4A75A

The lin28b cold shock domain in complex with hexathymidine.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
89
structure length
89
Chain Sequence
GSDPQVLRGSGHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYMEGFRSLKEGEPVEFTFKKSSKGFESLRVTGPGGNPCLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Lin28 Cold-Shock Domain Remodels Pre-Let-7 Microrna.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
molecule tags Chaperone/dna
molecule keywords LIN28 COLD SHOCK DOMAIN
total genus 18
structure length 89
sequence length 89
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2011-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a75A00
3PUYA 1WFQA 3S24A 4LWCA 3CCSA 4LF6L 1Q46A 1YJNA 3BU2A 3I4MG 3U50C 1OTCA 1C0AA 3HOWH 5C0XI 1XPRA 2WB1G 2UU9Q 4NXNL 2D0OA 4X62Q 1Z47A 3CCQA 2H5XA 4DR3Q 3JAMi 1X54A 1TWGH 1X6OA 5IP9H 4LFBQ 2MO1A 1Y1VG 4A76A 2ATWA 4DR7L 3M4QA 4JI4Q 4MNOA 2E2JH 2GVBA 3W1GA 4HIMA 1SRUA 5LMUL 4IOCA 2K50A 3I2ZA 4O0AA 4YY3Q 3F2CA 4DV6L 3TEHB 1XMOQ 4DR5L 3PUXA 2ASBA 3TQYA 1M90C 1MKHA 2KHJA 4UP9A 2VQFQ 2B63G 3STBC 4KHPQ 3NEMA 3AFPA 1EWIA 3KDFB 4LF8L 2YTVA 3F2DA 1VQPA 1R9TH 4JCVE 4A3GH 3T1YL 4LF9L 1TWCH 4B3SQ 1PH3A 1U5KA 4JI1L 2JA7G 4LF9Q 1P8LA 2UUAQ 4OWWB 5C4XH 1Y1VH 1RL2A 3J81j 3H15A 4IJHA 2QA4A 3I4NG 5HGQA 3HKSA 1U0LA 4B3RQ 1HNZQ 2RHQB 1KC8C 2B3GA 3JC66 1V1QA 2QEXA 4ALPA 2RHSB 5C0XG 4MTNA 2ES2A 3RN5A 2HT1A 1B8AA 1XMQL 2A19A 2KBNA 1D8LA 2WAQE 1VQIA 4LUZA 1VQ5A 4JI0Q 2MFIA 4A3BG 3M4OH 2KCTA 1IZ6A 2Y0SE 1I94L 4LF4L 3AYHB 1PH5A 2VUMG 2PI2E 2WP8J 2JA5H 1VQMA 1X3EA 1VQ8A 1W3SA 1PV4A 3PO3H 2CFMA 2NN6G 3A5UA 3I56A 3DLLA 4DV0L 1HR0W 4GKJL 2AMCB 4TQUS 1Q1BA 4A3BH 4YWKA 1CKNA 2Q2UA 5GAHC 3CD6A 2AKWB 4AQYQ 4B3TQ 4X62L 4JBKA 3J81i 5GAEC 2B63H 3HOYG 2YTXA 5ELOA 3JAMc 2K5VA 2CQOA 4LF8Q 1WCMH 3LGJA 1HZAA 3WWVA 3M85A 2EXDA 1UE7A 4LUVA 1NTGA 1VQ6A 1I50H 4X66Q 3UDGA 4UPAA 4OWTB 3EIVA 1W2BA 2OCEA 4DR5Q 5IP9G 1PH4A 1JJ2A 5IYBG 3U58A 1N32Q 1PFSA 2NVTH 3K80C 4BBRH 3A74A 4RMFA 4DPGA 1WCMG 3I4OA 1VQEA 3Q8DA 5C44H 2HHHL 4KHZA 1NY4A 4OONA 4A3EG 1ASYA 1C9OA 5JJKA 1YJWA 4LFCL 2R93H 3K8AA 1QVFA 4GN5A 4GOPA 2BH2A 4A3FH 3RNUA 4LUOA 2V1CC 3L7ZC 1I5FA 1QUQB 3PIOA 1L1OC 1MJCA 4A4IA 5GROA 3I7FA 5IYDG 3CPWA 2Q2TA 3GTKH 3U4VA 1QZGA 4IOAA 2UXDL 4APVA 4BBSH 2VUMH 4IFDJ 3CW2C 1VQLA 1NBWA 3UE1A 1IL2A 3HOVG 4JOIC 3OTOL 1VQJA 1PYBA 4IPCA 2YTYA 3UE0A 4DV4L 4HIKA 4L5TA 3H0GH 3HOWG 3ERSX 2LSSA 4GOPB 3UDIA 1S72A 2BA0A 4OO1G 2AWOA 2E8GA 2L15A 1VQAA 3ULLA 2GN5A 2ZJRA 2K75A 4A3LH 1NMFA 1NE3A 5JEAJ 2JQOA 1HNWQ 2MQHA 3HOVH 2VQEQ 3T1HQ 2Z0SA 4C2MH 1Q1EA 4XTCS 3PF4A 4O2DA 4DV7Q 4A3KG 1XNQQ 1PH9A 3S16H 3TS0A 4JI5Q 4JV5L 4X65L 3NELA 4A3CH 2UUBQ 2ZJQA 4HJ9A 4KLKA 4PZ7A 1X3GA 3M9BA 2NZHA 4R4IA 2IX1A 4JI3L 3HKZG 3MXNB 1VQBA 2MNAA 3SGIA 3KLWA 4AIMA 4HJ5A 1PH2A 3HKZE 4X64L 5FLMH 1LTLA 1X55A 2JA9A 4DNIA 3CCJA 1V43A 3EN2A 4L5SA 2OTJA 5M3MG 5ELNA 2OQ0A 1HJPA 1OXUA 5JJIA 3FKIG 1RIPA 1E7ZA 1OXTA 1D7QA 1I3QH 2UXBQ 1B70B 4JI5L 4BY7G 2QGQA 1IBML 2UU9L 4B3RL 2BH8A 1K73C 1Q8KA 2I5LX 4DV4Q 2VL6A 2ID0A 1NJIC 4JI7L 5LMNL 1K3RA 4IJLA 3GTGH 5M3FG 4L5QA 3K81C 1TXYA 3AQQA 3M7NA 3OTOQ 3J7ZC 1FJGQ 4K0KL 5JJLA 3I4MH 4OO1I 2XGTA 4WJ3M 3I55A 5M5YH 1UEBA 3KF6A 4GLAC 3U4ZA 1FJGL 4K0KQ 2UXDQ 1SROA 4A3IH 1UWVA 4A93G 4YY3L 1XMOL 3S2HH 1PA6A 1BKBA 1PHJA 2Q2HA 1YHAA 3CC2A 4C3HH 2JA5G 2PQAA 4GKJQ 1EOVA 1G51A 1EUJA 1WYDA 1K8AC 3GTOH 4LFBL 2IHFA 3J81c 1KIXA 4GLXA 4YCVA 4YHHQ 3CMAA 4DV2Q 1VQ9A 4JBWA 4P72A 1WI5A 3TREA 2UXCL 4IFDG 5GAGC 4DV1L 1YJ9A 3CC7A 1JMCA 1VQNA 2IT1A 3G48A 3D31A 1VQGA 1J5EL 5FJ8H 1VQHA 3PUWA 4J15A 2DUDA 1KQSA 4X6AH 2N8NA 1HNZL 3GTJH 4GNXC 3HOZH 4JI6Q 2CCZA 1CSQA 2R7ZH 1AH9A 1WOCA 2KHIA 4H02A 1BBWA 4LW1A 4RG1A 4POFA 4DR4L 2RCNA 1HNWL 1VQCA 1IBMQ 1X9NA 1L2FA 1OXVA 3FP9A 2JA7H 4JI8L 4DV3L 3ZJYC 3KJPA 3GTPH 3RLNA 4GS3A 5AJ3L 4A3GG 1BBUA 1SR3A 1N33L 1GKHA 5HY6A 4EX5A 2F3IA 1EIFA 2A1AA 3OYYA 4DV3Q 5M3FH 4NXMQ 4DV0Q 3BZCA 2Q2IA 1CKNB 4MZ9A 3PF5A 1G291 1XJVA 3J7A5 1DGSA 1XMQQ 3S17H 4BXXH 3W1BA 5C4JH 4JI6L 2Y0SG 1N9WA 2ZTDA 2CWAA 4YCUA 4GKKL 3FKIH 2PMZE 3RR5A 1N36L 1G6PA 1NMGA 3KFUA 2ZTCA 4UP7A 4PMWA 2N78A 1E24A 1QVCA 3E9IA 1CUKA 4GN3B 4LFAQ 5C3EG 1Q81C 1FVIA 4P73A 1Y1WH 1Q7YC 3CQZH 4OXPA 1VQKA 2Z6KC 2KCMA 5IP7H 4P74A 4A3JG 1VCIA 3PUZA 2PI2A 5BR8L 3BJUA 1Z9FA 4R4CA 2VQEL 3T1HL 4JBMA 2K5NA 5LMNW 5IYCG 4IPDA 3G6EA 2WB1E 3T1YQ 4A3CG 3ICEA 4LF5Q 2JA6G 4FDBA 3NBHB 4DAMA 1H95A 5IWAL 2R92H 1E1OA 4P71A 1PH7A 4R4QA 5FLXc 1I6HH 2JJQA 4XIGS 2B29A 4ME3A 4QJFA 3KJOA 2R7DA 3A0JA 4HJAA 2ZM6Q 1VQOA 4A3LG 1YVCA 1IBKL 4GLVB 2JE6I 3KF8B 4A3MG 1A8VA 1GM5A 4YWMA 4BY1H 3HOUG 3NENA 4PZ6A 2ZM6L 4HIOA 3S1MH 2LXJA 4IPGA 5C3EH 2VQFL 3A5ZB 4JOIA 4GNXB 1PH6A 1N34L 1SN8A 2N49A 5DLQE 2VZAA 4BBSG 4NXML 1JJCB 1EQQA 2NVXH 1K8GA 3G71A 2IY5B 2R6GA 3PCOB 4JG2A 1N34Q 2I5MX 1FGUA 2JA8G 2R92G 1L1OB 5EAYA 1KHIA 3L2PA 3HOXG 2JA6H 1Q12A 3ULJA 2ZJPA 4X66L 3S15H 5IYCH 1EIYB 2ALYB 3FHWA 2AHOB 1JE5A 4JC0A 4A3EH 4A3JH 2WAQG 4UY8C 3M3YH 1A62A 1HZBA 2KENA 4PZ8A 4LF4Q 1YHBA 2NZOA 1Q82C 1K9MC 4DUZL 1GO3E 2ZTEA 5IYBH 2E2IH 3PO2H 3RZOH 1EFWA 3L0OA 1VQ7A 2F4VL 1L0WA 4IO9A 5IWAQ 1QZHA 3GO5A 4DR2L 4QY7A 4HIDA 1IBLL 4Y7NH 3GTLH 3KDFA 1GD7A 4AQYL 1A0IA 1IYJB 2GVAA 4B3TL 1MIUA 2UXBL 1J6QA 5BR8Q 5GADC 2JEAI 4PG3A 5K36G 5FLMG 1WJJA 5JEAG 1MJEA 4A3MH 4OWXB 1VS0A 2A8VA 4LF7Q 2I5HA 4GKKQ 1N8RC 3PO3G 1SMXA 2I0QA 2K52A 1EYGA 1PVOA 4OX9L 3ULPA 4JV5Q 1HZCA 2UUBL 2N3SA 4DAYB 1A63A 4KHPL 2UUAL 4JI3Q 5FJ8G 4DV7L 2OWOA 1XNQL 4NXNQ 1YZ6A 3B6YA 3CC4A 3H3VH 4IFDI 4DR3L 2VNUD 1SLJA 2OQKA 5IT9c 5IP7G 1Q86C 2AWNA 1Y1WG 1XPUA 1V9PA 3CP0A 2HHHQ 5AJ3Q 3KYHC 3F2BA 4BY1G 5IE8A 4IPHA 1LUZA 1YITA 4DUZQ 1XTDA 1CKOA 3IRBA 2NVQH 1L1OA 2UUCQ 2F52A 1ASZA 1S3OA 3K7UC 3S14H 4BXXG 3KF6B 1B7YB 2LXKA 1S40A 3GD7A 1J5EQ 1JT8A 1YEZA 2IHEA 2WFWA 4A3IG 1LYLA 4A93H 1YNXA 4A3FG 4DUYQ 4KI0A 4DKAC 5J3BA 4GNXA 3KOJA 4LF7L 4LFCQ 1FL0A 4AYBE 3W5OA 4JBJA 3AFQA 3CPFA 4AH6A 3CCEA 4DV2L 5C44G 4LF5L 4DR1L 2R7FA 1LM0A 2UXCQ 3HFZB 1XPOA 4POGA 3RLOA 4DR7Q 1HH2P 1E1TA 3GDEA 2YV5A 3J80i 1PYSB 4AYBG 2HQLA 4A3KH 1VQ4A 4R1JA 4JI2Q 1HR0L 1IBLQ 5H1SE 3OW2A 2JA8H 4JI0L 4JYAQ 4UP8A 3TRZA 4BY7H 1OXXK 3S1QH 2EQSA 1N32L 4X64Q 3CCUA 3K0XA 3G4SA 3RZDH 1SFOH 2K14A 3PGZA 3D0FA 3PSIA 1HNXL 2E5LQ 1AE2A 2VY3A 4C3IH 1IBKQ 1KXLA 3HOUH 1SE8A 2CWPA 3RLFA 3CCLA 3BZKA 2OTLA 3CCMA 4A75A 1O7IA 3S1NH 3UDFA 1C7YA 4R4TA 4BA2I 1PH1A 2CKZB 2Z6KA 2NVYH 4B3SL 1TWAH 1X56A 2PNHA 1QVGA 3S2DH 3STBD 3DM3A 5M5WH 3PIPA 4DUYL 3VDYA 4NPSA 3HOZG 2DGYA 3CCVA 1XNRQ 1KL9A 1JJGA 1K83H 2JK8A 3CAMA 2JEBI 1QUQA 2RF4A 4YCWA 4DK3C 4B3MQ 4QL5A 4DR4Q 2NN6I 1KRTA 4LFAL 3H0GG 4DV6Q 4WJ4A 3AEVA 2K4KA 1I94Q 1CKMA 3K7AH 4TVAB 2BA1A 2D0PA 3CCRA 3GTMH 3J80c 1TWFH 3E9HA 2UUCL 3I4NH 4X65Q 3CMEA 4BA1I 5C0XJ 3PV0A 4LNQA 5C4XG 2C35B 3CF5A 4EQ5A 1VQDA 4QGUA 4A3DG 4YHHL 5LMNQ 1GVPA 1UE5A 1AE3A 1IXRA 5IYDH 1KD1C 1E22A 5M5XH 4GOPC 1X3FA 1YI2A 4LF6Q 3PO2G 4DR2Q 1M1KC 4JI8Q 2XTIA 3CXCA 1CSPA 3F1ZA 2R93G 2HIVA 2YU9H 3ER0A 3PUVA 2FXQA 1N33Q 4P75A 1HNXQ 4DR6L 4QQBX 2EIFA 2HIXA 4C3JH 1K0RA 4YWLA 3GTQH 1UE6A 2MO0A 4BBRG 4A3DH 1KRSA 4DV1Q 4HJ8A 1KAWA 2YYZA 4GN4B 3HOXH 3TS2A 1Y14B 2PQAB 2R7ZG 2VS1A 2E2HH 4OX9Q 1N36Q 1YBYA 2D62A 2K5HA 1OXSC 1EQRA 3MEFA 3UDXA 1PH8A 4DR1Q 4JI4L 4JI7Q 3RN2A 4Y52H 1XNRL 4HJ7A 4NB3A 5LMUQ 1E3PA 3HOYH 1BVSA 3EBEA 4B3ML 2F4VQ 5M3MH 3H3VI 1HZ9A 2IX0A 5IY0A 1HR0Q 4JI2L 4JYAL 5GQOA 4JI1Q 5E7NA 1T9HA 2E5LL 4QIWE 3F8TA 1X65A 3M4PA 1UE1A 3S1RH 2VW9A 1VQFA 4L5RC 1JB7A 4DV5L 1P16A 1YIJA 4R4OA 1YHQA 1TWHH 4DR6Q 4DK6C 4DV5Q 3E0EA
chains in the Genus database with same CATH superfamily
3S24A 1EY8A 3CCSA 1LTAD 5C0XH 3CKIB 4H13C 1QCBD 3HOWH 1CTMA 4FNFA 5C5LA 2H5XA 3PMFA 5EKIA 4DR3Q 5IP9H 2ATWA 1Y8OB 2A68C 1M8AA 3M4QA 2GVBA 1QE6A 2N55A 4O0AA 4YY3Q 1XMOQ 3PUXA 2IL8A 4DNRB 2ASBA 2ENBA 1MKHA 2KHJA 4UP9A 3NEMA 1I4RA 3VYSA 5EBCA 2YTVA 2NZ1D 4JCVE 1WTOA 3SK4A 1DOKA 1II3A 1RKNA 1U5KA 4JI1L 1LABA 2Z9HA 3J81j 2Q8IB 3A56A 3KLRA 2QA4A 2FJ2A 1ZYRC 1KC8C 1HQRD 1UNSA 2RHSB 2ES2A 3RN5A 4FF1A 3AMUA 4BBRB 3FMCA 3M4OH 1TY0A 1IZ6A 4F87A 3HOUB 1PH5A 1IW7D 2VB2X 3O13A 4R8IA 2JA5H 4ODGA 1W3SA 4N8FA 3FKIB 4BY1B 2XIWA 5EPKA 1D5MC 3CD6A 4A3BB 4X62L 4Q5VA 5M3FB 2YTXA 5ELOA 4K2KA 1WCMH 1HZAA 4N9PA 2ICEC 1UE7A 2K03A 3V96A 1NTGA 1U9RA 1VQ6A 1A15A 3Q0AA 2DY7A 4DR5Q 1BUVT 2NVTH 1EZ6A 4RMFA 4OONA 5DAUA 3D3RA 3H09A 1QVFA 2B2WA 3R2TA 2BH2A 1EIHA 3PIOA 3HEJA 1L1OC 1MJCA 5FLXE 5GROA 3CPWA 2E75C 1SNMA 1QZGA 2EOTA 2KEDA 4IOAA 1EYAA 1E2WA 1HTPA 2VUMH 3UE1A 4K8JA 3VR2A 2F0KA 3OTOL 1VQJA 4QB4A 2EE1A 3X3NA 2R61A 1C4QA 1F2YA 1O7LA 4OO1G 4ZCKA 3GQBA 4A3LH 1NMFA 2JQOA 1HNWQ 3C1EA 2BCOA 2Z0SA 4C2MH 2DNEA 3NBIA 4A3KG 1XNQQ 3S16H 4JI5Q 4X65L 2FHTA 4A3CH 2UUBQ 2WACA 1BCPF 4R4IA 2IX1A 4JI3L 1TQOA 1PH2A 3SGIA 4AIMA 2QDBA 3WOFA 1PMRA 1X55A 3CCJA 1QG7A 1V43A 3EN2A 5ELNA 5JJIA 1E7ZA 1I3QH 1B70B 2BH8A 1K73C 2VL6A 5BN3A 5LMNL 3S15B 5FO8B 3D4WA 3K81C 1TXYA 1E2ZA 4K0KL 4OO1I 4WJ3M 4GLAC 3FEWX 3KF6A 3U4ZA 4K0KQ 4ZQ3A 1SROA 2L1BA 4TRDA 1UWVA 4A93G 4YY3L 1XMOL 2UXDQ 1EY9A 3S2HH 1PA6A 1SE4A 1CQFA 1CFMA 2JA5G 4LFBL 4GKJQ 1G51A 1ILPA 1EUJA 2E74C 2HCCA 3GTQB 1Y69U 3J81c 4BBSB 1UUPA 2KECA 1I6HB 1F9SA 2A6HC 1FYCA 3MEHA 4HSPA 4KN4C 1VQ9A 4GZYC 4JBWA 1I4XA 5KIXA 3TREA 1YJ9A 4DV1L 1VQNA 1IW7C 5F2DA 2L55A 1HFGA 1J5EL 5CV5A 1KQSA 4ZRZA 3GTJH 5C44B 4JI6Q 1CSQA 1WOCA 2EVBA 4RG1A 4OEMB 4DR4L 4FYDA 1EEID 4JI8L 4J1MA 3GTPH 1RD9D 1QILA 4IUQA 2E2HB 3J7YW 1GHKA 4NXMQ 4MZ9A 2Q8RE 1XMQQ 1EY0A 2A69C 3C2PA 2XRQD 4PMWA 1E24A 1EWHA 2F0JA 1CUKA 5C3EG 1Q81C 1Q7YC 4P73A 3CQZH 1VQKA 4OL7A 2XWJB 3PUZA 5BR8L 2VQEL 3T1HL 3BVMA 4A3CG 4IPDA 1K0SA 3ICEA 4LF5Q 2JA6G 4FDBA 3NBHB 3DWPA 5C4JB 3Q6SA 1E1OA 3W2DA 1BO0A 1VQOA 1YVCA 1EYDA 1IBKL 1W6JA 2MHVA 3PQIA 4A3MG 4ZKBB 2RCFA 2LXJA 4IPGA 5C3EH 2VQFL 1SNDA 4H7BA 1SBBB 4XXEA 1SYDA 1WTXA 1V1PB 5CV4A 4CDDC 2IY5B 2DN8A 3TMEA 5ELFA 5EAYA 5IGBA 5J22A 1K3BC 1EIYB 2ALYB 3FHWA 4RFBA 4UY8C 4JC0A 4A3EH 2F0DA 4KKSA 1NCVA 2SNMA 3GV6A 1T5XD 1YHBA 1LTTD 1SE3A 1Q82C 2RDHA 3IKJA 4RA8A 1AN8A 5EGTA 3KBGA 3ONAB 3L0OA 5IIFA 5C3WA 1VQ7A 3GO5A 3GTLH 1H9SB 4B3TL 3SDZA 1MIUA 2O5JC 4R9WA 2QEJC 1J6QA 1GXDC 4PG3A 2R3ZA 1WJJA 5I6YA 1ET6A 3HOVB 2I5HA 5IGGA 4TSSA 1HZCA 4S3SA 2N3SA 4DAYB 1A63A 4CKCA 4KHPL 2UUAL 1VMCA 5FJ8G 4DV7L 2KUMA 3IFTA 4IFDI 2VNUD 1SLJA 4O1NA 1I4QA 2WKCA 2FINB 1STAA 2HHHQ 1AFPA 1YITA 5T1GA 2R93B 4DUZQ 4CJ0B 2MJ8A 3IRBA 1NSNS 2EY6A 2F52A 4N9TA 2LXKA 1LYLA 2HDLA 3TZDA 2JYOA 1DOLA 4EQPA 4DKAC 4LFCQ 2LKVA 1ICWA 4XT3B 5AFWA 3AFQA 1LTGD 5C44G 3TP6A 4DR1L 4RKLA 3HFZB 5M9OA 2EPBA 2PW5A 5HURA 1SE2A 1IBLQ 2L12A 4JYAQ 4LK1C 1OXXK 1F9PA 1NAPA 1N32L 4B08A 2QDLA 1E2VA 1STEA 5CV8A 1HNXL 2F0VA 1IBKQ 1SE8A 2CWPA 4KHVA 3BZKA 4G7ZC 3S1NH 5G3LD 3T51B 4HTHA 4R4TA 5LHY1 1PH1A 4B3SL 1SDFA 1X56A 3GTMB 3PIPA 3CU7A 2F0LA 1XNRQ 1KL9A 1JJGA 1K83H 4DK3C 2JEBI 4YCWA 4B3MQ 1GUOA 3DXJC 4QL5A 3SXHA 1JWMD 5COYA 3D8GA 4LFAL 3SVMA 2CVRA 1D1IA 4TVAB 2OXPA 3J80c 3E9HA 3I4NH 1BR9A 4BA1I 5EJWA 5I9OA 4EQ5A 1VQDA 2C5CA 5FO9B 3N52A 4A3DG 3FVQA 1IXRA 1KD1C 1E22A 1CZGA 4QIWB 1RTNA 1DD2A 2F0WA 1CT1D 2E2JB 4JI8Q 2XTIA 2Z6BA 1WD1A 5IGEA 3KF8A 2R93G 4DR6L 5D65A 1G6ZA 2EIFA 4C3JH 4YWLA 4DGZA 1WD0A 4BBRG 4A3DH 3DM1A 2BE5C 2R7ZG 1NR2A 4FXKC 5ELBA 1CHPD 2K5HA 3BDCA 3EROA 1EQRA 1ML0D 1TWHB 4HCEA 3MFGA 3Q23A 1BVSA 4FF3A 3H3VI 2IX0A 1HR0Q 4JI2L 4JI1Q 1WTVA 5E7NA 2A68D 1VQFA 4OELB 1F77A 5I4DA 4Y7NB 1TWHH 4C1NI 4DR6Q 2PQEA 1ZYRD 3PUYA 3GTOB 4LF6L 2RA4A 1EZ8A 4OHJA 3BU2A 1YJNA 1C0AA 1LTSD 2D0OA 4NP5A 1GUNA 1TWGH 5M5YB 3TN2A 1A2TA 3DMUA 1L0YB 4MNOA 2E2JH 4IOCA 1SRUA 2K50A 4DV6L 3F2CA 5ELEA 4C2MB 3NQIA 4FP5D 3STBC 2B2UA 3FPPA 3F2DA 1VQPA 3VYUA 1PFNA 4X3TA 3MHBA 4XQQA 3EA6A 1PH3A 1H9RA 2O2LD 4CGYB 1XX8A 1EIGA 5C4XH 4OWWB 1EFID 4I7AA 4IJHA 3VR6A 5IGCA 2PO4A 2PPBC 5BN4A 2B3GA 1O7ZA 4X3SA 4KMUC 1EY4A 4IFDH 2A19A 1UAPA 4LUZA 1NR4A 3KBXA 5G3LF 4CDCC 1DOMA 3AB9A 3AYHB 2VUMG 2PI2E 4NKLA 2TSSA 5FK9C 1X3EA 3PO3H 3A5UA 2NN6G 2F0HA 3I56A 3MVVA 4DV0L 2Q2UA 4K6DA 4ID6A 4H44C 2B63H 3HOYG 3BG3A 1FD7D 3WWVA 1D2BA 4X66Q 3OMCA 3S9WA 4OWTB 3EIVA 1W2BA 3U58A 1PFSA 3SK5A 3A74A 3Q8DA 1VQEA 2V4DA 4C3JG 1NY4A 4A3EG 1C9OA 5JJKA 2MUYA 4LFCL 2R93H 2AUJD 1F9QA 1MSGA 2JP1A 4GOPA 4A3FH 1UEAB 3L7ZC 3VA7A 4DK1A 2CQAA 3I7FA 4A3KB 3FPUB 3HG9A 2CW0C 1VQLA 1NBWA 1IL2A 5E3FA 4RGTA 1GOZA 4DV4L 4OIJA 1IYVA 2K5DA 2EYOA 2SOBA 4L5TA 3J7AF 3HOWG 1K8OA 4EGVA 1S72A 3IFDA 3K59A 4RGOS 2E8GA 2ZJRA 2X6GA 3GTJB 1NE3A 5JEAJ 4FVMA 2MQHA 3HOVH 3K5LA 1HXYD 3S14B 3PF4A 4G7OC 1PH9A 5I6WA 3GTGB 2WIIB 1B50A 4HJ9A 3LNNA 2QCPX 3OMGA 3M9BA 3P75A 2LMCB 3HKZG 5CR3A 1BXTA 4KKTA 3Q22A 4X64L 1XYIA 2JA9A 4DNIA 2OTJA 2LFNA 5IODA 3U9OA 1HJPA 3CHBD 2EJGC 3FRPB 1RIPA 2I07B 3MWYW 1OXTA 1HUMA 3VR5A 4IUVA 3H3VC 4BY7G 2UU9L 4DV4Q 5FLXL 1K3RA 1RDPD 4IJLA 5M3FG 4L5QA 1RCVD 4EQNA 1EOTA 3QIAA 4DF7A 3AQQA 3GP7A 5LL6X 4PNYA 4NDXA 3I55A 1UEBA 3A8KE 3UI2A 4J6HA 5D3IB 1JR0D 1PHJA 2Q2HA 1LTID 1TKWB 1YHAA 5BN5A 4C3HH 2F3VA 1WYDA 3J80E 3RZOB 1LT3D 4C3JB 3TDQA 4GLXA 1KIXA 4YCVA 5C3XA 1SNQA 4X3UA 4P72A 1WI5A 5D3DA 4IFDG 5GAGC 1PLFA 2OEOA 2L4NA 5KRUA 4X6AH 2CCZA 1O80A 2KHIA 2AQ2B 2NVXB 1HNWL 2QF7A 4J8QA 4CDEC 4CDFC 2O4XA 1L2FA 2KCNA 4GS3A 1ENFA 4A3GG 5KNDA 1BBUA 4EX5A 2VUMB 5CMDA 2F3IA 2A1AA 3A7AB 3OYYA 3EVQA 4QCLA 2Q2IA 3J7A5 2XVSA 1XJVA 4BXXH 1IHZA 3W1BA 2ZTDA 2CWAA 3NBHA 4YCUA 4IN3A 1PXUA 4HR7B 2PMZE 1N36L 3MC0B 3ND9A 5JOBA 3MAQA 2D9UA 1Y1WH 2Z6KC 2NVTB 5IP7H 4A3JG 2EDGA 4UAIA 2RVLA 3OHXC 2PCFB 5LMNW 2WB1E 4N8X1 4DAMA 1ILQA 4F88A 1WCMB 2M2LA 1D5XC 1ET9A 1WTHA 2JSOA 4ABNA 1I6HH 2B29A 4A3LG 2R7DA 3A0JA 4KD3A 2JE6I 1Z7TA 4BY1H 3HOUG 4PZ6A 4ULLA 2FMMA 3MXGA 3A55A 3W3AA 1SXTA 1I4GA 5JVG3 2JA5B 3A5ZB 1SN8A 5DLQE 2NVXH 1K8GA 4A93B 3VYRA 1FGUA 1L1OB 1I4HA 2K5WA 2F0UA 3HOXG 2NVQB 3ULJA 3K57A 2ZJPA 3S15H 5IYCH 3JAME 2NTSA 1ZEQX 1RODA 1WTWA 2AHOB 3OWFA 2QILA 1I3QB 1A62A 2B2VC 2KENA 4PZ8A 3NTHA 2F4IA 4DUZL 3LWEA 4HMJA 3WDNA 5IYBH 3RZOH 1EFWA 5C6AA 3NHHA 3ITPA 2F4VL 4IO9A 2TMPA 1JOOA 1KNEA 1VF7A 4HIDA 4DR2L 1C48A 3KDFA 3FDTA 3K5NA 1A0IA 1IYJB 1SNCA 5LL6S 2UXBL 2F1MA 5BR8Q 2JEAI 1RHPA 4ZKCB 5JVH3 3KLSA 3TZUA 4OWXB 2A8VA 2B2YA 5C4ZA 1CM9A 2K04A 2K52A 1EYGA 4OX9L 4JV5Q 3BZDB 5EPLA 3HS0C 1RF2D 4ME5A 4ZAIA 1IL8A 3K6OA 1XNQL 3B6YA 4DXFA 3D4RA 1H9JA 1FR3A 4DR3L 5IT9c 5E4XA 2AWNA 2F03A 2WV6D 1XPUA 1V9PA 5NUCA 4WORA 3F2BA 4FXDA 5IE8A 4A3JB 4M8AA 1B9NA 2YU9B 1LUZA 2PZTA 2F0QA 2OF1A 3TBIB 1LO5D 1L1OA 2UUCQ 1ASZA 2M00A 3S14H 4YIJA 1KDBA 2K7VA 1YEZA 2WFWA 1H9KA 1BF4A 3HOYB 4RHRA 1FL0A 1TWFB 2EZVA 4LF5L 4Z9CB 4DR7Q 1HRJA 1E1TA 1Y8NB 2HQEA 4JI2Q 1HR0L 5FKAC 2JA8H 4JI0L 2B2TC 4UP8A 2M9VA 1WTQA 1TS4A 2HUGA 3CCUA 3C1FA 3P7JA 2E5LQ 2AUKA 5CV6A 3R3OA 3I90A 1K8MA 3HOUH 1PTOD 2OTLA 3M4OB 4A75A 1O7IA 2GA4B 2NN6H 1C7YA 2EYLA 1XXGA 2CKZB 1PRTB 2IW3A 2PNHA 4FF2A 3S2DH 4G7HC 1HA6A 2ZXRA 4BS9A 2LY7A 2I46A 4L63B 1Q8IA 1QUQA 4DR4Q 2NN6I 4JW0A 3TP8A 5CBEE 4DV6Q 2EY2A 3OWEB 1I94Q 1CKMA 3ND8A 3CCRA 2D0PA 3K5OA 1TWFH 1XTCD 4KK7A 1M4VA 2C35B 3CF5A 3HKZB 3EQLC 5KEEA 4QGUA 1GVPA 1AE3A 1Y1WB 1U4LA 3HOZB 4GOPC 2F0EA 4LF6Q 3OIQA 4DR2Q 1M1KC 3CXCA 1CSPA 5JJZA 1IKLA 2HIVA 3QR8A 3PUVA 5CV9A 2FXQA 2YU9H 1KDAA 1H9MA 3GTQH 3HOWB 4MHEA 1B2TA 3TS2A 3HOXH 2Z1CA 4OX9Q 4U68A 1EQVA 1N36Q 1OXSC 2HDMA 3GV3A 3MEFA 3UDXA 4Y52H 1TVXA 3MFYA 4NB3A 5LMUQ 2A6HD 5J39A 5JPMC 5GQOA 4XQJA 1B44D 4K2LA 4KJOA 4BWGB 3F8TA 4XQNA 1X65A 1UE1A 3I4LA 2VW9A 4L5RC 4KY7A 1JB7A 4DV5L 1P16A 1YHQA 1MI2A 1OO9B 3P20A 1TU2B 4DV5Q 4TKOB 4OIKA 1WFQA 3NWTA 1Q3LA 3MXPA 2EYMA 1XPRA 4K8IA 4NXNL 3H91A 1Z47A 1PYWD 3S16B 2MO1A 4DR7L 2A5HA 3Q24A 5LMUL 4CKEA 3TEHB 2F0OA 1M90C 4KHPQ 2B63G 2VQFQ 1J8IA 1LLRD 1GJXA 2KQ3A 1BCPB 1HFNA 3KDFB 1PDQA 3T1YL 4LF9L 2IX3A 4B3SQ 1LT4D 1S5DD 4RKBA 4LF9Q 1Y1VH 1U4MA 3H15A 3I4NG 3HKSA 4B3RQ 1HNZQ 1PTOC 3QG1A 4ALPA 1EU4A 2NVYB 4MTNA 2EJMA 2HT1A 4LAAA 2WAQE 3D6CA 1VQIA 4JI0Q 4A3BG 2MFIA 3OIPA 3DHQA 2Y0SE 4U673 1I94L 4LF4L 1ONLA 4XYQA 4EQOA 2WP8J 1SYEA 1VQ8A 1SFOB 1PV4A 4QUFA 2CFMA 4PV1C 3I4NB 5CC4A 2XNAC 1HR0W 4DAVA 1Q1BA 4A3BH 3QWNA 1CKNA 2EYJA 4AQYQ 1SSOA 5GAEC 3JAMc 2K5VA 2CQOA 3T13A 3TP7A 3BS1A 3JAML 4LF8Q 3MXNA 5CGKA 3M85A 2EXDA 3S2DB 4A3FB 1I50H 4UPAA 3GTMH 1JJ2A 2H4OA 2K01A 4BBRH 4DPGA 2HHHL 1PFMA 3G7LA 3K8AA 4GN5A 4KV6A 5I2YA 2V1CC 1G2TA 1QUQB 5E4WC 2Q2TA 2EYPA 3GTKH 2B63B 5JAVA 4DA2A 4IFDJ 2K1BA 5C5MA 2KHSA 1D5ZC 3HOVG 4JOIC 4IPCA 4HIKA 2SNSA 1ESRA 3UE0A 3PO3B 1TWCB 3H0GH 2LSSA 1R9TB 2BA0A 3DEOA 2E2DC 2L15A 5A35A 2EY1A 3ULLA 2K75A 2OT2A 3OW7A 1H9SA 3BYYB 3NK9A 4KD4A 3TS0A 4RGNA 2IJ0A 4DN4M 4MN3A 4PZ7A 1X3GA 2NZHA 3IAYA 2Y0SB 4ZUJA 1VQBA 2MNAA 3KLWA 4HJ5A 1S5FD 3HKZE 2CH4W 1LTLA 2A69D 4L5SA 3N6RA 1OXUA 3SR1A 4K6LA 3FKIG 1KDCA 1D1KA 1D7QA 4JI5L 4CHTB 2QGQA 1A3TA 4JK1C 1Q8KA 2I5LX 3E5SA 2ID0A 1NJIC 4JI7L 3GTGH 3OOCA 5A2QE 2WB1B 4WRDA 1QB5D 1BQQT 5JJLA 1FNUA 1FJGQ 5DEHA 3I4MH 4WFN3 1TWGB 5M5YH 5M3MB 1FJGL 1A2UA 2XWBB 4IUTA 1NUCA 4C1NK 1GHJA 3WOEA 3GTOH 1RJTA 2IHFA 1GUGA 1LTBD 1DYQA 4YHHQ 3NTIA 4DV2Q 1ICFB 2UXCL 1JMCA 2SDFA 3CC7A 3G48A 4DU9A 1VQGA 3EFXD 1GUTA 1TT2A 3IL8A 1TS3A 2N8NA 3MTSA 1HNZL 1HA5A 3NWSA 4GNXC 2PZUA 2K32A 5EBDA 2R7ZH 3QOLA 4H02A 1Q90A 1IBMQ 1X9NA 2JA7H 3FP9A 3RUZA 1AW7A 2G9HD 4I7ZC 4DV3L 3ZJYC 3KJPA 3RLNA 1HQMC 4B9WA 1GKHA 2CW0D 4G57A 1MD2D 1EIFA 4DV3Q 1PTOH 1SYCA 3S17H 1DGSA 3HRZC 1QNUA 2B2VA 3I91A 3VYTA 5IGFA 1N9WA 4JI6L 4KKUA 1VDZA 3RR5A 2BE5D 5M5WB 5K5PA 4UP7A 2N78A 1V8QA 1QVCA 1AEXA 3M4YA 1MHWC 1KTKA 4RWSC 2KCMA 4P74A 1VCIA 2PI2A 3T4AC 4JBMA 5IYCG 3T1YQ 2A73B 1H95A 4R4QA 2EXZA 2JJQA 4XIGS 4BY7B 4QJFA 3KJOA 4HJAA 1WTPA 1YNJD 5C4XB 1K83B 3M3YB 1SNPA 3E0JA 4GLVB 1YNNC 1EL0A 3KF8B 1GM5A 1A8VA 1SYFA 4YWMA 3NENA 2QW7A 3S1MH 3AU7A 1PZKD 3D4DA 3GTPB 1N34L 2F3WA 1PH6A 2N49A 2KOLA 4C3HG 3G71A 1N34Q 4JG2A 4AYBB 2R92G 3DEPA 1KHIA 2JA6H 1Q12A 5I9PA 2L11A 4X66L 4IUUA 2F0NA 1CZWA 4CJ2C 3TSSA 1JE5A 4K5WA 2B2YC 1HZBA 2K33A 3T16A 4C3HB 2NZOA 2LS01 1GO3E 2ZTEA 2E2IH 1QOHA 3KK7A 2EJFC 4A3GB 1L0WA 5IWAQ 1QZHA 3F2UA 4Y7NH 5KYIA 1GD7A 2PNRC 1TIID 2GVAA 1BDOA 2B2TA 4E6IA 1JWSD 5FLMG 1JC7A 3NP8A 4X3KA 5JEAG 1MJEA 1LTRD 3EJIA 4QUCA 4GKKQ 2A6EC 2KCCA 3PO3G 1HPCA 5ISRA 2I0QA 3QJYA 1PFBA 3ULPA 2UUBL 3PO2B 1B9MA 4JI3Q 1X32A 3VA5A 4UDUC 2OWOA 3E6ZX 1YZ6A 3CC4A 2AQ3B 2CH4A 4HEDA 1Q86C 1KABA 1Y1WG 5K36H 3CP0A 1LV9A 3KYHC 4BY1G 4IPHA 1C8CA 3C46A 1XTDA 1CKOA 3HGBA 1S3OA 3K7UC 4RHSA 4BXXG 1B7YB 1JT8A 1J5EQ 2IHEA 4A3IG 1YNXA 4A3FG 1CHQD 4KI0A 5J3BA 3NTKA 3GTLB 1S5CD 5EPJA 3V2TA 3W5OA 3CPFA 3CCEA 5TSSA 2B8GA 3S1MB 2R7FA 4RAUC 4DAYA 4POGA 3RLOA 4FF4A 3J81E 3GDEA 1HH2P 1PYSB 3DUZA 4AYBG 4A3KH 5DM73 4R1JA 1VQ4A 1AZPA 3M3YH 2R92B 3OW2A 1JOQA 2RKSA 2NB0A 3TRZA 4BY7H 3J81L 2EQSA 2K6AA 3URYA 4X64Q 3K0XA 3G4SA 3DWQA 3RZDH 1MBYA 2K14A 1W6KA 1ZKOA 3D0FA 1EU3A 3SK8A 1AE2A 1B3QA 2VY3A 5M5XB 1KXLA 2DJFC 2VXWA 3SK6A 3CCLA 3RLFA 1J9OA 2NWGA 3NXWA 3CCMA 1EY5A 1I4PA 1JQYD 3UDFA 4BA2I 2E76C 2Z6KA 1B53A 5C3EB 3MZ5A 3DM3A 5M5WH 3HOZG 1O7YA 2DGYA 3CCVA 2PW7A 4CKBA 2JK8A 1STBA 3MA2B 2RF4A 2QKIC 2HD3A 4QMGA 5JPNC 1PRTD 3H0GG 4WJ4A 2Z8LA 4PMCA 3L3OC 1CA6A 2BA1A 2PZWA 2UUCL 4HN7A 1YNJC 3I3CA 1KLGD 4X65Q 5IGDA 3PV0A 3RMHA 5C0XJ 1DXMA 3CMEA 2JA7B 1F2ZA 3CQZB 1UE5A 2EY5A 1B3AA 2R7ZB 5IYDH 5M5XH 4V0BA 3A8JE 4Q0FA 3BVZA 1YI2A 2IPKD 1SYBA 4K5XA 1PZJD 3F1ZA 2C9OA 4P75A 4QQBX 1K0RA 1FGBD 1RTOA 2K05A 1UE6A 3J80L 4DV1Q 2YYZA 4GN4B 2XN9C 2VS1A 2JXMB 2E2HH 4A3IB 4RCNA 3VR4A 4C56C 1YBYA 4JI4L 5I2XA 2PYKA 1LACA 3OPOA 1E3PA 3EBEA 1SAPA 2NUCA 5M3MH 5IY0A 2PMZB 5KNBA 1FNWA 2F0TA 4QIWE 2E5LL 3M4PA 3S1RH 1IKMA 1VF5C 2NTTA 1SNOA 4R4OA 1ENAA 2RDFA 4KN7C 1STGA 1JCKB 3I73A 4DK6C 3E0EA 3H6MA 1HTLD 4LWCA 1SJHD 1Q46A 3I4MG 3U50C 4HCSA 4FXGC 4KY6A 1OTCA 5C0XI 2WB1G 4KTAA 2UU9Q 3S2HB 1PTOF 4FO2A 4X62Q 3CCQA 2EYFA 3JAMi 1X54A 1X6OA 2XRSD 4LFBQ 3DWAA 1Y1VG 4A76A 1JWUD 2K5QA 4JI4Q 4H0LC 1LT6D 2P5ZX 3W1GA 4HIMA 3I2ZA 4DR5L 4IURA 3TQYA 1WTRA 3AFPA 2DNCA 1STYA 1EWIA 3K58A 4LF8L 1JOKA 1R9TH 4A3GH 1SMYD 3P1HA 1TWCH 3SHLA 2CHBD 1JORA 2JA7G 3E3XA 4V190 4PMBA 4RGMA 4A3DB 1A3UA 1P8LA 2UUAQ 1RL2A 3QO2A 1WVLA 2B8FA 2RQXA 1BCPD 5HGQA 1U0LA 2RHQB 4O42A 1TR5A 3JC66 2F0IA 1V1QA 2QEXA 5C0XG 1B8AA 5CYUA 1XMQL 2KBNA 1D8LA 1F2MA 1VQ5A 3J7AV 2H1EA 1V1PA 2KCTA 4B9XA 4ZK9B 1Z6HA 1VQMA 1EY7A 3RZDB 1TS5A 3DLLA 2F0PA 4ZYSA 4GKJL 2AMCB 1YNND 4TQUS 4YWKA 5GAHC 1PRTF 3MXUA 4C3IG 2AKWB 4B3TQ 5CBAE 2B2WC 4JBKA 3J81i 1F9RA 2RSNA 3LGJA 1O78A 3U9SA 3BVGA 3LWUA 4LUVA 3UDGA 1GUSA 1PH4A 2OCEA 3NSWA 5IP9G 3S1NB 1N32Q 5IYBG 4IQZA 1S5BD 3K80C 2Z4IA 5FOBB 1WCMG 3I4OA 2FFKB 3CRLC 4UHVA 2Q8TA 5C44H 4KHZA 1ASYA 3K5MA 1YJWA 1V1OA 4IUPA 4ZLTF 3I72A 5T1IA 1U4PA 2VB3X 3RNUA 4LUOA 1I5FA 2D5DA 1NNXA 1R4PB 2WKDA 1CQVA 4A4IA 5IYDG 3S17B 3CRKC 1FNVA 1DZ1A 3U4VA 1QNKA 2UXDL 1PTOB 4APVA 4BBSH 4JVZA 1Y1VB 2XSCA 3CW2C 3A7LA 3X3MA 5HGTA 1PYBA 2YTYA 1SYGA 3ERSX 2RSOA 3V05A 4GOPB 2L9HA 3UDIA 4XYOA 2AWOA 3HP3A 4DXGA 1VQAA 2GN5A 5E1FA 4DAPA 2BDOA 3R8BA 1S4ZA 2VQEQ 1G2SA 3T1HQ 1Q1EA 4XTCS 1HUNA 4M1UB 4O2DA 4DV7Q 1GUWA 1AZQA 4JV5L 3NELA 2SEBD 2ZJQA 4KLKA 3R2IA 1F2LA 2A74C 3MXNB 3PIO3 4HMIA 3KUPA 5ELCA 5FLMH 4CBVA 1ZXTA 5M3MG 2OQ0A 2J4XA 4P2CB 1DONA 1VMPA 4CJ1B 2UXBQ 1HCZA 4B3RL 1IBML 3S1RB 2KJXA 2RDGA 2JA6B 2F0SA 1SMYC 2FMCA 3M7NA 3OTOQ 3J7ZC 4LJZC 2XGTA 4NW2A 1JE4A 4A3IH 1CA5A 5CORA 1BKBA 1EEFD 3RD4A 3SEBA 4K14A 2X69A 5EKLA 3T53B 3CC2A 2PQAA 1EOVA 1K8AC 1G8ZD 2G9DA 4PQXA 4A3EB 3CMAA 5DNFA 2Z4HA 2DJGC 1R4QB 2IT1A 1Y8PB 3D31A 1E0BA 2N88A 1STHA 5A2QL 5FJ8H 1VQHA 3PUWA 4J15A 2DUDA 4DNTB 2L5TA 5IOCA 3HOZH 2AQ1B 1STNA 1AH9A 4LW1A 4POFA 1BBWA 3C3LA 2RCNA 2NBFA 1VQCA 1OXVA 4XDXA 1CK1A 3NE5B 5AJ3L 1SR3A 1N33L 5HY6A 1XWEA 3I70A 3LX0A 1PRTC 4XT1B 5M3FH 4DV0Q 3BZCA 3PF5A 1CKNB 1G291 5C4JH 4WJWA 2Y0SG 2RBMA 4GKKL 3FKIH 1SJED 1G6PA 1NMGA 3KFUA 4F8MA 2ZTCA 3E9IA 4MTKA 4GN3B 4LFAQ 1FVIA 2L0CA 4OXPA 3SE0A 2KVMA 4LMQD 3BJUA 1Z9FA 3QOJA 4L6TB 4R4CA 2K5NA 3G6EA 3K7AB 1CI3M 1U4RA 5IWAL 1BNZA 2K28A 2R92H 4P71A 1PH7A 4QF4A 1MGSA 1S5ED 2F0FA 5FLXc 4IALA 4ME3A 3HZXA 5DM63 1QJOA 2F0GA 2ZM6Q 1EWCA 2D2CC 2J7ZA 5JEAH 2ZM6L 4HIOA 3VR3A 1TWAB 4OGQC 2A6ED 4R8NA 2NYZD 4GNXB 4JOIA 3NUCA 3TP5A 2VZAA 4BBSG 4NXML 2HCIA 1JJCB 3D6WA 3G6JB 1EQQA 3I4MB 2MP1A 5EKKA 2R6GA 2ZXPA 3PCOB 1LT5D 2I5MX 2JA8G 4C3IB 1L0XB 3BDLA 2X6LA 3L2PA 3H94A 4F7XA 3S1QB 4A3JH 2WAQG 4LF4Q 4KJNA 1K9MC 3PO2H 1IYUA 1JB3A 1T5EA 4G4KA 1PZID 2BOSA 1SEBD 1IBLL 4QY7A 1K28A 4AQYL 4EVOA 4ILWA 3PIP3 5CV7A 5L37A 5GADC 5K36G 2KA7A 4A3MH 1VS0A 4LF7Q 1N8RC 1SMXA 1PVOA 1DM0B 1B1ZA 3H0GB 2E2IB 2F0MA 1BCPC 2ICIA 3BYTB 4NXNQ 4MIUA 3H3VH 5KYLA 2OQKA 5IP7G 3GTKB 3M7GA 5AJ3Q 3NQTA 3KLSX 1BBXC 4A3MB 4HSVA 2NVQH 1X3PA 5KGUA 3KF6B 2B2UC 1S40A 3GD7A 4A93H 4DUYQ 4GNXA 4LF7L 3QB3A 3KOJA 5FO7B 1I50B 4AYBE 4JBJA 1G91A 4AH6A 2KEEA 4DV2L 4IUNA 1LM0A 2UXCQ 1XPOA 3I8ZA 3HOXB 2MPMA 3J80i 2YV5A 2ZXOA 1ESFA 1EYCA 2HQLA 4K5VA 5H1SE 2O5IC 4DFAA 3S1QH 5J1ZA 2JN4A 5C4HA 1D6EC 5D14A 1SFOH 3PGZA 4KY5A 1JICA 3PSIA 4C3IH 2EYHA 1DJRD 1TS2A 1I6VC 2B39A 4RH6A 2NVYH 1TWAH 1QVGA 1HHVA 3A54A 1KLUD 3STBD 4DUYL 1B4OA 4NPSA 3VDYA 1MSHA 2WINB 3CAMA 3A8IE 5KNCA 1KRTA 1X3QA 3AEVA 2K4KA 5IT9E 1ENCA 3K7AH 1QWYA 2MGSA 2ZT9C 4LNQA 5C4XG 5ELDA 4YHHL 5LMNQ 1TY2A 4HAEA 3OSOA 1KAAA 4ZUIA 3BDOA 1X3FA 3PO2G 2IWHA 5IT9L 2BDNA 3ER0A 1N33Q 1HNXQ 2HIXA 2JA8B 2J0TD 2MO0A 1KRSA 4HJ8A 1KAWA 2G5DA 1Y14B 2PQAB 4JPBW 4RCOA 3NPPA 1A6XA 4IZ8A 3ZYYX 2WAQB 1EQTA 2D62A 1DCZA 1PH8A 4DR1Q 1BOSA 4JI7Q 3T56B 3RN2A 1XNRL 5EQ0A 4HJ7A 4OO1H 1EY6A 2F4VQ 3HOYH 4B3ML 1HZ9A 1KNAA 4JYAL 3ERQA 1A3VA 4I65A 4NMZA 2DY8A 4DK0A 1T9HA 4L8JA 1YIJA 3K0YA 3L9AX 3R93A 1AP0A
chains in the Genus database with same CATH topology
3PUYA 1WFQA 3S24A 4LWCA 3CCSA 4LF6L 1Q46A 1YJNA 3BU2A 3I4MG 3U50C 1OTCA 1C0AA 3HOWH 5C0XI 1XPRA 2WB1G 2UU9Q 4NXNL 2D0OA 4X62Q 1Z47A 3CCQA 2H5XA 4DR3Q 3JAMi 1X54A 1TWGH 1X6OA 5IP9H 4LFBQ 2MO1A 1Y1VG 4A76A 2ATWA 4DR7L 3M4QA 4JI4Q 4MNOA 2E2JH 2GVBA 3W1GA 4HIMA 1SRUA 5LMUL 4IOCA 2K50A 3I2ZA 4O0AA 4YY3Q 3F2CA 4DV6L 3TEHB 1XMOQ 4DR5L 3PUXA 2ASBA 3TQYA 1M90C 1MKHA 2KHJA 4UP9A 2VQFQ 2B63G 3STBC 4KHPQ 3NEMA 3AFPA 1EWIA 3KDFB 4LF8L 2YTVA 3F2DA 1VQPA 1R9TH 4JCVE 4A3GH 3T1YL 4LF9L 1TWCH 4B3SQ 1PH3A 1U5KA 4JI1L 2JA7G 4LF9Q 1P8LA 2UUAQ 4OWWB 5C4XH 1Y1VH 1RL2A 3J81j 3H15A 4IJHA 2QA4A 3I4NG 5HGQA 3HKSA 1U0LA 4B3RQ 1HNZQ 2RHQB 1KC8C 2B3GA 3JC66 1V1QA 2QEXA 4ALPA 2RHSB 5C0XG 4MTNA 2ES2A 3RN5A 2HT1A 1B8AA 1XMQL 2A19A 2KBNA 1D8LA 2WAQE 1VQIA 4LUZA 1VQ5A 4JI0Q 2MFIA 4A3BG 3M4OH 2KCTA 1IZ6A 2Y0SE 1I94L 4LF4L 3AYHB 1PH5A 2VUMG 2PI2E 2WP8J 2JA5H 1VQMA 1X3EA 1VQ8A 1W3SA 1PV4A 3PO3H 2CFMA 2NN6G 3A5UA 3I56A 3DLLA 4DV0L 1HR0W 4GKJL 2AMCB 4TQUS 1Q1BA 4A3BH 4YWKA 1CKNA 2Q2UA 5GAHC 3CD6A 2AKWB 4AQYQ 4B3TQ 4X62L 4JBKA 3J81i 5GAEC 2B63H 3HOYG 2YTXA 5ELOA 3JAMc 2K5VA 2CQOA 4LF8Q 1WCMH 3LGJA 1HZAA 3WWVA 3M85A 2EXDA 1UE7A 4LUVA 1NTGA 1VQ6A 1I50H 4X66Q 3UDGA 4UPAA 4OWTB 3EIVA 1W2BA 2OCEA 4DR5Q 5IP9G 1PH4A 1JJ2A 5IYBG 3U58A 1N32Q 1PFSA 2NVTH 3K80C 4BBRH 3A74A 4RMFA 4DPGA 1WCMG 3I4OA 1VQEA 3Q8DA 5C44H 2HHHL 4KHZA 1NY4A 4OONA 4A3EG 1ASYA 1C9OA 5JJKA 1YJWA 4LFCL 2R93H 3K8AA 1QVFA 4GN5A 4GOPA 2BH2A 4A3FH 3RNUA 4LUOA 2V1CC 3L7ZC 1I5FA 1QUQB 3PIOA 1L1OC 1MJCA 4A4IA 5GROA 3I7FA 5IYDG 3CPWA 2Q2TA 3GTKH 3U4VA 1QZGA 4IOAA 2UXDL 4APVA 4BBSH 2VUMH 4IFDJ 3CW2C 1VQLA 1NBWA 3UE1A 1IL2A 3HOVG 4JOIC 3OTOL 1VQJA 1PYBA 4IPCA 2YTYA 3UE0A 4DV4L 4HIKA 4L5TA 3H0GH 3HOWG 3ERSX 2LSSA 4GOPB 3UDIA 1S72A 2BA0A 4OO1G 2AWOA 2E8GA 2L15A 1VQAA 3ULLA 2GN5A 2ZJRA 2K75A 4A3LH 1NMFA 1NE3A 5JEAJ 2JQOA 1HNWQ 2MQHA 3HOVH 2VQEQ 3T1HQ 2Z0SA 4C2MH 1Q1EA 4XTCS 3PF4A 4O2DA 4DV7Q 4A3KG 1XNQQ 1PH9A 3S16H 3TS0A 4JI5Q 4JV5L 4X65L 3NELA 4A3CH 2UUBQ 2ZJQA 4HJ9A 4KLKA 4PZ7A 1X3GA 3M9BA 2NZHA 4R4IA 2IX1A 4JI3L 3HKZG 3MXNB 1VQBA 2MNAA 3SGIA 3KLWA 4AIMA 4HJ5A 1PH2A 3HKZE 4X64L 5FLMH 1LTLA 1X55A 2JA9A 4DNIA 3CCJA 1V43A 3EN2A 4L5SA 2OTJA 5M3MG 5ELNA 2OQ0A 1HJPA 1OXUA 5JJIA 3FKIG 1RIPA 1E7ZA 1OXTA 1D7QA 1I3QH 2UXBQ 1B70B 4JI5L 4BY7G 2QGQA 1IBML 2UU9L 4B3RL 2BH8A 1K73C 1Q8KA 2I5LX 4DV4Q 2VL6A 2ID0A 1NJIC 4JI7L 5LMNL 1K3RA 4IJLA 3GTGH 5M3FG 4L5QA 3K81C 1TXYA 3AQQA 3M7NA 3OTOQ 3J7ZC 1FJGQ 4K0KL 5JJLA 3I4MH 4OO1I 2XGTA 4WJ3M 3I55A 5M5YH 1UEBA 3KF6A 4GLAC 3U4ZA 1FJGL 4K0KQ 2UXDQ 1SROA 4A3IH 1UWVA 4A93G 4YY3L 1XMOL 3S2HH 1PA6A 1BKBA 1PHJA 2Q2HA 1YHAA 3CC2A 4C3HH 2JA5G 2PQAA 4GKJQ 1EOVA 1G51A 1EUJA 1WYDA 1K8AC 3GTOH 4LFBL 2IHFA 3J81c 1KIXA 4GLXA 4YCVA 4YHHQ 3CMAA 4DV2Q 1VQ9A 4JBWA 4P72A 1WI5A 3TREA 2UXCL 4IFDG 5GAGC 4DV1L 1YJ9A 3CC7A 1JMCA 1VQNA 2IT1A 3G48A 3D31A 1VQGA 1J5EL 5FJ8H 1VQHA 3PUWA 4J15A 2DUDA 1KQSA 4X6AH 2N8NA 1HNZL 3GTJH 4GNXC 3HOZH 4JI6Q 2CCZA 1CSQA 2R7ZH 1AH9A 1WOCA 2KHIA 4H02A 1BBWA 4LW1A 4RG1A 4POFA 4DR4L 2RCNA 1HNWL 1VQCA 1IBMQ 1X9NA 1L2FA 1OXVA 3FP9A 2JA7H 4JI8L 4DV3L 3ZJYC 3KJPA 3GTPH 3RLNA 4GS3A 5AJ3L 4A3GG 1BBUA 1SR3A 1N33L 1GKHA 5HY6A 4EX5A 2F3IA 1EIFA 2A1AA 3OYYA 4DV3Q 5M3FH 4NXMQ 4DV0Q 3BZCA 2Q2IA 1CKNB 4MZ9A 3PF5A 1G291 1XJVA 3J7A5 1DGSA 1XMQQ 3S17H 4BXXH 3W1BA 5C4JH 4JI6L 2Y0SG 1N9WA 2ZTDA 2CWAA 4YCUA 4GKKL 3FKIH 2PMZE 3RR5A 1N36L 1G6PA 1NMGA 3KFUA 2ZTCA 4UP7A 4PMWA 2N78A 1E24A 1QVCA 3E9IA 1CUKA 4GN3B 4LFAQ 5C3EG 1Q81C 1FVIA 4P73A 1Y1WH 1Q7YC 3CQZH 4OXPA 1VQKA 2Z6KC 2KCMA 5IP7H 4P74A 4A3JG 1VCIA 3PUZA 2PI2A 5BR8L 3BJUA 1Z9FA 4R4CA 2VQEL 3T1HL 4JBMA 2K5NA 5LMNW 5IYCG 4IPDA 3G6EA 2WB1E 3T1YQ 4A3CG 3ICEA 4LF5Q 2JA6G 4FDBA 3NBHB 4DAMA 1H95A 5IWAL 2R92H 1E1OA 4P71A 1PH7A 4R4QA 5FLXc 1I6HH 2JJQA 4XIGS 2B29A 4ME3A 4QJFA 3KJOA 2R7DA 3A0JA 4HJAA 2ZM6Q 1VQOA 4A3LG 1YVCA 1IBKL 4GLVB 2JE6I 3KF8B 4A3MG 1A8VA 1GM5A 4YWMA 4BY1H 3HOUG 3NENA 4PZ6A 2ZM6L 4HIOA 3S1MH 2LXJA 4IPGA 5C3EH 2VQFL 3A5ZB 4JOIA 4GNXB 1PH6A 1N34L 1SN8A 2N49A 5DLQE 2VZAA 4BBSG 4NXML 1JJCB 1EQQA 2NVXH 1K8GA 3G71A 2IY5B 2R6GA 3PCOB 4JG2A 1N34Q 2I5MX 1FGUA 2JA8G 2R92G 1L1OB 5EAYA 1KHIA 3L2PA 3HOXG 2JA6H 1Q12A 3ULJA 2ZJPA 4X66L 3S15H 5IYCH 1EIYB 2ALYB 3FHWA 2AHOB 1JE5A 4JC0A 4A3EH 4A3JH 2WAQG 4UY8C 3M3YH 1A62A 1HZBA 2KENA 4PZ8A 4LF4Q 1YHBA 2NZOA 1Q82C 1K9MC 4DUZL 1GO3E 2ZTEA 5IYBH 2E2IH 3PO2H 3RZOH 1EFWA 3L0OA 1VQ7A 2F4VL 1L0WA 4IO9A 5IWAQ 1QZHA 3GO5A 4DR2L 4QY7A 4HIDA 1IBLL 4Y7NH 3GTLH 3KDFA 1GD7A 4AQYL 1A0IA 1IYJB 2GVAA 4B3TL 1MIUA 2UXBL 1J6QA 5BR8Q 5GADC 2JEAI 4PG3A 5K36G 5FLMG 1WJJA 5JEAG 1MJEA 4A3MH 4OWXB 1VS0A 2A8VA 4LF7Q 2I5HA 4GKKQ 1N8RC 3PO3G 1SMXA 2I0QA 2K52A 1EYGA 1PVOA 4OX9L 3ULPA 4JV5Q 1HZCA 2UUBL 2N3SA 4DAYB 1A63A 4KHPL 2UUAL 4JI3Q 5FJ8G 4DV7L 2OWOA 1XNQL 4NXNQ 1YZ6A 3B6YA 3CC4A 3H3VH 4IFDI 4DR3L 2VNUD 1SLJA 2OQKA 5IT9c 5IP7G 1Q86C 2AWNA 1Y1WG 1XPUA 1V9PA 3CP0A 2HHHQ 5AJ3Q 3KYHC 3F2BA 4BY1G 5IE8A 4IPHA 1LUZA 1YITA 4DUZQ 1XTDA 1CKOA 3IRBA 2NVQH 1L1OA 2UUCQ 2F52A 1ASZA 1S3OA 3K7UC 3S14H 4BXXG 3KF6B 1B7YB 2LXKA 1S40A 3GD7A 1J5EQ 1JT8A 1YEZA 2IHEA 2WFWA 4A3IG 1LYLA 4A93H 1YNXA 4A3FG 4DUYQ 4KI0A 4DKAC 5J3BA 4GNXA 3KOJA 4LF7L 4LFCQ 1FL0A 4AYBE 3W5OA 4JBJA 3AFQA 3CPFA 4AH6A 3CCEA 4DV2L 5C44G 4LF5L 4DR1L 2R7FA 1LM0A 2UXCQ 3HFZB 1XPOA 4POGA 3RLOA 4DR7Q 1HH2P 1E1TA 3GDEA 2YV5A 3J80i 1PYSB 4AYBG 2HQLA 4A3KH 1VQ4A 4R1JA 4JI2Q 1HR0L 1IBLQ 5H1SE 3OW2A 2JA8H 4JI0L 4JYAQ 4UP8A 3TRZA 4BY7H 1OXXK 3S1QH 2EQSA 1N32L 4X64Q 3CCUA 3K0XA 3G4SA 3RZDH 1SFOH 2K14A 3PGZA 3D0FA 3PSIA 1HNXL 2E5LQ 1AE2A 2VY3A 4C3IH 1IBKQ 1KXLA 3HOUH 1SE8A 2CWPA 3RLFA 3CCLA 3BZKA 2OTLA 3CCMA 4A75A 1O7IA 3S1NH 3UDFA 1C7YA 4R4TA 4BA2I 1PH1A 2CKZB 2Z6KA 2NVYH 4B3SL 1TWAH 1X56A 2PNHA 1QVGA 3S2DH 3STBD 3DM3A 5M5WH 3PIPA 4DUYL 3VDYA 4NPSA 3HOZG 2DGYA 3CCVA 1XNRQ 1KL9A 1JJGA 1K83H 2JK8A 3CAMA 2JEBI 1QUQA 2RF4A 4YCWA 4DK3C 4B3MQ 4QL5A 4DR4Q 2NN6I 1KRTA 4LFAL 3H0GG 4DV6Q 4WJ4A 3AEVA 2K4KA 1I94Q 1CKMA 3K7AH 4TVAB 2BA1A 2D0PA 3CCRA 3GTMH 3J80c 1TWFH 3E9HA 2UUCL 3I4NH 4X65Q 3CMEA 4BA1I 5C0XJ 3PV0A 4LNQA 5C4XG 2C35B 3CF5A 4EQ5A 1VQDA 4QGUA 4A3DG 4YHHL 5LMNQ 1GVPA 1UE5A 1AE3A 1IXRA 5IYDH 1KD1C 1E22A 5M5XH 4GOPC 1X3FA 1YI2A 4LF6Q 3PO2G 4DR2Q 1M1KC 4JI8Q 2XTIA 3CXCA 1CSPA 3F1ZA 2R93G 2HIVA 2YU9H 3ER0A 3PUVA 2FXQA 1N33Q 4P75A 1HNXQ 4DR6L 4QQBX 2EIFA 2HIXA 4C3JH 1K0RA 4YWLA 3GTQH 1UE6A 2MO0A 4BBRG 4A3DH 1KRSA 4DV1Q 4HJ8A 1KAWA 2YYZA 4GN4B 3HOXH 3TS2A 1Y14B 2PQAB 2R7ZG 2VS1A 2E2HH 4OX9Q 1N36Q 1YBYA 2D62A 2K5HA 1OXSC 1EQRA 3MEFA 3UDXA 1PH8A 4DR1Q 4JI4L 4JI7Q 3RN2A 4Y52H 1XNRL 4HJ7A 4NB3A 5LMUQ 1E3PA 3HOYH 1BVSA 3EBEA 4B3ML 2F4VQ 5M3MH 3H3VI 1HZ9A 2IX0A 5IY0A 1HR0Q 4JI2L 4JYAL 5GQOA 4JI1Q 5E7NA 1T9HA 2E5LL 4QIWE 3F8TA 1X65A 3M4PA 1UE1A 3S1RH 2VW9A 1VQFA 4L5RC 1JB7A 4DV5L 1P16A 1YIJA 4R4OA 1YHQA 1TWHH 4DR6Q 4DK6C 4DV5Q 3E0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUY A;  1WFQ A;  3S24 A;  4LWC A;  3CCS A;  4LF6 L;  1Q46 A;  1YJN A;  3BU2 A;  3I4M G;  3U50 C;  1OTC A;  1C0A A;  3HOW H;  5C0X I;  1XPR A;  2WB1 G;  2UU9 Q;  4NXN L;  2D0O A;  4X62 Q;  1Z47 A;  3CCQ A;  2H5X A;  4DR3 Q;  3JAM i;  1X54 A;  1TWG H;  1X6O A;  5IP9 H;  4LFB Q;  2MO1 A;  1Y1V G;  4A76 A;  2ATW A;  4DR7 L;  3M4Q A;  4JI4 Q;  4MNO A;  2E2J H;  2GVB A;  3W1G A;  4HIM A;  1SRU A;  5LMU L;  4IOC A;  2K50 A;  3I2Z A;  4O0A A;  4YY3 Q;  3F2C A;  4DV6 L;  3TEH B;  1XMO Q;  4DR5 L;  3PUX A;  2ASB A;  3TQY A;  1M90 C;  1MKH A;  2KHJ A;  4UP9 A;  2VQF Q;  2B63 G;  3STB C;  4KHP Q;  3NEM A;  3AFP A;  1EWI A;  3KDF B;  4LF8 L;  2YTV A;  3F2D A;  1VQP A;  1R9T H;  4JCV E;  4A3G H;  3T1Y L;  4LF9 L;  1TWC H;  4B3S Q;  1PH3 A;  1U5K A;  4JI1 L;  2JA7 G;  4LF9 Q;  1P8L A;  2UUA Q;  4OWW B;  5C4X H;  1Y1V H;  1RL2 A;  3J81 j;  3H15 A;  4IJH A;  2QA4 A;  3I4N G;  5HGQ A;  3HKS A;  1U0L A;  4B3R Q;  1HNZ Q;  2RHQ B;  1KC8 C;  2B3G A;  3JC6 6;  1V1Q A;  2QEX A;  4ALP A;  2RHS B;  5C0X G;  4MTN A;  2ES2 A;  3RN5 A;  2HT1 A;  1B8A A;  1XMQ L;  2A19 A;  2KBN A;  1D8L A;  2WAQ E;  1VQI A;  4LUZ A;  1VQ5 A;  4JI0 Q;  2MFI A;  4A3B G;  3M4O H;  2KCT A;  1IZ6 A;  2Y0S E;  1I94 L;  4LF4 L;  3AYH B;  1PH5 A;  2VUM G;  2PI2 E;  2WP8 J;  2JA5 H;  1VQM A;  1X3E A;  1VQ8 A;  1W3S A;  1PV4 A;  3PO3 H;  2CFM A;  2NN6 G;  3A5U A;  3I56 A;  3DLL A;  4DV0 L;  1HR0 W;  4GKJ L;  2AMC B;  4TQU S;  1Q1B A;  4A3B H;  4YWK A;  1CKN A;  2Q2U A;  5GAH C;  3CD6 A;  2AKW B;  4AQY Q;  4B3T Q;  4X62 L;  4JBK A;  3J81 i;  5GAE C;  2B63 H;  3HOY G;  2YTX A;  5ELO A;  3JAM c;  2K5V A;  2CQO A;  4LF8 Q;  1WCM H;  3LGJ A;  1HZA A;  3WWV A;  3M85 A;  2EXD A;  1UE7 A;  4LUV A;  1NTG A;  1VQ6 A;  1I50 H;  4X66 Q;  3UDG A;  4UPA A;  4OWT B;  3EIV A;  1W2B A;  2OCE A;  4DR5 Q;  5IP9 G;  1PH4 A;  1JJ2 A;  5IYB G;  3U58 A;  1N32 Q;  1PFS A;  2NVT H;  3K80 C;  4BBR H;  3A74 A;  4RMF A;  4DPG A;  1WCM G;  3I4O A;  1VQE A;  3Q8D A;  5C44 H;  2HHH L;  4KHZ A;  1NY4 A;  4OON A;  4A3E G;  1ASY A;  1C9O A;  5JJK A;  1YJW A;  4LFC L;  2R93 H;  3K8A A;  1QVF A;  4GN5 A;  4GOP A;  2BH2 A;  4A3F H;  3RNU A;  4LUO A;  2V1C C;  3L7Z C;  1I5F A;  1QUQ B;  3PIO A;  1L1O C;  1MJC A;  4A4I A;  5GRO A;  3I7F A;  5IYD G;  3CPW A;  2Q2T A;  3GTK H;  3U4V A;  1QZG A;  4IOA A;  2UXD L;  4APV A;  4BBS H;  2VUM H;  4IFD J;  3CW2 C;  1VQL A;  1NBW A;  3UE1 A;  1IL2 A;  3HOV G;  4JOI C;  3OTO L;  1VQJ A;  1PYB A;  4IPC A;  2YTY A;  3UE0 A;  4DV4 L;  4HIK A;  4L5T A;  3H0G H;  3HOW G;  3ERS X;  2LSS A;  4GOP B;  3UDI A;  1S72 A;  2BA0 A;  4OO1 G;  2AWO A;  2E8G A;  2L15 A;  1VQA A;  3ULL A;  2GN5 A;  2ZJR A;  2K75 A;  4A3L H;  1NMF A;  1NE3 A;  5JEA J;  2JQO A;  1HNW Q;  2MQH A;  3HOV H;  2VQE Q;  3T1H Q;  2Z0S A;  4C2M H;  1Q1E A;  4XTC S;  3PF4 A;  4O2D A;  4DV7 Q;  4A3K G;  1XNQ Q;  1PH9 A;  3S16 H;  3TS0 A;  4JI5 Q;  4JV5 L;  4X65 L;  3NEL A;  4A3C H;  2UUB Q;  2ZJQ A;  4HJ9 A;  4KLK A;  4PZ7 A;  1X3G A;  3M9B A;  2NZH A;  4R4I A;  2IX1 A;  4JI3 L;  3HKZ G;  3MXN B;  1VQB A;  2MNA A;  3SGI A;  3KLW A;  4AIM A;  4HJ5 A;  1PH2 A;  3HKZ E;  4X64 L;  5FLM H;  1LTL A;  1X55 A;  2JA9 A;  4DNI A;  3CCJ A;  1V43 A;  3EN2 A;  4L5S A;  2OTJ A;  5M3M G;  5ELN A;  2OQ0 A;  1HJP A;  1OXU A;  5JJI A;  3FKI G;  1RIP A;  1E7Z A;  1OXT A;  1D7Q A;  1I3Q H;  2UXB Q;  1B70 B;  4JI5 L;  4BY7 G;  2QGQ A;  1IBM L;  2UU9 L;  4B3R L;  2BH8 A;  1K73 C;  1Q8K A;  2I5L X;  4DV4 Q;  2VL6 A;  2ID0 A;  1NJI C;  4JI7 L;  5LMN L;  1K3R A;  4IJL A;  3GTG H;  5M3F G;  4L5Q A;  3K81 C;  1TXY A;  3AQQ A;  3M7N A;  3OTO Q;  3J7Z C;  1FJG Q;  4K0K L;  5JJL A;  3I4M H;  4OO1 I;  2XGT A;  4WJ3 M;  3I55 A;  5M5Y H;  1UEB A;  3KF6 A;  4GLA C;  3U4Z A;  1FJG L;  4K0K Q;  2UXD Q;  1SRO A;  4A3I H;  1UWV A;  4A93 G;  4YY3 L;  1XMO L;  3S2H H;  1PA6 A;  1BKB A;  1PHJ A;  2Q2H A;  1YHA A;  3CC2 A;  4C3H H;  2JA5 G;  2PQA A;  4GKJ Q;  1EOV A;  1G51 A;  1EUJ A;  1WYD A;  1K8A C;  3GTO H;  4LFB L;  2IHF A;  3J81 c;  1KIX A;  4GLX A;  4YCV A;  4YHH Q;  3CMA A;  4DV2 Q;  1VQ9 A;  4JBW A;  4P72 A;  1WI5 A;  3TRE A;  2UXC L;  4IFD G;  5GAG C;  4DV1 L;  1YJ9 A;  3CC7 A;  1JMC A;  1VQN A;  2IT1 A;  3G48 A;  3D31 A;  1VQG A;  1J5E L;  5FJ8 H;  1VQH A;  3PUW A;  4J15 A;  2DUD A;  1KQS A;  4X6A H;  2N8N A;  1HNZ L;  3GTJ H;  4GNX C;  3HOZ H;  4JI6 Q;  2CCZ A;  1CSQ A;  2R7Z H;  1AH9 A;  1WOC A;  2KHI A;  4H02 A;  1BBW A;  4LW1 A;  4RG1 A;  4POF A;  4DR4 L;  2RCN A;  1HNW L;  1VQC A;  1IBM Q;  1X9N A;  1L2F A;  1OXV A;  3FP9 A;  2JA7 H;  4JI8 L;  4DV3 L;  3ZJY C;  3KJP A;  3GTP H;  3RLN A;  4GS3 A;  5AJ3 L;  4A3G G;  1BBU A;  1SR3 A;  1N33 L;  1GKH A;  5HY6 A;  4EX5 A;  2F3I A;  1EIF A;  2A1A A;  3OYY A;  4DV3 Q;  5M3F H;  4NXM Q;  4DV0 Q;  3BZC A;  2Q2I A;  1CKN B;  4MZ9 A;  3PF5 A;  1G29 1;  1XJV A;  3J7A 5;  1DGS A;  1XMQ Q;  3S17 H;  4BXX H;  3W1B A;  5C4J H;  4JI6 L;  2Y0S G;  1N9W A;  2ZTD A;  2CWA A;  4YCU A;  4GKK L;  3FKI H;  2PMZ E;  3RR5 A;  1N36 L;  1G6P A;  1NMG A;  3KFU A;  2ZTC A;  4UP7 A;  4PMW A;  2N78 A;  1E24 A;  1QVC A;  3E9I A;  1CUK A;  4GN3 B;  4LFA Q;  5C3E G;  1Q81 C;  1FVI A;  4P73 A;  1Y1W H;  1Q7Y C;  3CQZ H;  4OXP A;  1VQK A;  2Z6K C;  2KCM A;  5IP7 H;  4P74 A;  4A3J G;  1VCI A;  3PUZ A;  2PI2 A;  5BR8 L;  3BJU A;  1Z9F A;  4R4C A;  2VQE L;  3T1H L;  4JBM A;  2K5N A;  5LMN W;  5IYC G;  4IPD A;  3G6E A;  2WB1 E;  3T1Y Q;  4A3C G;  3ICE A;  4LF5 Q;  2JA6 G;  4FDB A;  3NBH B;  4DAM A;  1H95 A;  5IWA L;  2R92 H;  1E1O A;  4P71 A;  1PH7 A;  4R4Q A;  5FLX c;  1I6H H;  2JJQ A;  4XIG S;  2B29 A;  4ME3 A;  4QJF A;  3KJO A;  2R7D A;  3A0J A;  4HJA A;  2ZM6 Q;  1VQO A;  4A3L G;  1YVC A;  1IBK L;  4GLV B;  2JE6 I;  3KF8 B;  4A3M G;  1A8V A;  1GM5 A;  4YWM A;  4BY1 H;  3HOU G;  3NEN A;  4PZ6 A;  2ZM6 L;  4HIO A;  3S1M H;  2LXJ A;  4IPG A;  5C3E H;  2VQF L;  3A5Z B;  4JOI A;  4GNX B;  1PH6 A;  1N34 L;  1SN8 A;  2N49 A;  5DLQ E;  2VZA A;  4BBS G;  4NXM L;  1JJC B;  1EQQ A;  2NVX H;  1K8G A;  3G71 A;  2IY5 B;  2R6G A;  3PCO B;  4JG2 A;  1N34 Q;  2I5M X;  1FGU A;  2JA8 G;  2R92 G;  1L1O B;  5EAY A;  1KHI A;  3L2P A;  3HOX G;  2JA6 H;  1Q12 A;  3ULJ A;  2ZJP A;  4X66 L;  3S15 H;  5IYC H;  1EIY B;  2ALY B;  3FHW A;  2AHO B;  1JE5 A;  4JC0 A;  4A3E H;  4A3J H;  2WAQ G;  4UY8 C;  3M3Y H;  1A62 A;  1HZB A;  2KEN A;  4PZ8 A;  4LF4 Q;  1YHB A;  2NZO A;  1Q82 C;  1K9M C;  4DUZ L;  1GO3 E;  2ZTE A;  5IYB H;  2E2I H;  3PO2 H;  3RZO H;  1EFW A;  3L0O A;  1VQ7 A;  2F4V L;  1L0W A;  4IO9 A;  5IWA Q;  1QZH A;  3GO5 A;  4DR2 L;  4QY7 A;  4HID A;  1IBL L;  4Y7N H;  3GTL H;  3KDF A;  1GD7 A;  4AQY L;  1A0I A;  1IYJ B;  2GVA A;  4B3T L;  1MIU A;  2UXB L;  1J6Q A;  5BR8 Q;  5GAD C;  2JEA I;  4PG3 A;  5K36 G;  5FLM G;  1WJJ A;  5JEA G;  1MJE A;  4A3M H;  4OWX B;  1VS0 A;  2A8V A;  4LF7 Q;  2I5H A;  4GKK Q;  1N8R C;  3PO3 G;  1SMX A;  2I0Q A;  2K52 A;  1EYG A;  1PVO A;  4OX9 L;  3ULP A;  4JV5 Q;  1HZC A;  2UUB L;  2N3S A;  4DAY B;  1A63 A;  4KHP L;  2UUA L;  4JI3 Q;  5FJ8 G;  4DV7 L;  2OWO A;  1XNQ L;  4NXN Q;  1YZ6 A;  3B6Y A;  3CC4 A;  3H3V H;  4IFD I;  4DR3 L;  2VNU D;  1SLJ A;  2OQK A;  5IT9 c;  5IP7 G;  1Q86 C;  2AWN A;  1Y1W G;  1XPU A;  1V9P A;  3CP0 A;  2HHH Q;  5AJ3 Q;  3KYH C;  3F2B A;  4BY1 G;  5IE8 A;  4IPH A;  1LUZ A;  1YIT A;  4DUZ Q;  1XTD A;  1CKO A;  3IRB A;  2NVQ H;  1L1O A;  2UUC Q;  2F52 A;  1ASZ A;  1S3O A;  3K7U C;  3S14 H;  4BXX G;  3KF6 B;  1B7Y B;  2LXK A;  1S40 A;  3GD7 A;  1J5E Q;  1JT8 A;  1YEZ A;  2IHE A;  2WFW A;  4A3I G;  1LYL A;  4A93 H;  1YNX A;  4A3F G;  4DUY Q;  4KI0 A;  4DKA C;  5J3B A;  4GNX A;  3KOJ A;  4LF7 L;  4LFC Q;  1FL0 A;  4AYB E;  3W5O A;  4JBJ A;  3AFQ A;  3CPF A;  4AH6 A;  3CCE A;  4DV2 L;  5C44 G;  4LF5 L;  4DR1 L;  2R7F A;  1LM0 A;  2UXC Q;  3HFZ B;  1XPO A;  4POG A;  3RLO A;  4DR7 Q;  1HH2 P;  1E1T A;  3GDE A;  2YV5 A;  3J80 i;  1PYS B;  4AYB G;  2HQL A;  4A3K H;  1VQ4 A;  4R1J A;  4JI2 Q;  1HR0 L;  1IBL Q;  5H1S E;  3OW2 A;  2JA8 H;  4JI0 L;  4JYA Q;  4UP8 A;  3TRZ A;  4BY7 H;  1OXX K;  3S1Q H;  2EQS A;  1N32 L;  4X64 Q;  3CCU A;  3K0X A;  3G4S A;  3RZD H;  1SFO H;  2K14 A;  3PGZ A;  3D0F A;  3PSI A;  1HNX L;  2E5L Q;  1AE2 A;  2VY3 A;  4C3I H;  1IBK Q;  1KXL A;  3HOU H;  1SE8 A;  2CWP A;  3RLF A;  3CCL A;  3BZK A;  2OTL A;  3CCM A;  4A75 A;  1O7I A;  3S1N H;  3UDF A;  1C7Y A;  4R4T A;  4BA2 I;  1PH1 A;  2CKZ B;  2Z6K A;  2NVY H;  4B3S L;  1TWA H;  1X56 A;  2PNH A;  1QVG A;  3S2D H;  3STB D;  3DM3 A;  5M5W H;  3PIP A;  4DUY L;  3VDY A;  4NPS A;  3HOZ G;  2DGY A;  3CCV A;  1XNR Q;  1KL9 A;  1JJG A;  1K83 H;  2JK8 A;  3CAM A;  2JEB I;  1QUQ A;  2RF4 A;  4YCW A;  4DK3 C;  4B3M Q;  4QL5 A;  4DR4 Q;  2NN6 I;  1KRT A;  4LFA L;  3H0G G;  4DV6 Q;  4WJ4 A;  3AEV A;  2K4K A;  1I94 Q;  1CKM A;  3K7A H;  4TVA B;  2BA1 A;  2D0P A;  3CCR A;  3GTM H;  3J80 c;  1TWF H;  3E9H A;  2UUC L;  3I4N H;  4X65 Q;  3CME A;  4BA1 I;  5C0X J;  3PV0 A;  4LNQ A;  5C4X G;  2C35 B;  3CF5 A;  4EQ5 A;  1VQD A;  4QGU A;  4A3D G;  4YHH L;  5LMN Q;  1GVP A;  1UE5 A;  1AE3 A;  1IXR A;  5IYD H;  1KD1 C;  1E22 A;  5M5X H;  4GOP C;  1X3F A;  1YI2 A;  4LF6 Q;  3PO2 G;  4DR2 Q;  1M1K C;  4JI8 Q;  2XTI A;  3CXC A;  1CSP A;  3F1Z A;  2R93 G;  2HIV A;  2YU9 H;  3ER0 A;  3PUV A;  2FXQ A;  1N33 Q;  4P75 A;  1HNX Q;  4DR6 L;  4QQB X;  2EIF A;  2HIX A;  4C3J H;  1K0R A;  4YWL A;  3GTQ H;  1UE6 A;  2MO0 A;  4BBR G;  4A3D H;  1KRS A;  4DV1 Q;  4HJ8 A;  1KAW A;  2YYZ A;  4GN4 B;  3HOX H;  3TS2 A;  1Y14 B;  2PQA B;  2R7Z G;  2VS1 A;  2E2H H;  4OX9 Q;  1N36 Q;  1YBY A;  2D62 A;  2K5H A;  1OXS C;  1EQR A;  3MEF A;  3UDX A;  1PH8 A;  4DR1 Q;  4JI4 L;  4JI7 Q;  3RN2 A;  4Y52 H;  1XNR L;  4HJ7 A;  4NB3 A;  5LMU Q;  1E3P A;  3HOY H;  1BVS A;  3EBE A;  4B3M L;  2F4V Q;  5M3M H;  3H3V I;  1HZ9 A;  2IX0 A;  5IY0 A;  1HR0 Q;  4JI2 L;  4JYA L;  5GQO A;  4JI1 Q;  5E7N A;  1T9H A;  2E5L L;  4QIW E;  3F8T A;  1X65 A;  3M4P A;  1UE1 A;  3S1R H;  2VW9 A;  1VQF A;  4L5R C;  1JB7 A;  4DV5 L;  1P16 A;  1YIJ A;  4R4O A;  1YHQ A;  1TWH H;  4DR6 Q;  4DK6 C;  4DV5 Q;  3E0E A; 
#chains in the Genus database with same CATH topology
 3S24 A;  1EY8 A;  3CCS A;  1LTA D;  5C0X H;  3CKI B;  4H13 C;  1QCB D;  3HOW H;  1CTM A;  4FNF A;  5C5L A;  2H5X A;  3PMF A;  5EKI A;  4DR3 Q;  5IP9 H;  2ATW A;  1Y8O B;  2A68 C;  1M8A A;  3M4Q A;  2GVB A;  1QE6 A;  2N55 A;  4O0A A;  4YY3 Q;  1XMO Q;  3PUX A;  2IL8 A;  4DNR B;  2ASB A;  2ENB A;  1MKH A;  2KHJ A;  4UP9 A;  3NEM A;  1I4R A;  3VYS A;  5EBC A;  2YTV A;  2NZ1 D;  4JCV E;  1WTO A;  3SK4 A;  1DOK A;  1II3 A;  1RKN A;  1U5K A;  4JI1 L;  1LAB A;  2Z9H A;  3J81 j;  2Q8I B;  3A56 A;  3KLR A;  2QA4 A;  2FJ2 A;  1ZYR C;  1KC8 C;  1HQR D;  1UNS A;  2RHS B;  2ES2 A;  3RN5 A;  4FF1 A;  3AMU A;  4BBR B;  3FMC A;  3M4O H;  1TY0 A;  1IZ6 A;  4F87 A;  3HOU B;  1PH5 A;  1IW7 D;  2VB2 X;  3O13 A;  4R8I A;  2JA5 H;  4ODG A;  1W3S A;  4N8F A;  3FKI B;  4BY1 B;  2XIW A;  5EPK A;  1D5M C;  3CD6 A;  4A3B B;  4X62 L;  4Q5V A;  5M3F B;  2YTX A;  5ELO A;  4K2K A;  1WCM H;  1HZA A;  4N9P A;  2ICE C;  1UE7 A;  2K03 A;  3V96 A;  1NTG A;  1U9R A;  1VQ6 A;  1A15 A;  3Q0A A;  2DY7 A;  4DR5 Q;  1BUV T;  2NVT H;  1EZ6 A;  4RMF A;  4OON A;  5DAU A;  3D3R A;  3H09 A;  1QVF A;  2B2W A;  3R2T A;  2BH2 A;  1EIH A;  3PIO A;  3HEJ A;  1L1O C;  1MJC A;  5FLX E;  5GRO A;  3CPW A;  2E75 C;  1SNM A;  1QZG A;  2EOT A;  2KED A;  4IOA A;  1EYA A;  1E2W A;  1HTP A;  2VUM H;  3UE1 A;  4K8J A;  3VR2 A;  2F0K A;  3OTO L;  1VQJ A;  4QB4 A;  2EE1 A;  3X3N A;  2R61 A;  1C4Q A;  1F2Y A;  1O7L A;  4OO1 G;  4ZCK A;  3GQB A;  4A3L H;  1NMF A;  2JQO A;  1HNW Q;  3C1E A;  2BCO A;  2Z0S A;  4C2M H;  2DNE A;  3NBI A;  4A3K G;  1XNQ Q;  3S16 H;  4JI5 Q;  4X65 L;  2FHT A;  4A3C H;  2UUB Q;  2WAC A;  1BCP F;  4R4I A;  2IX1 A;  4JI3 L;  1TQO A;  1PH2 A;  3SGI A;  4AIM A;  2QDB A;  3WOF A;  1PMR A;  1X55 A;  3CCJ A;  1QG7 A;  1V43 A;  3EN2 A;  5ELN A;  5JJI A;  1E7Z A;  1I3Q H;  1B70 B;  2BH8 A;  1K73 C;  2VL6 A;  5BN3 A;  5LMN L;  3S15 B;  5FO8 B;  3D4W A;  3K81 C;  1TXY A;  1E2Z A;  4K0K L;  4OO1 I;  4WJ3 M;  4GLA C;  3FEW X;  3KF6 A;  3U4Z A;  4K0K Q;  4ZQ3 A;  1SRO A;  2L1B A;  4TRD A;  1UWV A;  4A93 G;  4YY3 L;  1XMO L;  2UXD Q;  1EY9 A;  3S2H H;  1PA6 A;  1SE4 A;  1CQF A;  1CFM A;  2JA5 G;  4LFB L;  4GKJ Q;  1G51 A;  1ILP A;  1EUJ A;  2E74 C;  2HCC A;  3GTQ B;  1Y69 U;  3J81 c;  4BBS B;  1UUP A;  2KEC A;  1I6H B;  1F9S A;  2A6H C;  1FYC A;  3MEH A;  4HSP A;  4KN4 C;  1VQ9 A;  4GZY C;  4JBW A;  1I4X A;  5KIX A;  3TRE A;  1YJ9 A;  4DV1 L;  1VQN A;  1IW7 C;  5F2D A;  2L55 A;  1HFG A;  1J5E L;  5CV5 A;  1KQS A;  4ZRZ A;  3GTJ H;  5C44 B;  4JI6 Q;  1CSQ A;  1WOC A;  2EVB A;  4RG1 A;  4OEM B;  4DR4 L;  4FYD A;  1EEI D;  4JI8 L;  4J1M A;  3GTP H;  1RD9 D;  1QIL A;  4IUQ A;  2E2H B;  3J7Y W;  1GHK A;  4NXM Q;  4MZ9 A;  2Q8R E;  1XMQ Q;  1EY0 A;  2A69 C;  3C2P A;  2XRQ D;  4PMW A;  1E24 A;  1EWH A;  2F0J A;  1CUK A;  5C3E G;  1Q81 C;  1Q7Y C;  4P73 A;  3CQZ H;  1VQK A;  4OL7 A;  2XWJ B;  3PUZ A;  5BR8 L;  2VQE L;  3T1H L;  3BVM A;  4A3C G;  4IPD A;  1K0S A;  3ICE A;  4LF5 Q;  2JA6 G;  4FDB A;  3NBH B;  3DWP A;  5C4J B;  3Q6S A;  1E1O A;  3W2D A;  1BO0 A;  1VQO A;  1YVC A;  1EYD A;  1IBK L;  1W6J A;  2MHV A;  3PQI A;  4A3M G;  4ZKB B;  2RCF A;  2LXJ A;  4IPG A;  5C3E H;  2VQF L;  1SND A;  4H7B A;  1SBB B;  4XXE A;  1SYD A;  1WTX A;  1V1P B;  5CV4 A;  4CDD C;  2IY5 B;  2DN8 A;  3TME A;  5ELF A;  5EAY A;  5IGB A;  5J22 A;  1K3B C;  1EIY B;  2ALY B;  3FHW A;  4RFB A;  4UY8 C;  4JC0 A;  4A3E H;  2F0D A;  4KKS A;  1NCV A;  2SNM A;  3GV6 A;  1T5X D;  1YHB A;  1LTT D;  1SE3 A;  1Q82 C;  2RDH A;  3IKJ A;  4RA8 A;  1AN8 A;  5EGT A;  3KBG A;  3ONA B;  3L0O A;  5IIF A;  5C3W A;  1VQ7 A;  3GO5 A;  3GTL H;  1H9S B;  4B3T L;  3SDZ A;  1MIU A;  2O5J C;  4R9W A;  2QEJ C;  1J6Q A;  1GXD C;  4PG3 A;  2R3Z A;  1WJJ A;  5I6Y A;  1ET6 A;  3HOV B;  2I5H A;  5IGG A;  4TSS A;  1HZC A;  4S3S A;  2N3S A;  4DAY B;  1A63 A;  4CKC A;  4KHP L;  2UUA L;  1VMC A;  5FJ8 G;  4DV7 L;  2KUM A;  3IFT A;  4IFD I;  2VNU D;  1SLJ A;  4O1N A;  1I4Q A;  2WKC A;  2FIN B;  1STA A;  2HHH Q;  1AFP A;  1YIT A;  5T1G A;  2R93 B;  4DUZ Q;  4CJ0 B;  2MJ8 A;  3IRB A;  1NSN S;  2EY6 A;  2F52 A;  4N9T A;  2LXK A;  1LYL A;  2HDL A;  3TZD A;  2JYO A;  1DOL A;  4EQP A;  4DKA C;  4LFC Q;  2LKV A;  1ICW A;  4XT3 B;  5AFW A;  3AFQ A;  1LTG D;  5C44 G;  3TP6 A;  4DR1 L;  4RKL A;  3HFZ B;  5M9O A;  2EPB A;  2PW5 A;  5HUR A;  1SE2 A;  1IBL Q;  2L12 A;  4JYA Q;  4LK1 C;  1OXX K;  1F9P A;  1NAP A;  1N32 L;  4B08 A;  2QDL A;  1E2V A;  1STE A;  5CV8 A;  1HNX L;  2F0V A;  1IBK Q;  1SE8 A;  2CWP A;  4KHV A;  3BZK A;  4G7Z C;  3S1N H;  5G3L D;  3T51 B;  4HTH A;  4R4T A;  5LHY 1;  1PH1 A;  4B3S L;  1SDF A;  1X56 A;  3GTM B;  3PIP A;  3CU7 A;  2F0L A;  1XNR Q;  1KL9 A;  1JJG A;  1K83 H;  4DK3 C;  2JEB I;  4YCW A;  4B3M Q;  1GUO A;  3DXJ C;  4QL5 A;  3SXH A;  1JWM D;  5COY A;  3D8G A;  4LFA L;  3SVM A;  2CVR A;  1D1I A;  4TVA B;  2OXP A;  3J80 c;  3E9H A;  3I4N H;  1BR9 A;  4BA1 I;  5EJW A;  5I9O A;  4EQ5 A;  1VQD A;  2C5C A;  5FO9 B;  3N52 A;  4A3D G;  3FVQ A;  1IXR A;  1KD1 C;  1E22 A;  1CZG A;  4QIW B;  1RTN A;  1DD2 A;  2F0W A;  1CT1 D;  2E2J B;  4JI8 Q;  2XTI A;  2Z6B A;  1WD1 A;  5IGE A;  3KF8 A;  2R93 G;  4DR6 L;  5D65 A;  1G6Z A;  2EIF A;  4C3J H;  4YWL A;  4DGZ A;  1WD0 A;  4BBR G;  4A3D H;  3DM1 A;  2BE5 C;  2R7Z G;  1NR2 A;  4FXK C;  5ELB A;  1CHP D;  2K5H A;  3BDC A;  3ERO A;  1EQR A;  1ML0 D;  1TWH B;  4HCE A;  3MFG A;  3Q23 A;  1BVS A;  4FF3 A;  3H3V I;  2IX0 A;  1HR0 Q;  4JI2 L;  4JI1 Q;  1WTV A;  5E7N A;  2A68 D;  1VQF A;  4OEL B;  1F77 A;  5I4D A;  4Y7N B;  1TWH H;  4C1N I;  4DR6 Q;  2PQE A;  1ZYR D;  3PUY A;  3GTO B;  4LF6 L;  2RA4 A;  1EZ8 A;  4OHJ A;  3BU2 A;  1YJN A;  1C0A A;  1LTS D;  2D0O A;  4NP5 A;  1GUN A;  1TWG H;  5M5Y B;  3TN2 A;  1A2T A;  3DMU A;  1L0Y B;  4MNO A;  2E2J H;  4IOC A;  1SRU A;  2K50 A;  4DV6 L;  3F2C A;  5ELE A;  4C2M B;  3NQI A;  4FP5 D;  3STB C;  2B2U A;  3FPP A;  3F2D A;  1VQP A;  3VYU A;  1PFN A;  4X3T A;  3MHB A;  4XQQ A;  3EA6 A;  1PH3 A;  1H9R A;  2O2L D;  4CGY B;  1XX8 A;  1EIG A;  5C4X H;  4OWW B;  1EFI D;  4I7A A;  4IJH A;  3VR6 A;  5IGC A;  2PO4 A;  2PPB C;  5BN4 A;  2B3G A;  1O7Z A;  4X3S A;  4KMU C;  1EY4 A;  4IFD H;  2A19 A;  1UAP A;  4LUZ A;  1NR4 A;  3KBX A;  5G3L F;  4CDC C;  1DOM A;  3AB9 A;  3AYH B;  2VUM G;  2PI2 E;  4NKL A;  2TSS A;  5FK9 C;  1X3E A;  3PO3 H;  3A5U A;  2NN6 G;  2F0H A;  3I56 A;  3MVV A;  4DV0 L;  2Q2U A;  4K6D A;  4ID6 A;  4H44 C;  2B63 H;  3HOY G;  3BG3 A;  1FD7 D;  3WWV A;  1D2B A;  4X66 Q;  3OMC A;  3S9W A;  4OWT B;  3EIV A;  1W2B A;  3U58 A;  1PFS A;  3SK5 A;  3A74 A;  3Q8D A;  1VQE A;  2V4D A;  4C3J G;  1NY4 A;  4A3E G;  1C9O A;  5JJK A;  2MUY A;  4LFC L;  2R93 H;  2AUJ D;  1F9Q A;  1MSG A;  2JP1 A;  4GOP A;  4A3F H;  1UEA B;  3L7Z C;  3VA7 A;  4DK1 A;  2CQA A;  3I7F A;  4A3K B;  3FPU B;  3HG9 A;  2CW0 C;  1VQL A;  1NBW A;  1IL2 A;  5E3F A;  4RGT A;  1GOZ A;  4DV4 L;  4OIJ A;  1IYV A;  2K5D A;  2EYO A;  2SOB A;  4L5T A;  3J7A F;  3HOW G;  1K8O A;  4EGV A;  1S72 A;  3IFD A;  3K59 A;  4RGO S;  2E8G A;  2ZJR A;  2X6G A;  3GTJ B;  1NE3 A;  5JEA J;  4FVM A;  2MQH A;  3HOV H;  3K5L A;  1HXY D;  3S14 B;  3PF4 A;  4G7O C;  1PH9 A;  5I6W A;  3GTG B;  2WII B;  1B50 A;  4HJ9 A;  3LNN A;  2QCP X;  3OMG A;  3M9B A;  3P75 A;  2LMC B;  3HKZ G;  5CR3 A;  1BXT A;  4KKT A;  3Q22 A;  4X64 L;  1XYI A;  2JA9 A;  4DNI A;  2OTJ A;  2LFN A;  5IOD A;  3U9O A;  1HJP A;  3CHB D;  2EJG C;  3FRP B;  1RIP A;  2I07 B;  3MWY W;  1OXT A;  1HUM A;  3VR5 A;  4IUV A;  3H3V C;  4BY7 G;  2UU9 L;  4DV4 Q;  5FLX L;  1K3R A;  1RDP D;  4IJL A;  5M3F G;  4L5Q A;  1RCV D;  4EQN A;  1EOT A;  3QIA A;  4DF7 A;  3AQQ A;  3GP7 A;  5LL6 X;  4PNY A;  4NDX A;  3I55 A;  1UEB A;  3A8K E;  3UI2 A;  4J6H A;  5D3I B;  1JR0 D;  1PHJ A;  2Q2H A;  1LTI D;  1TKW B;  1YHA A;  5BN5 A;  4C3H H;  2F3V A;  1WYD A;  3J80 E;  3RZO B;  1LT3 D;  4C3J B;  3TDQ A;  4GLX A;  1KIX A;  4YCV A;  5C3X A;  1SNQ A;  4X3U A;  4P72 A;  1WI5 A;  5D3D A;  4IFD G;  5GAG C;  1PLF A;  2OEO A;  2L4N A;  5KRU A;  4X6A H;  2CCZ A;  1O80 A;  2KHI A;  2AQ2 B;  2NVX B;  1HNW L;  2QF7 A;  4J8Q A;  4CDE C;  4CDF C;  2O4X A;  1L2F A;  2KCN A;  4GS3 A;  1ENF A;  4A3G G;  5KND A;  1BBU A;  4EX5 A;  2VUM B;  5CMD A;  2F3I A;  2A1A A;  3A7A B;  3OYY A;  3EVQ A;  4QCL A;  2Q2I A;  3J7A 5;  2XVS A;  1XJV A;  4BXX H;  1IHZ A;  3W1B A;  2ZTD A;  2CWA A;  3NBH A;  4YCU A;  4IN3 A;  1PXU A;  4HR7 B;  2PMZ E;  1N36 L;  3MC0 B;  3ND9 A;  5JOB A;  3MAQ A;  2D9U A;  1Y1W H;  2Z6K C;  2NVT B;  5IP7 H;  4A3J G;  2EDG A;  4UAI A;  2RVL A;  3OHX C;  2PCF B;  5LMN W;  2WB1 E;  4N8X 1;  4DAM A;  1ILQ A;  4F88 A;  1WCM B;  2M2L A;  1D5X C;  1ET9 A;  1WTH A;  2JSO A;  4ABN A;  1I6H H;  2B29 A;  4A3L G;  2R7D A;  3A0J A;  4KD3 A;  2JE6 I;  1Z7T A;  4BY1 H;  3HOU G;  4PZ6 A;  4ULL A;  2FMM A;  3MXG A;  3A55 A;  3W3A A;  1SXT A;  1I4G A;  5JVG 3;  2JA5 B;  3A5Z B;  1SN8 A;  5DLQ E;  2NVX H;  1K8G A;  4A93 B;  3VYR A;  1FGU A;  1L1O B;  1I4H A;  2K5W A;  2F0U A;  3HOX G;  2NVQ B;  3ULJ A;  3K57 A;  2ZJP A;  3S15 H;  5IYC H;  3JAM E;  2NTS A;  1ZEQ X;  1ROD A;  1WTW A;  2AHO B;  3OWF A;  2QIL A;  1I3Q B;  1A62 A;  2B2V C;  2KEN A;  4PZ8 A;  3NTH A;  2F4I A;  4DUZ L;  3LWE A;  4HMJ A;  3WDN A;  5IYB H;  3RZO H;  1EFW A;  5C6A A;  3NHH A;  3ITP A;  2F4V L;  4IO9 A;  2TMP A;  1JOO A;  1KNE A;  1VF7 A;  4HID A;  4DR2 L;  1C48 A;  3KDF A;  3FDT A;  3K5N A;  1A0I A;  1IYJ B;  1SNC A;  5LL6 S;  2UXB L;  2F1M A;  5BR8 Q;  2JEA I;  1RHP A;  4ZKC B;  5JVH 3;  3KLS A;  3TZU A;  4OWX B;  2A8V A;  2B2Y A;  5C4Z A;  1CM9 A;  2K04 A;  2K52 A;  1EYG A;  4OX9 L;  4JV5 Q;  3BZD B;  5EPL A;  3HS0 C;  1RF2 D;  4ME5 A;  4ZAI A;  1IL8 A;  3K6O A;  1XNQ L;  3B6Y A;  4DXF A;  3D4R A;  1H9J A;  1FR3 A;  4DR3 L;  5IT9 c;  5E4X A;  2AWN A;  2F03 A;  2WV6 D;  1XPU A;  1V9P A;  5NUC A;  4WOR A;  3F2B A;  4FXD A;  5IE8 A;  4A3J B;  4M8A A;  1B9N A;  2YU9 B;  1LUZ A;  2PZT A;  2F0Q A;  2OF1 A;  3TBI B;  1LO5 D;  1L1O A;  2UUC Q;  1ASZ A;  2M00 A;  3S14 H;  4YIJ A;  1KDB A;  2K7V A;  1YEZ A;  2WFW A;  1H9K A;  1BF4 A;  3HOY B;  4RHR A;  1FL0 A;  1TWF B;  2EZV A;  4LF5 L;  4Z9C B;  4DR7 Q;  1HRJ A;  1E1T A;  1Y8N B;  2HQE A;  4JI2 Q;  1HR0 L;  5FKA C;  2JA8 H;  4JI0 L;  2B2T C;  4UP8 A;  2M9V A;  1WTQ A;  1TS4 A;  2HUG A;  3CCU A;  3C1F A;  3P7J A;  2E5L Q;  2AUK A;  5CV6 A;  3R3O A;  3I90 A;  1K8M A;  3HOU H;  1PTO D;  2OTL A;  3M4O B;  4A75 A;  1O7I A;  2GA4 B;  2NN6 H;  1C7Y A;  2EYL A;  1XXG A;  2CKZ B;  1PRT B;  2IW3 A;  2PNH A;  4FF2 A;  3S2D H;  4G7H C;  1HA6 A;  2ZXR A;  4BS9 A;  2LY7 A;  2I46 A;  4L63 B;  1Q8I A;  1QUQ A;  4DR4 Q;  2NN6 I;  4JW0 A;  3TP8 A;  5CBE E;  4DV6 Q;  2EY2 A;  3OWE B;  1I94 Q;  1CKM A;  3ND8 A;  3CCR A;  2D0P A;  3K5O A;  1TWF H;  1XTC D;  4KK7 A;  1M4V A;  2C35 B;  3CF5 A;  3HKZ B;  3EQL C;  5KEE A;  4QGU A;  1GVP A;  1AE3 A;  1Y1W B;  1U4L A;  3HOZ B;  4GOP C;  2F0E A;  4LF6 Q;  3OIQ A;  4DR2 Q;  1M1K C;  3CXC A;  1CSP A;  5JJZ A;  1IKL A;  2HIV A;  3QR8 A;  3PUV A;  5CV9 A;  2FXQ A;  2YU9 H;  1KDA A;  1H9M A;  3GTQ H;  3HOW B;  4MHE A;  1B2T A;  3TS2 A;  3HOX H;  2Z1C A;  4OX9 Q;  4U68 A;  1EQV A;  1N36 Q;  1OXS C;  2HDM A;  3GV3 A;  3MEF A;  3UDX A;  4Y52 H;  1TVX A;  3MFY A;  4NB3 A;  5LMU Q;  2A6H D;  5J39 A;  5JPM C;  5GQO A;  4XQJ A;  1B44 D;  4K2L A;  4KJO A;  4BWG B;  3F8T A;  4XQN A;  1X65 A;  1UE1 A;  3I4L A;  2VW9 A;  4L5R C;  4KY7 A;  1JB7 A;  4DV5 L;  1P16 A;  1YHQ A;  1MI2 A;  1OO9 B;  3P20 A;  1TU2 B;  4DV5 Q;  4TKO B;  4OIK A;  1WFQ A;  3NWT A;  1Q3L A;  3MXP A;  2EYM A;  1XPR A;  4K8I A;  4NXN L;  3H91 A;  1Z47 A;  1PYW D;  3S16 B;  2MO1 A;  4DR7 L;  2A5H A;  3Q24 A;  5LMU L;  4CKE A;  3TEH B;  2F0O A;  1M90 C;  4KHP Q;  2B63 G;  2VQF Q;  1J8I A;  1LLR D;  1GJX A;  2KQ3 A;  1BCP B;  1HFN A;  3KDF B;  1PDQ A;  3T1Y L;  4LF9 L;  2IX3 A;  4B3S Q;  1LT4 D;  1S5D D;  4RKB A;  4LF9 Q;  1Y1V H;  1U4M A;  3H15 A;  3I4N G;  3HKS A;  4B3R Q;  1HNZ Q;  1PTO C;  3QG1 A;  4ALP A;  1EU4 A;  2NVY B;  4MTN A;  2EJM A;  2HT1 A;  4LAA A;  2WAQ E;  3D6C A;  1VQI A;  4JI0 Q;  4A3B G;  2MFI A;  3OIP A;  3DHQ A;  2Y0S E;  4U67 3;  1I94 L;  4LF4 L;  1ONL A;  4XYQ A;  4EQO A;  2WP8 J;  1SYE A;  1VQ8 A;  1SFO B;  1PV4 A;  4QUF A;  2CFM A;  4PV1 C;  3I4N B;  5CC4 A;  2XNA C;  1HR0 W;  4DAV A;  1Q1B A;  4A3B H;  3QWN A;  1CKN A;  2EYJ A;  4AQY Q;  1SSO A;  5GAE C;  3JAM c;  2K5V A;  2CQO A;  3T13 A;  3TP7 A;  3BS1 A;  3JAM L;  4LF8 Q;  3MXN A;  5CGK A;  3M85 A;  2EXD A;  3S2D B;  4A3F B;  1I50 H;  4UPA A;  3GTM H;  1JJ2 A;  2H4O A;  2K01 A;  4BBR H;  4DPG A;  2HHH L;  1PFM A;  3G7L A;  3K8A A;  4GN5 A;  4KV6 A;  5I2Y A;  2V1C C;  1G2T A;  1QUQ B;  5E4W C;  2Q2T A;  2EYP A;  3GTK H;  2B63 B;  5JAV A;  4DA2 A;  4IFD J;  2K1B A;  5C5M A;  2KHS A;  1D5Z C;  3HOV G;  4JOI C;  4IPC A;  4HIK A;  2SNS A;  1ESR A;  3UE0 A;  3PO3 B;  1TWC B;  3H0G H;  2LSS A;  1R9T B;  2BA0 A;  3DEO A;  2E2D C;  2L15 A;  5A35 A;  2EY1 A;  3ULL A;  2K75 A;  2OT2 A;  3OW7 A;  1H9S A;  3BYY B;  3NK9 A;  4KD4 A;  3TS0 A;  4RGN A;  2IJ0 A;  4DN4 M;  4MN3 A;  4PZ7 A;  1X3G A;  2NZH A;  3IAY A;  2Y0S B;  4ZUJ A;  1VQB A;  2MNA A;  3KLW A;  4HJ5 A;  1S5F D;  3HKZ E;  2CH4 W;  1LTL A;  2A69 D;  4L5S A;  3N6R A;  1OXU A;  3SR1 A;  4K6L A;  3FKI G;  1KDC A;  1D1K A;  1D7Q A;  4JI5 L;  4CHT B;  2QGQ A;  1A3T A;  4JK1 C;  1Q8K A;  2I5L X;  3E5S A;  2ID0 A;  1NJI C;  4JI7 L;  3GTG H;  3OOC A;  5A2Q E;  2WB1 B;  4WRD A;  1QB5 D;  1BQQ T;  5JJL A;  1FNU A;  1FJG Q;  5DEH A;  3I4M H;  4WFN 3;  1TWG B;  5M5Y H;  5M3M B;  1FJG L;  1A2U A;  2XWB B;  4IUT A;  1NUC A;  4C1N K;  1GHJ A;  3WOE A;  3GTO H;  1RJT A;  2IHF A;  1GUG A;  1LTB D;  1DYQ A;  4YHH Q;  3NTI A;  4DV2 Q;  1ICF B;  2UXC L;  1JMC A;  2SDF A;  3CC7 A;  3G48 A;  4DU9 A;  1VQG A;  3EFX D;  1GUT A;  1TT2 A;  3IL8 A;  1TS3 A;  2N8N A;  3MTS A;  1HNZ L;  1HA5 A;  3NWS A;  4GNX C;  2PZU A;  2K32 A;  5EBD A;  2R7Z H;  3QOL A;  4H02 A;  1Q90 A;  1IBM Q;  1X9N A;  2JA7 H;  3FP9 A;  3RUZ A;  1AW7 A;  2G9H D;  4I7Z C;  4DV3 L;  3ZJY C;  3KJP A;  3RLN A;  1HQM C;  4B9W A;  1GKH A;  2CW0 D;  4G57 A;  1MD2 D;  1EIF A;  4DV3 Q;  1PTO H;  1SYC A;  3S17 H;  1DGS A;  3HRZ C;  1QNU A;  2B2V A;  3I91 A;  3VYT A;  5IGF A;  1N9W A;  4JI6 L;  4KKU A;  1VDZ A;  3RR5 A;  2BE5 D;  5M5W B;  5K5P A;  4UP7 A;  2N78 A;  1V8Q A;  1QVC A;  1AEX A;  3M4Y A;  1MHW C;  1KTK A;  4RWS C;  2KCM A;  4P74 A;  1VCI A;  2PI2 A;  3T4A C;  4JBM A;  5IYC G;  3T1Y Q;  2A73 B;  1H95 A;  4R4Q A;  2EXZ A;  2JJQ A;  4XIG S;  4BY7 B;  4QJF A;  3KJO A;  4HJA A;  1WTP A;  1YNJ D;  5C4X B;  1K83 B;  3M3Y B;  1SNP A;  3E0J A;  4GLV B;  1YNN C;  1EL0 A;  3KF8 B;  1GM5 A;  1A8V A;  1SYF A;  4YWM A;  3NEN A;  2QW7 A;  3S1M H;  3AU7 A;  1PZK D;  3D4D A;  3GTP B;  1N34 L;  2F3W A;  1PH6 A;  2N49 A;  2KOL A;  4C3H G;  3G71 A;  1N34 Q;  4JG2 A;  4AYB B;  2R92 G;  3DEP A;  1KHI A;  2JA6 H;  1Q12 A;  5I9P A;  2L11 A;  4X66 L;  4IUU A;  2F0N A;  1CZW A;  4CJ2 C;  3TSS A;  1JE5 A;  4K5W A;  2B2Y C;  1HZB A;  2K33 A;  3T16 A;  4C3H B;  2NZO A;  2LS0 1;  1GO3 E;  2ZTE A;  2E2I H;  1QOH A;  3KK7 A;  2EJF C;  4A3G B;  1L0W A;  5IWA Q;  1QZH A;  3F2U A;  4Y7N H;  5KYI A;  1GD7 A;  2PNR C;  1TII D;  2GVA A;  1BDO A;  2B2T A;  4E6I A;  1JWS D;  5FLM G;  1JC7 A;  3NP8 A;  4X3K A;  5JEA G;  1MJE A;  1LTR D;  3EJI A;  4QUC A;  4GKK Q;  2A6E C;  2KCC A;  3PO3 G;  1HPC A;  5ISR A;  2I0Q A;  3QJY A;  1PFB A;  3ULP A;  2UUB L;  3PO2 B;  1B9M A;  4JI3 Q;  1X32 A;  3VA5 A;  4UDU C;  2OWO A;  3E6Z X;  1YZ6 A;  3CC4 A;  2AQ3 B;  2CH4 A;  4HED A;  1Q86 C;  1KAB A;  1Y1W G;  5K36 H;  3CP0 A;  1LV9 A;  3KYH C;  4BY1 G;  4IPH A;  1C8C A;  3C46 A;  1XTD A;  1CKO A;  3HGB A;  1S3O A;  3K7U C;  4RHS A;  4BXX G;  1B7Y B;  1JT8 A;  1J5E Q;  2IHE A;  4A3I G;  1YNX A;  4A3F G;  1CHQ D;  4KI0 A;  5J3B A;  3NTK A;  3GTL B;  1S5C D;  5EPJ A;  3V2T A;  3W5O A;  3CPF A;  3CCE A;  5TSS A;  2B8G A;  3S1M B;  2R7F A;  4RAU C;  4DAY A;  4POG A;  3RLO A;  4FF4 A;  3J81 E;  3GDE A;  1HH2 P;  1PYS B;  3DUZ A;  4AYB G;  4A3K H;  5DM7 3;  4R1J A;  1VQ4 A;  1AZP A;  3M3Y H;  2R92 B;  3OW2 A;  1JOQ A;  2RKS A;  2NB0 A;  3TRZ A;  4BY7 H;  3J81 L;  2EQS A;  2K6A A;  3URY A;  4X64 Q;  3K0X A;  3G4S A;  3DWQ A;  3RZD H;  1MBY A;  2K14 A;  1W6K A;  1ZKO A;  3D0F A;  1EU3 A;  3SK8 A;  1AE2 A;  1B3Q A;  2VY3 A;  5M5X B;  1KXL A;  2DJF C;  2VXW A;  3SK6 A;  3CCL A;  3RLF A;  1J9O A;  2NWG A;  3NXW A;  3CCM A;  1EY5 A;  1I4P A;  1JQY D;  3UDF A;  4BA2 I;  2E76 C;  2Z6K A;  1B53 A;  5C3E B;  3MZ5 A;  3DM3 A;  5M5W H;  3HOZ G;  1O7Y A;  2DGY A;  3CCV A;  2PW7 A;  4CKB A;  2JK8 A;  1STB A;  3MA2 B;  2RF4 A;  2QKI C;  2HD3 A;  4QMG A;  5JPN C;  1PRT D;  3H0G G;  4WJ4 A;  2Z8L A;  4PMC A;  3L3O C;  1CA6 A;  2BA1 A;  2PZW A;  2UUC L;  4HN7 A;  1YNJ C;  3I3C A;  1KLG D;  4X65 Q;  5IGD A;  3PV0 A;  3RMH A;  5C0X J;  1DXM A;  3CME A;  2JA7 B;  1F2Z A;  3CQZ B;  1UE5 A;  2EY5 A;  1B3A A;  2R7Z B;  5IYD H;  5M5X H;  4V0B A;  3A8J E;  4Q0F A;  3BVZ A;  1YI2 A;  2IPK D;  1SYB A;  4K5X A;  1PZJ D;  3F1Z A;  2C9O A;  4P75 A;  4QQB X;  1K0R A;  1FGB D;  1RTO A;  2K05 A;  1UE6 A;  3J80 L;  4DV1 Q;  2YYZ A;  4GN4 B;  2XN9 C;  2VS1 A;  2JXM B;  2E2H H;  4A3I B;  4RCN A;  3VR4 A;  4C56 C;  1YBY A;  4JI4 L;  5I2X A;  2PYK A;  1LAC A;  3OPO A;  1E3P A;  3EBE A;  1SAP A;  2NUC A;  5M3M H;  5IY0 A;  2PMZ B;  5KNB A;  1FNW A;  2F0T A;  4QIW E;  2E5L L;  3M4P A;  3S1R H;  1IKM A;  1VF5 C;  2NTT A;  1SNO A;  4R4O A;  1ENA A;  2RDF A;  4KN7 C;  1STG A;  1JCK B;  3I73 A;  4DK6 C;  3E0E A;  3H6M A;  1HTL D;  4LWC A;  1SJH D;  1Q46 A;  3I4M G;  3U50 C;  4HCS A;  4FXG C;  4KY6 A;  1OTC A;  5C0X I;  2WB1 G;  4KTA A;  2UU9 Q;  3S2H B;  1PTO F;  4FO2 A;  4X62 Q;  3CCQ A;  2EYF A;  3JAM i;  1X54 A;  1X6O A;  2XRS D;  4LFB Q;  3DWA A;  1Y1V G;  4A76 A;  1JWU D;  2K5Q A;  4JI4 Q;  4H0L C;  1LT6 D;  2P5Z X;  3W1G A;  4HIM A;  3I2Z A;  4DR5 L;  4IUR A;  3TQY A;  1WTR A;  3AFP A;  2DNC A;  1STY A;  1EWI A;  3K58 A;  4LF8 L;  1JOK A;  1R9T H;  4A3G H;  1SMY D;  3P1H A;  1TWC H;  3SHL A;  2CHB D;  1JOR A;  2JA7 G;  3E3X A;  4V19 0;  4PMB A;  4RGM A;  4A3D B;  1A3U A;  1P8L A;  2UUA Q;  1RL2 A;  3QO2 A;  1WVL A;  2B8F A;  2RQX A;  1BCP D;  5HGQ A;  1U0L A;  2RHQ B;  4O42 A;  1TR5 A;  3JC6 6;  2F0I A;  1V1Q A;  2QEX A;  5C0X G;  1B8A A;  5CYU A;  1XMQ L;  2KBN A;  1D8L A;  1F2M A;  1VQ5 A;  3J7A V;  2H1E A;  1V1P A;  2KCT A;  4B9X A;  4ZK9 B;  1Z6H A;  1VQM A;  1EY7 A;  3RZD B;  1TS5 A;  3DLL A;  2F0P A;  4ZYS A;  4GKJ L;  2AMC B;  1YNN D;  4TQU S;  4YWK A;  5GAH C;  1PRT F;  3MXU A;  4C3I G;  2AKW B;  4B3T Q;  5CBA E;  2B2W C;  4JBK A;  3J81 i;  1F9R A;  2RSN A;  3LGJ A;  1O78 A;  3U9S A;  3BVG A;  3LWU A;  4LUV A;  3UDG A;  1GUS A;  1PH4 A;  2OCE A;  3NSW A;  5IP9 G;  3S1N B;  1N32 Q;  5IYB G;  4IQZ A;  1S5B D;  3K80 C;  2Z4I A;  5FOB B;  1WCM G;  3I4O A;  2FFK B;  3CRL C;  4UHV A;  2Q8T A;  5C44 H;  4KHZ A;  1ASY A;  3K5M A;  1YJW A;  1V1O A;  4IUP A;  4ZLT F;  3I72 A;  5T1I A;  1U4P A;  2VB3 X;  3RNU A;  4LUO A;  1I5F A;  2D5D A;  1NNX A;  1R4P B;  2WKD A;  1CQV A;  4A4I A;  5IYD G;  3S17 B;  3CRK C;  1FNV A;  1DZ1 A;  3U4V A;  1QNK A;  2UXD L;  1PTO B;  4APV A;  4BBS H;  4JVZ A;  1Y1V B;  2XSC A;  3CW2 C;  3A7L A;  3X3M A;  5HGT A;  1PYB A;  2YTY A;  1SYG A;  3ERS X;  2RSO A;  3V05 A;  4GOP B;  2L9H A;  3UDI A;  4XYO A;  2AWO A;  3HP3 A;  4DXG A;  1VQA A;  2GN5 A;  5E1F A;  4DAP A;  2BDO A;  3R8B A;  1S4Z A;  2VQE Q;  1G2S A;  3T1H Q;  1Q1E A;  4XTC S;  1HUN A;  4M1U B;  4O2D A;  4DV7 Q;  1GUW A;  1AZQ A;  4JV5 L;  3NEL A;  2SEB D;  2ZJQ A;  4KLK A;  3R2I A;  1F2L A;  2A74 C;  3MXN B;  3PIO 3;  4HMI A;  3KUP A;  5ELC A;  5FLM H;  4CBV A;  1ZXT A;  5M3M G;  2OQ0 A;  2J4X A;  4P2C B;  1DON A;  1VMP A;  4CJ1 B;  2UXB Q;  1HCZ A;  4B3R L;  1IBM L;  3S1R B;  2KJX A;  2RDG A;  2JA6 B;  2F0S A;  1SMY C;  2FMC A;  3M7N A;  3OTO Q;  3J7Z C;  4LJZ C;  2XGT A;  4NW2 A;  1JE4 A;  4A3I H;  1CA5 A;  5COR A;  1BKB A;  1EEF D;  3RD4 A;  3SEB A;  4K14 A;  2X69 A;  5EKL A;  3T53 B;  3CC2 A;  2PQA A;  1EOV A;  1K8A C;  1G8Z D;  2G9D A;  4PQX A;  4A3E B;  3CMA A;  5DNF A;  2Z4H A;  2DJG C;  1R4Q B;  2IT1 A;  1Y8P B;  3D31 A;  1E0B A;  2N88 A;  1STH A;  5A2Q L;  5FJ8 H;  1VQH A;  3PUW A;  4J15 A;  2DUD A;  4DNT B;  2L5T A;  5IOC A;  3HOZ H;  2AQ1 B;  1STN A;  1AH9 A;  4LW1 A;  4POF A;  1BBW A;  3C3L A;  2RCN A;  2NBF A;  1VQC A;  1OXV A;  4XDX A;  1CK1 A;  3NE5 B;  5AJ3 L;  1SR3 A;  1N33 L;  5HY6 A;  1XWE A;  3I70 A;  3LX0 A;  1PRT C;  4XT1 B;  5M3F H;  4DV0 Q;  3BZC A;  3PF5 A;  1CKN B;  1G29 1;  5C4J H;  4WJW A;  2Y0S G;  2RBM A;  4GKK L;  3FKI H;  1SJE D;  1G6P A;  1NMG A;  3KFU A;  4F8M A;  2ZTC A;  3E9I A;  4MTK A;  4GN3 B;  4LFA Q;  1FVI A;  2L0C A;  4OXP A;  3SE0 A;  2KVM A;  4LMQ D;  3BJU A;  1Z9F A;  3QOJ A;  4L6T B;  4R4C A;  2K5N A;  3G6E A;  3K7A B;  1CI3 M;  1U4R A;  5IWA L;  1BNZ A;  2K28 A;  2R92 H;  4P71 A;  1PH7 A;  4QF4 A;  1MGS A;  1S5E D;  2F0F A;  5FLX c;  4IAL A;  4ME3 A;  3HZX A;  5DM6 3;  1QJO A;  2F0G A;  2ZM6 Q;  1EWC A;  2D2C C;  2J7Z A;  5JEA H;  2ZM6 L;  4HIO A;  3VR3 A;  1TWA B;  4OGQ C;  2A6E D;  4R8N A;  2NYZ D;  4GNX B;  4JOI A;  3NUC A;  3TP5 A;  2VZA A;  4BBS G;  4NXM L;  2HCI A;  1JJC B;  3D6W A;  3G6J B;  1EQQ A;  3I4M B;  2MP1 A;  5EKK A;  2R6G A;  2ZXP A;  3PCO B;  1LT5 D;  2I5M X;  2JA8 G;  4C3I B;  1L0X B;  3BDL A;  2X6L A;  3L2P A;  3H94 A;  4F7X A;  3S1Q B;  4A3J H;  2WAQ G;  4LF4 Q;  4KJN A;  1K9M C;  3PO2 H;  1IYU A;  1JB3 A;  1T5E A;  4G4K A;  1PZI D;  2BOS A;  1SEB D;  1IBL L;  4QY7 A;  1K28 A;  4AQY L;  4EVO A;  4ILW A;  3PIP 3;  5CV7 A;  5L37 A;  5GAD C;  5K36 G;  2KA7 A;  4A3M H;  1VS0 A;  4LF7 Q;  1N8R C;  1SMX A;  1PVO A;  1DM0 B;  1B1Z A;  3H0G B;  2E2I B;  2F0M A;  1BCP C;  2ICI A;  3BYT B;  4NXN Q;  4MIU A;  3H3V H;  5KYL A;  2OQK A;  5IP7 G;  3GTK B;  3M7G A;  5AJ3 Q;  3NQT A;  3KLS X;  1BBX C;  4A3M B;  4HSV A;  2NVQ H;  1X3P A;  5KGU A;  3KF6 B;  2B2U C;  1S40 A;  3GD7 A;  4A93 H;  4DUY Q;  4GNX A;  4LF7 L;  3QB3 A;  3KOJ A;  5FO7 B;  1I50 B;  4AYB E;  4JBJ A;  1G91 A;  4AH6 A;  2KEE A;  4DV2 L;  4IUN A;  1LM0 A;  2UXC Q;  1XPO A;  3I8Z A;  3HOX B;  2MPM A;  3J80 i;  2YV5 A;  2ZXO A;  1ESF A;  1EYC A;  2HQL A;  4K5V A;  5H1S E;  2O5I C;  4DFA A;  3S1Q H;  5J1Z A;  2JN4 A;  5C4H A;  1D6E C;  5D14 A;  1SFO H;  3PGZ A;  4KY5 A;  1JIC A;  3PSI A;  4C3I H;  2EYH A;  1DJR D;  1TS2 A;  1I6V C;  2B39 A;  4RH6 A;  2NVY H;  1TWA H;  1QVG A;  1HHV A;  3A54 A;  1KLU D;  3STB D;  4DUY L;  1B4O A;  4NPS A;  3VDY A;  1MSH A;  2WIN B;  3CAM A;  3A8I E;  5KNC A;  1KRT A;  1X3Q A;  3AEV A;  2K4K A;  5IT9 E;  1ENC A;  3K7A H;  1QWY A;  2MGS A;  2ZT9 C;  4LNQ A;  5C4X G;  5ELD A;  4YHH L;  5LMN Q;  1TY2 A;  4HAE A;  3OSO A;  1KAA A;  4ZUI A;  3BDO A;  1X3F A;  3PO2 G;  2IWH A;  5IT9 L;  2BDN A;  3ER0 A;  1N33 Q;  1HNX Q;  2HIX A;  2JA8 B;  2J0T D;  2MO0 A;  1KRS A;  4HJ8 A;  1KAW A;  2G5D A;  1Y14 B;  2PQA B;  4JPB W;  4RCO A;  3NPP A;  1A6X A;  4IZ8 A;  3ZYY X;  2WAQ B;  1EQT A;  2D62 A;  1DCZ A;  1PH8 A;  4DR1 Q;  1BOS A;  4JI7 Q;  3T56 B;  3RN2 A;  1XNR L;  5EQ0 A;  4HJ7 A;  4OO1 H;  1EY6 A;  2F4V Q;  3HOY H;  4B3M L;  1HZ9 A;  1KNA A;  4JYA L;  3ERQ A;  1A3V A;  4I65 A;  4NMZ A;  2DY8 A;  4DK0 A;  1T9H A;  4L8J A;  1YIJ A;  3K0Y A;  3L9A X;  3R93 A;  1AP0 A; 
#chains in the Genus database with same CATH homology
 3PUY A;  1WFQ A;  3S24 A;  4LWC A;  3CCS A;  4LF6 L;  1Q46 A;  1YJN A;  3BU2 A;  3I4M G;  3U50 C;  1OTC A;  1C0A A;  3HOW H;  5C0X I;  1XPR A;  2WB1 G;  2UU9 Q;  4NXN L;  2D0O A;  4X62 Q;  1Z47 A;  3CCQ A;  2H5X A;  4DR3 Q;  3JAM i;  1X54 A;  1TWG H;  1X6O A;  5IP9 H;  4LFB Q;  2MO1 A;  1Y1V G;  4A76 A;  2ATW A;  4DR7 L;  3M4Q A;  4JI4 Q;  4MNO A;  2E2J H;  2GVB A;  3W1G A;  4HIM A;  1SRU A;  5LMU L;  4IOC A;  2K50 A;  3I2Z A;  4O0A A;  4YY3 Q;  3F2C A;  4DV6 L;  3TEH B;  1XMO Q;  4DR5 L;  3PUX A;  2ASB A;  3TQY A;  1M90 C;  1MKH A;  2KHJ A;  4UP9 A;  2VQF Q;  2B63 G;  3STB C;  4KHP Q;  3NEM A;  3AFP A;  1EWI A;  3KDF B;  4LF8 L;  2YTV A;  3F2D A;  1VQP A;  1R9T H;  4JCV E;  4A3G H;  3T1Y L;  4LF9 L;  1TWC H;  4B3S Q;  1PH3 A;  1U5K A;  4JI1 L;  2JA7 G;  4LF9 Q;  1P8L A;  2UUA Q;  4OWW B;  5C4X H;  1Y1V H;  1RL2 A;  3J81 j;  3H15 A;  4IJH A;  2QA4 A;  3I4N G;  5HGQ A;  3HKS A;  1U0L A;  4B3R Q;  1HNZ Q;  2RHQ B;  1KC8 C;  2B3G A;  3JC6 6;  1V1Q A;  2QEX A;  4ALP A;  2RHS B;  5C0X G;  4MTN A;  2ES2 A;  3RN5 A;  2HT1 A;  1B8A A;  1XMQ L;  2A19 A;  2KBN A;  1D8L A;  2WAQ E;  1VQI A;  4LUZ A;  1VQ5 A;  4JI0 Q;  2MFI A;  4A3B G;  3M4O H;  2KCT A;  1IZ6 A;  2Y0S E;  1I94 L;  4LF4 L;  3AYH B;  1PH5 A;  2VUM G;  2PI2 E;  2WP8 J;  2JA5 H;  1VQM A;  1X3E A;  1VQ8 A;  1W3S A;  1PV4 A;  3PO3 H;  2CFM A;  2NN6 G;  3A5U A;  3I56 A;  3DLL A;  4DV0 L;  1HR0 W;  4GKJ L;  2AMC B;  4TQU S;  1Q1B A;  4A3B H;  4YWK A;  1CKN A;  2Q2U A;  5GAH C;  3CD6 A;  2AKW B;  4AQY Q;  4B3T Q;  4X62 L;  4JBK A;  3J81 i;  5GAE C;  2B63 H;  3HOY G;  2YTX A;  5ELO A;  3JAM c;  2K5V A;  2CQO A;  4LF8 Q;  1WCM H;  3LGJ A;  1HZA A;  3WWV A;  3M85 A;  2EXD A;  1UE7 A;  4LUV A;  1NTG A;  1VQ6 A;  1I50 H;  4X66 Q;  3UDG A;  4UPA A;  4OWT B;  3EIV A;  1W2B A;  2OCE A;  4DR5 Q;  5IP9 G;  1PH4 A;  1JJ2 A;  5IYB G;  3U58 A;  1N32 Q;  1PFS A;  2NVT H;  3K80 C;  4BBR H;  3A74 A;  4RMF A;  4DPG A;  1WCM G;  3I4O A;  1VQE A;  3Q8D A;  5C44 H;  2HHH L;  4KHZ A;  1NY4 A;  4OON A;  4A3E G;  1ASY A;  1C9O A;  5JJK A;  1YJW A;  4LFC L;  2R93 H;  3K8A A;  1QVF A;  4GN5 A;  4GOP A;  2BH2 A;  4A3F H;  3RNU A;  4LUO A;  2V1C C;  3L7Z C;  1I5F A;  1QUQ B;  3PIO A;  1L1O C;  1MJC A;  4A4I A;  5GRO A;  3I7F A;  5IYD G;  3CPW A;  2Q2T A;  3GTK H;  3U4V A;  1QZG A;  4IOA A;  2UXD L;  4APV A;  4BBS H;  2VUM H;  4IFD J;  3CW2 C;  1VQL A;  1NBW A;  3UE1 A;  1IL2 A;  3HOV G;  4JOI C;  3OTO L;  1VQJ A;  1PYB A;  4IPC A;  2YTY A;  3UE0 A;  4DV4 L;  4HIK A;  4L5T A;  3H0G H;  3HOW G;  3ERS X;  2LSS A;  4GOP B;  3UDI A;  1S72 A;  2BA0 A;  4OO1 G;  2AWO A;  2E8G A;  2L15 A;  1VQA A;  3ULL A;  2GN5 A;  2ZJR A;  2K75 A;  4A3L H;  1NMF A;  1NE3 A;  5JEA J;  2JQO A;  1HNW Q;  2MQH A;  3HOV H;  2VQE Q;  3T1H Q;  2Z0S A;  4C2M H;  1Q1E A;  4XTC S;  3PF4 A;  4O2D A;  4DV7 Q;  4A3K G;  1XNQ Q;  1PH9 A;  3S16 H;  3TS0 A;  4JI5 Q;  4JV5 L;  4X65 L;  3NEL A;  4A3C H;  2UUB Q;  2ZJQ A;  4HJ9 A;  4KLK A;  4PZ7 A;  1X3G A;  3M9B A;  2NZH A;  4R4I A;  2IX1 A;  4JI3 L;  3HKZ G;  3MXN B;  1VQB A;  2MNA A;  3SGI A;  3KLW A;  4AIM A;  4HJ5 A;  1PH2 A;  3HKZ E;  4X64 L;  5FLM H;  1LTL A;  1X55 A;  2JA9 A;  4DNI A;  3CCJ A;  1V43 A;  3EN2 A;  4L5S A;  2OTJ A;  5M3M G;  5ELN A;  2OQ0 A;  1HJP A;  1OXU A;  5JJI A;  3FKI G;  1RIP A;  1E7Z A;  1OXT A;  1D7Q A;  1I3Q H;  2UXB Q;  1B70 B;  4JI5 L;  4BY7 G;  2QGQ A;  1IBM L;  2UU9 L;  4B3R L;  2BH8 A;  1K73 C;  1Q8K A;  2I5L X;  4DV4 Q;  2VL6 A;  2ID0 A;  1NJI C;  4JI7 L;  5LMN L;  1K3R A;  4IJL A;  3GTG H;  5M3F G;  4L5Q A;  3K81 C;  1TXY A;  3AQQ A;  3M7N A;  3OTO Q;  3J7Z C;  1FJG Q;  4K0K L;  5JJL A;  3I4M H;  4OO1 I;  2XGT A;  4WJ3 M;  3I55 A;  5M5Y H;  1UEB A;  3KF6 A;  4GLA C;  3U4Z A;  1FJG L;  4K0K Q;  2UXD Q;  1SRO A;  4A3I H;  1UWV A;  4A93 G;  4YY3 L;  1XMO L;  3S2H H;  1PA6 A;  1BKB A;  1PHJ A;  2Q2H A;  1YHA A;  3CC2 A;  4C3H H;  2JA5 G;  2PQA A;  4GKJ Q;  1EOV A;  1G51 A;  1EUJ A;  1WYD A;  1K8A C;  3GTO H;  4LFB L;  2IHF A;  3J81 c;  1KIX A;  4GLX A;  4YCV A;  4YHH Q;  3CMA A;  4DV2 Q;  1VQ9 A;  4JBW A;  4P72 A;  1WI5 A;  3TRE A;  2UXC L;  4IFD G;  5GAG C;  4DV1 L;  1YJ9 A;  3CC7 A;  1JMC A;  1VQN A;  2IT1 A;  3G48 A;  3D31 A;  1VQG A;  1J5E L;  5FJ8 H;  1VQH A;  3PUW A;  4J15 A;  2DUD A;  1KQS A;  4X6A H;  2N8N A;  1HNZ L;  3GTJ H;  4GNX C;  3HOZ H;  4JI6 Q;  2CCZ A;  1CSQ A;  2R7Z H;  1AH9 A;  1WOC A;  2KHI A;  4H02 A;  1BBW A;  4LW1 A;  4RG1 A;  4POF A;  4DR4 L;  2RCN A;  1HNW L;  1VQC A;  1IBM Q;  1X9N A;  1L2F A;  1OXV A;  3FP9 A;  2JA7 H;  4JI8 L;  4DV3 L;  3ZJY C;  3KJP A;  3GTP H;  3RLN A;  4GS3 A;  5AJ3 L;  4A3G G;  1BBU A;  1SR3 A;  1N33 L;  1GKH A;  5HY6 A;  4EX5 A;  2F3I A;  1EIF A;  2A1A A;  3OYY A;  4DV3 Q;  5M3F H;  4NXM Q;  4DV0 Q;  3BZC A;  2Q2I A;  1CKN B;  4MZ9 A;  3PF5 A;  1G29 1;  1XJV A;  3J7A 5;  1DGS A;  1XMQ Q;  3S17 H;  4BXX H;  3W1B A;  5C4J H;  4JI6 L;  2Y0S G;  1N9W A;  2ZTD A;  2CWA A;  4YCU A;  4GKK L;  3FKI H;  2PMZ E;  3RR5 A;  1N36 L;  1G6P A;  1NMG A;  3KFU A;  2ZTC A;  4UP7 A;  4PMW A;  2N78 A;  1E24 A;  1QVC A;  3E9I A;  1CUK A;  4GN3 B;  4LFA Q;  5C3E G;  1Q81 C;  1FVI A;  4P73 A;  1Y1W H;  1Q7Y C;  3CQZ H;  4OXP A;  1VQK A;  2Z6K C;  2KCM A;  5IP7 H;  4P74 A;  4A3J G;  1VCI A;  3PUZ A;  2PI2 A;  5BR8 L;  3BJU A;  1Z9F A;  4R4C A;  2VQE L;  3T1H L;  4JBM A;  2K5N A;  5LMN W;  5IYC G;  4IPD A;  3G6E A;  2WB1 E;  3T1Y Q;  4A3C G;  3ICE A;  4LF5 Q;  2JA6 G;  4FDB A;  3NBH B;  4DAM A;  1H95 A;  5IWA L;  2R92 H;  1E1O A;  4P71 A;  1PH7 A;  4R4Q A;  5FLX c;  1I6H H;  2JJQ A;  4XIG S;  2B29 A;  4ME3 A;  4QJF A;  3KJO A;  2R7D A;  3A0J A;  4HJA A;  2ZM6 Q;  1VQO A;  4A3L G;  1YVC A;  1IBK L;  4GLV B;  2JE6 I;  3KF8 B;  4A3M G;  1A8V A;  1GM5 A;  4YWM A;  4BY1 H;  3HOU G;  3NEN A;  4PZ6 A;  2ZM6 L;  4HIO A;  3S1M H;  2LXJ A;  4IPG A;  5C3E H;  2VQF L;  3A5Z B;  4JOI A;  4GNX B;  1PH6 A;  1N34 L;  1SN8 A;  2N49 A;  5DLQ E;  2VZA A;  4BBS G;  4NXM L;  1JJC B;  1EQQ A;  2NVX H;  1K8G A;  3G71 A;  2IY5 B;  2R6G A;  3PCO B;  4JG2 A;  1N34 Q;  2I5M X;  1FGU A;  2JA8 G;  2R92 G;  1L1O B;  5EAY A;  1KHI A;  3L2P A;  3HOX G;  2JA6 H;  1Q12 A;  3ULJ A;  2ZJP A;  4X66 L;  3S15 H;  5IYC H;  1EIY B;  2ALY B;  3FHW A;  2AHO B;  1JE5 A;  4JC0 A;  4A3E H;  4A3J H;  2WAQ G;  4UY8 C;  3M3Y H;  1A62 A;  1HZB A;  2KEN A;  4PZ8 A;  4LF4 Q;  1YHB A;  2NZO A;  1Q82 C;  1K9M C;  4DUZ L;  1GO3 E;  2ZTE A;  5IYB H;  2E2I H;  3PO2 H;  3RZO H;  1EFW A;  3L0O A;  1VQ7 A;  2F4V L;  1L0W A;  4IO9 A;  5IWA Q;  1QZH A;  3GO5 A;  4DR2 L;  4QY7 A;  4HID A;  1IBL L;  4Y7N H;  3GTL H;  3KDF A;  1GD7 A;  4AQY L;  1A0I A;  1IYJ B;  2GVA A;  4B3T L;  1MIU A;  2UXB L;  1J6Q A;  5BR8 Q;  5GAD C;  2JEA I;  4PG3 A;  5K36 G;  5FLM G;  1WJJ A;  5JEA G;  1MJE A;  4A3M H;  4OWX B;  1VS0 A;  2A8V A;  4LF7 Q;  2I5H A;  4GKK Q;  1N8R C;  3PO3 G;  1SMX A;  2I0Q A;  2K52 A;  1EYG A;  1PVO A;  4OX9 L;  3ULP A;  4JV5 Q;  1HZC A;  2UUB L;  2N3S A;  4DAY B;  1A63 A;  4KHP L;  2UUA L;  4JI3 Q;  5FJ8 G;  4DV7 L;  2OWO A;  1XNQ L;  4NXN Q;  1YZ6 A;  3B6Y A;  3CC4 A;  3H3V H;  4IFD I;  4DR3 L;  2VNU D;  1SLJ A;  2OQK A;  5IT9 c;  5IP7 G;  1Q86 C;  2AWN A;  1Y1W G;  1XPU A;  1V9P A;  3CP0 A;  2HHH Q;  5AJ3 Q;  3KYH C;  3F2B A;  4BY1 G;  5IE8 A;  4IPH A;  1LUZ A;  1YIT A;  4DUZ Q;  1XTD A;  1CKO A;  3IRB A;  2NVQ H;  1L1O A;  2UUC Q;  2F52 A;  1ASZ A;  1S3O A;  3K7U C;  3S14 H;  4BXX G;  3KF6 B;  1B7Y B;  2LXK A;  1S40 A;  3GD7 A;  1J5E Q;  1JT8 A;  1YEZ A;  2IHE A;  2WFW A;  4A3I G;  1LYL A;  4A93 H;  1YNX A;  4A3F G;  4DUY Q;  4KI0 A;  4DKA C;  5J3B A;  4GNX A;  3KOJ A;  4LF7 L;  4LFC Q;  1FL0 A;  4AYB E;  3W5O A;  4JBJ A;  3AFQ A;  3CPF A;  4AH6 A;  3CCE A;  4DV2 L;  5C44 G;  4LF5 L;  4DR1 L;  2R7F A;  1LM0 A;  2UXC Q;  3HFZ B;  1XPO A;  4POG A;  3RLO A;  4DR7 Q;  1HH2 P;  1E1T A;  3GDE A;  2YV5 A;  3J80 i;  1PYS B;  4AYB G;  2HQL A;  4A3K H;  1VQ4 A;  4R1J A;  4JI2 Q;  1HR0 L;  1IBL Q;  5H1S E;  3OW2 A;  2JA8 H;  4JI0 L;  4JYA Q;  4UP8 A;  3TRZ A;  4BY7 H;  1OXX K;  3S1Q H;  2EQS A;  1N32 L;  4X64 Q;  3CCU A;  3K0X A;  3G4S A;  3RZD H;  1SFO H;  2K14 A;  3PGZ A;  3D0F A;  3PSI A;  1HNX L;  2E5L Q;  1AE2 A;  2VY3 A;  4C3I H;  1IBK Q;  1KXL A;  3HOU H;  1SE8 A;  2CWP A;  3RLF A;  3CCL A;  3BZK A;  2OTL A;  3CCM A;  4A75 A;  1O7I A;  3S1N H;  3UDF A;  1C7Y A;  4R4T A;  4BA2 I;  1PH1 A;  2CKZ B;  2Z6K A;  2NVY H;  4B3S L;  1TWA H;  1X56 A;  2PNH A;  1QVG A;  3S2D H;  3STB D;  3DM3 A;  5M5W H;  3PIP A;  4DUY L;  3VDY A;  4NPS A;  3HOZ G;  2DGY A;  3CCV A;  1XNR Q;  1KL9 A;  1JJG A;  1K83 H;  2JK8 A;  3CAM A;  2JEB I;  1QUQ A;  2RF4 A;  4YCW A;  4DK3 C;  4B3M Q;  4QL5 A;  4DR4 Q;  2NN6 I;  1KRT A;  4LFA L;  3H0G G;  4DV6 Q;  4WJ4 A;  3AEV A;  2K4K A;  1I94 Q;  1CKM A;  3K7A H;  4TVA B;  2BA1 A;  2D0P A;  3CCR A;  3GTM H;  3J80 c;  1TWF H;  3E9H A;  2UUC L;  3I4N H;  4X65 Q;  3CME A;  4BA1 I;  5C0X J;  3PV0 A;  4LNQ A;  5C4X G;  2C35 B;  3CF5 A;  4EQ5 A;  1VQD A;  4QGU A;  4A3D G;  4YHH L;  5LMN Q;  1GVP A;  1UE5 A;  1AE3 A;  1IXR A;  5IYD H;  1KD1 C;  1E22 A;  5M5X H;  4GOP C;  1X3F A;  1YI2 A;  4LF6 Q;  3PO2 G;  4DR2 Q;  1M1K C;  4JI8 Q;  2XTI A;  3CXC A;  1CSP A;  3F1Z A;  2R93 G;  2HIV A;  2YU9 H;  3ER0 A;  3PUV A;  2FXQ A;  1N33 Q;  4P75 A;  1HNX Q;  4DR6 L;  4QQB X;  2EIF A;  2HIX A;  4C3J H;  1K0R A;  4YWL A;  3GTQ H;  1UE6 A;  2MO0 A;  4BBR G;  4A3D H;  1KRS A;  4DV1 Q;  4HJ8 A;  1KAW A;  2YYZ A;  4GN4 B;  3HOX H;  3TS2 A;  1Y14 B;  2PQA B;  2R7Z G;  2VS1 A;  2E2H H;  4OX9 Q;  1N36 Q;  1YBY A;  2D62 A;  2K5H A;  1OXS C;  1EQR A;  3MEF A;  3UDX A;  1PH8 A;  4DR1 Q;  4JI4 L;  4JI7 Q;  3RN2 A;  4Y52 H;  1XNR L;  4HJ7 A;  4NB3 A;  5LMU Q;  1E3P A;  3HOY H;  1BVS A;  3EBE A;  4B3M L;  2F4V Q;  5M3M H;  3H3V I;  1HZ9 A;  2IX0 A;  5IY0 A;  1HR0 Q;  4JI2 L;  4JYA L;  5GQO A;  4JI1 Q;  5E7N A;  1T9H A;  2E5L L;  4QIW E;  3F8T A;  1X65 A;  3M4P A;  1UE1 A;  3S1R H;  2VW9 A;  1VQF A;  4L5R C;  1JB7 A;  4DV5 L;  1P16 A;  1YIJ A;  4R4O A;  1YHQ A;  1TWH H;  4DR6 Q;  4DK6 C;  4DV5 Q;  3E0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...