  3MXN B;  2YU9 H;  3ERQ A;  1G91 A;  2BE5 C;  1VQ5 A;  1NE3 A;  3FHW A;  1PYB A;  5KNB A;  4CGY B;  1I4R A;  3NWT A;  4BBS G;  4IJL A;  3D6C A;  2YTV A;  4ZRZ A;  2G9H D;  4JI1 L;  3E9H A;  2ZM6 L;  3NTH A;  5C4X B;  4RCN A;  3G48 A;  3GTO B;  2Q8T A;  3RR5 A;  1ML0 D;  4RHS A;  3A7L A;  3KK7 A;  1KLG D;  5M3F B;  4RFB A;  4KY6 A;  1WTW A;  1HXY D;  1FNV A;  2XRQ D;  1JC7 A;  1PFN A;  5AJ3 Q;  1SYG A;  1IYV A;  4Q0F A;  1IBL L;  4JI3 L;  1STB A;  4X6A H;  1SJE D;  2F52 A;  3K7A H;  2R92 G;  2KEN A;  3EA6 A;  4G4K A;  4ILW A;  3SR1 A;  4KY7 A;  4MTK A;  5M3M G;  1UE5 A;  2NYZ D;  3J7A V;  3IFT A;  3TZD A;  1SNO A;  5EPK A;  1XMQ L;  3K8A A;  2K6A A;  1U4L A;  5M3F G;  1IW7 C;  1VQO A;  2A6H C;  3J81 E;  2E75 C;  1A8V A;  2EJM A;  2BH8 A;  4QGU A;  1PFM A;  1X3G A;  4C2M B;  4G7H C;  4A3M G;  2LKV A;  2YTY A;  4OIJ A;  2JSO A;  3BDL A;  1SND A;  1KQS A;  1VMP A;  4QIW E;  1MGS A;  1QNK A;  5DAU A;  1C0A A;  4GKK L;  2N8N A;  1ESR A;  4MNO A;  1GUT A;  4QY7 A;  2MPM A;  3HOZ H;  3I55 A;  2PPB C;  1FR3 A;  3PCO B;  4LF9 Q;  2F0N A;  5LHY 1;  4LMQ D;  3U9O A;  1HNW L;  3WOF A;  2Z0S A;  5IGG A;  1SN8 A;  4FP5 D;  1NJI C;  5FLM H;  4JI3 Q;  2EDG A;  1YEZ A;  1RHP A;  3J7A 5;  1EY4 A;  5JJK A;  4QB4 A;  2ZXR A;  1HUN A;  1JJC B;  4TSS A;  4DR7 Q;  5K36 G;  1BBU A;  1DJR D;  1M1K C;  2F0L A;  3J80 c;  1TQO A;  3OW2 A;  5KYL A;  3J81 c;  2ZT9 C;  1RDP D;  1DOK A;  4A3F G;  3HOV B;  1HR0 W;  4X64 L;  4DV0 Q;  5IIF A;  1E22 A;  2LXJ A;  4GKJ L;  4JYA L;  3T4A C;  1AZP A;  2E8G A;  1PVO A;  2IPK D;  4XQN A;  3TS0 A;  2EYM A;  2KJX A;  4B3M Q;  5D3I B;  1GUN A;  3FEW X;  1YHA A;  5IGF A;  1ET9 A;  1A2U A;  5AFW A;  4X3T A;  4IFD J;  2EYL A;  3UDX A;  1WI5 A;  1JB3 A;  3QB3 A;  1H9M A;  2Z6K A;  5FLX E;  4LF4 L;  4QUC A;  4AH6 A;  4PZ7 A;  4A93 B;  2RDH A;  1WYD A;  1VQA A;  5HUR A;  1WVL A;  1EFW A;  1LT6 D;  3SK5 A;  1PZI D;  4LK1 C;  5M5W H;  4J1M A;  3S24 A;  4BWG B;  1TWC H;  3HOZ B;  1ET6 A;  2P5Z X;  3CCU A;  1JMC A;  3PUZ A;  2KUM A;  1VQ8 A;  1KDB A;  2J0T D;  3PUW A;  5FO9 B;  2K7V A;  1OXS C;  4HSV A;  1HQM C;  4JW0 A;  3ULL A;  5C3E G;  4CDC C;  4JV5 L;  1PZJ D;  2NVQ B;  3NEL A;  4C2M H;  2R3Z A;  2PMZ E;  4M8A A;  5J39 A;  3OYY A;  4LNQ A;  3JAM L;  1JE5 A;  1Y14 B;  4A3M H;  1PH1 A;  3GTQ B;  1RTN A;  4CHT B;  4EQO A;  1RD9 D;  4WFN 3;  5I6Y A;  4TKO B;  1EIF A;  2F0G A;  4DKA C;  4DV5 L;  4BY7 H;  1K3R A;  4JI0 Q;  5IYC H;  4QL5 A;  4PG3 A;  4QJF A;  2ZJR A;  1BQQ T;  2I07 B;  1I94 Q;  4JI8 L;  1L0X B;  4HED A;  4TVA B;  3KF8 B;  5FO8 B;  3VYR A;  4A3D B;  2WAQ G;  4LF5 Q;  1I4H A;  2TMP A;  4ALP A;  3I2Z A;  3HKZ G;  4DR4 Q;  4IFD I;  3M7G A;  3RLN A;  3JAM E;  2K1B A;  5C0X H;  2AMC B;  5CV4 A;  1X3Q A;  1ZKO A;  3OIP A;  4LF7 L;  4RA8 A;  3HOY B;  4A3K H;  5JPM C;  3GTG H;  1BOS A;  4IAL A;  4KJO A;  5GRO A;  4DUZ Q;  5D3D A;  1OTC A;  1SRO A;  2B2T A;  2Q2U A;  4OO1 H;  1G6Z A;  3NQT A;  4RCO A;  4AYB G;  4EQP A;  2VZA A;  4KHZ A;  2NB0 A;  4AQY Q;  3I7F A;  4BY7 B;  3VR2 A;  1JIC A;  2PQA A;  2Q2I A;  2K04 A;  4K6L A;  1KNE A;  1N34 Q;  2ZTD A;  3TS2 A;  1A3T A;  1E2W A;  4K14 A;  4A3B G;  2IHF A;  1NR4 A;  1YNX A;  1L1O C;  3L3O C;  3SK4 A;  2GVA A;  5HGT A;  5C0X I;  3AMU A;  1BCP D;  3W2D A;  4ZKB B;  2V4D A;  2DN8 A;  5I9P A;  4QQB X;  5E4X A;  2F0S A;  5CGK A;  5JPN C;  1UUP A;  2HCI A;  2IL8 A;  4NW2 A;  3SHL A;  4B3S Q;  1S5D D;  4RGO S;  3DWA A;  2L1B A;  2XRS D;  1N33 Q;  3NBH A;  1PYW D;  4BA2 I;  1EEI D;  1O7I A;  1TWC B;  1D1K A;  5JVH 3;  1XMO L;  2NZO A;  2XIW A;  4YY3 L;  1L0W A;  4DAY A;  1SYF A;  4DK6 C;  1VQ4 A;  5EKK A;  1Y8P B;  2E74 C;  4LUZ A;  3KDF B;  1SLJ A;  1SNP A;  2E2H H;  3PGZ A;  4ZYS A;  1EY5 A;  3DXJ C;  4JI6 L;  2CQO A;  2KEE A;  1TWA H;  1UE1 A;  4LFB L;  4BBR G;  2UXD Q;  3M85 A;  1FVI A;  1KAW A;  3NPP A;  1ENF A;  4CJ1 B;  2K33 A;  3RLF A;  4EVO A;  2CHB D;  1VQ7 A;  2R61 A;  1TKW B;  1SE3 A;  1L1O B;  3SDZ A;  1VQ6 A;  4OO1 I;  3TN2 A;  3CC4 A;  3L9A X;  1PFS A;  3G6J B;  3DUZ A;  2MP1 A;  5LMU L;  1K9M C;  3K58 A;  4J8Q A;  2IWH A;  1KC8 C;  2QDL A;  4ZQ3 A;  4X62 Q;  3G6E A;  3R93 A;  1LT4 D;  3PIO 3;  4IN3 A;  1HZ9 A;  3ZYY X;  3AQQ A;  4HIM A;  3HG9 A;  4K2L A;  3J7A F;  4CBV A;  1TS4 A;  4IQZ A;  4KKS A;  1CSP A;  4EQ5 A;  2JEB I;  1N9W A;  4KD3 A;  1CKN B;  4HJ5 A;  2I5H A;  3P20 A;  1AP0 A;  4K5V A;  4R4T A;  4KHV A;  3F2C A;  1L2F A;  3OMC A;  4RGM A;  1PH5 A;  2JEA I;  1SE4 A;  2FHT A;  2PZT A;  3CRL C;  3FMC A;  3MA2 B;  2OCE A;  2F03 A;  2A73 B;  1YVC A;  3L2P A;  3KLR A;  3T1H L;  4DGZ A;  2F3V A;  5C3X A;  4HJ8 A;  2NN6 H;  3GTQ H;  5ELE A;  4DV2 L;  3BU2 A;  2K4K A;  4LUO A;  1P16 A;  4LFA L;  1XNQ Q;  1CT1 D;  3HOU G;  2NVQ H;  2CFM A;  1ZYR D;  1EQT A;  1V1P A;  1H9K A;  1PTO C;  1EQV A;  3J81 i;  4KKT A;  2R6G A;  3K57 A;  3CMA A;  3X3M A;  5IOC A;  4DV4 Q;  4JI4 L;  4LAA A;  4NB3 A;  1XNQ L;  2AQ1 B;  3UDI A;  2JXM B;  1HA6 A;  4GNX A;  2NN6 I;  3N6R A;  4PNY A;  1N36 L;  3MHB A;  5I2Y A;  4HJ7 A;  1H95 A;  2RHS B;  2K5D A;  1DD2 A;  1QVF A;  2MJ8 A;  4K5X A;  1SYD A;  4B3S L;  2LMC B;  2EVB A;  4P74 A;  1BCP B;  3VR6 A;  1PRT C;  4DV3 Q;  4DU9 A;  1TII D;  5H1S E;  2D2C C;  4K8J A;  5T1I A;  4BBS H;  2K5W A;  3STB D;  3AYH B;  5C3E B;  1N34 L;  4X3S A;  1YNJ C;  4Y7N B;  2OTJ A;  2C35 B;  3WDN A;  1T5X D;  1MBY A;  3J7Y W;  3HOV H;  3GTP H;  4IFD G;  5L37 A;  3IL8 A;  4LF7 Q;  4DF7 A;  1M8A A;  2JA7 G;  2CKZ B;  1YJ9 A;  2RQX A;  4ZUJ A;  1STH A;  2D9U A;  4PMW A;  4MTN A;  1U4R A;  5FKA C;  5JVG 3;  5LMU Q;  2YU9 B;  3S16 H;  1QUQ A;  1VQD A;  3EN2 A;  1STG A;  4BXX H;  3A54 A;  3HOZ G;  4KKU A;  3M9B A;  2HDM A;  5M5Y H;  4KK7 A;  1HRJ A;  1G6P A;  1EQR A;  2AUK A;  2QDB A;  3RUZ A;  3AFP A;  1LTL A;  2IHE A;  3D6W A;  1S4Z A;  3OWF A;  4IPD A;  1KDC A;  1ROD A;  3HKZ E;  1EFI D;  3S1M B;  3NE5 B;  3TQY A;  3J81 L;  1Y69 U;  2FMM A;  2DY7 A;  1NNX A;  2VB2 X;  2JN4 A;  1U4P A;  4FO2 A;  1AN8 A;  3SVM A;  1Z9F A;  4HMJ A;  3CPW A;  1I5F A;  4APV A;  1B70 B;  4GS3 A;  4DN4 M;  5EKL A;  4LWC A;  3TZU A;  2Z4H A;  2WP8 J;  3V05 A;  3D4D A;  4ME3 A;  2N49 A;  4C3J B;  2F0O A;  2AWO A;  3OIQ A;  4LF4 Q;  3W5O A;  5ELN A;  3HRZ C;  4KHP Q;  3BJU A;  1ASY A;  1D5X C;  2VNU D;  1G2S A;  2HCC A;  1V1Q A;  1LT5 D;  3TME A;  3VR4 A;  4B3M L;  2F4I A;  4A3G G;  1KLU D;  2AKW B;  3DWP A;  1IYJ B;  4P2C B;  3MWY W;  4PZ8 A;  1QVG A;  1OXV A;  3HOU B;  1TWG H;  3OTO L;  2RBM A;  4J15 A;  1MI2 A;  4K5W A;  1NAP A;  1D7Q A;  1UWV A;  3NEM A;  4U67 3;  1DOM A;  4RG1 A;  1SE2 A;  1KRS A;  3G7L A;  4YIJ A;  3UE1 A;  3CCJ A;  2WFW A;  3A8J E;  2YV5 A;  2JA8 H;  3H3V I;  1L1O A;  2A68 D;  3TP7 A;  3KLW A;  1TS5 A;  5IP7 H;  5LL6 X;  1I4Q A;  4JC0 A;  3S17 H;  3I73 A;  3E3X A;  4BY1 H;  4CDD C;  1PH8 A;  2H5X A;  2M2L A;  2AQ3 B;  2YTX A;  2EZV A;  4DV7 L;  4QCL A;  2R7Z B;  3CC7 A;  2ZJP A;  3B6Y A;  4DA2 A;  1F9R A;  1LTR D;  3BDC A;  4A3E G;  4Q5V A;  3S2H H;  4JOI A;  5G3L D;  3H3V H;  2R92 H;  1M90 C;  2IT1 A;  1R4Q B;  1O78 A;  1M4V A;  2BCO A;  5FK9 C;  2EY2 A;  2Y0S B;  2DY8 A;  1EZ6 A;  2VXW A;  1ZXT A;  5EPL A;  1KL9 A;  3A5U A;  2UUC Q;  1SEB D;  2MNA A;  1IZ6 A;  4C1N I;  2BDO A;  2QGQ A;  1J8I A;  2N3S A;  2IW3 A;  1F77 A;  4OX9 L;  3ONA B;  1Y1W G;  5GAG C;  4JI4 Q;  4LF6 L;  1CKO A;  5IY0 A;  2B63 B;  1G8Z D;  3C3L A;  2R93 B;  3F1Z A;  2M00 A;  2CQA A;  4HN7 A;  4WJ3 M;  4R4I A;  1DGS A;  2NVX B;  3PO2 B;  2Y0S G;  1BCP F;  1VQ9 A;  3U50 C;  3C46 A;  1XMO Q;  3DEP A;  2V1C C;  3H0G B;  4P73 A;  3RN2 A;  4C3J H;  2OT2 A;  5BN4 A;  2ZM6 Q;  4HMI A;  1BR9 A;  3GTJ B;  2QA4 A;  5M5X H;  2F0U A;  1I6H B;  2KED A;  1PTO B;  3NP8 A;  2R93 G;  1TWF H;  5IWA L;  2LSS A;  4LW1 A;  1A3V A;  4FF3 A;  5IOD A;  1MHW C;  3WOE A;  1HA5 A;  2RDF A;  4GOP B;  1A6X A;  1SNC A;  1O7L A;  3R3O A;  4A3J B;  3GQB A;  3EIV A;  2UXB L;  2XVS A;  3ND9 A;  3S14 H;  4DV1 L;  4DR6 L;  2ATW A;  4IPH A;  2NVY B;  4ABN A;  1SYC A;  1AEX A;  1JWM D;  4KLK A;  3BVG A;  4A3K G;  1PH6 A;  5JJL A;  2DJG C;  3PUV A;  4X3K A;  1H9S B;  5C0X G;  2HQE A;  2L9H A;  2QIL A;  2X6G A;  5IYD H;  1LV9 A;  1HZA A;  1XPU A;  4MZ9 A;  2N78 A;  1GUW A;  2Z9H A;  3H0G H;  4NDX A;  1X3F A;  4N8F A;  3I8Z A;  3E9I A;  4H0L C;  1IW7 D;  4DR1 Q;  1CZG A;  4L63 B;  4KMU C;  4RH6 A;  3S16 B;  2K14 A;  3NBI A;  4CJ0 B;  3IKJ A;  1WTR A;  2K01 A;  5IT9 E;  1KDA A;  3PUX A;  3A8K E;  5DM7 3;  4DAM A;  1IBL Q;  4G57 A;  1VF5 C;  4UHV A;  1WTO A;  5BN5 A;  1B3A A;  1E1T A;  3RN5 A;  2XGT A;  4C3J G;  2PO4 A;  4LFC L;  3GTO H;  2J7Z A;  4OEM B;  1A0I A;  1FGU A;  1GJX A;  3BG3 A;  2KA7 A;  4IUR A;  1XWE A;  1YJN A;  3MAQ A;  1VQC A;  4CKE A;  4RAU C;  4BBS B;  3Q0A A;  1DON A;  1VQH A;  4YHH Q;  1E1O A;  1EIY B;  4JI1 Q;  3VR5 A;  5EQ0 A;  1B9N A;  1EWI A;  1N36 Q;  3HKZ B;  4P75 A;  3S2H B;  2OWO A;  2IJ0 A;  2PZU A;  2QEJ C;  3BZC A;  3H15 A;  1RCV D;  5DEH A;  2NVT B;  3UDF A;  1N32 L;  2H4O A;  2NTT A;  3QO2 A;  3I4N H;  4DR4 L;  1SR3 A;  1TY2 A;  2IX1 A;  1QUQ B;  3DWQ A;  2VY3 A;  1IHZ A;  1U0L A;  4A4I A;  1Q86 C;  4R4Q A;  4I7Z C;  1MKH A;  1I4P A;  1EY8 A;  2YYZ A;  3A5Z B;  4RWS C;  4A3B H;  1SNM A;  3TP5 A;  2NVY H;  3GDE A;  3BS1 A;  4HCE A;  4ZKC B;  2NTS A;  1S72 A;  1DZ1 A;  2FMC A;  3M4O B;  3HOW H;  1JT8 A;  2EY1 A;  1Q8I A;  3HOV G;  1EU3 A;  3QIA A;  4FXG C;  4RKB A;  4NKL A;  5KEE A;  3NEN A;  3E0J A;  5TSS A;  4F7X A;  5GAE C;  1TWG B;  5IYD G;  1XPO A;  1VDZ A;  1IYU A;  4DUY Q;  2Z8L A;  3CPF A;  1S40 A;  5DM6 3;  1II3 A;  4L5T A;  1DXM A;  1Y1V B;  2K28 A;  4JPB W;  1QIL A;  3AB9 A;  2OXP A;  1X6O A;  4EGV A;  2ICE C;  3NTK A;  3J81 j;  3NK9 A;  3EJI A;  2WAQ B;  1CFM A;  3UI2 A;  1YNN D;  1MSG A;  4BBR B;  1SFO H;  1VF7 A;  1IKM A;  5ELO A;  1XYI A;  3MFG A;  5ELF A;  5FJ8 H;  1WTP A;  1S5B D;  2AWN A;  4ZCK A;  3U4Z A;  4L5S A;  5JEA H;  2KVM A;  1J9O A;  1X32 A;  2F0I A;  3F8T A;  4ODG A;  1CA6 A;  1W3S A;  3PO3 B;  4L6T B;  3OOC A;  3A8I E;  2K03 A;  5A35 A;  1AZQ A;  1T5E A;  3S2D H;  5C4J H;  1O7Y A;  4DR3 Q;  3R8B A;  5JEA J;  3WWV A;  4JBK A;  2KBN A;  5D14 A;  3CCS A;  2B2Y C;  4A3B B;  1PFB A;  1VQN A;  3S1M H;  5EJW A;  2RCN A;  3K5O A;  4R4C A;  2PW5 A;  4JYA Q;  1SNQ A;  3V96 A;  3GTK B;  1QVC A;  2HQL A;  1U5K A;  4N9P A;  1OXX K;  2A69 D;  2HUG A;  2NVT H;  4HAE A;  1G2T A;  4FVM A;  1F9Q A;  1WOC A;  3QOJ A;  1EYG A;  2L12 A;  3GV6 A;  1YHB A;  4DR7 L;  1JWU D;  3CCV A;  3HOW G;  4ME5 A;  3CCR A;  2E5L Q;  4HSP A;  1WJJ A;  2K5V A;  2WB1 B;  3BDO A;  2G5D A;  1BVS A;  3GTP B;  1UEB A;  3HEJ A;  4BXX G;  4YHH L;  2KCT A;  1HNW Q;  1CUK A;  4LF9 L;  3IFD A;  3GD7 A;  2D0O A;  3ITP A;  1CKN A;  5IYB G;  1XPR A;  1EYA A;  3IRB A;  4A3K B;  1YNJ D;  5C3E H;  2UUA L;  2K5H A;  3GTG B;  4GOP A;  3V2T A;  2XN9 C;  5J3B A;  3F2U A;  3PQI A;  4YCW A;  2SNS A;  2Z6K C;  1PRT B;  1CHQ D;  1PRT D;  4O2D A;  3I70 A;  2QEX A;  2A6E D;  4KI0 A;  1C9O A;  3FPP A;  3BVM A;  3ND8 A;  3SK8 A;  4DV5 Q;  5C6A A;  3PIO A;  2EYH A;  1E3P A;  3RZO B;  1H9S A;  2UUB L;  2F0E A;  1JE4 A;  3T1Y L;  2LXK A;  3FVQ A;  4GLA C;  4GLX A;  2I0Q A;  5F2D A;  1YZ6 A;  1FL0 A;  2KHI A;  2RVL A;  4DR1 L;  4F8M A;  1GHK A;  1B1Z A;  1JOQ A;  3DHQ A;  4UY8 C;  2RA4 A;  1V1P B;  5BR8 L;  1CI3 M;  1K83 H;  4KN7 C;  1BBX C;  1I50 H;  3T53 B;  2JA6 H;  1FNU A;  4QIW B;  4ZK9 B;  2A19 A;  1SJH D;  1HNX L;  4JG2 A;  4PQX A;  4XYO A;  3F2B A;  1JOR A;  4KTA A;  1XNR Q;  1YNN C;  4A3J H;  3LGJ A;  4WJW A;  3AEV A;  2UXC L;  3FP9 A;  4BY7 G;  1IBM Q;  1LLR D;  4XTC S;  3CU7 A;  2WKC A;  1EL0 A;  2F4V Q;  4AQY L;  2AHO B;  1ILQ A;  4B9X A;  2MGS A;  5M5X B;  1JCK B;  4TQU S;  2JA9 A;  3PF4 A;  4DXG A;  1OO9 B;  1IBK Q;  1YIJ A;  1LAC A;  2UXC Q;  1HUM A;  4NXN Q;  1LT3 D;  3S1Q B;  2JE6 I;  3H09 A;  1QCB D;  4LF8 L;  3C1F A;  5EAY A;  2IX3 A;  1HNZ Q;  1D6E C;  4C3H B;  3CD6 A;  2K52 A;  3S1R B;  2F4V L;  2NBF A;  3I91 A;  5BR8 Q;  1HR0 Q;  2R93 H;  1PYS B;  3D3R A;  2MQH A;  2F3W A;  5CMD A;  4C3I B;  4XT3 B;  5LMN W;  1SE8 A;  3CP0 A;  1XNR L;  2RSO A;  4DR3 L;  2HD3 A;  1FJG L;  1GUS A;  1Q8K A;  1FNW A;  4TRD A;  3RZD B;  2ES2 A;  1U4M A;  2JA7 B;  2JJQ A;  5NUC A;  1NBW A;  2A6H D;  4GN4 B;  1B8A A;  2EJG C;  2KQ3 A;  2EYJ A;  4PMC A;  2RDG A;  1LUZ A;  2LS0 1;  1KIX A;  1P8L A;  5E4W C;  1STE A;  3NXW A;  2R92 B;  3NWS A;  4DK1 A;  1IKL A;  2UUA Q;  1WTQ A;  1QE6 A;  2KHJ A;  1EU4 A;  3J80 E;  3MTS A;  4BY1 G;  1Q82 C;  4I65 A;  4POG A;  4XDX A;  4DFA A;  1VS0 A;  2EYF A;  5C4Z A;  3M4Y A;  4JVZ A;  3K59 A;  2Q8R E;  1LTT D;  1LTB D;  2Q2H A;  1VQK A;  1ENA A;  1XMQ Q;  2E5L L;  2JA8 B;  2ZTC A;  2EXD A;  1X3E A;  4A3L G;  1YHQ A;  4JI5 Q;  1RL2 A;  3TP6 A;  3ERS X;  4OHJ A;  2EYO A;  3E6Z X;  4NPS A;  2B8G A;  2CVR A;  2ASB A;  2F0F A;  3NBH B;  2DJF C;  3KF6 B;  1TU2 B;  3MVV A;  3HOU H;  4V0B A;  2RCF A;  4A3F B;  4A3I B;  3HOY H;  3M4P A;  1EUJ A;  2SEB D;  3CME A;  4RKL A;  3MXU A;  2R7F A;  4H02 A;  1GOZ A;  4OO1 G;  4MHE A;  1XTC D;  4AIM A;  2PNR C;  4A3D H;  2QKI C;  5IGD A;  2L0C A;  2WV6 D;  1WTV A;  3TBI B;  2OQK A;  3CAM A;  4A3G B;  4KJN A;  3STB C;  4A93 G;  5C4X H;  4A3F H;  4UP7 A;  1PDQ A;  1J6Q A;  4OIK A;  2DGY A;  3QJY A;  1STN A;  1SAP A;  2EPB A;  2Q8I B;  3T56 B;  1K0S A;  3ER0 A;  1A3U A;  4JI5 L;  4KHP L;  1KHI A;  4F88 A;  3W3A A;  3TRE A;  3QWN A;  1EQQ A;  3ZJY C;  2FJ2 A;  4RMF A;  1B9M A;  4WJ4 A;  3PIP 3;  3RMH A;  1VMC A;  5E3F A;  1JJ2 A;  4LFC Q;  4UAI A;  1I4X A;  3TP8 A;  1BXT A;  2F0M A;  4DNR B;  2R7D A;  3T13 A;  4DUY L;  4DV6 Q;  4J6H A;  5J22 A;  1O7Z A;  2VQE Q;  4IOC A;  4JBW A;  5I4D A;  4OWW B;  3OHX C;  4HJ9 A;  3PMF A;  4LJZ C;  3H3V C;  2UUB Q;  2K32 A;  1CZW A;  1HFG A;  2JA8 G;  3M3Y B;  5IP7 G;  5HY6 A;  3E5S A;  3C2P A;  5AJ3 L;  2JA5 H;  2R7Z G;  1PA6 A;  3H0G G;  5CYU A;  3GTL H;  1EIH A;  4KV6 A;  4UP8 A;  5I2X A;  1AE2 A;  1B3Q A;  2BA0 A;  1PXU A;  3K81 C;  3RZD H;  4DR5 Q;  4QF4 A;  1QOH A;  3L0O A;  5IE8 A;  2Z1C A;  1I6V C;  1TS3 A;  2JA5 G;  3E0E A;  1VQG A;  2PW7 A;  3QR8 A;  3MZ5 A;  2MFI A;  1TS2 A;  1K0R A;  3U9S A;  4K8I A;  2B8F A;  2Z6B A;  1OXU A;  4CDF C;  2B2U C;  2HIX A;  4A3J G;  2RF4 A;  4FF2 A;  2A5H A;  3S1R H;  4XQJ A;  5HGQ A;  2WII B;  3MC0 B;  4O42 A;  3TSS A;  3KLS X;  2PI2 E;  1PH2 A;  4FYD A;  3JAM c;  3VYS A;  1HZB A;  1I3Q H;  1SYB A;  3J7Z C;  4OGQ C;  1Z6H A;  5LMN Q;  2AQ2 B;  4Z9C B;  4A3C H;  3SXH A;  1SMY C;  3R2T A;  3I4N G;  2NUC A;  2E2I B;  3P75 A;  1YI2 A;  1TY0 A;  4XT1 B;  1U9R A;  1WFQ A;  5FOB B;  5DNF A;  1VCI A;  2LY7 A;  2VQF Q;  1FGB D;  1RKN A;  2CWP A;  4K0K L;  3DLL A;  1NTG A;  2HDL A;  4GOP C;  3MEH A;  4HIK A;  1G29 1;  3UDG A;  4OWT B;  1EOV A;  1E2V A;  4JI7 L;  2A6E C;  2E2D C;  2K05 A;  4RGN A;  5C0X J;  2PQE A;  4OEL B;  2ZXO A;  2B39 A;  4LF6 Q;  2BH2 A;  2O4X A;  1PZK D;  4OXP A;  4BS9 A;  4DAP A;  4NXM Q;  4MIU A;  3CF5 A;  3PIP A;  2F0W A;  2OTL A;  2VL6 A;  2XTI A;  1GUO A;  1ENC A;  1F2Y A;  3PO2 G;  3HZX A;  1A62 A;  2L15 A;  5ELB A;  3TRZ A;  1JQY D;  1FYC A;  3ERO A;  3P7J A;  2H1E A;  2UXB Q;  1LTA D;  3BYT B;  1I3Q B;  4L8J A;  3FKI G;  1WCM B;  4KN4 C;  3NTI A;  3OWE B;  2WAC A;  5FLX c;  3O13 A;  4L5Q A;  4JBJ A;  3VA7 A;  2K5N A;  1X56 A;  2TSS A;  3A7A B;  4KY5 A;  3D4R A;  2PYK A;  5IGC A;  2CH4 W;  5ELC A;  3D31 A;  2VUM B;  3I3C A;  3CQZ H;  4DV7 Q;  1KTK A;  3C1E A;  1F2M A;  1XXG A;  2HHH Q;  1O80 A;  3UE0 A;  2EY5 A;  4JI2 L;  1F9P A;  2DNE A;  1IL2 A;  3LWU A;  1UEA B;  4LUV A;  5JEA G;  4YCV A;  5IP9 G;  3DM3 A;  5IWA Q;  4X65 L;  3P1H A;  2A1A A;  3TDQ A;  5FLM G;  2I5L X;  1TXY A;  3G4S A;  3W1B A;  2RSN A;  1PV4 A;  1D2B A;  1CTM A;  4AYB B;  1TT2 A;  3BZD B;  3RD4 A;  1Y8N B;  2CW0 C;  4IJH A;  4FF1 A;  1EYD A;  2EQS A;  1TWA B;  1CK1 A;  1W6K A;  1ZEQ X;  4S3S A;  1KRT A;  4DR2 Q;  3H94 A;  1C7Y A;  3KF6 A;  4OX9 Q;  4E6I A;  2E2H B;  3RLO A;  1MD2 D;  1UAP A;  3GTM H;  2B2Y A;  3CW2 C;  2SNM A;  1BKB A;  3GTM B;  4LFB Q;  3BVZ A;  1Q81 C;  4DV4 L;  5K36 H;  4I7A A;  4HIO A;  1DM0 B;  3DM1 A;  3KUP A;  3U4V A;  5FJ8 G;  3I4M B;  1JR0 D;  5J1Z A;  5BN3 A;  4R8I A;  3HS0 C;  4FNF A;  1EZ8 A;  4X3U A;  5D65 A;  1J5E Q;  3HKS A;  3CCQ A;  3H91 A;  4HID A;  3OPO A;  4IUT A;  1NSN S;  1ICW A;  4FXD A;  5K5P A;  1UNS A;  2I5M X;  2XNA C;  4CKC A;  2SDF A;  3Q22 A;  5C4J B;  1PH3 A;  2UUC L;  2O2L D;  4N8X 1;  4P71 A;  1V43 A;  4C3I H;  1QZH A;  3EBE A;  1W2B A;  2F0K A;  3NUC A;  2KOL A;  2BDN A;  2VUM H;  3KJP A;  2EY6 A;  2K75 A;  1VQL A;  3PV0 A;  3K7A B;  3NQI A;  3Q8D A;  4X66 Q;  1E24 A;  1DYQ A;  1EY0 A;  3SEB A;  4A3G H;  5IYB H;  3ULJ A;  2HIV A;  4FDB A;  3QOL A;  5EGT A;  1GHJ A;  1R9T H;  2PMZ B;  1PLF A;  3OW7 A;  1EWH A;  4DAV A;  3S1Q H;  4B3T L;  1WCM H;  3ULP A;  5M3F H;  2KCM A;  4DAY B;  1JOO A;  1RJT A;  3X3N A;  4X62 L;  2FXQ A;  5CR3 A;  4A3I H;  1IXR A;  1CA5 A;  1X3P A;  5CBA E;  4IO9 A;  4DNI A;  1ASZ A;  2A68 C;  1PMR A;  4A3L H;  1XTD A;  5LL6 S;  1YBY A;  1EOT A;  3VYU A;  3LWE A;  3HOW B;  4POF A;  4A3M B;  2UXD L;  1BBW A;  4DV1 Q;  4DR6 Q;  4G7O C;  3LX0 A;  1D5M C;  4NXM L;  2JA6 B;  2WAQ E;  3HOX H;  1D5Z C;  1X65 A;  1HJP A;  1TVX A;  3I56 A;  1S3O A;  4A3C G;  2OQ0 A;  5IT9 c;  1EY9 A;  5G3L F;  5EPJ A;  2OEO A;  4X66 L;  3S1N H;  2IY5 B;  2BOS A;  1K73 C;  1Z47 A;  5KGU A;  4ZLT F;  3JC6 6;  1VQJ A;  1Y1V G;  1B7Y B;  5GAD C;  1Q12 A;  3FKI H;  2K50 A;  3KJO A;  4YY3 Q;  4K0K Q;  5M5W B;  3RZO H;  3AU7 A;  4YWL A;  1WD0 A;  1A63 A;  1BF4 A;  4A93 H;  3K7U C;  1V1O A;  4OON A;  4RGT A;  2N88 A;  1TR5 A;  2DUD A;  2LFN A;  4RHR A;  4IOA A;  3PO3 G;  3U58 A;  3R2I A;  2MO0 A;  5M9O A;  4OL7 A;  3I4L A;  4K2K A;  1BUV T;  4LFA Q;  3CXC A;  4XQQ A;  3PUY A;  5ISR A;  2PZW A;  1EY7 A;  2QCP X;  1BO0 A;  1X54 A;  3URY A;  2J4X A;  1BDO A;  2E2J H;  2JK8 A;  3EQL C;  5A2Q L;  3HP3 A;  1D1I A;  1LTS D;  1K8A C;  1AFP A;  2BA1 A;  3GTL B;  2L11 A;  2F1M A;  4GNX C;  5CBE E;  4C3H H;  4LF5 L;  4UPA A;  2F0J A;  1VQE A;  1WTH A;  2KEC A;  1XJV A;  5ELD A;  3M3Y H;  3MXG A;  5I9O A;  4JI2 Q;  2A69 C;  1K28 A;  1B53 A;  1H9R A;  4OWX B;  4DXF A;  1L0Y B;  3D8G A;  3K0X A;  1EY6 A;  2XWB B;  1CQV A;  4C56 C;  2O5I C;  1Y1W B;  3KFU A;  2PCF B;  4R8N A;  1NMG A;  3MEF A;  3W1G A;  5M3M B;  1QZG A;  1R4P B;  2WB1 E;  4F87 A;  2VUM G;  5E7N A;  2WKD A;  1B2T A;  3J80 i;  2I46 A;  2SOB A;  2VQE L;  2HHH L;  4DV3 L;  3A74 A;  1KAB A;  1VQP A;  4XYQ A;  2Q2T A;  4CDE C;  5JJI A;  2XWJ B;  1TWF B;  5M3M H;  1I50 B;  2VW9 A;  1K83 B;  3PO3 H;  3I4M G;  4XIG S;  1NY4 A;  1RIP A;  4A3E B;  1VQM A;  1J5E L;  1K8G A;  1QJO A;  3K6O A;  1WCM G;  5T1G A;  4DPG A;  4FF4 A;  2A74 C;  1SMY D;  3S15 H;  4JI7 Q;  1ONL A;  4FXK C;  2OF1 A;  3K5L A;  3FRP B;  2ICI A;  4DNT B;  4DV2 Q;  2B2V A;  2NVX H;  1NMF A;  1GVP A;  1PH4 A;  1UE7 A;  1B4O A;  1A15 A;  2B63 H;  1LTG D;  2GA4 B;  1TWH B;  3NSW A;  1PH9 A;  5CV9 A;  2NN6 G;  5COR A;  1JWS D;  3PSI A;  1HZC A;  2G9D A;  3CRK C;  4YWM A;  4X65 Q;  1YJW A;  5GAH C;  3CCM A;  2JQO A;  2B3G A;  1STA A;  5CV7 A;  1BNZ A;  1MIU A;  1K8O A;  3T1H Q;  1D8L A;  2RKS A;  3MXP A;  2L5T A;  3CC2 A;  2PQA B;  1EYC A;  1Q1B A;  1CHP D;  1PTO D;  2ZTE A;  1HQR D;  3KBX A;  1DOL A;  1SDF A;  5LMN L;  5CV8 A;  2CH4 A;  2R7Z H;  1LO5 D;  1E7Z A;  3KOJ A;  1QG7 A;  3CCL A;  3VA5 A;  3GTK H;  2B2W A;  1NCV A;  3D4W A;  1B44 D;  4BY1 B;  2GN5 A;  4GKK Q;  3S17 B;  4HTH A;  4QUF A;  4DUZ L;  1HCZ A;  4JI8 Q;  4N9T A;  4GN3 B;  1Y8O B;  3HOX B;  1AW7 A;  1NR2 A;  1CM9 A;  3OTO Q;  5C5L A;  4WRD A;  3DMU A;  4PZ6 A;  1B50 A;  4B08 A;  4NP5 A;  2JA7 H;  2PNH A;  2ZXP A;  4EX5 A;  1C48 A;  3L7Z C;  1LM0 A;  2M9V A;  4IUQ A;  4JBM A;  3S2D B;  4GLV B;  1QB5 D;  4IZ8 A;  4O0A A;  4MN3 A;  4JV5 Q;  4B3T Q;  3JAM i;  1F2Z A;  1HFN A;  2QF7 A;  2VQF L;  1MSH A;  1TWH H;  3K5N A;  1QNU A;  1EWC A;  4C1N K;  1RTO A;  2JYO A;  3HOX G;  1GUG A;  5C44 B;  2ID0 A;  3GP7 A;  1STY A;  1EIG A;  3KLS A;  5A2Q E;  3SK6 A;  4HR7 B;  3I72 A;  2ALY B;  4IPC A;  3MXN A;  4NMZ A;  4IUP A;  4DV6 L;  4R1J A;  2B2V C;  3PF5 A;  3S15 B;  4QMG A;  1Y1V H;  4CJ2 C;  1A2T A;  4A3E H;  1GO3 E;  2KCN A;  4U68 A;  3D0F A;  2B63 G;  2VB3 X;  3VYT A;  4GZY C;  3CKI B;  5C5M A;  1C4Q A;  4ZAI A;  2JA6 G;  4EQN A;  3BZK A;  1X9N A;  1IBK L;  1ZYR C;  5C44 G;  3Q23 A;  4YWK A;  2RHQ B;  4WOR A;  1V9P A;  1Q1E A;  2D0P A;  1ICF B;  4GKJ Q;  4DK0 A;  4DV0 L;  4X64 Q;  2Y0S E;  2JP1 A;  1AH9 A;  3M4O H;  4C3I G;  3Q24 A;  1PHJ A;  1JJG A;  3EVQ A;  3NHH A;  3DEO A;  4DR5 L;  3SE0 A;  1MJE A;  3IAY A;  3M7N A;  1H9J A;  4DR2 L;  5C4X G;  2KCC A;  2NZ1 D;  1GKH A;  1PTO H;  4ULL A;  4Y52 H;  3KYH C;  3EFX D;  1Y1W H;  1I6H H;  5KND A;  3F2D A;  1SBB B;  3MFY A;  3GTJ H;  4JI0 L;  2CCZ A;  2C9O A;  3BYY B;  5IGB A;  4K6D A;  4DK3 C;  5EBD A;  3I4N B;  1HHV A;  4P72 A;  3VR3 A;  1S5C D;  4O1N A;  4GNX B;  1S5F D;  1ILP A;  3PO2 H;  1I94 L;  5DLQ E;  2Z4I A;  2UU9 L;  2K5Q A; 
#chains in the Genus database with same CATH homology
 2NZH A;  3CPF A;  4DUY Q;  1S40 A;  4OO1 I;  3CC4 A;  2UXB Q;  1CSQ A;  4L5T A;  1PFS A;  3FKI G;  5LMU L;  1K9M C;  1X6O A;  5FLX c;  4L5Q A;  4JBJ A;  1KC8 C;  4X62 Q;  3J81 j;  2K5N A;  3G6E A;  2ZJQ A;  1X56 A;  1GD7 A;  3VDY A;  1HZ9 A;  1SFO H;  3AQQ A;  3SGI A;  4HIM A;  1X55 A;  5ELO A;  4Y7N H;  3D31 A;  4A76 A;  1CSP A;  5FJ8 H;  3CQZ H;  2VS1 A;  4EQ5 A;  4DV7 Q;  2JEB I;  1N9W A;  2MO1 A;  1CKN B;  4HJ5 A;  2AWN A;  3HFZ B;  3U4Z A;  2HHH Q;  2I5H A;  1HNW Q;  3UE0 A;  4JI2 L;  4L5S A;  1IL2 A;  4R4T A;  4LUV A;  5JEA G;  3F8T A;  3F2C A;  4YCV A;  5IP9 G;  1L2F A;  2EIF A;  1W3S A;  3DM3 A;  3TEH B;  5IWA Q;  1PH5 A;  2JEA I;  3AFQ A;  1VQB A;  4X65 L;  2A8V A;  1UE6 A;  2A1A A;  2OCE A;  1PH7 A;  3S2D H;  5FLM G;  5C4J H;  4R4O A;  4A3I G;  2I5L X;  1TXY A;  3G4S A;  3W1B A;  1FJG Q;  1YVC A;  1PV4 A;  4DR3 Q;  5JEA J;  4YCU A;  3L2P A;  2UU9 Q;  3WWV A;  4IJH A;  3T1H L;  4L5R C;  2EQS A;  3GO5 A;  4JBK A;  1KRT A;  2KBN A;  4DR2 Q;  3A0J A;  4HJ8 A;  3K80 C;  2GVB A;  2IX0 A;  3KF6 A;  3CCS A;  4OX9 Q;  3GTQ H;  2F3I A;  1VQN A;  4DV2 L;  3BU2 A;  3S1M H;  2K4K A;  3RLO A;  4LUO A;  4UP9 A;  3GTM H;  3CW2 C;  1P16 A;  4LFA L;  1BKB A;  1XNQ Q;  4LFB Q;  1Q81 C;  2RCN A;  4DV4 L;  4R4C A;  2CFM A;  2NVQ H;  4HIO A;  3HOU G;  5FJ8 G;  3U4V A;  5IP9 H;  4JYA Q;  1HNZ L;  1QVC A;  2HQL A;  3J81 i;  2R6G A;  3CMA A;  1U5K A;  4LF8 Q;  1OXX K;  4DV4 Q;  4NXN L;  4JI4 L;  4NB3 A;  1XNQ L;  1J5E Q;  3HKS A;  3CCQ A;  4HID A;  1Q7Y C;  3UDI A;  1MJC A;  4GNX A;  2NVT H;  2NN6 I;  1N36 L;  2WB1 G;  2E2I H;  4HJ7 A;  2I5M X;  1H95 A;  4JCV E;  1WOC A;  2RHS B;  1EYG A;  1QVF A;  1PH3 A;  1YHB A;  4DR7 L;  2HT1 A;  2UUC L;  3CCV A;  4B3S L;  3HOW G;  1T9H A;  3CCR A;  2E5L Q;  4P74 A;  1WJJ A;  1N32 Q;  2K5V A;  4IPG A;  4P71 A;  1V43 A;  4A75 A;  4DV3 Q;  4C3I H;  1BVS A;  1VQF A;  1QZH A;  1SMX A;  2PI2 A;  3EBE A;  1W2B A;  5H1S E;  2VUM H;  4BBS H;  3KJP A;  1UEB A;  2K75 A;  1VQL A;  3PV0 A;  3Q8D A;  3AYH B;  3STB D;  4X66 Q;  4YHH L;  2KCT A;  4HJA A;  1E24 A;  4BBR H;  1N34 L;  1HNX Q;  4BXX G;  4JOI C;  3ULJ A;  1CKM A;  1CUK A;  2HIV A;  4FDB A;  5GQO A;  1AE3 A;  5IYB H;  2C35 B;  3G71 A;  5IYB G;  3GD7 A;  2D0O A;  1XPR A;  1CKN A;  2OTJ A;  3IRB A;  2UUA L;  2B29 A;  5C3E H;  1R9T H;  2K5H A;  4GOP A;  5C44 H;  3S1Q H;  5J3B A;  1WCM H;  1IBM L;  4B3T L;  3HOV H;  3GTP H;  4B3R L;  4IFD G;  3ULP A;  4YCW A;  5M3F H;  2KCM A;  2Z6K C;  4LF7 Q;  2JA7 G;  2CKZ B;  4O2D A;  1YJ9 A;  2QEX A;  4PMW A;  4DAY B;  4KI0 A;  4X62 L;  1C9O A;  4MTN A;  1G51 A;  2FXQ A;  4A3I H;  1IXR A;  4DV5 Q;  5LMU Q;  3PIO A;  4IO9 A;  4DNI A;  4AYB E;  1E3P A;  1ASZ A;  1HH2 P;  3S16 H;  3CCE A;  4JI6 Q;  4A3L H;  1KXL A;  1QUQ A;  1VQD A;  1XTD A;  3EN2 A;  2UUB L;  3ICE A;  4BXX H;  3T1Y L;  1LYL A;  2LXK A;  1YBY A;  4GN5 A;  3HOZ G;  4GLA C;  3M9B A;  3M4Q A;  4GLX A;  3RNU A;  2I0Q A;  1YZ6 A;  1FL0 A;  2KHI A;  1JB7 A;  5M5Y H;  4DR1 L;  3I4O A;  4POF A;  3T1Y Q;  4UY8 C;  1G6P A;  3KDF A;  1HR0 L;  1OXT A;  1EQR A;  5BR8 L;  1BBW A;  3I4M H;  4DV1 Q;  4DR6 Q;  2UXD L;  3AFP A;  1K83 H;  4NXM L;  1N33 L;  1I50 H;  1LTL A;  2IHE A;  2WAQ E;  3HOX H;  1X65 A;  4A3C G;  1HJP A;  3I56 A;  2JA6 H;  1S3O A;  2A19 A;  2OQ0 A;  5IT9 c;  1N8R C;  4A3D G;  4IPD A;  1HNX L;  4JG2 A;  4BA1 I;  2IY5 B;  2D62 A;  3HKZ E;  4X66 L;  3F2B A;  3S1N H;  1K73 C;  1Z47 A;  1XNR Q;  1Q46 A;  3JC6 6;  1VQI A;  1VQJ A;  4A3J H;  1Y1V G;  3LGJ A;  1YIT A;  3AEV A;  2UXC L;  3FP9 A;  1B7Y B;  1SRU A;  3TQY A;  5GAD C;  4BY7 G;  1Q12 A;  3FKI H;  4B3R Q;  2K50 A;  5IYC G;  3KJO A;  1KD1 C;  4YY3 Q;  1IBM Q;  4XTC S;  4K0K Q;  2CWA A;  3RZO H;  4YWL A;  1Z9F A;  3HOY G;  3MXN B;  2YU9 H;  2F4V Q;  4AQY L;  2AHO B;  3CPW A;  1I5F A;  1A63 A;  4APV A;  1B70 B;  4GS3 A;  4TQU S;  1VQ5 A;  4LWC A;  1NE3 A;  3FHW A;  1PYB A;  2JA9 A;  3K7U C;  3PF4 A;  4A93 H;  1IBK Q;  4OON A;  4BBS G;  1YIJ A;  4IJL A;  2WP8 J;  2UXC Q;  2DUD A;  4NXN Q;  4ME3 A;  2YTV A;  2JE6 I;  4JI1 L;  4LF8 L;  5EAY A;  2N49 A;  4IOA A;  1HNZ Q;  3PO3 G;  3U58 A;  3E9H A;  2AWO A;  4LF4 Q;  3CD6 A;  2ZM6 L;  2MO0 A;  2K52 A;  5ELN A;  3W5O A;  2F4V L;  4KHP Q;  3BJU A;  4LFA Q;  3G48 A;  5BR8 Q;  3CXC A;  1ASY A;  2VNU D;  1HR0 Q;  2R93 H;  1PYS B;  3RR5 A;  3PUY A;  2MQH A;  1X54 A;  1V1Q A;  5LMN W;  2E2J H;  4B3M L;  1SE8 A;  2JK8 A;  3CP0 A;  1XNR L;  4A3G G;  2AKW B;  4DR3 L;  5AJ3 Q;  1IYJ B;  1FJG L;  1Q8K A;  1K8A C;  2BA1 A;  4PZ8 A;  1QVG A;  1OXV A;  1IBL L;  4JI3 L;  4GNX C;  1TWG H;  2ES2 A;  4X6A H;  4C3H H;  3OTO L;  2JJQ A;  4UPA A;  4J15 A;  1VQE A;  1NBW A;  4LF5 L;  2F52 A;  3K7A H;  4GN4 B;  2R92 G;  1B8A A;  2KEN A;  1D7Q A;  1XJV A;  1UWV A;  3NEM A;  3M3Y H;  4JI2 Q;  1LUZ A;  1KIX A;  4RG1 A;  4OWX B;  1P8L A;  1UE5 A;  5M3M G;  1KRS A;  3UE1 A;  3K0X A;  1XMQ L;  3K8A A;  2UUA Q;  3CCJ A;  2WFW A;  5M3F G;  3KFU A;  1VQO A;  2KHJ A;  2YV5 A;  1A8V A;  1NMG A;  2JA8 H;  3H3V I;  1L1O A;  2BH8 A;  4QGU A;  1X3G A;  3MEF A;  3KLW A;  3W1G A;  5IP7 H;  4A3M G;  1QZG A;  4JC0 A;  4BY1 G;  3S17 H;  2WB1 E;  2VUM G;  1Q82 C;  5E7N A;  2YTY A;  4BY1 H;  4POG A;  1PH8 A;  3J80 i;  1VS0 A;  2H5X A;  1KQS A;  2VQE L;  2HHH L;  4DV3 L;  3A74 A;  4QIW E;  1C0A A;  4GKK L;  2YTX A;  2N8N A;  1VQP A;  2Q2H A;  4MNO A;  4QY7 A;  4DV7 L;  1VQK A;  3I55 A;  3CC7 A;  2ZJP A;  1XMQ Q;  3B6Y A;  2E5L L;  2Q2T A;  3HOZ H;  5JJI A;  3PCO B;  4A3E G;  2ZTC A;  2EXD A;  4LF9 Q;  1X3E A;  3S2H H;  4A3L G;  4JOI A;  5M3M H;  2VW9 A;  1YHQ A;  4JI5 Q;  1HNW L;  3H3V H;  2Z0S A;  1RL2 A;  2R92 H;  3PO3 H;  1M90 C;  3I4M G;  2IT1 A;  3ERS X;  4XIG S;  1SN8 A;  1NY4 A;  1NJI C;  1RIP A;  5FLM H;  1VQM A;  1J5E L;  1K8G A;  4JI3 Q;  1YEZ A;  1WCM G;  4NPS A;  2ASB A;  4DPG A;  3J7A 5;  3NBH B;  5JJK A;  3S15 H;  1KL9 A;  4JI7 Q;  3A5U A;  3KF6 B;  1GM5 A;  2UUC Q;  1JJC B;  3HOU H;  4DR7 Q;  5K36 G;  2MNA A;  1BBU A;  1IZ6 A;  1M1K C;  3HOY H;  2QGQ A;  3M4P A;  1EUJ A;  3CME A;  4DV2 Q;  2NVX H;  2N3S A;  4OX9 L;  1NMF A;  3J80 c;  3OW2 A;  1GVP A;  3J81 c;  1UE7 A;  1PH4 A;  1Y1W G;  2R7F A;  4H02 A;  5GAG C;  4A3F G;  4JI4 Q;  4LF6 L;  1CKO A;  5IY0 A;  1PH9 A;  1HR0 W;  4OO1 G;  4X64 L;  4DV0 Q;  1E22 A;  2LXJ A;  3F1Z A;  4GKJ L;  2NN6 G;  4JYA L;  4AIM A;  4A3D H;  2E8G A;  1PVO A;  3PSI A;  3TS0 A;  4R4I A;  1DGS A;  1HZC A;  4WJ3 M;  2Y0S G;  4B3M Q;  4YWM A;  1VQ9 A;  2OQK A;  3CAM A;  4X65 Q;  3STB C;  4A93 G;  3U50 C;  5C4X H;  4A3F H;  1YHA A;  1YJW A;  5GAH C;  4UP7 A;  3CCM A;  1J6Q A;  2JQO A;  1XMO Q;  2DGY A;  2B3G A;  2V1C C;  4P73 A;  3RN2 A;  4IFD J;  4C3J H;  3ER0 A;  3UDX A;  4JI5 L;  1WI5 A;  4KHP L;  1MIU A;  3T1H Q;  1KHI A;  2ZM6 Q;  2Z6K A;  1D8L A;  4LF4 L;  4AH6 A;  4PZ7 A;  2QA4 A;  5M5X H;  3CC2 A;  2PQA B;  1WYD A;  1VQA A;  3TRE A;  1Q1B A;  1EQQ A;  2ZTE A;  1EFW A;  3ZJY C;  2R93 G;  1TWF H;  4RMF A;  5IWA L;  4WJ4 A;  5M5W H;  2LSS A;  5LMN L;  4LW1 A;  1JJ2 A;  3S24 A;  1TWC H;  4LFC Q;  2R7Z H;  4GOP B;  3CCU A;  1JMC A;  3PUZ A;  1VQ8 A;  1E7Z A;  3KOJ A;  3PUW A;  3CCL A;  3EIV A;  2UXB L;  1OXS C;  2R7D A;  4DV1 L;  3GTK H;  4DUY L;  3S14 H;  4DR6 L;  2GN5 A;  3ULL A;  5C3E G;  4IPH A;  2ATW A;  4DV6 Q;  4GKK Q;  4JV5 L;  4DUZ L;  2VQE Q;  4IOC A;  3NEL A;  4C2M H;  2PMZ E;  4JBW A;  4KLK A;  4JI8 Q;  4A3K G;  1PH6 A;  4GN3 B;  3OYY A;  4LNQ A;  4OWW B;  5JJL A;  1JE5 A;  4HJ9 A;  3PUV A;  1Y14 B;  4A3M H;  1PH1 A;  2UUB Q;  5C0X G;  3OTO Q;  2JA8 G;  5IYD H;  2B63 H;  1HZA A;  5IP7 G;  1EIF A;  4PZ6 A;  4DKA C;  4DV5 L;  1XPU A;  4BY7 H;  1K3R A;  2N78 A;  4MZ9 A;  5HY6 A;  5IYC H;  3H0G H;  4QL5 A;  5AJ3 L;  1X3F A;  2PNH A;  2JA5 H;  4EX5 A;  4PG3 A;  3L7Z C;  1PA6 A;  4QJF A;  3H0G G;  2ZJR A;  1LM0 A;  2R7Z G;  4JBM A;  3E9I A;  3GTL H;  1I94 Q;  4DR1 Q;  4GLV B;  4UP8 A;  4JI8 L;  1AE2 A;  2K14 A;  2BA0 A;  3K81 C;  4TVA B;  3RZD H;  3KF8 B;  4O0A A;  4DR5 Q;  4JV5 Q;  4B3T Q;  3JAM i;  3L0O A;  2WAQ G;  5IE8 A;  3PUX A;  4LF5 Q;  4DAM A;  2VQF L;  2JA5 G;  4JI0 Q;  3E0E A;  4ALP A;  1IBL Q;  1TWH H;  1VQG A;  3I2Z A;  3HKZ G;  4DR4 Q;  4IFD I;  3HOX G;  3RLN A;  1E1T A;  3RN5 A;  2MFI A;  2XGT A;  4LF9 L;  4LFC L;  3GTO H;  2AMC B;  2ID0 A;  1K0R A;  1A0I A;  1FGU A;  4LF7 L;  4A3G H;  1OXU A;  2HIX A;  4A3K H;  4A3J G;  3GTG H;  2ALY B;  2RF4 A;  4IPC A;  5GRO A;  4DUZ Q;  3S1R H;  1OTC A;  1SRO A;  5HGQ A;  4DV6 L;  1YJN A;  2Q2U A;  4R1J A;  4AYB G;  3PF5 A;  2VZA A;  4KHZ A;  1VQC A;  2PI2 E;  4AQY Q;  3I7F A;  1PH2 A;  2PQA A;  3JAM c;  1Y1V H;  1HZB A;  1I3Q H;  2Q2I A;  4A3E H;  1GO3 E;  2B63 G;  1VQH A;  3D0F A;  4YHH Q;  1E1O A;  2ZTD A;  3J7Z C;  1N34 Q;  1EIY B;  3TS2 A;  2IHF A;  1YNX A;  4JI1 Q;  1L1O C;  4A3B G;  1EWI A;  2GVA A;  5C0X I;  5LMN Q;  1N36 Q;  4A3C H;  2JA6 G;  4P75 A;  3BZK A;  1X9N A;  1IBK L;  5C44 G;  2OWO A;  4QQB X;  4YWK A;  2RHQ B;  1V9P A;  3BZC A;  3H15 A;  1Q1E A;  2D0P A;  3I4N G;  3UDF A;  4GKJ Q;  1N32 L;  3I4N H;  4DV0 L;  4X64 Q;  4B3S Q;  4DR4 L;  1YI2 A;  1SR3 A;  2Y0S E;  1WFQ A;  2IX1 A;  1AH9 A;  1N33 Q;  1QUQ B;  3M4O H;  2JA7 H;  1VCI A;  4BA2 I;  2VY3 A;  2VQF Q;  1PHJ A;  1O7I A;  1U0L A;  2CWP A;  4A4I A;  4K0K L;  3DLL A;  1NTG A;  1XMO L;  2NZO A;  4YY3 L;  1Q86 C;  1JJG A;  1L0W A;  4DK6 C;  4DR5 L;  4GOP C;  1VQ4 A;  4R4Q A;  1MJE A;  3M7N A;  1MKH A;  4HIK A;  1G29 1;  4DR2 L;  5C4X G;  2YYZ A;  1GKH A;  3A5Z B;  4LUZ A;  4OWT B;  3UDG A;  4Y52 H;  3KDF B;  3KYH C;  1Y1W H;  1SLJ A;  2E2H H;  1EOV A;  3F2D A;  4A3B H;  3PGZ A;  2NVY H;  3GDE A;  1I6H H;  4JI7 L;  3GTJ H;  5C0X J;  4JI0 L;  1S72 A;  4JI6 L;  2CCZ A;  2CQO A;  1TWA H;  3HOW H;  1UE1 A;  4LF6 Q;  2BH2 A;  1JT8 A;  4OXP A;  4BBR G;  4NXM Q;  3HOV G;  4DK3 C;  4LFB L;  3CF5 A;  3PIP A;  2OTL A;  2UXD Q;  2VL6 A;  3M85 A;  1FVI A;  1KAW A;  2XTI A;  4P72 A;  3NEN A;  5GAE C;  3PO2 G;  1A62 A;  2L15 A;  4GNX B;  3TRZ A;  3RLF A;  5IYD G;  1I94 L;  5DLQ E;  3PO2 H;  1XPO A;  1VQ7 A;  2UU9 L;  1C7Y A;  1L1O B;  1VQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...