4A75A

The lin28b cold shock domain in complex with hexathymidine.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
89
structure length
89
Chain Sequence
GSDPQVLRGSGHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYMEGFRSLKEGEPVEFTFKKSSKGFESLRVTGPGGNPCLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Lin28 Cold-Shock Domain Remodels Pre-Let-7 Microrna.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
molecule tags Chaperone/dna
molecule keywords LIN28 COLD SHOCK DOMAIN
total genus 18
structure length 89
sequence length 89
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2011-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a75A00
4GN3B 2MNAA 1R9TH 4DR6Q 1JT8A 1CSPA 4B3SL 4DUYQ 4LF6L 3S1QH 3HOVG 5BR8Q 1YVCA 2NVYH 1LYLA 4DV4Q 2HIXA 1KC8C 1J5EQ 3G4SA 1XMQQ 4L5QA 3U4ZA 4LFAL 3HKZE 3RR5A 3I4NG 3J80c 2QGQA 1UE5A 2JA5G 3RLOA 1V9PA 4R4QA 3WWVA 2H5XA 3L2PA 3S1MH 4A4IA 4P72A 2HHHQ 2N8NA 3HOVH 2HIVA 4JI0Q 2Y0SE 4GLAC 1VQ5A 2K50A 4A75A 2UXBL 3GTQH 1NY4A 4DV3L 2JK8A 4BXXH 4LF7L 2ID0A 2K4KA 4POGA 5C44G 5ELNA 3BJUA 4DUZL 1SLJA 4P74A 1IBLL 1OTCA 1JB7A 3CC2A 4JI3L 5IP9H 3H0GG 3I4NH 3PIPA 2KHJA 3B6YA 1Y1VH 4QQBX 2R93G 5GAEC 1Q82C 3ICEA 1PH3A 1UWVA 1E3PA 2VY3A 3PF5A 1IBMQ 1YHBA 3PF4A 4DUYL 4LF6Q 2KHIA 2Z6KC 2JJQA 2OTLA 1G51A 2K5VA 2N3SA 2RF4A 5FLMG 1CKNB 3CMAA 5M5WH 4GNXB 3H3VH 2VUMG 4LNQA 3HOUG 4IO9A 1SE8A 4DV6L 2QEXA 2OWOA 3A0JA 3S16H 4JOIC 1PH4A 4JI0L 4L5SA 2UXBQ 5IP9G 1VQLA 1XPUA 3HOYG 2WP8J 2OQ0A 4A3MG 2F4VQ 4NXMQ 5IP7G 1Y1WH 1PHJA 2I0QA 2UU9L 4DR1Q 3FHWA 2R7ZH 1S3OA 1PH9A 5LMNL 1E22A 1G291 2LXKA 3TQYA 4DV3Q 4DR2L 4BA2I 1GKHA 2WB1E 2NZHA 4X62Q 5FLXc 1YIJA 1PH2A 3E9HA 1EWIA 3HOUH 3FKIG 1NE3A 1XNQQ 4OWTB 1UE1A 5EAYA 4LWCA 3J81c 4A76A 4QIWE 1C7YA 3M85A 2V1CC 4DR4L 1QVCA 5C4XG 2WAQE 1YJNA 3K7UC 4GS3A 3ERSX 1X6OA 1MIUA 3A5ZB 3MXNB 3F2BA 1VS0A 1X55A 2EIFA 2YTXA 2Q2HA 3S1RH 4LF5Q 3CCUA 3HKSA 4DV1L 3JAMi 4JC0A 4A3BG 2WFWA 4A3DH 1PH7A 3GO5A 3EBEA 5IE8A 3G48A 4JOIA 3PIOA 4B3RL 4DAMA 1T9HA 1Z9FA 4JG2A 4JI8L 2JEAI 1S72A 5JJKA 1EFWA 3CCLA 4JI6L 1VQBA 3M9BA 1PFSA 4KI0A 3T1HL 1KQSA 2UU9Q 3HOWG 2AWNA 4IJHA 1XTDA 5LMNQ 4DR2Q 2AWOA 3CP0A 3CCQA 5AJ3Q 4NXML 4LF4Q 4KHZA 4DR1L 2ZTDA 2AKWB 1BVSA 3KF6B 1S40A 4HJ8A 1JE5A 2PQAB 3RLNA 3UDFA 3HOWH 5JJIA 2D0OA 2ZTCA 1CKNA 2B3GA 4OWXB 3NELA 4UPAA 5M3MG 5IYBH 3KDFB 3UDGA 1YHAA 2I5MX 4GN4B 1W2BA 4LF8Q 3J7A5 1VQJA 1XMOL 3D0FA 4L5TA 4OO1G 3I55A 2HQLA 1NMGA 3KYHC 4EX5A 2R7ZG 2K14A 2NVXH 4ALPA 1PVOA 1N34L 3I4MG 4WJ4A 3KLWA 1YBYA 4JI8Q 4GNXC 4UP9A 4BY1G 1W3SA 2RHSB 4B3RQ 2R6GA 1QUQA 5C0XJ 2F52A 2ZTEA 3W1BA 3RNUA 2B29A 2K52A 1X3GA 4IFDG 4YHHQ 4LF4L 3PO3G 3T1HQ 5M3MH 4TQUS 5IYBG 1NTGA 1MKHA 1K0RA 1TWGH 2I5LX 1FJGL 3K8AA 2C35B 2IHEA 2VQFQ 2B63G 3ULLA 4NPSA 1CUKA 4DPGA 3CD6A 3GTGH 3F1ZA 1FGUA 3CCSA 4DR6L 4IPCA 4FDBA 2E5LL 3S2HH 5K36G 2HT1A 4P73A 2GN5A 4BXXG 2CCZA 1M90C 4GKJQ 1XMOQ 1XNRQ 2ZJQA 2JA8H 2YYZA 4BBSG 1JJCB 2K5NA 4AH6A 1PV4A 2EQSA 5H1SE 3G6EA 2D0PA 1HJPA 2RHQB 3FP9A 3T1YQ 1EQQA 3CC4A 1HZAA 1WCMH 1N34Q 4K0KL 5M5YH 1VQFA 4HIOA 1CKOA 4YCVA 3L0OA 2Q2TA 1FL0A 4GLXA 1IYJB 2ZJPA 2HHHL 4LFBQ 4B3ML 5GAHC 2JE6I 3U4VA 5J3BA 4YHHL 3J81j 1IL2A 1P8LA 4AIMA 1Q81C 2LSSA 3BZKA 1HNZQ 4B3TQ 4BY7G 4DAYB 5C4XH 1B70B 1YJWA 5HY6A 1YZ6A 1UE7A 4YWLA 2MFIA 3ER0A 2NZOA 3PGZA 4XIGS 4A3KH 1Q86C 1FJGQ 1IBLQ 2UXCQ 4X66Q 2VQFL 3CCVA 2Q2IA 4LF9L 1BKBA 2WAQG 3K80C 2VL6A 1E1TA 1HZ9A 3PSIA 2UUAQ 3HOYH 2UUCL 4BY7H 1JJGA 3JC66 1DGSA 1PH1A 1IBML 1PYSB 5LMUQ 1K3RA 5GROA 2YV5A 4GOPA 3VDYA 3ULJA 2KCTA 5C3EG 4DV5Q 1YITA 2GVBA 5C44H 1V43A 3CW2C 3CMEA 2XTIA 3TS2A 2Z6KA 3CCJA 3TREA 1Q46A 3PUVA 2DUDA 3T1YL 2WB1G 1VQCA 5E7NA 4LUZA 4K0KQ 3GDEA 5C3EH 1C9OA 4ME3A 3I2ZA 4B3TL 1D8LA 1MJCA 5IYDG 3S14H 4KLKA 2R7FA 3IRBA 5LMNW 3I4MH 1VQPA 2VW9A 2JA5H 2VQEQ 3J80i 1U0LA 4R4TA 3OW2A 1XNQL 4LF9Q 4A93G 1D7QA 5IWAL 2UUAL 2I5HA 5FLMH 1KXLA 3SGIA 4GOPC 4A3LG 1TWAH 3HOXG 2UUCQ 3S2DH 2A19A 1Q1EA 2F3IA 4DKAC 5BR8L 3ZJYC 1EYGA 3UDIA 1N33L 1QZHA 2VNUD 3KF6A 4DV1Q 4UP8A 2ES2A 1VQKA 1UE6A 1KD1C 2PQAA 4OXPA 4A93H 4JV5Q 5IYDH 4HJ9A 1A8VA 4JI4L 4QY7A 4JBMA 1K73C 3STBD 1JMCA 4A3FH 4R4CA 2QA4A 4A3KG 2B63H 4YWMA 1NBWA 4DV7L 1LUZA 4A3LH 1EUJA 2PI2E 1VQIA 1X65A 4DV2Q 1WI5A 2E2JH 2ZM6Q 3CPWA 3TRZA 4KHPL 2OCEA 1SN8A 4PZ6A 3PO2H 4OO1I 2PMZE 2Y0SG 2VQEL 2BA1A 4A3FG 4NB3A 1M1KC 3E0EA 1QUQB 5FJ8G 5IWAQ 3U50C 1QVFA 3KJPA 1XPOA 1OXVA 3F2CA 1YHQA 1GD7A 1YEZA 1WOCA 2CWPA 3JAMc 1N9WA 1TWCH 1VQGA 1KL9A 4A3CG 1VQ7A 2ASBA 3BU2A 1HNWL 1Q8KA 2IX0A 3AQQA 2XGTA 4IPDA 5IT9c 1Q7YC 1N33Q 3M4OH 4OX9Q 4JYAL 4IOAA 4DV4L 2ATWA 1TWFH 1OXTA 4DV6Q 1J5EL 5GADC 4DV7Q 1Y1VG 1CKMA 1BBUA 1A0IA 1GVPA 1X3EA 4PZ7A 3CXCA 1VQ8A 2PI2A 3RN5A 5C4JH 1AE2A 4WJ3M 3CF5A 3NEMA 5C0XI 4GNXA 2F4VL 1HH2P 4DV2L 2IY5B 4AQYQ 2ZM6L 4KHPQ 3DM3A 1X56A 4A3EH 1VQDA 3OTOQ 4HJ5A 4JI5Q 2JA8G 4X62L 3KFUA 3S15H 1HNXL 3HOZG 1RL2A 2NVTH 3F8TA 4BY1H 3AEVA 2Z0SA 4QJFA 1Q1BA 4EQ5A 5IY0A 1QZGA 2CKZB 1OXSC 1VQEA 3AFPA 5JEAJ 4YWKA 4Y7NH 4IFDI 1BBWA 4A3MH 4MNOA 1J6QA 4GKJL 2K5HA 3CAMA 4DK3C 4GOPB 3CCRA 1E24A 1PH8A 4OX9L 4JYAQ 1A62A 3GD7A 4DK6C 1I5FA 2JEBI 1HNWQ 4RMFA 3PO2G 2N78A 1K8GA 1IBKL 1SROA 1I50H 1VCIA 1A63A 3CC7A 1E7ZA 3GTJH 3TS0A 1HZBA 2MQHA 2E2IH 2JA7H 4JBWA 1LTLA 1Z47A 1L0WA 4AQYL 2ALYB 4JI1L 1VQOA 3OTOL 3J81i 3PUWA 1V1QA 2LXJA 2EXDA 1HNXQ 2NN6G 4APVA 2UUBQ 2JA7G 3KF8B 3KJOA 1KRSA 1YJ9A 1N32Q 3RZDH 1NMFA 5C0XG 4J15A 4X65L 1TXYA 3M7NA 1I94L 2OTJA 1E1OA 4L5RC 1XPRA 4IOCA 5M5XH 5IP7H 1WFQA 4JCVE 3K7AH 1Y1WG 1PH5A 1AE3A 4OONA 3W1GA 5LMUL 2E2HH 4GN5A 1I6HH 2JA6G 1KIXA 4JI7L 4UP7A 4LF8L 1IZ6A 4DV5L 3Q8DA 4DR4Q 1HZCA 3RN2A 3K81C 2DGYA 1KRTA 2NVQH 2AMCB 3AYHB 1JJ2A 4LF5L 5M3FH 1HR0Q 2BH8A 3M4QA 4AYBG 1SFOH 4RG1A 2NN6I 1IBKQ 4IFDJ 1K83H 1XJVA 2UXDQ 2VZAA 1KHIA 4C3HH 2JA6H 1Q12A 1OXXK 1UEBA 3BZCA 1K9MC 1N36Q 3A5UA 3PV0A 4H02A 4HJAA 4A3IG 4JI6Q 2Q2UA 4UY8C 3K0XA 4JI1Q 4A3CH 3EN2A 4PMWA 1Y14B 5JEAG 3PUYA 4X6AH 1PA6A 4AYBE 4X65Q 4R4IA 2BA0A 1N32L 4LW1A 3G71A 4A3GG 1VQ6A 5DLQE 2E5LQ 1I94Q 3HFZB 3L7ZC 4JI2Q 4C3JH 4A3IH 1VQNA 3RZOH 4NXNL 3PO3H 4DR7L 1H95A 1XNRL 2A1AA 3W5OA 2CQOA 1C0AA 4IPGA 2IT1A 3AFQA 3F2DA 1VQAA 4DV0L 4JI7Q 1MJEA 3UE1A 3HOZH 1KAWA 4QL5A 3FKIH 3DLLA 5IYCG 1HR0L 4C3IH 4A3EG 3H0GH 3STBC 3H15A 3GTOH 2UXDL 1G6PA 3H3VI 3OYYA 2A8VA 2CWAA 3PUXA 4LFBL 1FVIA 1SRUA 4HIKA 1CSQA 5IYCH 4JBJA 1HNZL 2MO1A 3GTLH 3RLFA 4C2MH 2YU9H 1N36L 1LM0A 3PUZA 1OXUA 3MEFA 1VQ4A 2MO0A 4PZ8A 4R1JA 2N49A 4BBSH 2GVAA 4HJ7A 1WJJA 4X66L 1ASZA 1TWHH 2YTYA 4A3BH 4A3DG 2R7DA 4Y52H 5M3FG 4JI2L 4DR7Q 3KOJA 4YY3Q 4NXNQ 5HGQA 4OWWB 4GKKQ 3CCEA 2AHOB 4IJLA 4P71A 4HIMA 2JQOA 3KDFA 1EIFA 3NENA 3TEHB 4POFA 4BBRH 1SR3A 4MTNA 4MZ9A 5FJ8H 4DV0Q 1L1OC 2R92G 5JJLA 1P16A 2CFMA 4O2DA 1X54A 2BH2A 4A3JG 2KBNA 1EQRA 5GAGC 4QGUA 5GQOA 4JBKA 4BBRG 1SMXA 4A3GH 3E9IA 3EIVA 2K75A 4DNIA 4B3MQ 4BA1I 4JI5L 3UE0A 4PG3A 1GO3E 3HOXH 4HIDA 1NJIC 4DR3Q 3PCOB 3S17H 2ZJRA 5AJ3L 1PH6A 1VQMA 2E8GA 3UDXA 3A74A 4LUOA 4X64Q 4DR5Q 4TVAB 4A3JH 1O7IA 4LFCQ 4YY3L 1U5KA 3GTKH 2YTVA 2UXCL 2KENA 4GKKL 1X9NA 2VUMH 4R4OA 3M3YH 1IXRA 1VQ9A 1RIPA 1YI2A 3I4OA 2RCNA 1L1OB 1L2FA 2JA9A 1L1OA 2IHFA 3CCMA 3NBHB 4B3SQ 3S1NH 4JV5L 4P75A 1I3QH 3GTPH 4LFAQ 4JI4Q 3M4PA 3GTMH 2VS1A 4YCUA 1B7YB 1VQHA 3D31A 1XMQL 2PNHA 1B8AA 4IPHA 1WYDA 3I56A 1PYBA 2OQKA 2KCMA 2IX1A 2R92H 3I7FA 3U58A 5ELOA 4LF7Q 2R93H 1X3FA 4LUVA 2L15A 3CQZH 2UUBL 1ASYA 2FXQA 1EIYB 1QVGA 1N8RC 1HR0W 4DUZQ 4DR3L 3ULPA 3LGJA 3J7ZC 1AH9A 1EOVA 3CPFA 4YCWA 1K8AC 4LFCL 4X64L 2D62A 4DR5L 4XTCS 1YNXA 1GM5A 4O0AA 4JI3Q 3HKZG 4GLVB 1WCMG 3S24A
chains in the Genus database with same CATH superfamily
1STYA 3GP7A 1Y8PB 3GTJB 4M8AA 4B3SL 3S1QH 2EVBA 2M9VA 2V4DA 2F0SA 1YVCA 1J5EQ 1RHPA 2NN6H 4L5QA 3S9WA 3FVQA 3HKZE 1SNMA 4H13C 2QGQA 1UE5A 1C4QA 2JA5G 4ME5A 1WTQA 4R4QA 2EYOA 2H5XA 3S1MH 4A4IA 3RZDB 2N8NA 2HIVA 4GLAC 3NQIA 3GTQH 4LF7L 2ID0A 1SEBD 4KJOA 1B2TA 1SYCA 1T5XD 4ID6A 1OO9B 2PMZB 3CC2A 1OTCA 3V05A 1JB7A 1LT3D 5IP9H 3FMCA 3B6YA 4A3EB 1Q82C 3ICEA 1UWVA 3PF5A 2NVTB 5KEEA 4LF6Q 1XX8A 1YNND 5DM73 2N3SA 1PZKD 3NQTA 4DNRB 4LNQA 2QW7A 4CDCC 1WTXA 2PYKA 3ZYYX 1QILA 3CQZB 4X3UA 4BY1B 1VMPA 2F0VA 4I7ZC 3SXHA 5KNCA 1VQLA 4FP5D 3HOYG 2F4VQ 1Z6HA 4LAAA 2R3ZA 1S3OA 1PH9A 1G291 4K8JA 4OL7A 4IALA 2VB2X 4BA2I 1HPCA 2NZHA 1YIJA 4DXGA 4K2LA 3E9HA 2L0CA 1NE3A 4CHTB 1EEID 2NWGA 2CH4W 3X3MA 2HDLA 3M85A 2V1CC 4F8MA 3D4DA 4CJ0B 1MIUA 3TMEA 2Q2HA 3HKSA 4A3BG 4A3DH 2WFWA 2XWJB 3G48A 2E2HB 3PIOA 4HR7B 4A3DB 1MD2D 4FYDA 1T9HA 4JI8L 4G4KA 3H6MA 4JI6L 4WRDA 1KQSA 4PMBA 2A6ED 3CCQA 4K5VA 2F0HA 1KAAA 4XT1B 1ENFA 3FPPA 3ITPA 3DUZA 3OIPA 4NDXA 2QILA 2PQAB 1STBA 5JJIA 3E0JA 3S15B 3RMHA 3NTHA 3QIAA 1VQJA 2KEDA 4L5TA 1NMGA 4EX5A 4S3SA 2R7ZG 4ALPA 1KABA 1PVOA 1N34L 5BN3A 1EYCA 3M7GA 1ZXTA 2FHTA 2Z4IA 2G9DA 2RHSB 4B3RQ 4DAYA 2WV6D 2ZTEA 3W1BA 2B29A 2QCPX 2K5QA 3HOUB 3PO3G 1TT2A 4A3IB 5M3MH 5IYBG 1K0RA 2HUGA 1FJGL 2C35B 1O7ZA 3CKIB 2VQFQ 2F0WA 3CD6A 2WAQB 4C3IB 1RODA 1FGUA 4FO2A 2KVMA 4DR6L 1WD1A 1EYAA 1SMYD 3X3NA 5C4HA 2NUCA 2ZJQA 5FKAC 4AH6A 5COYA 3TDQA 2PQEA 3NBIA 5EBCA 5C4ZA 5CBAE 5HGTA 3G6EA 1MHWC 1M4VA 2D0PA 3HZXA 2LMCB 1HJPA 3FP9A 1HZAA 5M5YH 4DAPA 4HIOA 5I6WA 4GLXA 2ZJPA 2LY7A 2HHHL 2JE6I 5DM63 5J3BA 4HCEA 1HNZQ 3BZKA 2L4NA 1UEAB 5C4XH 1YJWA 4MTKA 2F4IA 4R9WA 4BS9A 2MFIA 1O80A 2NZOA 3PGZA 2NYZD 3CCVA 2EJGC 1E1TA 2UUAQ 1JJGA 1CI3M 1DGSA 1LTID 5D65A 1H9JA 5GROA 2YV5A 4GOPA 4L6TB 3VDYA 3TBIB 1YITA 5C44H 3D4WA 3CW2C 1TWCB 5BN5A 3N52A 1FR3A 3CCJA 1ZEQX 4X3KA 1X3QA 3GDEA 3KLSX 3NXWA 2K28A 4ME3A 3MXPA 5IYDG 2R7FA 3PIP3 3I4MH 3GTGB 1EY8A 1YNJC 4KD4A 3N6RA 1BBXC 1IL8A 4R4TA 3S2HB 1KDCA 1C48A 4IUPA 1D7QA 1KXLA 2I5HA 1HA6A 3SGIA 2RQXA 4XQQA 1Q1EA 3ZJYC 2PZUA 1QZHA 5C5MA 3KF6A 2F03A 1LLRD 2N55A 1I4HA 1KD1C 1B9NA 3EJIA 4JBMA 4XT3B 1WVLA 4DV7L 5C4XB 4A3FB 1SN8A 4KJNA 3I8ZA 2Y0SG 1EOTA 2DY7A 1QUQB 1NR2A 5FJ8G 3ND8A 3H09A 5E4WC 4JVZA 4HN7A 3AB9A 4IFDH 1STEA 3FRPB 4QB4A 1VQ7A 1ET6A 2IL8A 3MVVA 1Q8KA 3AQQA 3K5NA 1BOSA 1IKLA 3HOVB 1F9PA 4NP5A 5D14A 2EXZA 4DV6Q 1J5EL 3NTKA 5GADC 1CKMA 5K36H 1A0IA 1X3EA 1VQ8A 5M3FB 4C56C 4ILWA 3NEMA 1B53A 3Q22A 2XNAC 1CA6A 4AQYQ 4OO1H 3DM3A 3P1HA 4HJ5A 3KFUA 2JA8G 3S15H 4X62L 4OIKA 2C9OA 4Y7NB 1RL2A 2NVTH 4K5XA 4XXEA 3AEVA 4QJFA 1MSGA 1TS5A 1QZGA 2CKZB 2JSOA 3I91A 2CW0C 5JEAJ 4IFDI 1BBWA 2R7ZB 4GKJL 2K5HA 4DK3C 1U4MA 1E24A 1PH8A 4CJ2C 1A62A 4GZYC 1EZ6A 3HGBA 3LWEA 1IW7D 1C8CA 4RMFA 1IBKL 3K5OA 3CC7A 4EGVA 3HP3A 3GTJH 2PPBC 2ENBA 3OOCA 4RA8A 3EQLC 4AQYL 2IW3A 1G2TA 3MEHA 2NN6G 2UUBQ 2JA7G 1HHVA 1TQOA 5M5XB 1NMFA 1WTHA 2Z8LA 5EKKA 2OTJA 2J4XA 1AZPA 4A3BB 1YNNC 4UP7A 4YIJA 1IZ6A 4DV5L 1LT6D 3RN2A 1CK1A 2AMCB 3AYHB 3L9AX 5M3FH 5C3XA 4KD3A 3JAME 2NN6I 4IFDJ 2H1EA 4DU9A 2VZAA 1OXXK 3PV0A 4H02A 4HJAA 4CKCA 1ONLA 4A3CH 2RSNA 1TU2B 3CRLC 3QOJA 1EQTA 3HOXB 4R8NA 2E5LQ 5EBDA 3HFZB 4C1NI 2L9HA 3L7ZC 1D1IA 1VQNA 4NXNL 5FLXL 2A1AA 1B3QA 1S5DD 2CQOA 1H9RA 2E75C 2IT1A 3AFQA 3M4YA 3ONAB 1JORA 4DV0L 2B8FA 4QL5A 1PTOD 3DLLA 3GTOB 4C3IH 1PZJD 4A3EG 2O5IC 2OEOA 1HFGA 1PTOB 3H91A 3GTOH 1I3QB 4RWSC 1G6PA 3PUXA 4HCSA 2A6EC 1FVIA 1SRUA 3D6WA 4HIKA 2MPMA 4JBJA 1QNUA 3GTLH 3BYTB 3PUZA 1OXUA 4IQZA 2D9UA 1VQ4A 2GVAA 4X66L 1TWHH 2YTYA 4Y52H 3NTIA 3E6ZX 4K6LA 4YY3Q 5DAUA 2A73B 5I2YA 2AHOB 1DJRD 1EIFA 2F1MA 4BBRH 4MZ9A 2R92G 3TSSA 4BY7B 1H9SA 1JOQA 1PTOF 4OELB 4CDEC 2KA7A 1EQRA 4IUNA 1SMXA 5JPMC 4DNIA 4TKOB 3HS0C 4BA1I 1ILPA 1JICA 1GO3E 4PG3A 1NJIC 1PH6A 1CZGA 2A68C 5C6AA 4DR5Q 4LFCQ 4H0LC 1KTKA 4YY3L 4N8X1 1VF7A 3GTKH 5J22A 3M3YH 1VQ9A 1L1OB 1L1OA 3ND9A 3NBHB 2WKDA 4JV5L 2A69C 1I3QH 3M4PA 3GTMH 4YCUA 4JPBW 3G6JB 2Z6BA 1XMQL 2D2CC 1TKWB 3NE5B 2OQKA 4LK1C 5ELBA 2KCMA 2IX1A 1GUSA 2R92H 3J81L 2R93H 4LUVA 4UHVA 3CQZH 3J80E 1EIYB 1Y69U 3VYSA 1N8RC 1R4QB 1HR0W 3ULPA 3J7ZC 1JOOA 1Y1WB 4GKKQ 4JI3Q 4X64L 1YNXA 1GUWA 1WCMG 1I50H 3S24A 4CGYB 2HCIA 4GN3B 2MNAA 4LMQD 4KKTA 2A5HA 1EIGA 5CV9A 1BCPB 1LYLA 4FF4A 1B50A 4B9XA 1KC8C 1XMQQ 3PO2B 3RR5A 3J80c 4RHSA 2BCOA 2F0QA 3TZUA 1DONA 5KYIA 3C1EA 4JI0Q 1VQ5A 4F88A 2B2YA 4A75A 4A3JB 2EYLA 4KY6A 1E2ZA 2ZXPA 5ISRA 2K4KA 3URYA 2XN9C 4P74A 4DFAA 3K5MA 1F77A 3G7LA 5A35A 1JB3A 4QQBX 2R93G 5ELEA 5GAEC 4FXGC 1IBMQ 2VY3A 1BCPF 4DUYL 1Y1VB 4RGNA 2EE1A 1F2ZA 1TY0A 1D5MC 2K5VA 2RF4A 1CKNB 3CMAA 4GNXB 3H3VH 3DMUA 3HOUG 4XYOA 3SK5A 2QEXA 2OWOA 3A0JA 3S16H 1PH4A 4A93B 5IP9G 2OQ0A 1PHJA 2UU9L 2I0QA 1CTMA 4DV3Q 1GKHA 2K7VA 3HOUH 5FLXc 1ZKOA 3IL8A 3FKIG 1UE1A 5EAYA 4LWCA 3J81c 3H0GB 2OXPA 1MSHA 1UUPA 4DR4L 1QVCA 2WAQE 2E2IB 3A8JE 3ERSX 3A5ZB 1VS0A 4LF5Q 1SNQA 4G57A 3JAMi 4JC0A 3GO5A 4P2CB 2TSSA 4B3RL 2Q8TA 1K0SA 4G7HC 2JEAI 3DXJC 1WTVA 5LMNQ 4DR2Q 1KNAA 1SFOB 2AWOA 5AJ3Q 4LF4Q 4QIWB 2CW0D 1JWSD 1TY2A 1BVSA 3KF6B 1WD0A 4G7OC 4I7AA 2Q8RE 3RLNA 1JOKA 2D0OA 4XYQA 3KDFB 1W2BA 1EY5A 1JR0D 3KYHC 1JC7A 4UP9A 4BY1G 2K03A 5C0XJ 1FNWA 2B8GA 4B9WA 2R61A 4YHHQ 1NTGA 1MKHA 1TWGH 1F2LA 2I5LX 4XDXA 3K8AA 2EZVA 2B63G 3ULLA 1CQFA 2I46A 3GTGH 1DOMA 4IPCA 4FDBA 5M9OA 2E5LL 2XRSD 3S2HH 2CCZA 1M90C 2C5CA 4B08A 4XQNA 2IWHA 3PQIA 1B3AA 3PIO3 4C2MB 3T1YQ 1EQQA 2JN4A 4RHRA 1N34Q 2EJMA 1W6JA 3T53B 1SNCA 1IYJB 1SYFA 5CBEE 1V1OA 3P7JA 4B3ML 4YHHL 1DXMA 4B3TQ 1T5EA 3VYRA 1NNXA 4RAUC 1SNPA 1X32A 1EY6A 5JVG3 1YZ6A 3C2PA 3HOWB 5I9OA 1A3VA 4A3KH 1FJGQ 1S5CD 1IBLQ 3SK8A 1DM0B 3HOYH 2UUCL 1IBML 1PYSB 3ULJA 3U9SA 1KLGD 1V43A 4OEMB 3RD4A 2AUJD 4MIUA 3QG1A 1PRTD 3TREA 2F0KA 1D2BA 1VQCA 5E7NA 4H44C 2FMMA 2SDFA 3I2ZA 4B3TL 5CC4A 3OWEB 4NKLA 3E3XA 5LMNW 1U0LA 3BDCA 1ZYRD 1DCZA 4DAVA 5IWAL 1F2YA 3DWAA 5FLMH 4K14A 1Y8OB 5KYLA 4KV6A 5BN4A 4GOPC 4OGQC 2A19A 2F3IA 3UDIA 1STNA 3FDTA 3C46A 3GV3A 2K6AA 5IYDH 2PQAA 1A8VA 4JI4L 4QY7A 4CKEA 3KK7A 1V8QA 3STBD 1JMCA 1B1ZA 3J7AV 4BBRB 1EUJA 2PI2E 1RF2D 4IN3A 1Z7TA 4DN4M 1JWUD 4AYBB 2ZM6Q 1QCBD 3R2TA 3SHLA 3HEJA 2PMZE 4A3FG 4NB3A 1M1KC 2EYJA 3KLRA 3QOLA 1QVFA 1XPOA 4TRDA 1OXVA 4QF4A 2CWPA 3JAMc 1QE6A 2B2VA 5CGKA 1TWCH 4MHEA 3MHBA 1FYCA 1TIID 3IFDA 4X3SA 1SJED 3NBHA 3M4OH 5IT9c 1I6HB 4ODGA 1LTAD 4OX9Q 4DV4L 2M2LA 2ATWA 5C4JB 1MGSA 1Y1VG 3K59A 3CXCA 4C1NK 5TSSA 5C4JH 5L37A 5C0XI 2F4VL 3GTMB 4KHPQ 5M5WB 1IYVA 3OTOQ 4JI5Q 1XWEA 1HNXL 3HOZG 3MA2B 1JWMD 2B2WC 3I70A 4EQ5A 4DK1A 3AFPA 2NVXB 4A3MH 2F0FA 1LTSD 4OX9L 4BWGB 4CDFC 1B9MA 4JK1C 1KDBA 2B63B 1I5FA 2JEBI 3MXUA 3PO2G 2B39A 1EWCA 1NSNS 1NUCA 5FO7B 2JA7H 1LTLA 1Z47A 1JE4A 1EY7A 2ALYB 3OTOL 1ICFB 4IUUA 4N8FA 2EXDA 1HNXQ 3A7AB 4ZCKA 1KRSA 1N32Q 2BDNA 5C0XG 1E1OA 4IUTA 4L5RC 2J7ZA 1VF5C 2MUYA 5IP7H 1Y1WG 1TWHB 1I6HH 4KHVA 2E2HH 4GN5A 1GUTA 4JI7L 4LF8L 1K8MA 2F0PA 2CH4A 2DGYA 1KRTA 1BR9A 5I9PA 1JJ2A 4LF5L 5T1GA 3K57A 3FEWX 3M4QA 4RH6A 5DNFA 5ELCA 3V2TA 4RG1A 3K58A 5LL6S 2OF1A 1XJVA 2UXDQ 1ENAA 1PTOC 4A3KB 3A5UA 2WKCA 4A3IG 2EY2A 4LJZC 3BG3A 4X6AH 1PA6A 4AYBE 4X65Q 5KNDA 1HCZA 5AFWA 1VQ6A 5DLQE 1CFMA 1O7LA 4A3IH 1XNRL 1BUVT 1G8ZD 1C0AA 4IPGA 1HQMC 1EY0A 3FKIH 1GUOA 1LACA 5DEHA 4EQPA 2UXDL 4ZAIA 1SAPA 2ZT9C 3OYYA 3SVMA 4DXFA 1BF4A 4XQJA 5IYCH 2NBFA 3K6OA 3RLFA 2YU9H 4PZ8A 2AQ2B 3S2DB 1SYEA 3LWUA 4HJ7A 1WJJA 1STAA 4A3BH 4A3DG 2R7DA 5M3FG 4DR7Q 3KOJA 4OWWB 1S4ZA 4P71A 4HIMA 5JPNC 4HTHA 2FJ2A 3TEHB 4POFA 2EY1A 4MTNA 3R3OA 2B2TC 2JXMB 1L1OC 1P16A 3W2DA 3S1QB 2NVYB 4A3JG 2PNRC 4CKBA 4FF2A 2A69D 3Q23A 2KECA 4HSVA 3NSWA 3HOYB 3F2UA 2RSOA 3S17H 3PCOB 3M3YB 5IGBA 4X64Q 4A3JH 5FOBB 2M00A 2PZTA 2YTVA 2KENA 2VUMH 1GUGA 1RCVD 2RCNA 1TS3A 5JOBA 3I4NB 3CCMA 2FINB 1SYDA 4IUQA 4IURA 1PRTF 1AW7A 4IPHA 2A68D 1E0BA 3I7FA 1PFBA 1X3FA 2L15A 1ASYA 2FXQA 2BOSA 1A15A 1SSOA 5EKIA 4DUZQ 3LGJA 4UDUC 4LFCL 4DR5L 1GM5A 3HKZG 5I6YA 1RTOA 5IGFA 5J1ZA 4ABNA 1R9TH 4DR6Q 1CSPA 1SMYC 4DUYQ 1AFPA 3J81E 1VMCA 5BR8Q 3VR4A 2NVYH 4M1UB 1U4PA 3VR3A 4KY7A 3T16A 4LFAL 3I4NG 5JVH3 2EYMA 1IW7C 1V9PA 3WWVA 3E5SA 1EQVA 2HHHQ 4O1NA 2Y0SE 2K50A 3KBGA 2UXBL 1NY4A 4DV3L 2JK8A 4BXXH 1S5ED 5C44G 1EFID 3BJUA 5I2XA 2MP1A 1SLJA 2L12A 4JI3L 2KHJA 1Y1VH 2KCCA 2DJGC 4DK0A 1PH3A 4H7BA 4KK7A 2JJQA 2OTLA 5FLMG 4A3MB 1SE8A 2ZXOA 2EYFA 4JOIC 2NZ1D 4L5SA 2B2YC 4EVOA 2F0MA 1SBBB 2QKIC 2UXBQ 1XPUA 4A3MG 5IP7G 1Y1WH 5IOCA 4DR1Q 2LXKA 3PO3B 2KUMA 2IJ0A 1PH2A 5D3IB 1CM9A 3I73A 4KN4C 1XNQQ 4KTAA 1C7YA 2OT2A 2VXWA 5IGGA 5C4XG 3QB3A 1YJNA 2O5JC 3KLSA 4GS3A 2XRQD 1X6OA 4FXDA 3S1RH 1LO5D 2YTXA 4DV1L 3S1MB 1PH7A 2RDGA 5IE8A 2IX3A 1SYBA 1KNEA 4DAMA 4JG2A 3TZDA 1S72A 1TS2A 1EFWA 3CCLA 4KI0A 3HOWG 3T1HL 2AWNA 1XTDA 3CP0A 4NXML 4K2KA 4KHZA 2ZTDA 1X3PA 2XSCA 2AKWB 4ZK9B 1B4OA 3OMCA 4HJ8A 1JE5A 3HOWH 5CMDA 3R93A 2ZTCA 4UPAA 2QDBA 2DNEA 2B2UA 1YHAA 2I5MX 4GN4B 4LF8Q 3BVMA 3D0FA 4OO1G 2HQLA 2K14A 2NVXH 1H9KA 1YBYA 4JI8Q 3L3OC 4WFN3 2F52A 5CV4A 5M3MB 3RNUA 5C5LA 1X3GA 3SEBA 4C3JB 3RZOB 4TQUS 2X6LA 3NP8A 2K01A 2HDMA 3AMUA 2IHEA 5CV6A 4DPGA 3GTLB 2EYPA 3F1ZA 2VB3X 4KKSA 1MI2A 4F87A 2IPKD 2JYOA 2HT1A 4P73A 4GKJQ 1HQRD 1XNRQ 2JA8H 1JJCB 2K5NA 1PV4A 1HRJA 5H1SE 5T1IA 1UAPA 1J8IA 2JA8B 2RHQB 1Q90A 1WTWA 1CKOA 4YCVA 3L0OA 2Q2TA 1TS4A 1SNDA 4QCLA 4LFBQ 3U4VA 2EDGA 4AIMA 2P5ZX 1RJTA 1B70B 1R9TB 4YWLA 1SE4A 3ER0A 1Q86C 4XIGS 2UXCQ 2QEJC 2Q2IA 1J9OA 2WAQG 3K80C 2VL6A 1HZ9A 2GA4B 3WOFA 4BY7H 1D6EC 3OW7A 4MN3A 1QG7A 1PH1A 5LMUQ 1K3RA 2QF7A 2HD3A 2KCTA 4DV5Q 5I4DA 2KQ3A 1GOZA 2SNMA 1ENCA 1PLFA 3CMEA 1ICWA 3TS2A 2Y0SB 1LTBD 5C44B 1Q46A 3T1YL 2WB1G 4K0KQ 1TWFB 5C3EH 1EL0A 3FKIB 1BXTA 1L0YB 2F3WA 3NPPA 4NW2A 2PCFB 3S14H 4KLKA 1U9RA 2NTTA 3T4AC 3BYYB 2JA5H 2VQEQ 2EY5A 3OW2A 1XNQL 4A93G 2A74C 2UUAL 4HMJA 4ZUJA 2R92B 1XXGA 4NMZA 1F9RA 4A3LG 1TWAH 2UUCQ 1ESRA 1PYWD 4OHJA 2B2VC 4ZQ3A 5LHY1 4DV1Q 1ML0D 1EYDA 3KUPA 3P20A 1SE3A 4UP8A 1TWAB 5CV8A 1VQKA 4A93H 3KBXA 4OXPA 1K8OA 4HJ9A 3OPOA 2HQEA 2NTSA 2R93B 4A3FH 4R4CA 2QA4A 1PZID 4A3KG 1NBWA 3RUZA 4A3LH 3I4LA 1VQIA 1X65A 3CPWA 3TRZA 4KHPL 2PW7A 2OCEA 2XIWA 3R8BA 2AQ1B 4L8JA 4PZ6A 1NR4A 2L55A 1G2SA 3IFTA 2VQEL 1WTOA 2E74C 4IUVA 2E76C 3DWQA 4KMUC 3KJPA 3F2CA 1YHQA 1A3TA 1NAPA 1N9WA 1FGBD 1VQGA 4A3CG 2AUKA 2ASBA 3BU2A 2IX0A 1Q7YC 1N33Q 3JAML 4IOAA 1TWFH 3MWYW 1L0XB 4DV7Q 4TSSA 5EQ0A 1RTNA 1AE2A 3IAYA 4DV2L 2ZM6L 1X56A 4A3EH 1CT1D 1VQDA 3OIQA 3F8TA 2I07B 2Z0SA 4FXKC 5IY0A 3MXGA 1VQEA 4YWKA 1J6QA 1LV9A 1HUMA 3QO2A 3CCRA 1PRTB 3GD7A 1DYQA 1CQVA 4DK6C 1HNWQ 2FFKB 1K8GA 2HCCA 2WIIB 1VCIA 1A63A 4K8IA 1E7ZA 1HZBA 4JBWA 5C0XH 1L0WA 3LNNA 1KLUD 1VQOA 3PUWA 2LS01 1I4GA 1HFNA 3A54A 3MAQA 1IHZA 3KF8B 4HMIA 1QB5D 4C3HG 1TXYA 3M7NA 1I94L 4IOCA 1E2WA 3K7AH 1PH5A 4OONA 3W1GA 5LMUL 4DGZA 1M8AA 1KIXA 1S5FD 3Q8DA 3SE0A 4FF1A 3BZDB 3K81C 1BO0A 2PZWA 2NVQH 3PMFA 2BH8A 3ERQA 4AYBG 1SFOH 2F0JA 3SK4A 4X3TA 1KHIA 2X6GA 4RFBA 1Q12A 5EPKA 4FF3A 4JI6Q 2Q2UA 4UY8C 3K0XA 4JI1Q 1IYUA 4PMWA 3R2IA 2BA0A 4OIJA 1N32L 2EOTA 3S17B 4A3GG 3VR5A 5IT9L 3MTSA 3D3RA 4JI2Q 5EKLA 5JEAH 1GJXA 4RGMA 5JAVA 3F2DA 2EPBA 4JI7Q 3UE1A 1PTOH 3HOZH 1IKMA 5IYCG 2F0EA 1EEFD 1A2UA 3H3VI 4HAEA 1LT5D 2CWAA 5KNBA 4DF7A 1N36L 2G9HD 3MEFA 4FNFA 2MO0A 2EJFC 3V96A 2N49A 1ASZA 3Q6SA 3T13A 1EIHA 3TN2A 4JI2L 4NXNQ 5HGQA 4K6DA 1ZYRC 3CCEA 2AQ3B 4IJLA 3O13A 3AU7A 4ZKCB 1BCPC 2Z4HA 3DM1A 3DWPA 5FJ8H 4WORA 2EY6A 1Q3LA 1GUNA 1HA5A 4N9TA 1BNZA 2CFMA 5FK9C 3T56B 3A8KE 2SNSA 5GAGC 5JJZA 3EIVA 2K75A 4RCNA 5CORA 1ESFA 1FNVA 3VYTA 3SR1A 4HIDA 2A6HC 4DR3Q 2ZJRA 5AJ3L 1VQMA 2E8GA 3UDXA 4LUOA 4TVAB 1U5KA 2UXCL 2F0NA 4GKKL 1X9NA 4R4OA 2RDHA 3OHXC 4I65A 3I4OA 3TP8A 2QDLA 1L2FA 2JA9A 2IHFA 2F0UA 3S1NH 3BDLA 5FO8B 1FD7D 4LFAQ 4WJWA 4R8IA 4JI4Q 3BS1A 2VS1A 5KGUA 1B7YB 1VQHA 1AN8A 3D31A 2DN8A 2PW5A 4L63B 1JCKB 1B8AA 3I56A 1EY4A 2O4XA 1PYBA 2SEBD 3OSOA 5ELOA 4E6IA 4LF7Q 2UUBL 5M5YB 1CZWA 1D5XC 1AH9A 1EOVA 4YCWA 1G91A 4O0AA 3EROA 4V190 1W6KA 1BCPD 3LX0A 3U9OA 4CJ1B 5IT9E 1JT8A 4LF6L 3MXNA 5E1FA 3HOVG 4DV4Q 2E2JB 2HIXA 3G4SA 3U4ZA 1Y8NB 2RA4A 4QUFA 1H9SB 4RGTA 3RLOA 1EY9A 3L2PA 4P72A 3HOVH 1F9SA 1YNJD 5FO9B 2L11A 3I72A 4POGA 1HTPA 5ELNA 3GTQB 1K28A 4DUZL 3IKJA 1IBLL 3H0GG 3I4NH 3PIPA 3A8IE 2F0OA 3H3VC 1U4LA 4KY5A 1E3PA 1YHBA 2H4OA 3PF4A 4C3HB 2KHIA 2Z6KC 1WTPA 1G6ZA 1G51A 2L5TA 2N88A 2F0DA 3S16B 2X69A 5M5WH 2VUMG 2WACA 4RGOS 4ZKBB 1AEXA 4DV6L 4IO9A 4Q5VA 3MFGA 1LTRD 4JI0L 1O78A 5ELFA 2DY8A 3T51B 2WP8J 3D6CA 5E3FA 4NXMQ 1GHJA 5A2QE 3FHWA 2R7ZH 5LMNL 1E22A 4PV1C 3MZ5A 3TQYA 4DR2L 2WB1E 3NWTA 4X62Q 2RVLA 1EWIA 4OWTB 4PNYA 2ICIA 3HG9A 2CHBD 4A76A 3P75A 2DJFC 4QIWE 2CVRA 2KEEA 1KDAA 1PFNA 2JA7B 3K7UC 3F2BA 3MXNB 1EU3A 1X55A 2EIFA 3CCUA 3EBEA 1EU4A 3I90A 4JOIA 4K5WA 3C3LA 1A6XA 1BDOA 1Z9FA 1CHPD 5NUCA 1VQBA 3M9BA 1PFSA 4PQXA 2UU9Q 3QR8A 3CU7A 4IJHA 1EZ8A 4DR1L 3GQBA 2RCFA 1SXTA 2NB0A 2D5DA 1S40A 1BQQT 2KJXA 3UDFA 1CKNA 1U4RA 2B3GA 3NELA 4OWXB 5M3MG 5IYBH 3D8GA 1K83B 3UDGA 3J7A5 1XMOL 3A55A 3I55A 4ZLTF 2K05A 3I4MG 4WJ4A 1RDPD 3KLWA 4GNXC 1W3SA 2R6GA 1QUQA 3HOZB 1RKNA 2K52A 4IFDG 4LF4L 4CDDC 3T1HQ 5C3EB 1II3A 1JQYD 2RKSA 1STHA 5ELDA 3S1NB 4NPSA 1CUKA 2CQAA 4V0BA 1ET9A 3VR6A 3CCSA 3S1RB 2K04A 5K36G 4BXXG 2GN5A 1EWHA 1XMOQ 4BBSG 2YYZA 3Q24A 1DD2A 2EQSA 5KIXA 4RCOA 1LTTD 2YU9B 3MFYA 1XTCD 4PMCA 1LT4D 3BDOA 3CC4A 1WCMH 4K0KL 1VQFA 2Z1CA 1TR5A 4BBSB 1FL0A 1O7YA 5GAHC 1IL2A 2NVQB 3J81j 1P8LA 1Q81C 2LSSA 4BY7G 4DAYB 4N9PA 5HY6A 2BDOA 4ZYSA 1V1PB 1UE7A 4X66Q 2VQFL 4LF9L 1BKBA 3PSIA 2FMCA 3JC66 5D3DA 1SJHD 3J80L 1D1KA 2O2LD 5G3LD 1B44D 2BE5C 3VR2A 5C3EG 1CHQD 2GVBA 4EQOA 3QJYA 1CA5A 2XTIA 1QNKA 5EGTA 2Z6KA 3PUVA 2DUDA 1GXDC 4LUZA 3MC0B 1HTLD 3KF8A 3K5LA 1C9OA 3I4MB 3VA5A 1D5ZC 2Z9HA 1D8LA 1MJCA 2K1BA 2KHSA 3IRBA 1PMRA 2K5WA 1VQPA 3DHQA 2VW9A 2G5DA 3J80i 2WINB 4LF9Q 3EVQA 3TP5A 3GTPB 3NUCA 1I4PA 4JW0A 3HOXG 3S2DH 4DKAC 3VYUA 2KCNA 2ICEC 5BR8L 1E2VA 1EYGA 1N33L 2VNUD 1WCMB 2ES2A 1UE6A 1XYIA 4JV5Q 4J6HA 1K73C 2B63H 4YWMA 1LUZA 1VDZA 4RKBA 1LABA 1H9MA 4DV2Q 1WI5A 2E2JH 1GHKA 3QWNA 1HUNA 3PO2H 4EQNA 5IODA 2RDFA 4OO1I 2XVSA 2BA1A 3HRZC 4UAIA 3E0EA 1FNUA 1SE2A 5IWAQ 2PO4A 3EFXD 3U50C 3A7LA 4C3IG 1GD7A 5IGCA 1YEZA 1WOCA 2ZXRA 4G7ZC 2JP1A 2F0IA 2F0LA 1KL9A 2B2TA 1HNWL 1A3UA 1I4QA 4IPDA 2XGTA 5IIFA 1LTGD 2F0GA 5CV5A 4JYAL 2VUMB 1PRTC 1OXTA 4F7XA 4RKLA 3M4OB 1AZQA 3EA6A 1BBUA 1GVPA 4PZ7A 2PI2A 3RN5A 4WJ3M 3CF5A 4GNXA 2IY5B 1HH2P 5F2DA 1S5BD 1DOLA 1F2MA 1SNOA 1WTRA 1DOKA 4BY1H 1Q1BA 1STGA 1F9QA 4Y7NH 2E2DC 4DA2A 3FPUB 4MNOA 3CAMA 4GOPB 1I4RA 4JYAQ 5LL6X 1PFMA 2N78A 3I3CA 2K5DA 1SROA 4HEDA 3TS0A 2MQHA 2E2IH 2K32A 2F3VA 3BVGA 4DNTB 4JI1L 1SDFA 3J81i 1V1QA 2LXJA 5A2QL 1NCVA 4APVA 5IGDA 3KJOA 1YJ9A 5E4XA 2EYHA 4U673 3RZDH 3K7AB 3H94A 4J15A 5EPJA 4X65L 1XPRA 4Z9CB 5M5XH 5HURA 1WFQA 4JCVE 1AE3A 5KRUA 2JA6G 2BE5D 4DR4Q 1HZCA 3W3AA 2Q8IB 5J39A 3TP6A 2K33A 4ZRZA 3GV6A 5K5PA 1HR0Q 1IBKQ 1K83H 4KN7C 2JA6H 4C3HH 1I4XA 1K9MC 1UEBA 3BZCA 1N36Q 1K3BC 4C3JG 1PDQA 3EN2A 1Y14B 4QUCA 3PUYA 5JEAG 3NK9A 4R4IA 3K0YA 1R4PB 2LKVA 4LW1A 3G71A 1I94Q 4C3JH 3RZOH 4DR7L 1H95A 3PO3H 3WDNA 3W5OA 3GTKB 3HKZB 4HSPA 1VQAA 1MJEA 1KAWA 1HR0L 2XWBB 3H0GH 3S14B 1UNSA 3STBC 3H15A 3CRKC 5CYUA 1TWGB 2A8VA 4LFBL 1CSQA 2F0TA 1HNZL 2MO1A 4C2MH 1LM0A 3WOEA 1DZ1A 4R1JA 4BBSH 4Q0FA 1RD9D 1QJOA 4O42A 4ZUIA 1AP0A 1V1PA 4IZ8A 1QOHA 3CHBD 3NWSA 2JQOA 3KDFA 2RBMA 3NENA 4U68A 1SR3A 5CV7A 4DV0Q 5JJLA 4CBVA 2JA6B 1A2TA 1QWYA 4O2DA 1X54A 2J0TD 2BH2A 4J1MA 2KBNA 3TP7A 4QGUA 4JBKA 5GQOA 4QMGA 4BBRG 4A3GH 3E9IA 3OWFA 1SYGA 3J7AF 5FLXE 4B3MQ 4JI5L 4A3GB 3UE0A 3HOXH 3VA7A 1Q8IA 3BVZA 3A74A 3DEOA 5EPLA 1O7IA 2MJ8A 3SK6A 2DNCA 2SOBA 1IXRA 2TMPA 2B2WA 4J8QA 3DEPA 1RIPA 2B2UC 3OMGA 1YI2A 2JA5B 3UI2A 5G3LF 3D4RA 5EJWA 1I6VC 4B3SQ 3C1FA 4P75A 1PXUA 3GTPH 2L1BA 3SDZA 4KKUA 2PNHA 3Q0AA 2KOLA 3A56A 1ILQA 2A6HD 1WYDA 4FVMA 5CR3A 1TVXA 3NHHA 3J7YW 5IGEA 4ULLA 2LFNA 3U58A 1HXYD 2MGSA 1QVGA 1I50B 4DR3L 1MBYA 3CPFA 1K8AC 2MHVA 5JJKA 2D62A 4XTCS 4GLVB 2WB1B 5C3WA 1OXSC
chains in the Genus database with same CATH topology
4GN3B 2MNAA 1R9TH 4DR6Q 1JT8A 1CSPA 4B3SL 4DUYQ 4LF6L 3S1QH 3HOVG 5BR8Q 1YVCA 2NVYH 1LYLA 4DV4Q 2HIXA 1KC8C 1J5EQ 3G4SA 1XMQQ 4L5QA 3U4ZA 4LFAL 3HKZE 3RR5A 3I4NG 3J80c 2QGQA 1UE5A 2JA5G 3RLOA 1V9PA 4R4QA 3WWVA 2H5XA 3L2PA 3S1MH 4A4IA 4P72A 2HHHQ 2N8NA 3HOVH 2HIVA 4JI0Q 2Y0SE 4GLAC 1VQ5A 2K50A 4A75A 2UXBL 3GTQH 1NY4A 4DV3L 2JK8A 4BXXH 4LF7L 2ID0A 2K4KA 4POGA 5C44G 5ELNA 3BJUA 4DUZL 1SLJA 4P74A 1IBLL 1OTCA 1JB7A 3CC2A 4JI3L 5IP9H 3H0GG 3I4NH 3PIPA 2KHJA 3B6YA 1Y1VH 4QQBX 2R93G 5GAEC 1Q82C 3ICEA 1PH3A 1UWVA 1E3PA 2VY3A 3PF5A 1IBMQ 1YHBA 3PF4A 4DUYL 4LF6Q 2KHIA 2Z6KC 2JJQA 2OTLA 1G51A 2K5VA 2N3SA 2RF4A 5FLMG 1CKNB 3CMAA 5M5WH 4GNXB 3H3VH 2VUMG 4LNQA 3HOUG 4IO9A 1SE8A 4DV6L 2QEXA 2OWOA 3A0JA 3S16H 4JOIC 1PH4A 4JI0L 4L5SA 2UXBQ 5IP9G 1VQLA 1XPUA 3HOYG 2WP8J 2OQ0A 4A3MG 2F4VQ 4NXMQ 5IP7G 1Y1WH 1PHJA 2I0QA 2UU9L 4DR1Q 3FHWA 2R7ZH 1S3OA 1PH9A 5LMNL 1E22A 1G291 2LXKA 3TQYA 4DV3Q 4DR2L 4BA2I 1GKHA 2WB1E 2NZHA 4X62Q 5FLXc 1YIJA 1PH2A 3E9HA 1EWIA 3HOUH 3FKIG 1NE3A 1XNQQ 4OWTB 1UE1A 5EAYA 4LWCA 3J81c 4A76A 4QIWE 1C7YA 3M85A 2V1CC 4DR4L 1QVCA 5C4XG 2WAQE 1YJNA 3K7UC 4GS3A 3ERSX 1X6OA 1MIUA 3A5ZB 3MXNB 3F2BA 1VS0A 1X55A 2EIFA 2YTXA 2Q2HA 3S1RH 4LF5Q 3CCUA 3HKSA 4DV1L 3JAMi 4JC0A 4A3BG 2WFWA 4A3DH 1PH7A 3GO5A 3EBEA 5IE8A 3G48A 4JOIA 3PIOA 4B3RL 4DAMA 1T9HA 1Z9FA 4JG2A 4JI8L 2JEAI 1S72A 5JJKA 1EFWA 3CCLA 4JI6L 1VQBA 3M9BA 1PFSA 4KI0A 3T1HL 1KQSA 2UU9Q 3HOWG 2AWNA 4IJHA 1XTDA 5LMNQ 4DR2Q 2AWOA 3CP0A 3CCQA 5AJ3Q 4NXML 4LF4Q 4KHZA 4DR1L 2ZTDA 2AKWB 1BVSA 3KF6B 1S40A 4HJ8A 1JE5A 2PQAB 3RLNA 3UDFA 3HOWH 5JJIA 2D0OA 2ZTCA 1CKNA 2B3GA 4OWXB 3NELA 4UPAA 5M3MG 5IYBH 3KDFB 3UDGA 1YHAA 2I5MX 4GN4B 1W2BA 4LF8Q 3J7A5 1VQJA 1XMOL 3D0FA 4L5TA 4OO1G 3I55A 2HQLA 1NMGA 3KYHC 4EX5A 2R7ZG 2K14A 2NVXH 4ALPA 1PVOA 1N34L 3I4MG 4WJ4A 3KLWA 1YBYA 4JI8Q 4GNXC 4UP9A 4BY1G 1W3SA 2RHSB 4B3RQ 2R6GA 1QUQA 5C0XJ 2F52A 2ZTEA 3W1BA 3RNUA 2B29A 2K52A 1X3GA 4IFDG 4YHHQ 4LF4L 3PO3G 3T1HQ 5M3MH 4TQUS 5IYBG 1NTGA 1MKHA 1K0RA 1TWGH 2I5LX 1FJGL 3K8AA 2C35B 2IHEA 2VQFQ 2B63G 3ULLA 4NPSA 1CUKA 4DPGA 3CD6A 3GTGH 3F1ZA 1FGUA 3CCSA 4DR6L 4IPCA 4FDBA 2E5LL 3S2HH 5K36G 2HT1A 4P73A 2GN5A 4BXXG 2CCZA 1M90C 4GKJQ 1XMOQ 1XNRQ 2ZJQA 2JA8H 2YYZA 4BBSG 1JJCB 2K5NA 4AH6A 1PV4A 2EQSA 5H1SE 3G6EA 2D0PA 1HJPA 2RHQB 3FP9A 3T1YQ 1EQQA 3CC4A 1HZAA 1WCMH 1N34Q 4K0KL 5M5YH 1VQFA 4HIOA 1CKOA 4YCVA 3L0OA 2Q2TA 1FL0A 4GLXA 1IYJB 2ZJPA 2HHHL 4LFBQ 4B3ML 5GAHC 2JE6I 3U4VA 5J3BA 4YHHL 3J81j 1IL2A 1P8LA 4AIMA 1Q81C 2LSSA 3BZKA 1HNZQ 4B3TQ 4BY7G 4DAYB 5C4XH 1B70B 1YJWA 5HY6A 1YZ6A 1UE7A 4YWLA 2MFIA 3ER0A 2NZOA 3PGZA 4XIGS 4A3KH 1Q86C 1FJGQ 1IBLQ 2UXCQ 4X66Q 2VQFL 3CCVA 2Q2IA 4LF9L 1BKBA 2WAQG 3K80C 2VL6A 1E1TA 1HZ9A 3PSIA 2UUAQ 3HOYH 2UUCL 4BY7H 1JJGA 3JC66 1DGSA 1PH1A 1IBML 1PYSB 5LMUQ 1K3RA 5GROA 2YV5A 4GOPA 3VDYA 3ULJA 2KCTA 5C3EG 4DV5Q 1YITA 2GVBA 5C44H 1V43A 3CW2C 3CMEA 2XTIA 3TS2A 2Z6KA 3CCJA 3TREA 1Q46A 3PUVA 2DUDA 3T1YL 2WB1G 1VQCA 5E7NA 4LUZA 4K0KQ 3GDEA 5C3EH 1C9OA 4ME3A 3I2ZA 4B3TL 1D8LA 1MJCA 5IYDG 3S14H 4KLKA 2R7FA 3IRBA 5LMNW 3I4MH 1VQPA 2VW9A 2JA5H 2VQEQ 3J80i 1U0LA 4R4TA 3OW2A 1XNQL 4LF9Q 4A93G 1D7QA 5IWAL 2UUAL 2I5HA 5FLMH 1KXLA 3SGIA 4GOPC 4A3LG 1TWAH 3HOXG 2UUCQ 3S2DH 2A19A 1Q1EA 2F3IA 4DKAC 5BR8L 3ZJYC 1EYGA 3UDIA 1N33L 1QZHA 2VNUD 3KF6A 4DV1Q 4UP8A 2ES2A 1VQKA 1UE6A 1KD1C 2PQAA 4OXPA 4A93H 4JV5Q 5IYDH 4HJ9A 1A8VA 4JI4L 4QY7A 4JBMA 1K73C 3STBD 1JMCA 4A3FH 4R4CA 2QA4A 4A3KG 2B63H 4YWMA 1NBWA 4DV7L 1LUZA 4A3LH 1EUJA 2PI2E 1VQIA 1X65A 4DV2Q 1WI5A 2E2JH 2ZM6Q 3CPWA 3TRZA 4KHPL 2OCEA 1SN8A 4PZ6A 3PO2H 4OO1I 2PMZE 2Y0SG 2VQEL 2BA1A 4A3FG 4NB3A 1M1KC 3E0EA 1QUQB 5FJ8G 5IWAQ 3U50C 1QVFA 3KJPA 1XPOA 1OXVA 3F2CA 1YHQA 1GD7A 1YEZA 1WOCA 2CWPA 3JAMc 1N9WA 1TWCH 1VQGA 1KL9A 4A3CG 1VQ7A 2ASBA 3BU2A 1HNWL 1Q8KA 2IX0A 3AQQA 2XGTA 4IPDA 5IT9c 1Q7YC 1N33Q 3M4OH 4OX9Q 4JYAL 4IOAA 4DV4L 2ATWA 1TWFH 1OXTA 4DV6Q 1J5EL 5GADC 4DV7Q 1Y1VG 1CKMA 1BBUA 1A0IA 1GVPA 1X3EA 4PZ7A 3CXCA 1VQ8A 2PI2A 3RN5A 5C4JH 1AE2A 4WJ3M 3CF5A 3NEMA 5C0XI 4GNXA 2F4VL 1HH2P 4DV2L 2IY5B 4AQYQ 2ZM6L 4KHPQ 3DM3A 1X56A 4A3EH 1VQDA 3OTOQ 4HJ5A 4JI5Q 2JA8G 4X62L 3KFUA 3S15H 1HNXL 3HOZG 1RL2A 2NVTH 3F8TA 4BY1H 3AEVA 2Z0SA 4QJFA 1Q1BA 4EQ5A 5IY0A 1QZGA 2CKZB 1OXSC 1VQEA 3AFPA 5JEAJ 4YWKA 4Y7NH 4IFDI 1BBWA 4A3MH 4MNOA 1J6QA 4GKJL 2K5HA 3CAMA 4DK3C 4GOPB 3CCRA 1E24A 1PH8A 4OX9L 4JYAQ 1A62A 3GD7A 4DK6C 1I5FA 2JEBI 1HNWQ 4RMFA 3PO2G 2N78A 1K8GA 1IBKL 1SROA 1I50H 1VCIA 1A63A 3CC7A 1E7ZA 3GTJH 3TS0A 1HZBA 2MQHA 2E2IH 2JA7H 4JBWA 1LTLA 1Z47A 1L0WA 4AQYL 2ALYB 4JI1L 1VQOA 3OTOL 3J81i 3PUWA 1V1QA 2LXJA 2EXDA 1HNXQ 2NN6G 4APVA 2UUBQ 2JA7G 3KF8B 3KJOA 1KRSA 1YJ9A 1N32Q 3RZDH 1NMFA 5C0XG 4J15A 4X65L 1TXYA 3M7NA 1I94L 2OTJA 1E1OA 4L5RC 1XPRA 4IOCA 5M5XH 5IP7H 1WFQA 4JCVE 3K7AH 1Y1WG 1PH5A 1AE3A 4OONA 3W1GA 5LMUL 2E2HH 4GN5A 1I6HH 2JA6G 1KIXA 4JI7L 4UP7A 4LF8L 1IZ6A 4DV5L 3Q8DA 4DR4Q 1HZCA 3RN2A 3K81C 2DGYA 1KRTA 2NVQH 2AMCB 3AYHB 1JJ2A 4LF5L 5M3FH 1HR0Q 2BH8A 3M4QA 4AYBG 1SFOH 4RG1A 2NN6I 1IBKQ 4IFDJ 1K83H 1XJVA 2UXDQ 2VZAA 1KHIA 4C3HH 2JA6H 1Q12A 1OXXK 1UEBA 3BZCA 1K9MC 1N36Q 3A5UA 3PV0A 4H02A 4HJAA 4A3IG 4JI6Q 2Q2UA 4UY8C 3K0XA 4JI1Q 4A3CH 3EN2A 4PMWA 1Y14B 5JEAG 3PUYA 4X6AH 1PA6A 4AYBE 4X65Q 4R4IA 2BA0A 1N32L 4LW1A 3G71A 4A3GG 1VQ6A 5DLQE 2E5LQ 1I94Q 3HFZB 3L7ZC 4JI2Q 4C3JH 4A3IH 1VQNA 3RZOH 4NXNL 3PO3H 4DR7L 1H95A 1XNRL 2A1AA 3W5OA 2CQOA 1C0AA 4IPGA 2IT1A 3AFQA 3F2DA 1VQAA 4DV0L 4JI7Q 1MJEA 3UE1A 3HOZH 1KAWA 4QL5A 3FKIH 3DLLA 5IYCG 1HR0L 4C3IH 4A3EG 3H0GH 3STBC 3H15A 3GTOH 2UXDL 1G6PA 3H3VI 3OYYA 2A8VA 2CWAA 3PUXA 4LFBL 1FVIA 1SRUA 4HIKA 1CSQA 5IYCH 4JBJA 1HNZL 2MO1A 3GTLH 3RLFA 4C2MH 2YU9H 1N36L 1LM0A 3PUZA 1OXUA 3MEFA 1VQ4A 2MO0A 4PZ8A 4R1JA 2N49A 4BBSH 2GVAA 4HJ7A 1WJJA 4X66L 1ASZA 1TWHH 2YTYA 4A3BH 4A3DG 2R7DA 4Y52H 5M3FG 4JI2L 4DR7Q 3KOJA 4YY3Q 4NXNQ 5HGQA 4OWWB 4GKKQ 3CCEA 2AHOB 4IJLA 4P71A 4HIMA 2JQOA 3KDFA 1EIFA 3NENA 3TEHB 4POFA 4BBRH 1SR3A 4MTNA 4MZ9A 5FJ8H 4DV0Q 1L1OC 2R92G 5JJLA 1P16A 2CFMA 4O2DA 1X54A 2BH2A 4A3JG 2KBNA 1EQRA 5GAGC 4QGUA 5GQOA 4JBKA 4BBRG 1SMXA 4A3GH 3E9IA 3EIVA 2K75A 4DNIA 4B3MQ 4BA1I 4JI5L 3UE0A 4PG3A 1GO3E 3HOXH 4HIDA 1NJIC 4DR3Q 3PCOB 3S17H 2ZJRA 5AJ3L 1PH6A 1VQMA 2E8GA 3UDXA 3A74A 4LUOA 4X64Q 4DR5Q 4TVAB 4A3JH 1O7IA 4LFCQ 4YY3L 1U5KA 3GTKH 2YTVA 2UXCL 2KENA 4GKKL 1X9NA 2VUMH 4R4OA 3M3YH 1IXRA 1VQ9A 1RIPA 1YI2A 3I4OA 2RCNA 1L1OB 1L2FA 2JA9A 1L1OA 2IHFA 3CCMA 3NBHB 4B3SQ 3S1NH 4JV5L 4P75A 1I3QH 3GTPH 4LFAQ 4JI4Q 3M4PA 3GTMH 2VS1A 4YCUA 1B7YB 1VQHA 3D31A 1XMQL 2PNHA 1B8AA 4IPHA 1WYDA 3I56A 1PYBA 2OQKA 2KCMA 2IX1A 2R92H 3I7FA 3U58A 5ELOA 4LF7Q 2R93H 1X3FA 4LUVA 2L15A 3CQZH 2UUBL 1ASYA 2FXQA 1EIYB 1QVGA 1N8RC 1HR0W 4DUZQ 4DR3L 3ULPA 3LGJA 3J7ZC 1AH9A 1EOVA 3CPFA 4YCWA 1K8AC 4LFCL 4X64L 2D62A 4DR5L 4XTCS 1YNXA 1GM5A 4O0AA 4JI3Q 3HKZG 4GLVB 1WCMG 3S24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GN3 B;  2MNA A;  1R9T H;  4DR6 Q;  1JT8 A;  1CSP A;  4B3S L;  4DUY Q;  4LF6 L;  3S1Q H;  3HOV G;  5BR8 Q;  1YVC A;  2NVY H;  1LYL A;  4DV4 Q;  2HIX A;  1KC8 C;  1J5E Q;  3G4S A;  1XMQ Q;  4L5Q A;  3U4Z A;  4LFA L;  3HKZ E;  3RR5 A;  3I4N G;  3J80 c;  2QGQ A;  1UE5 A;  2JA5 G;  3RLO A;  1V9P A;  4R4Q A;  3WWV A;  2H5X A;  3L2P A;  3S1M H;  4A4I A;  4P72 A;  2HHH Q;  2N8N A;  3HOV H;  2HIV A;  4JI0 Q;  2Y0S E;  4GLA C;  1VQ5 A;  2K50 A;  4A75 A;  2UXB L;  3GTQ H;  1NY4 A;  4DV3 L;  2JK8 A;  4BXX H;  4LF7 L;  2ID0 A;  2K4K A;  4POG A;  5C44 G;  5ELN A;  3BJU A;  4DUZ L;  1SLJ A;  4P74 A;  1IBL L;  1OTC A;  1JB7 A;  3CC2 A;  4JI3 L;  5IP9 H;  3H0G G;  3I4N H;  3PIP A;  2KHJ A;  3B6Y A;  1Y1V H;  4QQB X;  2R93 G;  5GAE C;  1Q82 C;  3ICE A;  1PH3 A;  1UWV A;  1E3P A;  2VY3 A;  3PF5 A;  1IBM Q;  1YHB A;  3PF4 A;  4DUY L;  4LF6 Q;  2KHI A;  2Z6K C;  2JJQ A;  2OTL A;  1G51 A;  2K5V A;  2N3S A;  2RF4 A;  5FLM G;  1CKN B;  3CMA A;  5M5W H;  4GNX B;  3H3V H;  2VUM G;  4LNQ A;  3HOU G;  4IO9 A;  1SE8 A;  4DV6 L;  2QEX A;  2OWO A;  3A0J A;  3S16 H;  4JOI C;  1PH4 A;  4JI0 L;  4L5S A;  2UXB Q;  5IP9 G;  1VQL A;  1XPU A;  3HOY G;  2WP8 J;  2OQ0 A;  4A3M G;  2F4V Q;  4NXM Q;  5IP7 G;  1Y1W H;  1PHJ A;  2I0Q A;  2UU9 L;  4DR1 Q;  3FHW A;  2R7Z H;  1S3O A;  1PH9 A;  5LMN L;  1E22 A;  1G29 1;  2LXK A;  3TQY A;  4DV3 Q;  4DR2 L;  4BA2 I;  1GKH A;  2WB1 E;  2NZH A;  4X62 Q;  5FLX c;  1YIJ A;  1PH2 A;  3E9H A;  1EWI A;  3HOU H;  3FKI G;  1NE3 A;  1XNQ Q;  4OWT B;  1UE1 A;  5EAY A;  4LWC A;  3J81 c;  4A76 A;  4QIW E;  1C7Y A;  3M85 A;  2V1C C;  4DR4 L;  1QVC A;  5C4X G;  2WAQ E;  1YJN A;  3K7U C;  4GS3 A;  3ERS X;  1X6O A;  1MIU A;  3A5Z B;  3MXN B;  3F2B A;  1VS0 A;  1X55 A;  2EIF A;  2YTX A;  2Q2H A;  3S1R H;  4LF5 Q;  3CCU A;  3HKS A;  4DV1 L;  3JAM i;  4JC0 A;  4A3B G;  2WFW A;  4A3D H;  1PH7 A;  3GO5 A;  3EBE A;  5IE8 A;  3G48 A;  4JOI A;  3PIO A;  4B3R L;  4DAM A;  1T9H A;  1Z9F A;  4JG2 A;  4JI8 L;  2JEA I;  1S72 A;  5JJK A;  1EFW A;  3CCL A;  4JI6 L;  1VQB A;  3M9B A;  1PFS A;  4KI0 A;  3T1H L;  1KQS A;  2UU9 Q;  3HOW G;  2AWN A;  4IJH A;  1XTD A;  5LMN Q;  4DR2 Q;  2AWO A;  3CP0 A;  3CCQ A;  5AJ3 Q;  4NXM L;  4LF4 Q;  4KHZ A;  4DR1 L;  2ZTD A;  2AKW B;  1BVS A;  3KF6 B;  1S40 A;  4HJ8 A;  1JE5 A;  2PQA B;  3RLN A;  3UDF A;  3HOW H;  5JJI A;  2D0O A;  2ZTC A;  1CKN A;  2B3G A;  4OWX B;  3NEL A;  4UPA A;  5M3M G;  5IYB H;  3KDF B;  3UDG A;  1YHA A;  2I5M X;  4GN4 B;  1W2B A;  4LF8 Q;  3J7A 5;  1VQJ A;  1XMO L;  3D0F A;  4L5T A;  4OO1 G;  3I55 A;  2HQL A;  1NMG A;  3KYH C;  4EX5 A;  2R7Z G;  2K14 A;  2NVX H;  4ALP A;  1PVO A;  1N34 L;  3I4M G;  4WJ4 A;  3KLW A;  1YBY A;  4JI8 Q;  4GNX C;  4UP9 A;  4BY1 G;  1W3S A;  2RHS B;  4B3R Q;  2R6G A;  1QUQ A;  5C0X J;  2F52 A;  2ZTE A;  3W1B A;  3RNU A;  2B29 A;  2K52 A;  1X3G A;  4IFD G;  4YHH Q;  4LF4 L;  3PO3 G;  3T1H Q;  5M3M H;  4TQU S;  5IYB G;  1NTG A;  1MKH A;  1K0R A;  1TWG H;  2I5L X;  1FJG L;  3K8A A;  2C35 B;  2IHE A;  2VQF Q;  2B63 G;  3ULL A;  4NPS A;  1CUK A;  4DPG A;  3CD6 A;  3GTG H;  3F1Z A;  1FGU A;  3CCS A;  4DR6 L;  4IPC A;  4FDB A;  2E5L L;  3S2H H;  5K36 G;  2HT1 A;  4P73 A;  2GN5 A;  4BXX G;  2CCZ A;  1M90 C;  4GKJ Q;  1XMO Q;  1XNR Q;  2ZJQ A;  2JA8 H;  2YYZ A;  4BBS G;  1JJC B;  2K5N A;  4AH6 A;  1PV4 A;  2EQS A;  5H1S E;  3G6E A;  2D0P A;  1HJP A;  2RHQ B;  3FP9 A;  3T1Y Q;  1EQQ A;  3CC4 A;  1HZA A;  1WCM H;  1N34 Q;  4K0K L;  5M5Y H;  1VQF A;  4HIO A;  1CKO A;  4YCV A;  3L0O A;  2Q2T A;  1FL0 A;  4GLX A;  1IYJ B;  2ZJP A;  2HHH L;  4LFB Q;  4B3M L;  5GAH C;  2JE6 I;  3U4V A;  5J3B A;  4YHH L;  3J81 j;  1IL2 A;  1P8L A;  4AIM A;  1Q81 C;  2LSS A;  3BZK A;  1HNZ Q;  4B3T Q;  4BY7 G;  4DAY B;  5C4X H;  1B70 B;  1YJW A;  5HY6 A;  1YZ6 A;  1UE7 A;  4YWL A;  2MFI A;  3ER0 A;  2NZO A;  3PGZ A;  4XIG S;  4A3K H;  1Q86 C;  1FJG Q;  1IBL Q;  2UXC Q;  4X66 Q;  2VQF L;  3CCV A;  2Q2I A;  4LF9 L;  1BKB A;  2WAQ G;  3K80 C;  2VL6 A;  1E1T A;  1HZ9 A;  3PSI A;  2UUA Q;  3HOY H;  2UUC L;  4BY7 H;  1JJG A;  3JC6 6;  1DGS A;  1PH1 A;  1IBM L;  1PYS B;  5LMU Q;  1K3R A;  5GRO A;  2YV5 A;  4GOP A;  3VDY A;  3ULJ A;  2KCT A;  5C3E G;  4DV5 Q;  1YIT A;  2GVB A;  5C44 H;  1V43 A;  3CW2 C;  3CME A;  2XTI A;  3TS2 A;  2Z6K A;  3CCJ A;  3TRE A;  1Q46 A;  3PUV A;  2DUD A;  3T1Y L;  2WB1 G;  1VQC A;  5E7N A;  4LUZ A;  4K0K Q;  3GDE A;  5C3E H;  1C9O A;  4ME3 A;  3I2Z A;  4B3T L;  1D8L A;  1MJC A;  5IYD G;  3S14 H;  4KLK A;  2R7F A;  3IRB A;  5LMN W;  3I4M H;  1VQP A;  2VW9 A;  2JA5 H;  2VQE Q;  3J80 i;  1U0L A;  4R4T A;  3OW2 A;  1XNQ L;  4LF9 Q;  4A93 G;  1D7Q A;  5IWA L;  2UUA L;  2I5H A;  5FLM H;  1KXL A;  3SGI A;  4GOP C;  4A3L G;  1TWA H;  3HOX G;  2UUC Q;  3S2D H;  2A19 A;  1Q1E A;  2F3I A;  4DKA C;  5BR8 L;  3ZJY C;  1EYG A;  3UDI A;  1N33 L;  1QZH A;  2VNU D;  3KF6 A;  4DV1 Q;  4UP8 A;  2ES2 A;  1VQK A;  1UE6 A;  1KD1 C;  2PQA A;  4OXP A;  4A93 H;  4JV5 Q;  5IYD H;  4HJ9 A;  1A8V A;  4JI4 L;  4QY7 A;  4JBM A;  1K73 C;  3STB D;  1JMC A;  4A3F H;  4R4C A;  2QA4 A;  4A3K G;  2B63 H;  4YWM A;  1NBW A;  4DV7 L;  1LUZ A;  4A3L H;  1EUJ A;  2PI2 E;  1VQI A;  1X65 A;  4DV2 Q;  1WI5 A;  2E2J H;  2ZM6 Q;  3CPW A;  3TRZ A;  4KHP L;  2OCE A;  1SN8 A;  4PZ6 A;  3PO2 H;  4OO1 I;  2PMZ E;  2Y0S G;  2VQE L;  2BA1 A;  4A3F G;  4NB3 A;  1M1K C;  3E0E A;  1QUQ B;  5FJ8 G;  5IWA Q;  3U50 C;  1QVF A;  3KJP A;  1XPO A;  1OXV A;  3F2C A;  1YHQ A;  1GD7 A;  1YEZ A;  1WOC A;  2CWP A;  3JAM c;  1N9W A;  1TWC H;  1VQG A;  1KL9 A;  4A3C G;  1VQ7 A;  2ASB A;  3BU2 A;  1HNW L;  1Q8K A;  2IX0 A;  3AQQ A;  2XGT A;  4IPD A;  5IT9 c;  1Q7Y C;  1N33 Q;  3M4O H;  4OX9 Q;  4JYA L;  4IOA A;  4DV4 L;  2ATW A;  1TWF H;  1OXT A;  4DV6 Q;  1J5E L;  5GAD C;  4DV7 Q;  1Y1V G;  1CKM A;  1BBU A;  1A0I A;  1GVP A;  1X3E A;  4PZ7 A;  3CXC A;  1VQ8 A;  2PI2 A;  3RN5 A;  5C4J H;  1AE2 A;  4WJ3 M;  3CF5 A;  3NEM A;  5C0X I;  4GNX A;  2F4V L;  1HH2 P;  4DV2 L;  2IY5 B;  4AQY Q;  2ZM6 L;  4KHP Q;  3DM3 A;  1X56 A;  4A3E H;  1VQD A;  3OTO Q;  4HJ5 A;  4JI5 Q;  2JA8 G;  4X62 L;  3KFU A;  3S15 H;  1HNX L;  3HOZ G;  1RL2 A;  2NVT H;  3F8T A;  4BY1 H;  3AEV A;  2Z0S A;  4QJF A;  1Q1B A;  4EQ5 A;  5IY0 A;  1QZG A;  2CKZ B;  1OXS C;  1VQE A;  3AFP A;  5JEA J;  4YWK A;  4Y7N H;  4IFD I;  1BBW A;  4A3M H;  4MNO A;  1J6Q A;  4GKJ L;  2K5H A;  3CAM A;  4DK3 C;  4GOP B;  3CCR A;  1E24 A;  1PH8 A;  4OX9 L;  4JYA Q;  1A62 A;  3GD7 A;  4DK6 C;  1I5F A;  2JEB I;  1HNW Q;  4RMF A;  3PO2 G;  2N78 A;  1K8G A;  1IBK L;  1SRO A;  1I50 H;  1VCI A;  1A63 A;  3CC7 A;  1E7Z A;  3GTJ H;  3TS0 A;  1HZB A;  2MQH A;  2E2I H;  2JA7 H;  4JBW A;  1LTL A;  1Z47 A;  1L0W A;  4AQY L;  2ALY B;  4JI1 L;  1VQO A;  3OTO L;  3J81 i;  3PUW A;  1V1Q A;  2LXJ A;  2EXD A;  1HNX Q;  2NN6 G;  4APV A;  2UUB Q;  2JA7 G;  3KF8 B;  3KJO A;  1KRS A;  1YJ9 A;  1N32 Q;  3RZD H;  1NMF A;  5C0X G;  4J15 A;  4X65 L;  1TXY A;  3M7N A;  1I94 L;  2OTJ A;  1E1O A;  4L5R C;  1XPR A;  4IOC A;  5M5X H;  5IP7 H;  1WFQ A;  4JCV E;  3K7A H;  1Y1W G;  1PH5 A;  1AE3 A;  4OON A;  3W1G A;  5LMU L;  2E2H H;  4GN5 A;  1I6H H;  2JA6 G;  1KIX A;  4JI7 L;  4UP7 A;  4LF8 L;  1IZ6 A;  4DV5 L;  3Q8D A;  4DR4 Q;  1HZC A;  3RN2 A;  3K81 C;  2DGY A;  1KRT A;  2NVQ H;  2AMC B;  3AYH B;  1JJ2 A;  4LF5 L;  5M3F H;  1HR0 Q;  2BH8 A;  3M4Q A;  4AYB G;  1SFO H;  4RG1 A;  2NN6 I;  1IBK Q;  4IFD J;  1K83 H;  1XJV A;  2UXD Q;  2VZA A;  1KHI A;  4C3H H;  2JA6 H;  1Q12 A;  1OXX K;  1UEB A;  3BZC A;  1K9M C;  1N36 Q;  3A5U A;  3PV0 A;  4H02 A;  4HJA A;  4A3I G;  4JI6 Q;  2Q2U A;  4UY8 C;  3K0X A;  4JI1 Q;  4A3C H;  3EN2 A;  4PMW A;  1Y14 B;  5JEA G;  3PUY A;  4X6A H;  1PA6 A;  4AYB E;  4X65 Q;  4R4I A;  2BA0 A;  1N32 L;  4LW1 A;  3G71 A;  4A3G G;  1VQ6 A;  5DLQ E;  2E5L Q;  1I94 Q;  3HFZ B;  3L7Z C;  4JI2 Q;  4C3J H;  4A3I H;  1VQN A;  3RZO H;  4NXN L;  3PO3 H;  4DR7 L;  1H95 A;  1XNR L;  2A1A A;  3W5O A;  2CQO A;  1C0A A;  4IPG A;  2IT1 A;  3AFQ A;  3F2D A;  1VQA A;  4DV0 L;  4JI7 Q;  1MJE A;  3UE1 A;  3HOZ H;  1KAW A;  4QL5 A;  3FKI H;  3DLL A;  5IYC G;  1HR0 L;  4C3I H;  4A3E G;  3H0G H;  3STB C;  3H15 A;  3GTO H;  2UXD L;  1G6P A;  3H3V I;  3OYY A;  2A8V A;  2CWA A;  3PUX A;  4LFB L;  1FVI A;  1SRU A;  4HIK A;  1CSQ A;  5IYC H;  4JBJ A;  1HNZ L;  2MO1 A;  3GTL H;  3RLF A;  4C2M H;  2YU9 H;  1N36 L;  1LM0 A;  3PUZ A;  1OXU A;  3MEF A;  1VQ4 A;  2MO0 A;  4PZ8 A;  4R1J A;  2N49 A;  4BBS H;  2GVA A;  4HJ7 A;  1WJJ A;  4X66 L;  1ASZ A;  1TWH H;  2YTY A;  4A3B H;  4A3D G;  2R7D A;  4Y52 H;  5M3F G;  4JI2 L;  4DR7 Q;  3KOJ A;  4YY3 Q;  4NXN Q;  5HGQ A;  4OWW B;  4GKK Q;  3CCE A;  2AHO B;  4IJL A;  4P71 A;  4HIM A;  2JQO A;  3KDF A;  1EIF A;  3NEN A;  3TEH B;  4POF A;  4BBR H;  1SR3 A;  4MTN A;  4MZ9 A;  5FJ8 H;  4DV0 Q;  1L1O C;  2R92 G;  5JJL A;  1P16 A;  2CFM A;  4O2D A;  1X54 A;  2BH2 A;  4A3J G;  2KBN A;  1EQR A;  5GAG C;  4QGU A;  5GQO A;  4JBK A;  4BBR G;  1SMX A;  4A3G H;  3E9I A;  3EIV A;  2K75 A;  4DNI A;  4B3M Q;  4BA1 I;  4JI5 L;  3UE0 A;  4PG3 A;  1GO3 E;  3HOX H;  4HID A;  1NJI C;  4DR3 Q;  3PCO B;  3S17 H;  2ZJR A;  5AJ3 L;  1PH6 A;  1VQM A;  2E8G A;  3UDX A;  3A74 A;  4LUO A;  4X64 Q;  4DR5 Q;  4TVA B;  4A3J H;  1O7I A;  4LFC Q;  4YY3 L;  1U5K A;  3GTK H;  2YTV A;  2UXC L;  2KEN A;  4GKK L;  1X9N A;  2VUM H;  4R4O A;  3M3Y H;  1IXR A;  1VQ9 A;  1RIP A;  1YI2 A;  3I4O A;  2RCN A;  1L1O B;  1L2F A;  2JA9 A;  1L1O A;  2IHF A;  3CCM A;  3NBH B;  4B3S Q;  3S1N H;  4JV5 L;  4P75 A;  1I3Q H;  3GTP H;  4LFA Q;  4JI4 Q;  3M4P A;  3GTM H;  2VS1 A;  4YCU A;  1B7Y B;  1VQH A;  3D31 A;  1XMQ L;  2PNH A;  1B8A A;  4IPH A;  1WYD A;  3I56 A;  1PYB A;  2OQK A;  2KCM A;  2IX1 A;  2R92 H;  3I7F A;  3U58 A;  5ELO A;  4LF7 Q;  2R93 H;  1X3F A;  4LUV A;  2L15 A;  3CQZ H;  2UUB L;  1ASY A;  2FXQ A;  1EIY B;  1QVG A;  1N8R C;  1HR0 W;  4DUZ Q;  4DR3 L;  3ULP A;  3LGJ A;  3J7Z C;  1AH9 A;  1EOV A;  3CPF A;  4YCW A;  1K8A C;  4LFC L;  4X64 L;  2D62 A;  4DR5 L;  4XTC S;  1YNX A;  1GM5 A;  4O0A A;  4JI3 Q;  3HKZ G;  4GLV B;  1WCM G;  3S24 A; 
#chains in the Genus database with same CATH topology
 1STY A;  3GP7 A;  1Y8P B;  3GTJ B;  4M8A A;  4B3S L;  3S1Q H;  2EVB A;  2M9V A;  2V4D A;  2F0S A;  1YVC A;  1J5E Q;  1RHP A;  2NN6 H;  4L5Q A;  3S9W A;  3FVQ A;  3HKZ E;  1SNM A;  4H13 C;  2QGQ A;  1UE5 A;  1C4Q A;  2JA5 G;  4ME5 A;  1WTQ A;  4R4Q A;  2EYO A;  2H5X A;  3S1M H;  4A4I A;  3RZD B;  2N8N A;  2HIV A;  4GLA C;  3NQI A;  3GTQ H;  4LF7 L;  2ID0 A;  1SEB D;  4KJO A;  1B2T A;  1SYC A;  1T5X D;  4ID6 A;  1OO9 B;  2PMZ B;  3CC2 A;  1OTC A;  3V05 A;  1JB7 A;  1LT3 D;  5IP9 H;  3FMC A;  3B6Y A;  4A3E B;  1Q82 C;  3ICE A;  1UWV A;  3PF5 A;  2NVT B;  5KEE A;  4LF6 Q;  1XX8 A;  1YNN D;  5DM7 3;  2N3S A;  1PZK D;  3NQT A;  4DNR B;  4LNQ A;  2QW7 A;  4CDC C;  1WTX A;  2PYK A;  3ZYY X;  1QIL A;  3CQZ B;  4X3U A;  4BY1 B;  1VMP A;  2F0V A;  4I7Z C;  3SXH A;  5KNC A;  1VQL A;  4FP5 D;  3HOY G;  2F4V Q;  1Z6H A;  4LAA A;  2R3Z A;  1S3O A;  1PH9 A;  1G29 1;  4K8J A;  4OL7 A;  4IAL A;  2VB2 X;  4BA2 I;  1HPC A;  2NZH A;  1YIJ A;  4DXG A;  4K2L A;  3E9H A;  2L0C A;  1NE3 A;  4CHT B;  1EEI D;  2NWG A;  2CH4 W;  3X3M A;  2HDL A;  3M85 A;  2V1C C;  4F8M A;  3D4D A;  4CJ0 B;  1MIU A;  3TME A;  2Q2H A;  3HKS A;  4A3B G;  4A3D H;  2WFW A;  2XWJ B;  3G48 A;  2E2H B;  3PIO A;  4HR7 B;  4A3D B;  1MD2 D;  4FYD A;  1T9H A;  4JI8 L;  4G4K A;  3H6M A;  4JI6 L;  4WRD A;  1KQS A;  4PMB A;  2A6E D;  3CCQ A;  4K5V A;  2F0H A;  1KAA A;  4XT1 B;  1ENF A;  3FPP A;  3ITP A;  3DUZ A;  3OIP A;  4NDX A;  2QIL A;  2PQA B;  1STB A;  5JJI A;  3E0J A;  3S15 B;  3RMH A;  3NTH A;  3QIA A;  1VQJ A;  2KED A;  4L5T A;  1NMG A;  4EX5 A;  4S3S A;  2R7Z G;  4ALP A;  1KAB A;  1PVO A;  1N34 L;  5BN3 A;  1EYC A;  3M7G A;  1ZXT A;  2FHT A;  2Z4I A;  2G9D A;  2RHS B;  4B3R Q;  4DAY A;  2WV6 D;  2ZTE A;  3W1B A;  2B29 A;  2QCP X;  2K5Q A;  3HOU B;  3PO3 G;  1TT2 A;  4A3I B;  5M3M H;  5IYB G;  1K0R A;  2HUG A;  1FJG L;  2C35 B;  1O7Z A;  3CKI B;  2VQF Q;  2F0W A;  3CD6 A;  2WAQ B;  4C3I B;  1ROD A;  1FGU A;  4FO2 A;  2KVM A;  4DR6 L;  1WD1 A;  1EYA A;  1SMY D;  3X3N A;  5C4H A;  2NUC A;  2ZJQ A;  5FKA C;  4AH6 A;  5COY A;  3TDQ A;  2PQE A;  3NBI A;  5EBC A;  5C4Z A;  5CBA E;  5HGT A;  3G6E A;  1MHW C;  1M4V A;  2D0P A;  3HZX A;  2LMC B;  1HJP A;  3FP9 A;  1HZA A;  5M5Y H;  4DAP A;  4HIO A;  5I6W A;  4GLX A;  2ZJP A;  2LY7 A;  2HHH L;  2JE6 I;  5DM6 3;  5J3B A;  4HCE A;  1HNZ Q;  3BZK A;  2L4N A;  1UEA B;  5C4X H;  1YJW A;  4MTK A;  2F4I A;  4R9W A;  4BS9 A;  2MFI A;  1O80 A;  2NZO A;  3PGZ A;  2NYZ D;  3CCV A;  2EJG C;  1E1T A;  2UUA Q;  1JJG A;  1CI3 M;  1DGS A;  1LTI D;  5D65 A;  1H9J A;  5GRO A;  2YV5 A;  4GOP A;  4L6T B;  3VDY A;  3TBI B;  1YIT A;  5C44 H;  3D4W A;  3CW2 C;  1TWC B;  5BN5 A;  3N52 A;  1FR3 A;  3CCJ A;  1ZEQ X;  4X3K A;  1X3Q A;  3GDE A;  3KLS X;  3NXW A;  2K28 A;  4ME3 A;  3MXP A;  5IYD G;  2R7F A;  3PIP 3;  3I4M H;  3GTG B;  1EY8 A;  1YNJ C;  4KD4 A;  3N6R A;  1BBX C;  1IL8 A;  4R4T A;  3S2H B;  1KDC A;  1C48 A;  4IUP A;  1D7Q A;  1KXL A;  2I5H A;  1HA6 A;  3SGI A;  2RQX A;  4XQQ A;  1Q1E A;  3ZJY C;  2PZU A;  1QZH A;  5C5M A;  3KF6 A;  2F03 A;  1LLR D;  2N55 A;  1I4H A;  1KD1 C;  1B9N A;  3EJI A;  4JBM A;  4XT3 B;  1WVL A;  4DV7 L;  5C4X B;  4A3F B;  1SN8 A;  4KJN A;  3I8Z A;  2Y0S G;  1EOT A;  2DY7 A;  1QUQ B;  1NR2 A;  5FJ8 G;  3ND8 A;  3H09 A;  5E4W C;  4JVZ A;  4HN7 A;  3AB9 A;  4IFD H;  1STE A;  3FRP B;  4QB4 A;  1VQ7 A;  1ET6 A;  2IL8 A;  3MVV A;  1Q8K A;  3AQQ A;  3K5N A;  1BOS A;  1IKL A;  3HOV B;  1F9P A;  4NP5 A;  5D14 A;  2EXZ A;  4DV6 Q;  1J5E L;  3NTK A;  5GAD C;  1CKM A;  5K36 H;  1A0I A;  1X3E A;  1VQ8 A;  5M3F B;  4C56 C;  4ILW A;  3NEM A;  1B53 A;  3Q22 A;  2XNA C;  1CA6 A;  4AQY Q;  4OO1 H;  3DM3 A;  3P1H A;  4HJ5 A;  3KFU A;  2JA8 G;  3S15 H;  4X62 L;  4OIK A;  2C9O A;  4Y7N B;  1RL2 A;  2NVT H;  4K5X A;  4XXE A;  3AEV A;  4QJF A;  1MSG A;  1TS5 A;  1QZG A;  2CKZ B;  2JSO A;  3I91 A;  2CW0 C;  5JEA J;  4IFD I;  1BBW A;  2R7Z B;  4GKJ L;  2K5H A;  4DK3 C;  1U4M A;  1E24 A;  1PH8 A;  4CJ2 C;  1A62 A;  4GZY C;  1EZ6 A;  3HGB A;  3LWE A;  1IW7 D;  1C8C A;  4RMF A;  1IBK L;  3K5O A;  3CC7 A;  4EGV A;  3HP3 A;  3GTJ H;  2PPB C;  2ENB A;  3OOC A;  4RA8 A;  3EQL C;  4AQY L;  2IW3 A;  1G2T A;  3MEH A;  2NN6 G;  2UUB Q;  2JA7 G;  1HHV A;  1TQO A;  5M5X B;  1NMF A;  1WTH A;  2Z8L A;  5EKK A;  2OTJ A;  2J4X A;  1AZP A;  4A3B B;  1YNN C;  4UP7 A;  4YIJ A;  1IZ6 A;  4DV5 L;  1LT6 D;  3RN2 A;  1CK1 A;  2AMC B;  3AYH B;  3L9A X;  5M3F H;  5C3X A;  4KD3 A;  3JAM E;  2NN6 I;  4IFD J;  2H1E A;  4DU9 A;  2VZA A;  1OXX K;  3PV0 A;  4H02 A;  4HJA A;  4CKC A;  1ONL A;  4A3C H;  2RSN A;  1TU2 B;  3CRL C;  3QOJ A;  1EQT A;  3HOX B;  4R8N A;  2E5L Q;  5EBD A;  3HFZ B;  4C1N I;  2L9H A;  3L7Z C;  1D1I A;  1VQN A;  4NXN L;  5FLX L;  2A1A A;  1B3Q A;  1S5D D;  2CQO A;  1H9R A;  2E75 C;  2IT1 A;  3AFQ A;  3M4Y A;  3ONA B;  1JOR A;  4DV0 L;  2B8F A;  4QL5 A;  1PTO D;  3DLL A;  3GTO B;  4C3I H;  1PZJ D;  4A3E G;  2O5I C;  2OEO A;  1HFG A;  1PTO B;  3H91 A;  3GTO H;  1I3Q B;  4RWS C;  1G6P A;  3PUX A;  4HCS A;  2A6E C;  1FVI A;  1SRU A;  3D6W A;  4HIK A;  2MPM A;  4JBJ A;  1QNU A;  3GTL H;  3BYT B;  3PUZ A;  1OXU A;  4IQZ A;  2D9U A;  1VQ4 A;  2GVA A;  4X66 L;  1TWH H;  2YTY A;  4Y52 H;  3NTI A;  3E6Z X;  4K6L A;  4YY3 Q;  5DAU A;  2A73 B;  5I2Y A;  2AHO B;  1DJR D;  1EIF A;  2F1M A;  4BBR H;  4MZ9 A;  2R92 G;  3TSS A;  4BY7 B;  1H9S A;  1JOQ A;  1PTO F;  4OEL B;  4CDE C;  2KA7 A;  1EQR A;  4IUN A;  1SMX A;  5JPM C;  4DNI A;  4TKO B;  3HS0 C;  4BA1 I;  1ILP A;  1JIC A;  1GO3 E;  4PG3 A;  1NJI C;  1PH6 A;  1CZG A;  2A68 C;  5C6A A;  4DR5 Q;  4LFC Q;  4H0L C;  1KTK A;  4YY3 L;  4N8X 1;  1VF7 A;  3GTK H;  5J22 A;  3M3Y H;  1VQ9 A;  1L1O B;  1L1O A;  3ND9 A;  3NBH B;  2WKD A;  4JV5 L;  2A69 C;  1I3Q H;  3M4P A;  3GTM H;  4YCU A;  4JPB W;  3G6J B;  2Z6B A;  1XMQ L;  2D2C C;  1TKW B;  3NE5 B;  2OQK A;  4LK1 C;  5ELB A;  2KCM A;  2IX1 A;  1GUS A;  2R92 H;  3J81 L;  2R93 H;  4LUV A;  4UHV A;  3CQZ H;  3J80 E;  1EIY B;  1Y69 U;  3VYS A;  1N8R C;  1R4Q B;  1HR0 W;  3ULP A;  3J7Z C;  1JOO A;  1Y1W B;  4GKK Q;  4JI3 Q;  4X64 L;  1YNX A;  1GUW A;  1WCM G;  1I50 H;  3S24 A;  4CGY B;  2HCI A;  4GN3 B;  2MNA A;  4LMQ D;  4KKT A;  2A5H A;  1EIG A;  5CV9 A;  1BCP B;  1LYL A;  4FF4 A;  1B50 A;  4B9X A;  1KC8 C;  1XMQ Q;  3PO2 B;  3RR5 A;  3J80 c;  4RHS A;  2BCO A;  2F0Q A;  3TZU A;  1DON A;  5KYI A;  3C1E A;  4JI0 Q;  1VQ5 A;  4F88 A;  2B2Y A;  4A75 A;  4A3J B;  2EYL A;  4KY6 A;  1E2Z A;  2ZXP A;  5ISR A;  2K4K A;  3URY A;  2XN9 C;  4P74 A;  4DFA A;  3K5M A;  1F77 A;  3G7L A;  5A35 A;  1JB3 A;  4QQB X;  2R93 G;  5ELE A;  5GAE C;  4FXG C;  1IBM Q;  2VY3 A;  1BCP F;  4DUY L;  1Y1V B;  4RGN A;  2EE1 A;  1F2Z A;  1TY0 A;  1D5M C;  2K5V A;  2RF4 A;  1CKN B;  3CMA A;  4GNX B;  3H3V H;  3DMU A;  3HOU G;  4XYO A;  3SK5 A;  2QEX A;  2OWO A;  3A0J A;  3S16 H;  1PH4 A;  4A93 B;  5IP9 G;  2OQ0 A;  1PHJ A;  2UU9 L;  2I0Q A;  1CTM A;  4DV3 Q;  1GKH A;  2K7V A;  3HOU H;  5FLX c;  1ZKO A;  3IL8 A;  3FKI G;  1UE1 A;  5EAY A;  4LWC A;  3J81 c;  3H0G B;  2OXP A;  1MSH A;  1UUP A;  4DR4 L;  1QVC A;  2WAQ E;  2E2I B;  3A8J E;  3ERS X;  3A5Z B;  1VS0 A;  4LF5 Q;  1SNQ A;  4G57 A;  3JAM i;  4JC0 A;  3GO5 A;  4P2C B;  2TSS A;  4B3R L;  2Q8T A;  1K0S A;  4G7H C;  2JEA I;  3DXJ C;  1WTV A;  5LMN Q;  4DR2 Q;  1KNA A;  1SFO B;  2AWO A;  5AJ3 Q;  4LF4 Q;  4QIW B;  2CW0 D;  1JWS D;  1TY2 A;  1BVS A;  3KF6 B;  1WD0 A;  4G7O C;  4I7A A;  2Q8R E;  3RLN A;  1JOK A;  2D0O A;  4XYQ A;  3KDF B;  1W2B A;  1EY5 A;  1JR0 D;  3KYH C;  1JC7 A;  4UP9 A;  4BY1 G;  2K03 A;  5C0X J;  1FNW A;  2B8G A;  4B9W A;  2R61 A;  4YHH Q;  1NTG A;  1MKH A;  1TWG H;  1F2L A;  2I5L X;  4XDX A;  3K8A A;  2EZV A;  2B63 G;  3ULL A;  1CQF A;  2I46 A;  3GTG H;  1DOM A;  4IPC A;  4FDB A;  5M9O A;  2E5L L;  2XRS D;  3S2H H;  2CCZ A;  1M90 C;  2C5C A;  4B08 A;  4XQN A;  2IWH A;  3PQI A;  1B3A A;  3PIO 3;  4C2M B;  3T1Y Q;  1EQQ A;  2JN4 A;  4RHR A;  1N34 Q;  2EJM A;  1W6J A;  3T53 B;  1SNC A;  1IYJ B;  1SYF A;  5CBE E;  1V1O A;  3P7J A;  4B3M L;  4YHH L;  1DXM A;  4B3T Q;  1T5E A;  3VYR A;  1NNX A;  4RAU C;  1SNP A;  1X32 A;  1EY6 A;  5JVG 3;  1YZ6 A;  3C2P A;  3HOW B;  5I9O A;  1A3V A;  4A3K H;  1FJG Q;  1S5C D;  1IBL Q;  3SK8 A;  1DM0 B;  3HOY H;  2UUC L;  1IBM L;  1PYS B;  3ULJ A;  3U9S A;  1KLG D;  1V43 A;  4OEM B;  3RD4 A;  2AUJ D;  4MIU A;  3QG1 A;  1PRT D;  3TRE A;  2F0K A;  1D2B A;  1VQC A;  5E7N A;  4H44 C;  2FMM A;  2SDF A;  3I2Z A;  4B3T L;  5CC4 A;  3OWE B;  4NKL A;  3E3X A;  5LMN W;  1U0L A;  3BDC A;  1ZYR D;  1DCZ A;  4DAV A;  5IWA L;  1F2Y A;  3DWA A;  5FLM H;  4K14 A;  1Y8O B;  5KYL A;  4KV6 A;  5BN4 A;  4GOP C;  4OGQ C;  2A19 A;  2F3I A;  3UDI A;  1STN A;  3FDT A;  3C46 A;  3GV3 A;  2K6A A;  5IYD H;  2PQA A;  1A8V A;  4JI4 L;  4QY7 A;  4CKE A;  3KK7 A;  1V8Q A;  3STB D;  1JMC A;  1B1Z A;  3J7A V;  4BBR B;  1EUJ A;  2PI2 E;  1RF2 D;  4IN3 A;  1Z7T A;  4DN4 M;  1JWU D;  4AYB B;  2ZM6 Q;  1QCB D;  3R2T A;  3SHL A;  3HEJ A;  2PMZ E;  4A3F G;  4NB3 A;  1M1K C;  2EYJ A;  3KLR A;  3QOL A;  1QVF A;  1XPO A;  4TRD A;  1OXV A;  4QF4 A;  2CWP A;  3JAM c;  1QE6 A;  2B2V A;  5CGK A;  1TWC H;  4MHE A;  3MHB A;  1FYC A;  1TII D;  3IFD A;  4X3S A;  1SJE D;  3NBH A;  3M4O H;  5IT9 c;  1I6H B;  4ODG A;  1LTA D;  4OX9 Q;  4DV4 L;  2M2L A;  2ATW A;  5C4J B;  1MGS A;  1Y1V G;  3K59 A;  3CXC A;  4C1N K;  5TSS A;  5C4J H;  5L37 A;  5C0X I;  2F4V L;  3GTM B;  4KHP Q;  5M5W B;  1IYV A;  3OTO Q;  4JI5 Q;  1XWE A;  1HNX L;  3HOZ G;  3MA2 B;  1JWM D;  2B2W C;  3I70 A;  4EQ5 A;  4DK1 A;  3AFP A;  2NVX B;  4A3M H;  2F0F A;  1LTS D;  4OX9 L;  4BWG B;  4CDF C;  1B9M A;  4JK1 C;  1KDB A;  2B63 B;  1I5F A;  2JEB I;  3MXU A;  3PO2 G;  2B39 A;  1EWC A;  1NSN S;  1NUC A;  5FO7 B;  2JA7 H;  1LTL A;  1Z47 A;  1JE4 A;  1EY7 A;  2ALY B;  3OTO L;  1ICF B;  4IUU A;  4N8F A;  2EXD A;  1HNX Q;  3A7A B;  4ZCK A;  1KRS A;  1N32 Q;  2BDN A;  5C0X G;  1E1O A;  4IUT A;  4L5R C;  2J7Z A;  1VF5 C;  2MUY A;  5IP7 H;  1Y1W G;  1TWH B;  1I6H H;  4KHV A;  2E2H H;  4GN5 A;  1GUT A;  4JI7 L;  4LF8 L;  1K8M A;  2F0P A;  2CH4 A;  2DGY A;  1KRT A;  1BR9 A;  5I9P A;  1JJ2 A;  4LF5 L;  5T1G A;  3K57 A;  3FEW X;  3M4Q A;  4RH6 A;  5DNF A;  5ELC A;  3V2T A;  4RG1 A;  3K58 A;  5LL6 S;  2OF1 A;  1XJV A;  2UXD Q;  1ENA A;  1PTO C;  4A3K B;  3A5U A;  2WKC A;  4A3I G;  2EY2 A;  4LJZ C;  3BG3 A;  4X6A H;  1PA6 A;  4AYB E;  4X65 Q;  5KND A;  1HCZ A;  5AFW A;  1VQ6 A;  5DLQ E;  1CFM A;  1O7L A;  4A3I H;  1XNR L;  1BUV T;  1G8Z D;  1C0A A;  4IPG A;  1HQM C;  1EY0 A;  3FKI H;  1GUO A;  1LAC A;  5DEH A;  4EQP A;  2UXD L;  4ZAI A;  1SAP A;  2ZT9 C;  3OYY A;  3SVM A;  4DXF A;  1BF4 A;  4XQJ A;  5IYC H;  2NBF A;  3K6O A;  3RLF A;  2YU9 H;  4PZ8 A;  2AQ2 B;  3S2D B;  1SYE A;  3LWU A;  4HJ7 A;  1WJJ A;  1STA A;  4A3B H;  4A3D G;  2R7D A;  5M3F G;  4DR7 Q;  3KOJ A;  4OWW B;  1S4Z A;  4P71 A;  4HIM A;  5JPN C;  4HTH A;  2FJ2 A;  3TEH B;  4POF A;  2EY1 A;  4MTN A;  3R3O A;  2B2T C;  2JXM B;  1L1O C;  1P16 A;  3W2D A;  3S1Q B;  2NVY B;  4A3J G;  2PNR C;  4CKB A;  4FF2 A;  2A69 D;  3Q23 A;  2KEC A;  4HSV A;  3NSW A;  3HOY B;  3F2U A;  2RSO A;  3S17 H;  3PCO B;  3M3Y B;  5IGB A;  4X64 Q;  4A3J H;  5FOB B;  2M00 A;  2PZT A;  2YTV A;  2KEN A;  2VUM H;  1GUG A;  1RCV D;  2RCN A;  1TS3 A;  5JOB A;  3I4N B;  3CCM A;  2FIN B;  1SYD A;  4IUQ A;  4IUR A;  1PRT F;  1AW7 A;  4IPH A;  2A68 D;  1E0B A;  3I7F A;  1PFB A;  1X3F A;  2L15 A;  1ASY A;  2FXQ A;  2BOS A;  1A15 A;  1SSO A;  5EKI A;  4DUZ Q;  3LGJ A;  4UDU C;  4LFC L;  4DR5 L;  1GM5 A;  3HKZ G;  5I6Y A;  1RTO A;  5IGF A;  5J1Z A;  4ABN A;  1R9T H;  4DR6 Q;  1CSP A;  1SMY C;  4DUY Q;  1AFP A;  3J81 E;  1VMC A;  5BR8 Q;  3VR4 A;  2NVY H;  4M1U B;  1U4P A;  3VR3 A;  4KY7 A;  3T16 A;  4LFA L;  3I4N G;  5JVH 3;  2EYM A;  1IW7 C;  1V9P A;  3WWV A;  3E5S A;  1EQV A;  2HHH Q;  4O1N A;  2Y0S E;  2K50 A;  3KBG A;  2UXB L;  1NY4 A;  4DV3 L;  2JK8 A;  4BXX H;  1S5E D;  5C44 G;  1EFI D;  3BJU A;  5I2X A;  2MP1 A;  1SLJ A;  2L12 A;  4JI3 L;  2KHJ A;  1Y1V H;  2KCC A;  2DJG C;  4DK0 A;  1PH3 A;  4H7B A;  4KK7 A;  2JJQ A;  2OTL A;  5FLM G;  4A3M B;  1SE8 A;  2ZXO A;  2EYF A;  4JOI C;  2NZ1 D;  4L5S A;  2B2Y C;  4EVO A;  2F0M A;  1SBB B;  2QKI C;  2UXB Q;  1XPU A;  4A3M G;  5IP7 G;  1Y1W H;  5IOC A;  4DR1 Q;  2LXK A;  3PO3 B;  2KUM A;  2IJ0 A;  1PH2 A;  5D3I B;  1CM9 A;  3I73 A;  4KN4 C;  1XNQ Q;  4KTA A;  1C7Y A;  2OT2 A;  2VXW A;  5IGG A;  5C4X G;  3QB3 A;  1YJN A;  2O5J C;  3KLS A;  4GS3 A;  2XRQ D;  1X6O A;  4FXD A;  3S1R H;  1LO5 D;  2YTX A;  4DV1 L;  3S1M B;  1PH7 A;  2RDG A;  5IE8 A;  2IX3 A;  1SYB A;  1KNE A;  4DAM A;  4JG2 A;  3TZD A;  1S72 A;  1TS2 A;  1EFW A;  3CCL A;  4KI0 A;  3HOW G;  3T1H L;  2AWN A;  1XTD A;  3CP0 A;  4NXM L;  4K2K A;  4KHZ A;  2ZTD A;  1X3P A;  2XSC A;  2AKW B;  4ZK9 B;  1B4O A;  3OMC A;  4HJ8 A;  1JE5 A;  3HOW H;  5CMD A;  3R93 A;  2ZTC A;  4UPA A;  2QDB A;  2DNE A;  2B2U A;  1YHA A;  2I5M X;  4GN4 B;  4LF8 Q;  3BVM A;  3D0F A;  4OO1 G;  2HQL A;  2K14 A;  2NVX H;  1H9K A;  1YBY A;  4JI8 Q;  3L3O C;  4WFN 3;  2F52 A;  5CV4 A;  5M3M B;  3RNU A;  5C5L A;  1X3G A;  3SEB A;  4C3J B;  3RZO B;  4TQU S;  2X6L A;  3NP8 A;  2K01 A;  2HDM A;  3AMU A;  2IHE A;  5CV6 A;  4DPG A;  3GTL B;  2EYP A;  3F1Z A;  2VB3 X;  4KKS A;  1MI2 A;  4F87 A;  2IPK D;  2JYO A;  2HT1 A;  4P73 A;  4GKJ Q;  1HQR D;  1XNR Q;  2JA8 H;  1JJC B;  2K5N A;  1PV4 A;  1HRJ A;  5H1S E;  5T1I A;  1UAP A;  1J8I A;  2JA8 B;  2RHQ B;  1Q90 A;  1WTW A;  1CKO A;  4YCV A;  3L0O A;  2Q2T A;  1TS4 A;  1SND A;  4QCL A;  4LFB Q;  3U4V A;  2EDG A;  4AIM A;  2P5Z X;  1RJT A;  1B70 B;  1R9T B;  4YWL A;  1SE4 A;  3ER0 A;  1Q86 C;  4XIG S;  2UXC Q;  2QEJ C;  2Q2I A;  1J9O A;  2WAQ G;  3K80 C;  2VL6 A;  1HZ9 A;  2GA4 B;  3WOF A;  4BY7 H;  1D6E C;  3OW7 A;  4MN3 A;  1QG7 A;  1PH1 A;  5LMU Q;  1K3R A;  2QF7 A;  2HD3 A;  2KCT A;  4DV5 Q;  5I4D A;  2KQ3 A;  1GOZ A;  2SNM A;  1ENC A;  1PLF A;  3CME A;  1ICW A;  3TS2 A;  2Y0S B;  1LTB D;  5C44 B;  1Q46 A;  3T1Y L;  2WB1 G;  4K0K Q;  1TWF B;  5C3E H;  1EL0 A;  3FKI B;  1BXT A;  1L0Y B;  2F3W A;  3NPP A;  4NW2 A;  2PCF B;  3S14 H;  4KLK A;  1U9R A;  2NTT A;  3T4A C;  3BYY B;  2JA5 H;  2VQE Q;  2EY5 A;  3OW2 A;  1XNQ L;  4A93 G;  2A74 C;  2UUA L;  4HMJ A;  4ZUJ A;  2R92 B;  1XXG A;  4NMZ A;  1F9R A;  4A3L G;  1TWA H;  2UUC Q;  1ESR A;  1PYW D;  4OHJ A;  2B2V C;  4ZQ3 A;  5LHY 1;  4DV1 Q;  1ML0 D;  1EYD A;  3KUP A;  3P20 A;  1SE3 A;  4UP8 A;  1TWA B;  5CV8 A;  1VQK A;  4A93 H;  3KBX A;  4OXP A;  1K8O A;  4HJ9 A;  3OPO A;  2HQE A;  2NTS A;  2R93 B;  4A3F H;  4R4C A;  2QA4 A;  1PZI D;  4A3K G;  1NBW A;  3RUZ A;  4A3L H;  3I4L A;  1VQI A;  1X65 A;  3CPW A;  3TRZ A;  4KHP L;  2PW7 A;  2OCE A;  2XIW A;  3R8B A;  2AQ1 B;  4L8J A;  4PZ6 A;  1NR4 A;  2L55 A;  1G2S A;  3IFT A;  2VQE L;  1WTO A;  2E74 C;  4IUV A;  2E76 C;  3DWQ A;  4KMU C;  3KJP A;  3F2C A;  1YHQ A;  1A3T A;  1NAP A;  1N9W A;  1FGB D;  1VQG A;  4A3C G;  2AUK A;  2ASB A;  3BU2 A;  2IX0 A;  1Q7Y C;  1N33 Q;  3JAM L;  4IOA A;  1TWF H;  3MWY W;  1L0X B;  4DV7 Q;  4TSS A;  5EQ0 A;  1RTN A;  1AE2 A;  3IAY A;  4DV2 L;  2ZM6 L;  1X56 A;  4A3E H;  1CT1 D;  1VQD A;  3OIQ A;  3F8T A;  2I07 B;  2Z0S A;  4FXK C;  5IY0 A;  3MXG A;  1VQE A;  4YWK A;  1J6Q A;  1LV9 A;  1HUM A;  3QO2 A;  3CCR A;  1PRT B;  3GD7 A;  1DYQ A;  1CQV A;  4DK6 C;  1HNW Q;  2FFK B;  1K8G A;  2HCC A;  2WII B;  1VCI A;  1A63 A;  4K8I A;  1E7Z A;  1HZB A;  4JBW A;  5C0X H;  1L0W A;  3LNN A;  1KLU D;  1VQO A;  3PUW A;  2LS0 1;  1I4G A;  1HFN A;  3A54 A;  3MAQ A;  1IHZ A;  3KF8 B;  4HMI A;  1QB5 D;  4C3H G;  1TXY A;  3M7N A;  1I94 L;  4IOC A;  1E2W A;  3K7A H;  1PH5 A;  4OON A;  3W1G A;  5LMU L;  4DGZ A;  1M8A A;  1KIX A;  1S5F D;  3Q8D A;  3SE0 A;  4FF1 A;  3BZD B;  3K81 C;  1BO0 A;  2PZW A;  2NVQ H;  3PMF A;  2BH8 A;  3ERQ A;  4AYB G;  1SFO H;  2F0J A;  3SK4 A;  4X3T A;  1KHI A;  2X6G A;  4RFB A;  1Q12 A;  5EPK A;  4FF3 A;  4JI6 Q;  2Q2U A;  4UY8 C;  3K0X A;  4JI1 Q;  1IYU A;  4PMW A;  3R2I A;  2BA0 A;  4OIJ A;  1N32 L;  2EOT A;  3S17 B;  4A3G G;  3VR5 A;  5IT9 L;  3MTS A;  3D3R A;  4JI2 Q;  5EKL A;  5JEA H;  1GJX A;  4RGM A;  5JAV A;  3F2D A;  2EPB A;  4JI7 Q;  3UE1 A;  1PTO H;  3HOZ H;  1IKM A;  5IYC G;  2F0E A;  1EEF D;  1A2U A;  3H3V I;  4HAE A;  1LT5 D;  2CWA A;  5KNB A;  4DF7 A;  1N36 L;  2G9H D;  3MEF A;  4FNF A;  2MO0 A;  2EJF C;  3V96 A;  2N49 A;  1ASZ A;  3Q6S A;  3T13 A;  1EIH A;  3TN2 A;  4JI2 L;  4NXN Q;  5HGQ A;  4K6D A;  1ZYR C;  3CCE A;  2AQ3 B;  4IJL A;  3O13 A;  3AU7 A;  4ZKC B;  1BCP C;  2Z4H A;  3DM1 A;  3DWP A;  5FJ8 H;  4WOR A;  2EY6 A;  1Q3L A;  1GUN A;  1HA5 A;  4N9T A;  1BNZ A;  2CFM A;  5FK9 C;  3T56 B;  3A8K E;  2SNS A;  5GAG C;  5JJZ A;  3EIV A;  2K75 A;  4RCN A;  5COR A;  1ESF A;  1FNV A;  3VYT A;  3SR1 A;  4HID A;  2A6H C;  4DR3 Q;  2ZJR A;  5AJ3 L;  1VQM A;  2E8G A;  3UDX A;  4LUO A;  4TVA B;  1U5K A;  2UXC L;  2F0N A;  4GKK L;  1X9N A;  4R4O A;  2RDH A;  3OHX C;  4I65 A;  3I4O A;  3TP8 A;  2QDL A;  1L2F A;  2JA9 A;  2IHF A;  2F0U A;  3S1N H;  3BDL A;  5FO8 B;  1FD7 D;  4LFA Q;  4WJW A;  4R8I A;  4JI4 Q;  3BS1 A;  2VS1 A;  5KGU A;  1B7Y B;  1VQH A;  1AN8 A;  3D31 A;  2DN8 A;  2PW5 A;  4L63 B;  1JCK B;  1B8A A;  3I56 A;  1EY4 A;  2O4X A;  1PYB A;  2SEB D;  3OSO A;  5ELO A;  4E6I A;  4LF7 Q;  2UUB L;  5M5Y B;  1CZW A;  1D5X C;  1AH9 A;  1EOV A;  4YCW A;  1G91 A;  4O0A A;  3ERO A;  4V19 0;  1W6K A;  1BCP D;  3LX0 A;  3U9O A;  4CJ1 B;  5IT9 E;  1JT8 A;  4LF6 L;  3MXN A;  5E1F A;  3HOV G;  4DV4 Q;  2E2J B;  2HIX A;  3G4S A;  3U4Z A;  1Y8N B;  2RA4 A;  4QUF A;  1H9S B;  4RGT A;  3RLO A;  1EY9 A;  3L2P A;  4P72 A;  3HOV H;  1F9S A;  1YNJ D;  5FO9 B;  2L11 A;  3I72 A;  4POG A;  1HTP A;  5ELN A;  3GTQ B;  1K28 A;  4DUZ L;  3IKJ A;  1IBL L;  3H0G G;  3I4N H;  3PIP A;  3A8I E;  2F0O A;  3H3V C;  1U4L A;  4KY5 A;  1E3P A;  1YHB A;  2H4O A;  3PF4 A;  4C3H B;  2KHI A;  2Z6K C;  1WTP A;  1G6Z A;  1G51 A;  2L5T A;  2N88 A;  2F0D A;  3S16 B;  2X69 A;  5M5W H;  2VUM G;  2WAC A;  4RGO S;  4ZKB B;  1AEX A;  4DV6 L;  4IO9 A;  4Q5V A;  3MFG A;  1LTR D;  4JI0 L;  1O78 A;  5ELF A;  2DY8 A;  3T51 B;  2WP8 J;  3D6C A;  5E3F A;  4NXM Q;  1GHJ A;  5A2Q E;  3FHW A;  2R7Z H;  5LMN L;  1E22 A;  4PV1 C;  3MZ5 A;  3TQY A;  4DR2 L;  2WB1 E;  3NWT A;  4X62 Q;  2RVL A;  1EWI A;  4OWT B;  4PNY A;  2ICI A;  3HG9 A;  2CHB D;  4A76 A;  3P75 A;  2DJF C;  4QIW E;  2CVR A;  2KEE A;  1KDA A;  1PFN A;  2JA7 B;  3K7U C;  3F2B A;  3MXN B;  1EU3 A;  1X55 A;  2EIF A;  3CCU A;  3EBE A;  1EU4 A;  3I90 A;  4JOI A;  4K5W A;  3C3L A;  1A6X A;  1BDO A;  1Z9F A;  1CHP D;  5NUC A;  1VQB A;  3M9B A;  1PFS A;  4PQX A;  2UU9 Q;  3QR8 A;  3CU7 A;  4IJH A;  1EZ8 A;  4DR1 L;  3GQB A;  2RCF A;  1SXT A;  2NB0 A;  2D5D A;  1S40 A;  1BQQ T;  2KJX A;  3UDF A;  1CKN A;  1U4R A;  2B3G A;  3NEL A;  4OWX B;  5M3M G;  5IYB H;  3D8G A;  1K83 B;  3UDG A;  3J7A 5;  1XMO L;  3A55 A;  3I55 A;  4ZLT F;  2K05 A;  3I4M G;  4WJ4 A;  1RDP D;  3KLW A;  4GNX C;  1W3S A;  2R6G A;  1QUQ A;  3HOZ B;  1RKN A;  2K52 A;  4IFD G;  4LF4 L;  4CDD C;  3T1H Q;  5C3E B;  1II3 A;  1JQY D;  2RKS A;  1STH A;  5ELD A;  3S1N B;  4NPS A;  1CUK A;  2CQA A;  4V0B A;  1ET9 A;  3VR6 A;  3CCS A;  3S1R B;  2K04 A;  5K36 G;  4BXX G;  2GN5 A;  1EWH A;  1XMO Q;  4BBS G;  2YYZ A;  3Q24 A;  1DD2 A;  2EQS A;  5KIX A;  4RCO A;  1LTT D;  2YU9 B;  3MFY A;  1XTC D;  4PMC A;  1LT4 D;  3BDO A;  3CC4 A;  1WCM H;  4K0K L;  1VQF A;  2Z1C A;  1TR5 A;  4BBS B;  1FL0 A;  1O7Y A;  5GAH C;  1IL2 A;  2NVQ B;  3J81 j;  1P8L A;  1Q81 C;  2LSS A;  4BY7 G;  4DAY B;  4N9P A;  5HY6 A;  2BDO A;  4ZYS A;  1V1P B;  1UE7 A;  4X66 Q;  2VQF L;  4LF9 L;  1BKB A;  3PSI A;  2FMC A;  3JC6 6;  5D3D A;  1SJH D;  3J80 L;  1D1K A;  2O2L D;  5G3L D;  1B44 D;  2BE5 C;  3VR2 A;  5C3E G;  1CHQ D;  2GVB A;  4EQO A;  3QJY A;  1CA5 A;  2XTI A;  1QNK A;  5EGT A;  2Z6K A;  3PUV A;  2DUD A;  1GXD C;  4LUZ A;  3MC0 B;  1HTL D;  3KF8 A;  3K5L A;  1C9O A;  3I4M B;  3VA5 A;  1D5Z C;  2Z9H A;  1D8L A;  1MJC A;  2K1B A;  2KHS A;  3IRB A;  1PMR A;  2K5W A;  1VQP A;  3DHQ A;  2VW9 A;  2G5D A;  3J80 i;  2WIN B;  4LF9 Q;  3EVQ A;  3TP5 A;  3GTP B;  3NUC A;  1I4P A;  4JW0 A;  3HOX G;  3S2D H;  4DKA C;  3VYU A;  2KCN A;  2ICE C;  5BR8 L;  1E2V A;  1EYG A;  1N33 L;  2VNU D;  1WCM B;  2ES2 A;  1UE6 A;  1XYI A;  4JV5 Q;  4J6H A;  1K73 C;  2B63 H;  4YWM A;  1LUZ A;  1VDZ A;  4RKB A;  1LAB A;  1H9M A;  4DV2 Q;  1WI5 A;  2E2J H;  1GHK A;  3QWN A;  1HUN A;  3PO2 H;  4EQN A;  5IOD A;  2RDF A;  4OO1 I;  2XVS A;  2BA1 A;  3HRZ C;  4UAI A;  3E0E A;  1FNU A;  1SE2 A;  5IWA Q;  2PO4 A;  3EFX D;  3U50 C;  3A7L A;  4C3I G;  1GD7 A;  5IGC A;  1YEZ A;  1WOC A;  2ZXR A;  4G7Z C;  2JP1 A;  2F0I A;  2F0L A;  1KL9 A;  2B2T A;  1HNW L;  1A3U A;  1I4Q A;  4IPD A;  2XGT A;  5IIF A;  1LTG D;  2F0G A;  5CV5 A;  4JYA L;  2VUM B;  1PRT C;  1OXT A;  4F7X A;  4RKL A;  3M4O B;  1AZQ A;  3EA6 A;  1BBU A;  1GVP A;  4PZ7 A;  2PI2 A;  3RN5 A;  4WJ3 M;  3CF5 A;  4GNX A;  2IY5 B;  1HH2 P;  5F2D A;  1S5B D;  1DOL A;  1F2M A;  1SNO A;  1WTR A;  1DOK A;  4BY1 H;  1Q1B A;  1STG A;  1F9Q A;  4Y7N H;  2E2D C;  4DA2 A;  3FPU B;  4MNO A;  3CAM A;  4GOP B;  1I4R A;  4JYA Q;  5LL6 X;  1PFM A;  2N78 A;  3I3C A;  2K5D A;  1SRO A;  4HED A;  3TS0 A;  2MQH A;  2E2I H;  2K32 A;  2F3V A;  3BVG A;  4DNT B;  4JI1 L;  1SDF A;  3J81 i;  1V1Q A;  2LXJ A;  5A2Q L;  1NCV A;  4APV A;  5IGD A;  3KJO A;  1YJ9 A;  5E4X A;  2EYH A;  4U67 3;  3RZD H;  3K7A B;  3H94 A;  4J15 A;  5EPJ A;  4X65 L;  1XPR A;  4Z9C B;  5M5X H;  5HUR A;  1WFQ A;  4JCV E;  1AE3 A;  5KRU A;  2JA6 G;  2BE5 D;  4DR4 Q;  1HZC A;  3W3A A;  2Q8I B;  5J39 A;  3TP6 A;  2K33 A;  4ZRZ A;  3GV6 A;  5K5P A;  1HR0 Q;  1IBK Q;  1K83 H;  4KN7 C;  2JA6 H;  4C3H H;  1I4X A;  1K9M C;  1UEB A;  3BZC A;  1N36 Q;  1K3B C;  4C3J G;  1PDQ A;  3EN2 A;  1Y14 B;  4QUC A;  3PUY A;  5JEA G;  3NK9 A;  4R4I A;  3K0Y A;  1R4P B;  2LKV A;  4LW1 A;  3G71 A;  1I94 Q;  4C3J H;  3RZO H;  4DR7 L;  1H95 A;  3PO3 H;  3WDN A;  3W5O A;  3GTK B;  3HKZ B;  4HSP A;  1VQA A;  1MJE A;  1KAW A;  1HR0 L;  2XWB B;  3H0G H;  3S14 B;  1UNS A;  3STB C;  3H15 A;  3CRK C;  5CYU A;  1TWG B;  2A8V A;  4LFB L;  1CSQ A;  2F0T A;  1HNZ L;  2MO1 A;  4C2M H;  1LM0 A;  3WOE A;  1DZ1 A;  4R1J A;  4BBS H;  4Q0F A;  1RD9 D;  1QJO A;  4O42 A;  4ZUI A;  1AP0 A;  1V1P A;  4IZ8 A;  1QOH A;  3CHB D;  3NWS A;  2JQO A;  3KDF A;  2RBM A;  3NEN A;  4U68 A;  1SR3 A;  5CV7 A;  4DV0 Q;  5JJL A;  4CBV A;  2JA6 B;  1A2T A;  1QWY A;  4O2D A;  1X54 A;  2J0T D;  2BH2 A;  4J1M A;  2KBN A;  3TP7 A;  4QGU A;  4JBK A;  5GQO A;  4QMG A;  4BBR G;  4A3G H;  3E9I A;  3OWF A;  1SYG A;  3J7A F;  5FLX E;  4B3M Q;  4JI5 L;  4A3G B;  3UE0 A;  3HOX H;  3VA7 A;  1Q8I A;  3BVZ A;  3A74 A;  3DEO A;  5EPL A;  1O7I A;  2MJ8 A;  3SK6 A;  2DNC A;  2SOB A;  1IXR A;  2TMP A;  2B2W A;  4J8Q A;  3DEP A;  1RIP A;  2B2U C;  3OMG A;  1YI2 A;  2JA5 B;  3UI2 A;  5G3L F;  3D4R A;  5EJW A;  1I6V C;  4B3S Q;  3C1F A;  4P75 A;  1PXU A;  3GTP H;  2L1B A;  3SDZ A;  4KKU A;  2PNH A;  3Q0A A;  2KOL A;  3A56 A;  1ILQ A;  2A6H D;  1WYD A;  4FVM A;  5CR3 A;  1TVX A;  3NHH A;  3J7Y W;  5IGE A;  4ULL A;  2LFN A;  3U58 A;  1HXY D;  2MGS A;  1QVG A;  1I50 B;  4DR3 L;  1MBY A;  3CPF A;  1K8A C;  2MHV A;  5JJK A;  2D62 A;  4XTC S;  4GLV B;  2WB1 B;  5C3W A;  1OXS C; 
#chains in the Genus database with same CATH homology
 4GN3 B;  2MNA A;  1R9T H;  4DR6 Q;  1JT8 A;  1CSP A;  4B3S L;  4DUY Q;  4LF6 L;  3S1Q H;  3HOV G;  5BR8 Q;  1YVC A;  2NVY H;  1LYL A;  4DV4 Q;  2HIX A;  1KC8 C;  1J5E Q;  3G4S A;  1XMQ Q;  4L5Q A;  3U4Z A;  4LFA L;  3HKZ E;  3RR5 A;  3I4N G;  3J80 c;  2QGQ A;  1UE5 A;  2JA5 G;  3RLO A;  1V9P A;  4R4Q A;  3WWV A;  2H5X A;  3L2P A;  3S1M H;  4A4I A;  4P72 A;  2HHH Q;  2N8N A;  3HOV H;  2HIV A;  4JI0 Q;  2Y0S E;  4GLA C;  1VQ5 A;  2K50 A;  4A75 A;  2UXB L;  3GTQ H;  1NY4 A;  4DV3 L;  2JK8 A;  4BXX H;  4LF7 L;  2ID0 A;  2K4K A;  4POG A;  5C44 G;  5ELN A;  3BJU A;  4DUZ L;  1SLJ A;  4P74 A;  1IBL L;  1OTC A;  1JB7 A;  3CC2 A;  4JI3 L;  5IP9 H;  3H0G G;  3I4N H;  3PIP A;  2KHJ A;  3B6Y A;  1Y1V H;  4QQB X;  2R93 G;  5GAE C;  1Q82 C;  3ICE A;  1PH3 A;  1UWV A;  1E3P A;  2VY3 A;  3PF5 A;  1IBM Q;  1YHB A;  3PF4 A;  4DUY L;  4LF6 Q;  2KHI A;  2Z6K C;  2JJQ A;  2OTL A;  1G51 A;  2K5V A;  2N3S A;  2RF4 A;  5FLM G;  1CKN B;  3CMA A;  5M5W H;  4GNX B;  3H3V H;  2VUM G;  4LNQ A;  3HOU G;  4IO9 A;  1SE8 A;  4DV6 L;  2QEX A;  2OWO A;  3A0J A;  3S16 H;  4JOI C;  1PH4 A;  4JI0 L;  4L5S A;  2UXB Q;  5IP9 G;  1VQL A;  1XPU A;  3HOY G;  2WP8 J;  2OQ0 A;  4A3M G;  2F4V Q;  4NXM Q;  5IP7 G;  1Y1W H;  1PHJ A;  2I0Q A;  2UU9 L;  4DR1 Q;  3FHW A;  2R7Z H;  1S3O A;  1PH9 A;  5LMN L;  1E22 A;  1G29 1;  2LXK A;  3TQY A;  4DV3 Q;  4DR2 L;  4BA2 I;  1GKH A;  2WB1 E;  2NZH A;  4X62 Q;  5FLX c;  1YIJ A;  1PH2 A;  3E9H A;  1EWI A;  3HOU H;  3FKI G;  1NE3 A;  1XNQ Q;  4OWT B;  1UE1 A;  5EAY A;  4LWC A;  3J81 c;  4A76 A;  4QIW E;  1C7Y A;  3M85 A;  2V1C C;  4DR4 L;  1QVC A;  5C4X G;  2WAQ E;  1YJN A;  3K7U C;  4GS3 A;  3ERS X;  1X6O A;  1MIU A;  3A5Z B;  3MXN B;  3F2B A;  1VS0 A;  1X55 A;  2EIF A;  2YTX A;  2Q2H A;  3S1R H;  4LF5 Q;  3CCU A;  3HKS A;  4DV1 L;  3JAM i;  4JC0 A;  4A3B G;  2WFW A;  4A3D H;  1PH7 A;  3GO5 A;  3EBE A;  5IE8 A;  3G48 A;  4JOI A;  3PIO A;  4B3R L;  4DAM A;  1T9H A;  1Z9F A;  4JG2 A;  4JI8 L;  2JEA I;  1S72 A;  5JJK A;  1EFW A;  3CCL A;  4JI6 L;  1VQB A;  3M9B A;  1PFS A;  4KI0 A;  3T1H L;  1KQS A;  2UU9 Q;  3HOW G;  2AWN A;  4IJH A;  1XTD A;  5LMN Q;  4DR2 Q;  2AWO A;  3CP0 A;  3CCQ A;  5AJ3 Q;  4NXM L;  4LF4 Q;  4KHZ A;  4DR1 L;  2ZTD A;  2AKW B;  1BVS A;  3KF6 B;  1S40 A;  4HJ8 A;  1JE5 A;  2PQA B;  3RLN A;  3UDF A;  3HOW H;  5JJI A;  2D0O A;  2ZTC A;  1CKN A;  2B3G A;  4OWX B;  3NEL A;  4UPA A;  5M3M G;  5IYB H;  3KDF B;  3UDG A;  1YHA A;  2I5M X;  4GN4 B;  1W2B A;  4LF8 Q;  3J7A 5;  1VQJ A;  1XMO L;  3D0F A;  4L5T A;  4OO1 G;  3I55 A;  2HQL A;  1NMG A;  3KYH C;  4EX5 A;  2R7Z G;  2K14 A;  2NVX H;  4ALP A;  1PVO A;  1N34 L;  3I4M G;  4WJ4 A;  3KLW A;  1YBY A;  4JI8 Q;  4GNX C;  4UP9 A;  4BY1 G;  1W3S A;  2RHS B;  4B3R Q;  2R6G A;  1QUQ A;  5C0X J;  2F52 A;  2ZTE A;  3W1B A;  3RNU A;  2B29 A;  2K52 A;  1X3G A;  4IFD G;  4YHH Q;  4LF4 L;  3PO3 G;  3T1H Q;  5M3M H;  4TQU S;  5IYB G;  1NTG A;  1MKH A;  1K0R A;  1TWG H;  2I5L X;  1FJG L;  3K8A A;  2C35 B;  2IHE A;  2VQF Q;  2B63 G;  3ULL A;  4NPS A;  1CUK A;  4DPG A;  3CD6 A;  3GTG H;  3F1Z A;  1FGU A;  3CCS A;  4DR6 L;  4IPC A;  4FDB A;  2E5L L;  3S2H H;  5K36 G;  2HT1 A;  4P73 A;  2GN5 A;  4BXX G;  2CCZ A;  1M90 C;  4GKJ Q;  1XMO Q;  1XNR Q;  2ZJQ A;  2JA8 H;  2YYZ A;  4BBS G;  1JJC B;  2K5N A;  4AH6 A;  1PV4 A;  2EQS A;  5H1S E;  3G6E A;  2D0P A;  1HJP A;  2RHQ B;  3FP9 A;  3T1Y Q;  1EQQ A;  3CC4 A;  1HZA A;  1WCM H;  1N34 Q;  4K0K L;  5M5Y H;  1VQF A;  4HIO A;  1CKO A;  4YCV A;  3L0O A;  2Q2T A;  1FL0 A;  4GLX A;  1IYJ B;  2ZJP A;  2HHH L;  4LFB Q;  4B3M L;  5GAH C;  2JE6 I;  3U4V A;  5J3B A;  4YHH L;  3J81 j;  1IL2 A;  1P8L A;  4AIM A;  1Q81 C;  2LSS A;  3BZK A;  1HNZ Q;  4B3T Q;  4BY7 G;  4DAY B;  5C4X H;  1B70 B;  1YJW A;  5HY6 A;  1YZ6 A;  1UE7 A;  4YWL A;  2MFI A;  3ER0 A;  2NZO A;  3PGZ A;  4XIG S;  4A3K H;  1Q86 C;  1FJG Q;  1IBL Q;  2UXC Q;  4X66 Q;  2VQF L;  3CCV A;  2Q2I A;  4LF9 L;  1BKB A;  2WAQ G;  3K80 C;  2VL6 A;  1E1T A;  1HZ9 A;  3PSI A;  2UUA Q;  3HOY H;  2UUC L;  4BY7 H;  1JJG A;  3JC6 6;  1DGS A;  1PH1 A;  1IBM L;  1PYS B;  5LMU Q;  1K3R A;  5GRO A;  2YV5 A;  4GOP A;  3VDY A;  3ULJ A;  2KCT A;  5C3E G;  4DV5 Q;  1YIT A;  2GVB A;  5C44 H;  1V43 A;  3CW2 C;  3CME A;  2XTI A;  3TS2 A;  2Z6K A;  3CCJ A;  3TRE A;  1Q46 A;  3PUV A;  2DUD A;  3T1Y L;  2WB1 G;  1VQC A;  5E7N A;  4LUZ A;  4K0K Q;  3GDE A;  5C3E H;  1C9O A;  4ME3 A;  3I2Z A;  4B3T L;  1D8L A;  1MJC A;  5IYD G;  3S14 H;  4KLK A;  2R7F A;  3IRB A;  5LMN W;  3I4M H;  1VQP A;  2VW9 A;  2JA5 H;  2VQE Q;  3J80 i;  1U0L A;  4R4T A;  3OW2 A;  1XNQ L;  4LF9 Q;  4A93 G;  1D7Q A;  5IWA L;  2UUA L;  2I5H A;  5FLM H;  1KXL A;  3SGI A;  4GOP C;  4A3L G;  1TWA H;  3HOX G;  2UUC Q;  3S2D H;  2A19 A;  1Q1E A;  2F3I A;  4DKA C;  5BR8 L;  3ZJY C;  1EYG A;  3UDI A;  1N33 L;  1QZH A;  2VNU D;  3KF6 A;  4DV1 Q;  4UP8 A;  2ES2 A;  1VQK A;  1UE6 A;  1KD1 C;  2PQA A;  4OXP A;  4A93 H;  4JV5 Q;  5IYD H;  4HJ9 A;  1A8V A;  4JI4 L;  4QY7 A;  4JBM A;  1K73 C;  3STB D;  1JMC A;  4A3F H;  4R4C A;  2QA4 A;  4A3K G;  2B63 H;  4YWM A;  1NBW A;  4DV7 L;  1LUZ A;  4A3L H;  1EUJ A;  2PI2 E;  1VQI A;  1X65 A;  4DV2 Q;  1WI5 A;  2E2J H;  2ZM6 Q;  3CPW A;  3TRZ A;  4KHP L;  2OCE A;  1SN8 A;  4PZ6 A;  3PO2 H;  4OO1 I;  2PMZ E;  2Y0S G;  2VQE L;  2BA1 A;  4A3F G;  4NB3 A;  1M1K C;  3E0E A;  1QUQ B;  5FJ8 G;  5IWA Q;  3U50 C;  1QVF A;  3KJP A;  1XPO A;  1OXV A;  3F2C A;  1YHQ A;  1GD7 A;  1YEZ A;  1WOC A;  2CWP A;  3JAM c;  1N9W A;  1TWC H;  1VQG A;  1KL9 A;  4A3C G;  1VQ7 A;  2ASB A;  3BU2 A;  1HNW L;  1Q8K A;  2IX0 A;  3AQQ A;  2XGT A;  4IPD A;  5IT9 c;  1Q7Y C;  1N33 Q;  3M4O H;  4OX9 Q;  4JYA L;  4IOA A;  4DV4 L;  2ATW A;  1TWF H;  1OXT A;  4DV6 Q;  1J5E L;  5GAD C;  4DV7 Q;  1Y1V G;  1CKM A;  1BBU A;  1A0I A;  1GVP A;  1X3E A;  4PZ7 A;  3CXC A;  1VQ8 A;  2PI2 A;  3RN5 A;  5C4J H;  1AE2 A;  4WJ3 M;  3CF5 A;  3NEM A;  5C0X I;  4GNX A;  2F4V L;  1HH2 P;  4DV2 L;  2IY5 B;  4AQY Q;  2ZM6 L;  4KHP Q;  3DM3 A;  1X56 A;  4A3E H;  1VQD A;  3OTO Q;  4HJ5 A;  4JI5 Q;  2JA8 G;  4X62 L;  3KFU A;  3S15 H;  1HNX L;  3HOZ G;  1RL2 A;  2NVT H;  3F8T A;  4BY1 H;  3AEV A;  2Z0S A;  4QJF A;  1Q1B A;  4EQ5 A;  5IY0 A;  1QZG A;  2CKZ B;  1OXS C;  1VQE A;  3AFP A;  5JEA J;  4YWK A;  4Y7N H;  4IFD I;  1BBW A;  4A3M H;  4MNO A;  1J6Q A;  4GKJ L;  2K5H A;  3CAM A;  4DK3 C;  4GOP B;  3CCR A;  1E24 A;  1PH8 A;  4OX9 L;  4JYA Q;  1A62 A;  3GD7 A;  4DK6 C;  1I5F A;  2JEB I;  1HNW Q;  4RMF A;  3PO2 G;  2N78 A;  1K8G A;  1IBK L;  1SRO A;  1I50 H;  1VCI A;  1A63 A;  3CC7 A;  1E7Z A;  3GTJ H;  3TS0 A;  1HZB A;  2MQH A;  2E2I H;  2JA7 H;  4JBW A;  1LTL A;  1Z47 A;  1L0W A;  4AQY L;  2ALY B;  4JI1 L;  1VQO A;  3OTO L;  3J81 i;  3PUW A;  1V1Q A;  2LXJ A;  2EXD A;  1HNX Q;  2NN6 G;  4APV A;  2UUB Q;  2JA7 G;  3KF8 B;  3KJO A;  1KRS A;  1YJ9 A;  1N32 Q;  3RZD H;  1NMF A;  5C0X G;  4J15 A;  4X65 L;  1TXY A;  3M7N A;  1I94 L;  2OTJ A;  1E1O A;  4L5R C;  1XPR A;  4IOC A;  5M5X H;  5IP7 H;  1WFQ A;  4JCV E;  3K7A H;  1Y1W G;  1PH5 A;  1AE3 A;  4OON A;  3W1G A;  5LMU L;  2E2H H;  4GN5 A;  1I6H H;  2JA6 G;  1KIX A;  4JI7 L;  4UP7 A;  4LF8 L;  1IZ6 A;  4DV5 L;  3Q8D A;  4DR4 Q;  1HZC A;  3RN2 A;  3K81 C;  2DGY A;  1KRT A;  2NVQ H;  2AMC B;  3AYH B;  1JJ2 A;  4LF5 L;  5M3F H;  1HR0 Q;  2BH8 A;  3M4Q A;  4AYB G;  1SFO H;  4RG1 A;  2NN6 I;  1IBK Q;  4IFD J;  1K83 H;  1XJV A;  2UXD Q;  2VZA A;  1KHI A;  4C3H H;  2JA6 H;  1Q12 A;  1OXX K;  1UEB A;  3BZC A;  1K9M C;  1N36 Q;  3A5U A;  3PV0 A;  4H02 A;  4HJA A;  4A3I G;  4JI6 Q;  2Q2U A;  4UY8 C;  3K0X A;  4JI1 Q;  4A3C H;  3EN2 A;  4PMW A;  1Y14 B;  5JEA G;  3PUY A;  4X6A H;  1PA6 A;  4AYB E;  4X65 Q;  4R4I A;  2BA0 A;  1N32 L;  4LW1 A;  3G71 A;  4A3G G;  1VQ6 A;  5DLQ E;  2E5L Q;  1I94 Q;  3HFZ B;  3L7Z C;  4JI2 Q;  4C3J H;  4A3I H;  1VQN A;  3RZO H;  4NXN L;  3PO3 H;  4DR7 L;  1H95 A;  1XNR L;  2A1A A;  3W5O A;  2CQO A;  1C0A A;  4IPG A;  2IT1 A;  3AFQ A;  3F2D A;  1VQA A;  4DV0 L;  4JI7 Q;  1MJE A;  3UE1 A;  3HOZ H;  1KAW A;  4QL5 A;  3FKI H;  3DLL A;  5IYC G;  1HR0 L;  4C3I H;  4A3E G;  3H0G H;  3STB C;  3H15 A;  3GTO H;  2UXD L;  1G6P A;  3H3V I;  3OYY A;  2A8V A;  2CWA A;  3PUX A;  4LFB L;  1FVI A;  1SRU A;  4HIK A;  1CSQ A;  5IYC H;  4JBJ A;  1HNZ L;  2MO1 A;  3GTL H;  3RLF A;  4C2M H;  2YU9 H;  1N36 L;  1LM0 A;  3PUZ A;  1OXU A;  3MEF A;  1VQ4 A;  2MO0 A;  4PZ8 A;  4R1J A;  2N49 A;  4BBS H;  2GVA A;  4HJ7 A;  1WJJ A;  4X66 L;  1ASZ A;  1TWH H;  2YTY A;  4A3B H;  4A3D G;  2R7D A;  4Y52 H;  5M3F G;  4JI2 L;  4DR7 Q;  3KOJ A;  4YY3 Q;  4NXN Q;  5HGQ A;  4OWW B;  4GKK Q;  3CCE A;  2AHO B;  4IJL A;  4P71 A;  4HIM A;  2JQO A;  3KDF A;  1EIF A;  3NEN A;  3TEH B;  4POF A;  4BBR H;  1SR3 A;  4MTN A;  4MZ9 A;  5FJ8 H;  4DV0 Q;  1L1O C;  2R92 G;  5JJL A;  1P16 A;  2CFM A;  4O2D A;  1X54 A;  2BH2 A;  4A3J G;  2KBN A;  1EQR A;  5GAG C;  4QGU A;  5GQO A;  4JBK A;  4BBR G;  1SMX A;  4A3G H;  3E9I A;  3EIV A;  2K75 A;  4DNI A;  4B3M Q;  4BA1 I;  4JI5 L;  3UE0 A;  4PG3 A;  1GO3 E;  3HOX H;  4HID A;  1NJI C;  4DR3 Q;  3PCO B;  3S17 H;  2ZJR A;  5AJ3 L;  1PH6 A;  1VQM A;  2E8G A;  3UDX A;  3A74 A;  4LUO A;  4X64 Q;  4DR5 Q;  4TVA B;  4A3J H;  1O7I A;  4LFC Q;  4YY3 L;  1U5K A;  3GTK H;  2YTV A;  2UXC L;  2KEN A;  4GKK L;  1X9N A;  2VUM H;  4R4O A;  3M3Y H;  1IXR A;  1VQ9 A;  1RIP A;  1YI2 A;  3I4O A;  2RCN A;  1L1O B;  1L2F A;  2JA9 A;  1L1O A;  2IHF A;  3CCM A;  3NBH B;  4B3S Q;  3S1N H;  4JV5 L;  4P75 A;  1I3Q H;  3GTP H;  4LFA Q;  4JI4 Q;  3M4P A;  3GTM H;  2VS1 A;  4YCU A;  1B7Y B;  1VQH A;  3D31 A;  1XMQ L;  2PNH A;  1B8A A;  4IPH A;  1WYD A;  3I56 A;  1PYB A;  2OQK A;  2KCM A;  2IX1 A;  2R92 H;  3I7F A;  3U58 A;  5ELO A;  4LF7 Q;  2R93 H;  1X3F A;  4LUV A;  2L15 A;  3CQZ H;  2UUB L;  1ASY A;  2FXQ A;  1EIY B;  1QVG A;  1N8R C;  1HR0 W;  4DUZ Q;  4DR3 L;  3ULP A;  3LGJ A;  3J7Z C;  1AH9 A;  1EOV A;  3CPF A;  4YCW A;  1K8A C;  4LFC L;  4X64 L;  2D62 A;  4DR5 L;  4XTC S;  1YNX A;  1GM5 A;  4O0A A;  4JI3 Q;  3HKZ G;  4GLV B;  1WCM G;  3S24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...