4A75A

The lin28b cold shock domain in complex with hexathymidine.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
89
structure length
89
Chain Sequence
GSDPQVLRGSGHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYMEGFRSLKEGEPVEFTFKKSSKGFESLRVTGPGGNPCLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIN28 COLD SHOCK DOMAIN
publication title The Lin28 Cold-Shock Domain Remodels Pre-Let-7 Microrna.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
molecule tags Chaperone/dna
total genus 18
structure length 89
sequence length 89
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2011-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a75A00
1WYDA 2UXDQ 4KHPL 4OO1G 1N33Q 2F4VQ 3CC2A 1CSQA 2D0PA 3AYHB 1Y14B 3JAMi 2B29A 4HIMA 2E2HH 1YITA 4GOPC 4DV7Q 1KL9A 3PUYA 4IPGA 4JG2A 4MNOA 4R1JA 1SMXA 1K0RA 4YCUA 2I5LX 4ALPA 1XPUA 1YHAA 5M5WH 1XMQQ 1SE8A 1G6PA 1VQJA 5LMNW 1WCMH 4YY3L 4HIDA 4AH6A 2NN6G 5IYBH 4YY3Q 2HIVA 1GD7A 3PUVA 1EFWA 3UE0A 4YHHL 5FJ8H 1JE5A 3K7AH 1G51A 2BA1A 4JC0A 4YHHQ 4A3DG 4OX9L 3HKSA 2ZTCA 1E3PA 2QA4A 4A93H 4AYBE 1VQHA 4GN4B 1I94Q 1E1TA 2V1CC 2QGQA 1LTLA 2CWPA 5C44H 3H3VH 1PA6A 4A3CH 1JJCB 1M90C 4HJ9A 5GAHC 3CCUA 1UEBA 2F3IA 3UE1A 2NZOA 1V1QA 5IP7G 2K75A 3OTOL 3L7ZC 1N36Q 4LF4L 2UXCL 5IWAL 1XMOQ 2D0OA 3K0XA 3U4ZA 2ZTDA 4HJ8A 4A3FH 1JJ2A 4A3JG 4LF4Q 2UXCQ 4QQBX 3J80i 4K0KQ 1PFSA 1PH7A 4LF5L 4DR7Q 4LF5Q 2WAQG 5HGQA 5GAEC 1VQ7A 4A76A 2BH8A 1O7IA 2K5HA 4LNQA 3Q8DA 2AHOB 1Q1EA 2K14A 5GAGC 4EX5A 3U50C 2PQAA 3BU2A 1E1OA 3CCRA 4PZ6A 4JI5L 5M3FH 3EIVA 1GKHA 1NY4A 3D31A 4JI8Q 4A3EH 1KXLA 4JI5Q 4IO9A 4LF8L 3KF6B 1KIXA 2OWOA 2IY5B 4QL5A 4LF8Q 4X6AH 1TWCH 2GVBA 1VQBA 1CKNA 5GROA 3CCQA 1X54A 2I5HA 2JK8A 4JI7L 1VQGA 3IRBA 1WI5A 3KOJA 1J5EL 3M85A 4LF9L 4JI7Q 2R7ZH 4X62Q 2JE6I 4DR4Q 5FLMG 4DV6Q 3S24A 2RCNA 2GN5A 4IOCA 5HY6A 1E7ZA 3EBEA 2UUBL 5C0XI 1VQCA 2Q2UA 1TWFH 2UUBQ 4DR6L 3GDEA 4GLAC 3W1BA 3PF4A 1B70B 2ZTEA 4YCWA 1A62A 1OXUA 1YHQA 5M3MG 2CCZA 2NN6I 2BA0A 2FXQA 4A3CG 5BR8L 1EWIA 2R7FA 2N8NA 4DUZL 1RL2A 4HJ5A 5BR8Q 1PH1A 2LSSA 1AE3A 2Z6KC 2K50A 2YTYA 1KRSA 3RLNA 1HZ9A 3CXCA 1HNXL 3GTJH 1PVOA 2PI2E 4AYBG 4LUVA 4JOIC 2Q2IA 1HNXQ 4OWWB 1X65A 3RLOA 3AFQA 1I50H 2YYZA 4A3MG 3K81C 4NXMQ 3NEMA 2UUCL 4J15A 1YNXA 2JEAI 3ZJYC 1HR0L 5GQOA 1U0LA 2CWAA 3RLFA 3TQYA 1HR0Q 2E2JH 1VCIA 4POFA 4HIOA 3CMEA 1XJVA 4NB3A 1JJGA 1GO3E 4KHZA 4JBKA 2PNHA 4JBJA 4ME3A 3UDFA 4IPDA 2R6GA 4DV0Q 1FGUA 5ELNA 5IYCH 1N9WA 1N32L 1QVFA 4GNXA 2Y0SE 5C0XJ 1UE5A 3I4OA 4JI1Q 2YV5A 4C3JH 4IFDI 1AH9A 3J7ZC 1TWHH 4A75A 1A0IA 1UWVA 4LFAQ 1XNQL 2Z0SA 1EUJA 3HOZG 4A3BH 1K83H 1X6OA 5FLXc 2N78A 4DR1L 2B63H 1M1KC 4YCVA 5LMNL 3BJUA 2IX0A 4R4QA 3K7UC 4R4TA 2JA6H 5IP7H 1C7YA 2A1AA 4NPSA 4QGUA 1PYSB 2A19A 2Q2HA 2IX1A 1VQ6A 4A3JH 3KF6A 4RMFA 3S1RH 3S2DH 1CKNB 4DV3L 4DR2Q 4XIGS 2XTIA 2R92G 4DV3Q 2MNAA 2KCTA 1K8AC 2UUAL 2JA8G 2BH2A 3BZCA 1KC8C 2UUAQ 4KHPQ 3HKZE 3S17H 4P74A 3TREA 1WJJA 4UY8C 1SROA 1Q82C 3PIOA 3PV0A 4OONA 4DUYL 1QZGA 5C0XG 4JI4L 5DLQE 4DUYQ 2NVTH 4IFDJ 4BY1G 4JI4Q 5E7NA 1PH8A 1Y1VH 1HNWL 3PF5A 3K8AA 5IYDG 2VW9A 1HNWQ 1C0AA 5FLMH 2VY3A 2DGYA 1C9OA 3I56A 1IBKL 3PO3G 3RN2A 5IP9H 3A74A 1VQEA 4QJFA 1VQ4A 3M4OH 3CC4A 5IYCG 2WB1E 3KLWA 3RZOH 3F8TA 4JYAL 1VS0A 2AWNA 1UE6A 4OX9Q 3E9HA 2CFMA 4DR4L 5C4JH 3NELA 1YIJA 1NMFA 3CQZH 3HOUG 3OW2A 3SGIA 3PO2H 2ASBA 5M3MH 2C35B 2HIXA 4TQUS 3GTMH 4A3BG 5AJ3L 3G71A 2WP8J 1PH3A 2JEBI 2MFIA 3ULLA 2OCEA 3GD7A 3W1GA 5AJ3Q 2B63G 1YHBA 3FKIG 4YWLA 2JA6G 4JBWA 3G4SA 2UU9L 1OXTA 4LFBL 4TVAB 2E2IH 3I4MG 1RIPA 1L1OB 1Q1BA 3G6EA 3F2BA 2Y0SG 2XGTA 3OTOQ 1K3RA 1V43A 1MJEA 3A5ZB 3AQQA 4LW1A 1HZAA 3UDXA 4GNXB 3T1HL 5IWAQ 4PZ8A 5JJIA 3PUWA 4A3MH 5J3BA 2VNUD 1YJ9A 1XPRA 1L2FA 2ATWA 4IFDG 1OXSC 1L0WA 1CKMA 4P71A 2YU9H 3ULPA 1B8AA 3LGJA 2PI2A 1YJNA 1LM0A 4DNIA 4OXPA 1VQ5A 2R93H 3ER0A 2VUMG 2KENA 4X66L 2EQSA 2DUDA 4DAYB 3PUZA 1IXRA 4X66Q 3H15A 3NBHB 3FHWA 2D62A 4BBSG 1X3EA 2HQLA 1Y1VG 1KAWA 1Z9FA 2AKWB 3CMAA 1JMCA 1VQNA 3HOZH 1MIUA 4X65L 2N49A 4B3SL 3HKZG 4A4IA 1J5EQ 5IY0A 4JBMA 4LF9Q 1E24A 3TEHB 1SLJA 2PMZE 3I55A 1N8RC 2R7DA 3OYYA 3HFZB 5IP9G 1HJPA 3S2HH 1NBWA 4BBRG 3PGZA 4C2MH 1FVIA 1L1OC 1A8VA 1QVCA 1X55A 2E8GA 3NENA 3VDYA 3ERSX 2I0QA 3HOVH 1VQ9A 3S14H 1VQAA 4GNXC 4DV1L 3PO2G 3CPWA 4DR6Q 3BZKA 4FDBA 4LFCL 3TS2A 1UE1A 5EAYA 1CUKA 2HT1A 2R92H 3HOWH 4R4CA 3CCJA 4PMWA 2EXDA 4DUZQ 4DV4L 1SR3A 1P8LA 2ID0A 3DLLA 2JA8H 3STBC 2ALYB 4DV4Q 3H0GG 3RR5A 4B3ML 1VQPA 1FJGL 4B3MQ 3E0EA 4GLVB 4BY7G 1WFQA 1FJGQ 2CQOA 2OQKA 1XTDA 4BY1H 2RHQB 2UUCQ 3KFUA 3J7A5 2JJQA 1T9HA 2UXBL 3J81i 5IYDH 1A63A 2ZJRA 1EOVA 2R93G 1CSPA 1EIFA 2K52A 3PO3H 4O2DA 1L1OA 4APVA 5C4XH 4L5SA 3UDGA 1VQDA 1IBLL 1VQIA 1AE2A 4GKKL 1N32Q 1IBLQ 1MKHA 3PCOB 5C3EH 3HOUH 1XNRL 4OWXB 1Q12A 1DGSA 2LXJA 3J81c 1XNQQ 3GTLH 4DV2L 1PV4A 4L5QA 1EIYB 3M3YH 3FKIH 4DR1Q 4IOAA 1YI2A 5LMNQ 1VQ8A 1HH2P 4DKAC 3I4MH 1QVGA 3TRZA 3HOVG 4LWCA 1D8LA 4O0AA 3ULJA 1OTCA 3I4NH 5K36G 3HOXH 3KYHC 4L5TA 1QUQB 1VQFA 3M4QA 1KRTA 3HOWG 2F52A 4DR5L 1KHIA 2RHSB 4B3RL 1Y1WG 1ASZA 2B3GA 4GKJL 4P72A 3G48A 3CCLA 2MO0A 4IPCA 2QEXA 2VUMH 4GKJQ 2H5XA 2VQFL 2NZHA 4GLXA 4JCVE 2UU9Q 5JJKA 3M4PA 4IJHA 2K4KA 3FP9A 3GTPH 3F1ZA 1JB7A 4BBSH 1GM5A 4C3IH 3CP0A 2MQHA 4JI2L 4C3HH 4JI3L 3F2CA 4JI6L 4L5RC 4LF6L 4JI2Q 1R9TH 4JI6Q 3KJPA 2NVXH 4DR3L 2A8VA 1N33L 2ZJQA 2IT1A 2F4VL 4BBRH 4QIWE 3W5OA 4DR3Q 1IBKQ 4GS3A 5C4XG 1JT8A 3TS0A 2K5VA 2NVYH 2AWOA 3CAMA 4UP8A 4JYAQ 3M9BA 1SRUA 5ELOA 4DK3C 5C3EG 4DV7L 5JEAJ 4A3IG 4YWMA 3CF5A 2E5LL 3GO5A 1GVPA 1XMQL 3EN2A 3H3VI 4POGA 2JA9A 2E5LQ 1YZ6A 3GTQH 4AIMA 3DM3A 4A3KH 3KDFA 3GTOH 2I5MX 4RG1A 4YWKA 2OTJA 1VQMA 5H1SE 4JV5L 3S16H 3M7NA 3I7FA 1V9PA 2OQ0A 3H0GH 2JA5H 4JV5Q 1H95A 2ZM6L 1Q81C 1TWGH 3HOYG 4LFBQ 3JAMc 1EYGA 3GTKH 2ZM6Q 4UPAA 3JC66 3I4NG 1IZ6A 3HOXG 4WJ3M 3T1HQ 4DV5L 1Q7YC 4BY7H 1UE7A 4DV5Q 1X9NA 1I94L 2YTVA 5JJLA 4LUOA 1TXYA 3AEVA 1BBWA 1FL0A 3CCMA 1XPOA 4OWTB 4GN3B 2ZJPA 3STBD 1N34L 1EQQA 4Y52H 1Z47A 4NXNL 5IT9c 1N34Q 4A3GG 1WOCA 2YTXA 4IPHA 1X3GA 4NXNQ 1N36L 1Q8KA 1XMOL 1YVCA 4BXXH 1E22A 4GOPA 1PH9A 4DAMA 1VQLA 4EQ5A 1K8GA 1BBUA 1QUQA 4K0KL 5JEAG 1IYJB 4DR7L 1BKBA 4DPGA 2JA7H 5LMUL 3ICEA 4A3LH 1VQOA 4X65Q 5LMUQ 1SN8A 4B3SQ 2KHIA 1OXVA 1S40A 1YJWA 3L2PA 3S1MH 4Y7NH 1HNZL 3CD6A 4JI8L 1HNZQ 3S1QH 1IL2A 3S1NH 2WFWA 3U4VA 1QZHA 3J80c 4KLKA 3KJOA 4DV1Q 2NVQH 2VL6A 4LFCQ 4JI0L 4A3KG 3KF8B 2CKZB 4HJAA 5M5YH 4JI0Q 4OO1I 1Y1WH 1WCMG 2KCMA 4X62L 2N3SA 2WB1G 4HIKA 4DV6L 1S3OA 5IYBG 4B3TL 2JA5G 1I5FA 4UP9A 2VQEL 1CKOA 1YEZA 1SFOH 3RN5A 5FJ8G 1YBYA 3A5UA 4HJ7A 5M5XH 2VQEQ 3RNUA 4B3TQ 1PH5A 2GVAA 1Q86C 2KBNA 3PSIA 1KQSA 1OXXK 1NJIC 2AMCB 4PZ7A 4A93G 3MEFA 5GADC 3CPFA 3CW2C 1NE3A 4DK6C 4IJLA 3KDFB 5C44G 1BVSA 1PH2A 4XTCS 3D0FA 3L0OA 2UXBQ 2EIFA 1NMGA 1K9MC 2IHFA 1PHJA 1HZCA 1W3SA 1NTGA 1I6HH 2IHEA 1ASYA 2VZAA 3AFPA 3E9IA 3CC7A 3T1YL 4BXXG 4GKKQ 4A3FG 3T1YQ 4KI0A 3CCEA 4BA1I 5IE8A 4A3IH 2ES2A 4NXML 1K73C 2Q2TA 1TWAH 1XNRQ 2JA7G 1I3QH 1U5KA 2HHHL 4A3LG 1G291 4R4OA 1EQRA 1P16A 2HHHQ 2K5NA 1B7YB 2OTLA 4DV2Q 1D7QA 4UP7A 3RZDH 4P75A 4QY7A 3U58A 3J81j 1LYLA 3HOYH 4DV0L 3UDIA 3F2DA 4GOPB 4A3DH 3B6YA 5M3FG 4GN5A 4JI1L 1MJCA 4A3EG 3CCVA 3S15H 1PH4A 4AQYL 2L15A 2MO1A 3I2ZA 3PIPA 4AQYQ 3K80C 4LFAL 2KHJA 3CCSA 4H02A 1W2BA 1PH6A 4DR5Q 2R7ZG 4B3RQ 1S72A 3PUXA 4R4IA 1HZBA 1KD1C 1X3FA 2Z6KA 2WAQE 4MZ9A 3GTGH 4A3GH 3A0JA 4MTNA 3WWVA 2JQOA 2VQFQ 4P73A 2PQAB 4JOIA 2VS1A 1Q46A 4PG3A 4LF7L 3MXNB 4X64L 4WJ4A 1HR0W 1IBML 4LF7Q 4BA2I 4LUZA 4DR2L 4X64Q 2LXKA 1IBMQ 1LUZA 1J6QA 1VQKA 4JI3Q 1PYBA 4LF6Q 2UXDL 1X56A 2RF4A
chains in the Genus database with same CATH superfamily
4OEMB 3JAMi 1ICWA 4R8IA 1SEBD 4IPGA 4JG2A 1XPUA 1XMQQ 4RKLA 1F9SA 5C5LA 1QE6A 3HRZC 2NN6G 5EKKA 1GD7A 1EFWA 3UE0A 3NTKA 3VA7A 2PZTA 3V2TA 1E3PA 4KN7C 5JVG3 3RMHA 2XIWA 4N8FA 4CKBA 1E1TA 2WKDA 2CWPA 1B3AA 4HJ9A 5KNBA 5I2XA 3CCUA 1C4QA 1UEBA 2XWJB 2F3IA 5IP7G 3OTOL 3C2PA 5IWAL 2ZTDA 2UXCQ 3J80i 4K0KQ 2FINB 3VR5A 2WAQG 5DM73 4LK1C 3Q8DA 1Q1EA 2K14A 3U50C 2PQAA 1BQQT 2J7ZA 5EPJA 5M3FH 4JI8Q 3D31A 1H9KA 1Q8IA 3KF6B 1WTVA 2OWOA 2B2UC 5KGUA 5KRUA 1TWCH 5GROA 1CKNA 4N9TA 2JK8A 1VQGA 4LF9L 5EPLA 1FNWA 4X62Q 1PYWD 4KY7A 5HY6A 5M3FB 2AQ1B 1E7ZA 1ENAA 2UUBL 1VQCA 1SBBB 3GDEA 1TWCB 5CMDA 2OF1A 1Q90A 2G9HD 2K1BA 5M3MG 1PRTD 2LFNA 2SNSA 2R7FA 4HJ5A 1DOLA 1PH1A 1CHQD 4OO1H 2Z6KC 3RLNA 4AYBG 1HNXQ 5IGCA 3SK4A 1X65A 3RLOA 4NXMQ 2UUCL 4J15A 3MAQA 1HA5A 2EY2A 1HR0L 4K6DA 4N8X1 3RLFA 4HSPA 4FYDA 4RFBA 1VCIA 4HIOA 3CMEA 5JJZA 1JJGA 5KNDA 1JB3A 2LY7A 2D9UA 2EOTA 4DNTB 1I4GA 1N9WA 1N32L 2Y0SE 5C0XJ 3I4OA 4K6LA 2YV5A 1TR5A 3J7ZC 1HRJA 1LLRD 4IURA 1HPCA 4FXKC 2BE5C 2EY5A 4KK7A 2PZUA 2B63H 3PO3B 3BJUA 4R4TA 4U68A 2A1AA 2A19A 4L8JA 1VQ6A 3KK7A 3OSOA 4B9XA 3S1RH 1II3A 2TMPA 1CKNB 2R92G 3KBXA 3TSSA 2B63B 5CV9A 1BF4A 3PIO3 1IHZA 3BVZA 1Q3LA 4P74A 2NTTA 2A74C 1Q82C 3S1RB 5I9PA 2NVTH 5K5PA 1LTSD 4HR7B 1K28A 3K8AA 5IYDG 1HNWQ 1C0AA 4ZUIA 2DGYA 1C9OA 1B9MA 3M4OH 1VQEA 3CC4A 3KLWA 1TS4A 4JYAL 3SHLA 3E9HA 2CFMA 3NP8A 2NVTB 1YIJA 3HOUG 1ZYRC 3O13A 1GUTA 3OW2A 4DAVA 2C35B 3G71A 1PH3A 3W1GA 5CV7A 4YWLA 1ICFB 3NPPA 1I4RA 2QCPX 4QCLA 1RDPD 1BBXC 4UAIA 3NTIA 1I4HA 5JJIA 4LJZC 2VNUD 1EL0A 5CBAE 4IFDG 1CKMA 2YU9H 1SMYC 1NCVA 1CTMA 1LM0A 3MHBA 3VA5A 3C3LA 1EYCA 2Z8LA 1LT6D 3T4AC 3LNNA 3SR1A 2FFKB 2HQLA 4G4KA 3DEPA 4F87A 1JMCA 3CMAA 3HOZH 1O7ZA 1MIUA 4X65L 3HKZG 4A4IA 1J5EQ 1E24A 1A3TA 1A15A 1D5MC 1HJPA 5I6WA 3X3NA 4KKSA 3NENA 3HOVH 4RCNA 1VQ9A 3S14H 3CPWA 1J8IA 3TS2A 3HOWH 3MXGA 4DV4L 1SR3A 2ID0A 2Z4HA 3C1FA 2JA8H 3STBC 4EQOA 3HOVB 3S14B 1GUNA 1FJGL 1KNEA 3E0EA 5CV4A 2V4DA 4KTAA 2HDLA 4QUCA 1XTDA 3HOWB 2K5DA 5DEHA 4BY1H 1JOKA 1TS2A 3H09A 1A63A 2ZJRA 2K7VA 3A7AB 4APVA 1L1OA 5C4XH 3EJIA 3VR3A 5CC4A 4GKKL 1MKHA 4BY1B 3I4LA 2EPBA 4CJ1B 1Q12A 1DGSA 2LXJA 1XNQQ 3WDNA 3GTLH 3M3YH 2X6GA 1IYUA 4IOAA 5C4XB 3GV6A 3RUZA 3KBGA 1I4XA 2F0HA 3I4MH 1QVGA 1SJED 4LWCA 4BWGB 1OTCA 3KYHC 4G7ZC 3GTLB 3I73A 2G5DA 4TKOB 3M3YB 2XSCA 4B3RL 1Y1WG 1SXTA 3I4MB 2Y0SB 2MO0A 2VUMH 4GKJQ 2NZHA 1S5FD 3M4PA 4KD3A 2L5TA 3QOJA 3F1ZA 4DXGA 1GM5A 4RGNA 4C3IH 2B39A 2MQHA 1QNKA 4JI2Q 5E4WC 1DXMA 4JI6Q 3Q0AA 2VUMB 1MHWC 2K6AA 1IKLA 3OIQA 4DR3Q 4GS3A 1JT8A 3UI2A 1RD9D 1UEAB 1CK1A 2AWOA 4F8MA 1Y8PB 4C3IB 5JEAJ 4A3IG 3CF5A 3H3VI 1XWEA 2B2VC 1XMQL 5JVH3 1RF2D 4HMIA 1SE2A 4ZLTF 3GTOH 3D4RA 1PZKD 2XWBB 3TMEA 5ELDA 3M7NA 2JA5H 1Q81C 2MPMA 1STEA 4UPAA 3HOXG 1HUNA 4CDFC 4BY7H 2F0IA 1UE7A 4DV5Q 2CW0D 2K05A 4LUOA 2E76C 3GTOB 2O5JC 1XPOA 2ZJPA 2JA5B 4A3GG 3T13A 3K57A 4BY7B 2E2DC 4GOPA 4DAMA 4K0KL 1K8GA 1BBUA 1QUQA 1U4LA 1BO0A 4C3HG 4DPGA 2JA7H 1EZ8A 1RODA 3Q23A 4V190 5CGKA 1SN8A 1H9MA 1PDQA 2EY1A 2VB3X 3CD6A 4ME5A 2K28A 4JI8L 2WFWA 3U4VA 2JA7B 4DV1Q 3KJOA 2NVQH 4LFCQ 4ZRZA 4JI0L 3ND9A 1ONLA 4X62L 2WB1G 2Z1CA 1S3OA 5IYBG 4B3TL 4ZK9B 4CDEC 4HJ7A 2DN8A 1TVXA 4LAAA 4B9WA 1PH5A 1HHVA 2AMCB 2NVQB 2RCFA 3MEFA 5GADC 4DK6C 5C44G 1BVSA 2QW7A 3D0FA 3L0OA 2CH4W 5J39A 2XNAC 2EE1A 4IUUA 1B4OA 2IHEA 1ASYA 4BXXG 3T1YL 4FO2A 4OELB 1A3VA 2Z9HA 3CCEA 2LMCB 4ZYSA 3WOFA 4NXML 1K73C 2Q2TA 4MN3A 1S5DD 4IALA 4A3LG 3K0YA 4R4OA 1X3PA 2K5NA 3MWYW 4UP7A 3RZDH 2F0VA 3C1EA 4QY7A 3U58A 1E2WA 3TBIB 2EYPA 4GOPB 1TU2B 4GN5A 1U9RA 3I2ZA 1PRTC 3H6MA 2JYOA 3RZDB 1W2BA 1PH6A 1EY5A 4QMGA 2F0QA 2B2TA 3WWVA 4TRDA 1F2ZA 2JQOA 5ISRA 4JOIA 3BYYB 3CU7A 4WJWA 4LF7L 2PQEA 4WJ4A 4LUZA 4R8NA 1TQOA 4X64Q 3A8KE 3HGBA 3KF8A 3TP5A 2MUYA 5CORA 2K5WA 2UXDL 1X56A 1SMXA 1SYBA 2F4VQ 3CC2A 3FDTA 1X32A 3OW7A 2B29A 4HIMA 1KL9A 4QUFA 4ALPA 4C56C 4CGYB 1YHAA 5M5WH 4OIKA 3S1MB 4ABNA 4HEDA 5LMNW 1WVLA 2CVRA 3DUZA 4HIDA 4AH6A 3K6OA 4YY3Q 2HIVA 4UHVA 4YHHL 1B44D 4J6HA 1EU3A 3K7AH 2BA1A 4JC0A 2QA4A 2BCOA 3N52A 3I70A 2V1CC 3I90A 5BN4A 3H3VH 1JJCB 1M90C 4CHTB 5ELCA 1UUPA 3SK8A 3K7AB 1SNOA 1V1QA 1CZWA 4I7ZC 2EYHA 2K75A 1STGA 4ZUJA 3L7ZC 3QB3A 3Q24A 1N36Q 4LF4L 3U4ZA 4A3FH 4HJ8A 1JJ2A 5JPNC 4A3JG 1U4MA 2KVMA 1PFSA 1PH7A 4LF5L 1SYFA 2A69D 1CT1D 5HGQA 5GAEC 1CI3M 2DNCA 3NWTA 2BH8A 5GAGC 1TKWB 3BVMA 1B1ZA 1KLGD 4KN4C 1LTID 4A3FB 3CCRA 4JI5L 1SJHD 5C4ZA 3EIVA 1EY8A 1R4QB 1CFMA 3CHBD 1KIXA 4QL5A 4LF8Q 4X6AH 5IOCA 1VQBA 4JI7L 2NUCA 1WI5A 1J5EL 2F0NA 5FLMG 3S24A 1KNAA 4IOCA 4PMBA 1UNSA 2B8FA 3OMGA 2WACA 1EQVA 4UDUC 4WFN3 2M00A 4X3SA 3PF4A 5CV8A 2CCZA 2BA0A 2EJGC 2N8NA 1RL2A 1F2MA 5BR8Q 4K8JA 4RHRA 1WTOA 1SDFA 1MSGA 3D4DA 2K50A 3CXCA 2PI2E 1V1OA 4KD4A 2QILA 2F3VA 1I50H 4A3MG 3K81C 1RTOA 3NEMA 1TY0A 1CA6A 1BR9A 2R92B 3J81L 1F2YA 3C46A 1PTOC 3TQYA 2TSSA 4POFA 4IUVA 2JXMB 1XJVA 4JBKA 1NNXA 2ICEC 3UDFA 4IPDA 1I50B 5ELNA 4GNXA 5I6YA 3LX0A 1TWHH 4A75A 1UWVA 1XNQL 2B2YC 2B2WA 4KY6A 1EY4A 4YCVA 5IGBA 1AZPA 2IX0A 3DMUA 3K7UC 1GUWA 4DAYA 5EBDA 2E74C 2I07B 3NBHA 1MD2D 3KF6A 1TWHB 3J81E 3S2DH 4DR2Q 4XIGS 2BDOA 5IGGA 4DV3Q 2MNAA 4IFDH 2KCTA 1ILPA 1FNVA 3BZCA 2UUAQ 3S17H 3TREA 3EROA 1FGBD 1SROA 4K2LA 3PIOA 3PV0A 3S2DB 3BG3A 4OONA 5FOBB 4DUYL 5C0XG 4JI4L 5DLQE 2F0SA 3R3OA 3IL8A 1WD0A 3PF5A 1VDZA 2VW9A 1T5XD 3S17B 5IGEA 3I56A 4EQNA 3RN2A 4NW2A 2WB1E 2O4XA 2AWNA 4OL7A 3R8BA 4DR4L 3NELA 1B50A 3SGIA 1F9RA 2WP8J 3QO2A 5J22A 3ULLA 2OCEA 5AJ3Q 1E2ZA 2VB2X 3FKIG 1GHJA 2JA6G 5IT9L 4XT3B 3A55A 2UU9L 1OXTA 2E2IH 1L0XB 2C5CA 1MJEA 2XGTA 3A5ZB 4LW1A 4GNXB 2O2LD 5J3BA 1XPRA 1L2FA 2EZVA 4RAUC 3NTHA 4M1UB 1QNUA 5ELFA 2PI2A 2IL8A 2E2IB 3R2IA 3MA2B 1VQ5A 1NAPA 2PW7A 3ER0A 1TWGB 2KENA 4X66L 2F0PA 2DUDA 4DAYB 4DFAA 3PUZA 1IXRA 3H15A 3NBHB 5AFWA 4BBSG 1Y1VG 1Z7TA 2FHTA 4K5XA 2AKWB 3FEWX 4RGTA 5IT9E 1STBA 5IY0A 3TEHB 1SLJA 1SYEA 4G57A 3FVQA 3HFZB 5IP9G 4BBRG 3PGZA 2AQ3B 1QVCA 1L1OC 2E8GA 1X55A 4XDXA 5D3DA 3ERSX 3P7JA 3P75A 4DV1L 2HCCA 4LFCL 2CW0C 2HT1A 1ZEQX 2RKSA 3AMUA 4R4CA 3T56B 3CCJA 4DUZQ 1L0YB 2ALYB 3H0GG 1A3UA 4B3ML 2A6ED 2OQKA 4IQZA 2RHQB 4ILWA 1HCZA 1T5EA 3TDQA 1T9HA 1Y1WB 3E0JA 3J81i 3SK5A 1EOVA 2R93G 1JWMD 1CSPA 1EIFA 2K52A 3PO3H 5I4DA 3FRPB 3A54A 1BOSA 2E75C 1KABA 4NP5A 3OOCA 1W6KA 1IBLQ 1CM9A 2EJMA 5LL6S 3J81c 1PV4A 4L5QA 1RTNA 2JP1A 4V0BA 4DR1Q 4DK1A 3I3CA 5LMNQ 1VQ8A 4DKAC 4ZKCB 3TRZA 4H13C 2PW5A 4F88A 3ONAB 4CDCC 3HOXH 4L5TA 2F52A 1JWSD 1I4PA 3EFXD 4RA8A 1DOKA 2RHSB 3H91A 4P72A 2XVSA 2QEXA 3MFGA 3TN2A 2H5XA 2IWHA 4GLXA 2KCCA 3HOXB 1MGSA 3GTPH 5D3IB 1JB7A 4GZYC 3CP0A 3EA6A 5COYA 3LWEA 4K14A 1CZGA 4C3HH 3F2CA 1EY6A 1SNMA 3KJPA 2XRSD 4KKUA 2A8VA 2EYJA 2F4VL 1IKMA 5L37A 3TS0A 4FVMA 3MTSA 3NUCA 2NWGA 3CAMA 4UP8A 3GTPB 4DK3C 5C3EG 1G8ZD 1GVPA 4C3HB 4XQQA 2E5LQ 2C9OA 4XQJA 2I5MX 4RG1A 4YWKA 4YIJA 4ZCKA 3S16H 3I7FA 1V9PA 4JV5Q 2ZM6L 4LFBQ 3HOYG 5A35A 3T1HQ 4KKTA 1X9NA 3I91A 5EJWA 1TXYA 3VYRA 3K5OA 3AEVA 1BBWA 3CCMA 2WB1B 3S16B 5BN3A 1AP0A 3ND8A 5IT9c 4IZ8A 1N34Q 1WOCA 3QIAA 2YTXA 5EQ0A 1X3GA 5F2DA 3URYA 5JPMC 1N36L 4NXNQ 1YVCA 5DAUA 2A68D 4BXXH 4G7HC 3G6JB 3Q6SA 1VQLA 5JEAG 1BKBA 1ET9A 5LMUL 3ICEA 4A3LH 1VQOA 5ELBA 1K3BC 3J7YW 5KYIA 2KHIA 4B3SQ 3CRLC 4KHVA 3S1MH 3BDLA 4Y7NH 1FR3A 3KLRA 1HNZL 2F03A 1KDBA 3K5LA 3S1QH 3S1NH 3MXNA 1STNA 2N88A 1GOZA 1NR4A 4A3KG 2CKZB 1D5ZC 4DXFA 1BCPB 1EFID 2RDFA 2KCMA 1AZQA 2N3SA 1A2UA 3HG9A 4UP9A 1EEID 1MBYA 4Y7NB 2DJFC 2VQEL 3RN5A 1SFOH 1YBYA 3A5UA 4DN4M 5M5XH 1B2TA 3S1QB 3OIPA 5I9OA 3S1NB 3V96A 2KBNA 1KQSA 1NJIC 4PZ7A 3TP8A 1RCVD 2F0EA 3U9SA 1EIGA 1NE3A 2A69C 5EPKA 3H3VC 4XTCS 2UXBQ 1EY7A 2EIFA 4QF4A 1SFOB 2X6LA 5M5XB 1QILA 1W3SA 4EVOA 4S3SA 2M9VA 4BA1I 4B08A 3PQIA 3QOLA 1XNRQ 5IGDA 1G291 3FMCA 2JSOA 2HHHQ 1B7YB 4DV2Q 1F9QA 4P75A 1JWUD 2QDBA 4KV6A 4H44C 4HMJA 1H9SB 1JR0D 5M3FG 1MJCA 3S15H 1PH4A 4ODGA 2MO1A 4AQYQ 2ZXRA 3M4YA 3PUXA 4R4IA 1Y8OB 1TY2A 2Z6KA 1KD1C 2RA4A 2WAQE 4MZ9A 3GTGH 4MTNA 2VQFQ 4P73A 1E2VA 3S15B 3MXNB 2EYLA 4DR2L 1FNUA 1Y8NB 1IBMQ 1VQKA 4JI3Q 3GTGB 1WYDA 5FO8B 4OO1G 1B53A 1F9PA 1CSQA 5C3XA 4HCSA 3AYHB 1Y14B 3HP3A 2E2HH 2R61A 4DV7Q 4H0LC 1WTPA 3ERQA 1DONA 4MNOA 4R1JA 1K0RA 4JW0A 2EDGA 1G6PA 2KQ3A 4HTHA 5TSSA 1WCMH 4DU9A 2PO4A 2HDMA 3NXWA 3PUVA 2L55A 2EYOA 5FJ8H 2E2HB 1JE5A 2A73B 4C1NI 4A3DG 1BDOA 2K5QA 3HKSA 4A93H 4AYBE 1VQHA 1O7YA 2F0JA 2MGSA 1WCMB 2QGQA 1LTLA 1QG7A 1PA6A 1Y69U 2K04A 4K5WA 1LTTD 2NZOA 3VYSA 1BXTA 4A93B 5A2QL 2UXCL 2D0OA 3K0XA 3OPOA 1D2BA 1PZID 5C4JB 4QQBX 3GTMB 4TSSA 1D1KA 5CBEE 1Z6HA 2CQAA 4XQNA 2NYZD 1O7IA 4LNQA 3J7AF 1MSHA 4OIJA 3BU2A 5EKLA 1E1OA 1V8QA 4PZ6A 1NY4A 4A3EH 1KXLA 4IO9A 2IY5B 2GVBA 3CCQA 3W3AA 1X54A 2I5HA 5D14A 4IUPA 3IRBA 3NQTA 2R7ZH 4DV6Q 2RCNA 5A2QE 3EBEA 3SEBA 3KLSX 4A3EB 2Q2UA 4ID6A 2UUBQ 4GLAC 1B70B 2ZTEA 1A62A 1OXUA 1YHQA 4A3CG 2R7ZB 2FXQA 4DUZL 1SYDA 5K36H 1HUMA 1AE3A 2YTYA 4DNRB 1HNXL 1D1IA 3I8ZA 1PVOA 1QB5D 2SOBA 4OWWB 3AFQA 1A6XA 2YYZA 2H4OA 1YNXA 2JEAI 1DD2A 3ZJYC 5GQOA 1U0LA 2CWAA 4DAPA 2E2JH 1HR0Q 4DA2A 2NN6H 4KHZA 2PNRC 2F0TA 4ME3A 1ML0D 4LMQD 4JK1C 4DV0Q 2Q8RE 3IFDA 5IODA 4IFDI 1AH9A 2E2JB 4LFAQ 3HOZG 3IAYA 1X6OA 4DR1L 1VF7A 2N78A 5LMNL 2JA6H 4R4QA 1QJOA 5IP7H 3IKJA 1LABA 2VXWA 1PYSB 2Q2HA 2IX1A 4K2KA 4CJ2C 3T51B 4RMFA 1ZYRD 1O78A 2EY6A 2XTIA 1G2SA 1JE4A 2JA6B 2JA8G 4KY5A 3DWQA 2BH2A 2SDFA 1KC8C 3FPUB 4KHPQ 3HKZE 3IFTA 5T1GA 4JVZA 4UY8C 2FJ2A 4HAEA 1AN8A 4MTKA 2WAQB 4BY1G 4RKBA 5E7NA 1PH8A 1Y1VH 1EY9A 2HUGA 3BS1A 1HNWL 2A6HD 2VY3A 1BCPF 1RHPA 5IP9H 3JAML 3A74A 2Q8IB 5IYCG 2F0MA 4OX9Q 4C3JG 2F0DA 3NHHA 1Y1VB 3SK6A 5M3MH 4TQUS 2HIXA 4A3BG 3LWUA 2JEBI 1YHBA 3G4SA 4BBRB 5EGTA 4LFBL 3I4MG 1RIPA 1EOTA 1Q1BA 2NZ1D 2XN9C 2Y0SG 3G6EA 4WJ3M 1CQFA 1K3RA 3UDXA 1SNQA 3T1HL 1IYVA 3A8IE 1V1PA 2EJFC 5M3MB 2DY8A 1YJ9A 4K5VA 4ZKBB 2ATWA 1NSNS 1EY0A 1L0WA 1SE4A 1LT3D 2Z6BA 3GV3A 1B8AA 3LGJA 4OXPA 2R93H 4MIUA 4AYBB 1KDCA 2VUMG 2EQSA 3J80L 3FHWA 2D62A 2JN4A 1X3EA 2B2VA 4C3IG 5C4HA 3J7AV 1VQNA 2N49A 4B3SL 2R93B 2F0GA 3I55A 2WINB 1SSOA 1N8RC 1NBWA 3QWNA 1FVIA 2KHSA 1A8VA 3H94A 3W2DA 3VDYA 1WTQA 2X69A 2RSOA 2I0QA 2KA7A 1WTWA 1VQAA 3PO2G 4DR6Q 3BZKA 3M7GA 4FDBA 5EAYA 4DGZA 1HA6A 1LV9A 4MHEA 2R92H 4PMWA 2KECA 1P8LA 2IX3A 5KIXA 4NMZA 4DV4Q 2CHBD 4KJOA 1XYIA 5HURA 4IUTA 1B9NA 1VQPA 2F0WA 3E6ZX 2A68C 1EQTA 4GLVB 4BY7G 1WFQA 1FJGQ 2CQOA 1VMCA 3KFUA 3J7A5 5C6AA 3SE0A 2JJQA 1PLFA 2L4NA 5KEEA 2UXBL 3CRKC 1WTHA 5IYDH 2N55A 4O42A 4L5SA 1DOMA 2B8GA 3MXUA 4J1MA 3UDGA 1E0BA 1HFGA 1VQDA 1V1PB 1VQIA 1AE2A 4M8AA 2RSNA 4ZAIA 5C3EH 3HOUH 1XNRL 4OWXB 3QG1A 3VR2A 1HTPA 4DV2L 1EIYB 1YI2A 2AUJD 2I46A 3P20A 5C3EB 3HOUB 1PMRA 4ZQ3A 5E4XA 3M4QA 1KRTA 1TS3A 4EQPA 1KHIA 3GQBA 1ASZA 2B3GA 5M9OA 4GKJL 5BN5A 3NE5B 4R9WA 5E1FA 2VQFL 4JCVE 2F0OA 4PQXA 1JORA 2L11A 2AQ2B 2K4KA 2HD3A 4JI2L 4JI6L 4JI3L 4L5RC 4RH6A 3VR4A 1R9TH 2HQEA 4O1NA 4DR3L 2ZT9C 2ZJQA 2IT1A 4QIWE 3W5OA 1IBKQ 2K5VA 2NVYH 3S9WA 5JAVA 4DV7L 5ELOA 3K5MA 4YWMA 2ZXOA 3GO5A 3EN2A 1GUGA 3HKZB 1R9TB 4AIMA 3DM3A 3A56A 4A3KH 1PFBA 3VR6A 1KDAA 2NVYB 1TWGH 3JAMc 1EYGA 3GTKH 3I4NG 3JC66 1IZ6A 4DV5L 1AEXA 1Q7YC 1GXDC 1O7LA 1HXYD 4A3KB 1QWYA 5LL6X 1I4QA 1SNCA 3GP7A 5C5MA 4OWTB 1EQQA 4Y52H 1HTLD 4XYQA 3GTKB 4IPHA 2RQXA 1STYA 2PPBC 1E22A 1LT5D 5FO9B 1CQVA 1IYJB 4J8QA 3T53B 1S40A 3ITPA 1DM0B 1KTKA 1EYDA 4OHJA 1SYCA 3N6RA 5KYLA 4L63B 3SDZA 5C3WA 2L0CA 1QZHA 3J80c 1LT4D 3BVGA 4KJNA 2HCIA 4JI0Q 1Y1WH 3I72A 4DV6L 1MI2A 1I5FA 4CJ0B 1YEZA 4B3TQ 3RNUA 1F77A 4U673 3MC0B 2K03A 3CPFA 1STAA 1PRTB 1AFPA 2PCFB 4BS9A 1ESFA 4PV1C 1EYAA 1I6HH 1HQMC 3AFPA 2SEBD 1HQRD 4A3FG 1NUCA 3T1YQ 2ES2A 4A3IH 3E5SA 3NWSA 2QF7A 1I3QH 2DY7A 1ET6A 1EQRA 1P16A 5FKAC 5FLXL 1LTBD 2OTLA 1D7QA 1S5BD 1I6HB 2QKIC 3J81j 3PIP3 4DV0L 4CBVA 4A3DH 4A3IB 4NKLA 2OT2A 3CKIB 1I3QB 4G7OC 2J4XA 4H7BA 4LFAL 2KHJA 1IL8A 2PYKA 4DR5Q 5CV5A 1HZBA 1A2TA 1SNDA 4A3GH 4A3DB 4WORA 3G7LA 2PQAB 2VS1A 4IUNA 2MHVA 4X64L 1HR0W 4K8IA 4LF7Q 4BA2I 4FXDA 5FLXE 2LXKA 1K8MA 1J6QA 5EBCA 1PYBA 4LF6Q 1RKNA 4A3GB 2RF4A 2MJ8A 2DNEA 4CKEA 5LHY1 2UXDQ 4RGOS 1VMPA 4KHPL 1N33Q 1ENFA 1LTAD 3DWPA 2D0PA 3DWAA 1YITA 5NUCA 4Q5VA 4GOPC 3MFYA 3PUYA 1GUSA 4YCUA 3Q22A 2I5LX 1SE8A 1VQJA 2B2YA 1JQYD 1IW7D 4YY3L 5IYBH 1G51A 4YHHQ 1D5XC 4OX9L 1PXUA 2ZTCA 1H9JA 1I6VC 4XYOA 1TT2A 4GN4B 1I94Q 4QIWB 5C44H 4A3CH 4DF7A 3E3XA 5GAHC 1S5CD 3UE1A 3SXHA 3M4OB 2H1EA 1H9SA 1XMOQ 1SNPA 1YNJD 4LF4Q 5C44B 4DR7Q 3V05A 1W6JA 4LF5Q 5JOBA 1PTOH 1VQ7A 3L9AX 1ILQA 4A76A 2A6HC 2K5HA 1VF5C 2AHOB 3K58A 4EX5A 1TIID 2WV6D 3DM1A 1GKHA 2BDNA 2F1MA 4JI5Q 4LF8L 1JOOA 1PFNA 1LTRD 2KJXA 2YU9B 1PTOB 4HCEA 3DEOA 3OWFA 3KOJA 1BCPD 1PTOD 1KAAA 3M85A 4JI7Q 2JE6I 2GN5A 4Q0FA 1DJRD 5C0XI 2D5DA 5G3LF 1TWFH 4DR6L 3W1BA 2O5IC 4YCWA 3QJYA 1OO9B 2NN6I 4FP5D 3HOZB 5BR8L 1EWIA 3QR8A 2LSSA 2B2TC 5D65A 1KRSA 1HZ9A 4IUQA 3GTJH 4LUVA 1TWFB 4JOIC 2EYFA 2Q2IA 1C8CA 5HGTA 3VYTA 2B2UA 1X3QA 5DNFA 1EU4A 3TZDA 1YNND 1GUOA 1S5ED 4HSVA 1GHKA 4I65A 2JA8B 2F0LA 1JICA 3BZDB 4NB3A 1GO3E 3GTJB 2PNHA 4JBJA 4RWSC 2R6GA 1FGUA 5IYCH 1QVFA 5CYUA 3MXPA 1UE5A 4JI1Q 4C3JH 4RCOA 5DM63 1A0IA 4A3BH 2Z0SA 1EUJA 3D6CA 3A7LA 1K83H 5FLXc 1M1KC 2QEJC 2WKCA 1C7YA 4NPSA 4QGUA 2K01A 2GA4B 3MEHA 4C3JB 4A3JH 1STHA 1PFMA 4A3BB 2AUKA 4DV3L 1K83B 2EXZA 1K8AC 3ZYYX 4P2CB 2UUAL 4Z9CB 1EWCA 3F2UA 5J1ZA 3U9OA 2MP1A 1WJJA 4A3JB 3BDCA 4OGQC 2SNMA 1QZGA 2EVBA 4DUYQ 4IFDJ 4JI4Q 2RDHA 3AB9A 5CV6A 2F0KA 3K59A 1UAPA 5FLMH 1EEFD 1IBKL 3PO3G 4QJFA 1VQ4A 1DCZA 3RZOH 3F8TA 1VS0A 3PMFA 1UE6A 4FNFA 1K0SA 2LKVA 5C4JH 1NMFA 3CQZH 5EKIA 3PO2H 4DR4Q 2ASBA 3GTMH 4JPBW 4L6TB 2PZWA 5AJ3L 1D6EC 2MFIA 3GD7A 1PRTF 2B63G 4JBWA 1EWHA 4F7XA 1EIHA 3RZOB 4TVAB 1L1OB 3F2BA 2UU9Q 3OTOQ 1V43A 1FD7D 3AQQA 1HZAA 3CQZB 5IWAQ 1WTXA 3PO2B 4PZ8A 3PUWA 4A3MH 2ZXPA 1OXSC 2F3WA 4P71A 3ULPA 1YJNA 4I7AA 4DNIA 1U4RA 4X3KA 3HEJA 3SVMA 2J0TD 1KLUD 4DK0A 5IIFA 4X66Q 4A3MB 1CA5A 3WOEA 1AW7A 1KAWA 1Z9FA 3A8JE 1TS5A 1F2LA 3BYTB 4JBMA 4LF9Q 2PMZE 3NQIA 1BUVT 2R7DA 3OYYA 3S2HH 2Q8TA 4C2MH 4CKCA 2EYMA 4C1NK 4FF4A 4EGVA 4GNXC 1JCKB 1DYQA 3P1HA 1UE1A 1CUKA 2BE5D 2KOLA 2EXDA 2B2WC 2F0FA 1NR2A 4FF1A 2RVLA 3DLLA 3S2HB 4C2MB 3OHXC 4XXEA 3RR5A 4IN3A 2RBMA 1K8OA 4B3MQ 3HS0C 5C0XH 1EZ6A 1SAPA 2P5ZX 3KLSA 2UUCQ 1DZ1A 4FF3A 4X3UA 4NDXA 3EVQA 4O2DA 3L3OC 1HFNA 3DHQA 1IBLL 1N32Q 1QOHA 3PCOB 4KMUC 1ZXTA 3R2TA 3FKIH 1BNZA 5I2YA 3BDOA 1HH2P 3HOVG 1D8LA 2A6EC 4O0AA 3ULJA 1LACA 1SYGA 2BOSA 1LTGD 3I4NH 2QDLA 3RD4A 2K32A 2KCNA 1QUQB 1VQFA 4WRDA 3OWEB 3HOWG 3FKIB 4DR5L 3G48A 3CCLA 4IPCA 3HZXA 4ULLA 3I4NB 5JJKA 4IJHA 3FP9A 1FYCA 1S4ZA 4BBSH 2FMMA 5CR3A 1GJXA 1SMYD 4LF6L 2K33A 4RHSA 1PZJD 2NVXH 1PTOF 5FO7B 2D2CC 1N33L 5C4XG 4BBRH 1M8AA 5IGFA 2NTSA 4JYAQ 3M9BA 1SRUA 4BBSB 2E5LL 4POGA 2JA9A 1YZ6A 2G9DA 2M2LA 1J9OA 2R3ZA 3TP6A 3AU7A 3GTQH 2NVXB 3NBIA 3KDFA 3T16A 4N9PA 1H9RA 2OTJA 1VQMA 5H1SE 4JV5L 2OQ0A 2Z4IA 3H0GH 2ZM6Q 3OMCA 3MVVA 2KEEA 3D6WA 2CH4A 5M5WB 3D8GA 2YTVA 1I94L 3GTQB 5JJLA 3KUPA 1FL0A 4CDDC 4GN3B 3JAME 3H0GB 3STBD 1N34L 1M4VA 1Z47A 5T1IA 4NXNL 3NK9A 5FK9C 2F0UA 1Q8KA 1G91A 1XMOL 1PH9A 4EQ5A 3K5NA 1WTRA 2IJ0A 4DR7L 2RDGA 4X65Q 5LMUQ 1IW7C 1OXVA 1U4PA 1ENCA 1YJWA 2KEDA 4FF2A 3L2PA 4HN7A 2OEOA 3D4WA 1G2TA 1B3QA 1HNZQ 1WD1A 1IL2A 2IPKD 4KLKA 1JOQA 2F4IA 2LS01 2VL6A 5E3FA 3KF8B 4HJAA 2KUMA 5M5YH 2IW3A 1XTCD 4OO1I 1ZKOA 1WCMG 4HIKA 1G6ZA 2JA5G 1LO5D 1O80A 1CKOA 2L9HA 3EQLC 4X3TA 5FJ8G 3J80E 1H95A 2VQEQ 2GVAA 2OXPA 1Q86C 3PSIA 1OXXK 3MZ5A 4A93G 1YNJC 2XRQD 2PMZB 3CW2C 5M5YB 4IJLA 3NSWA 3KDFB 1PH2A 3TP7A 1NMGA 1K9MC 2IHFA 1PHJA 1HZCA 1NTGA 2VZAA 3E9IA 3CC7A 4PMCA 4GKKQ 4KI0A 5IE8A 2JA7G 1TWAH 2NB0A 1U5KA 2HHHL 3VYUA 2WIIB 4PNYA 1BCPC 4FXGC 4XT1B 3D3RA 5KNCA 1LYLA 3TZUA 3HOYH 2ICIA 1R4PB 3UDIA 2ENBA 3F2DA 1SE3A 3B6YA 1CHPD 1TWAB 4JI1L 4A3EG 1C48A 3CCVA 4AQYL 3R93A 2L1BA 4E6IA 2L15A 1XX8A 3PIPA 3K80C 3CCSA 1QCBD 4H02A 2NBFA 2R7ZG 4B3RQ 1S72A 1ESRA 3HOYB 1X3FA 1JC7A 3A0JA 4RGMA 5G3LD 2A5HA 2L12A 1Q46A 1XXGA 2DJGC 2FMCA 4PG3A 1RJTA 3DXJC 1IBML 5JEAH 5ELEA 1LUZA 1YNNC 4QB4A 3FPPA 5K36G 3X3MA
chains in the Genus database with same CATH topology
1WYDA 2UXDQ 4KHPL 4OO1G 1N33Q 2F4VQ 3CC2A 1CSQA 2D0PA 3AYHB 1Y14B 3JAMi 2B29A 4HIMA 2E2HH 1YITA 4GOPC 4DV7Q 1KL9A 3PUYA 4IPGA 4JG2A 4MNOA 4R1JA 1SMXA 1K0RA 4YCUA 2I5LX 4ALPA 1XPUA 1YHAA 5M5WH 1XMQQ 1SE8A 1G6PA 1VQJA 5LMNW 1WCMH 4YY3L 4HIDA 4AH6A 2NN6G 5IYBH 4YY3Q 2HIVA 1GD7A 3PUVA 1EFWA 3UE0A 4YHHL 5FJ8H 1JE5A 3K7AH 1G51A 2BA1A 4JC0A 4YHHQ 4A3DG 4OX9L 3HKSA 2ZTCA 1E3PA 2QA4A 4A93H 4AYBE 1VQHA 4GN4B 1I94Q 1E1TA 2V1CC 2QGQA 1LTLA 2CWPA 5C44H 3H3VH 1PA6A 4A3CH 1JJCB 1M90C 4HJ9A 5GAHC 3CCUA 1UEBA 2F3IA 3UE1A 2NZOA 1V1QA 5IP7G 2K75A 3OTOL 3L7ZC 1N36Q 4LF4L 2UXCL 5IWAL 1XMOQ 2D0OA 3K0XA 3U4ZA 2ZTDA 4HJ8A 4A3FH 1JJ2A 4A3JG 4LF4Q 2UXCQ 4QQBX 3J80i 4K0KQ 1PFSA 1PH7A 4LF5L 4DR7Q 4LF5Q 2WAQG 5HGQA 5GAEC 1VQ7A 4A76A 2BH8A 1O7IA 2K5HA 4LNQA 3Q8DA 2AHOB 1Q1EA 2K14A 5GAGC 4EX5A 3U50C 2PQAA 3BU2A 1E1OA 3CCRA 4PZ6A 4JI5L 5M3FH 3EIVA 1GKHA 1NY4A 3D31A 4JI8Q 4A3EH 1KXLA 4JI5Q 4IO9A 4LF8L 3KF6B 1KIXA 2OWOA 2IY5B 4QL5A 4LF8Q 4X6AH 1TWCH 2GVBA 1VQBA 1CKNA 5GROA 3CCQA 1X54A 2I5HA 2JK8A 4JI7L 1VQGA 3IRBA 1WI5A 3KOJA 1J5EL 3M85A 4LF9L 4JI7Q 2R7ZH 4X62Q 2JE6I 4DR4Q 5FLMG 4DV6Q 3S24A 2RCNA 2GN5A 4IOCA 5HY6A 1E7ZA 3EBEA 2UUBL 5C0XI 1VQCA 2Q2UA 1TWFH 2UUBQ 4DR6L 3GDEA 4GLAC 3W1BA 3PF4A 1B70B 2ZTEA 4YCWA 1A62A 1OXUA 1YHQA 5M3MG 2CCZA 2NN6I 2BA0A 2FXQA 4A3CG 5BR8L 1EWIA 2R7FA 2N8NA 4DUZL 1RL2A 4HJ5A 5BR8Q 1PH1A 2LSSA 1AE3A 2Z6KC 2K50A 2YTYA 1KRSA 3RLNA 1HZ9A 3CXCA 1HNXL 3GTJH 1PVOA 2PI2E 4AYBG 4LUVA 4JOIC 2Q2IA 1HNXQ 4OWWB 1X65A 3RLOA 3AFQA 1I50H 2YYZA 4A3MG 3K81C 4NXMQ 3NEMA 2UUCL 4J15A 1YNXA 2JEAI 3ZJYC 1HR0L 5GQOA 1U0LA 2CWAA 3RLFA 3TQYA 1HR0Q 2E2JH 1VCIA 4POFA 4HIOA 3CMEA 1XJVA 4NB3A 1JJGA 1GO3E 4KHZA 4JBKA 2PNHA 4JBJA 4ME3A 3UDFA 4IPDA 2R6GA 4DV0Q 1FGUA 5ELNA 5IYCH 1N9WA 1N32L 1QVFA 4GNXA 2Y0SE 5C0XJ 1UE5A 3I4OA 4JI1Q 2YV5A 4C3JH 4IFDI 1AH9A 3J7ZC 1TWHH 4A75A 1A0IA 1UWVA 4LFAQ 1XNQL 2Z0SA 1EUJA 3HOZG 4A3BH 1K83H 1X6OA 5FLXc 2N78A 4DR1L 2B63H 1M1KC 4YCVA 5LMNL 3BJUA 2IX0A 4R4QA 3K7UC 4R4TA 2JA6H 5IP7H 1C7YA 2A1AA 4NPSA 4QGUA 1PYSB 2A19A 2Q2HA 2IX1A 1VQ6A 4A3JH 3KF6A 4RMFA 3S1RH 3S2DH 1CKNB 4DV3L 4DR2Q 4XIGS 2XTIA 2R92G 4DV3Q 2MNAA 2KCTA 1K8AC 2UUAL 2JA8G 2BH2A 3BZCA 1KC8C 2UUAQ 4KHPQ 3HKZE 3S17H 4P74A 3TREA 1WJJA 4UY8C 1SROA 1Q82C 3PIOA 3PV0A 4OONA 4DUYL 1QZGA 5C0XG 4JI4L 5DLQE 4DUYQ 2NVTH 4IFDJ 4BY1G 4JI4Q 5E7NA 1PH8A 1Y1VH 1HNWL 3PF5A 3K8AA 5IYDG 2VW9A 1HNWQ 1C0AA 5FLMH 2VY3A 2DGYA 1C9OA 3I56A 1IBKL 3PO3G 3RN2A 5IP9H 3A74A 1VQEA 4QJFA 1VQ4A 3M4OH 3CC4A 5IYCG 2WB1E 3KLWA 3RZOH 3F8TA 4JYAL 1VS0A 2AWNA 1UE6A 4OX9Q 3E9HA 2CFMA 4DR4L 5C4JH 3NELA 1YIJA 1NMFA 3CQZH 3HOUG 3OW2A 3SGIA 3PO2H 2ASBA 5M3MH 2C35B 2HIXA 4TQUS 3GTMH 4A3BG 5AJ3L 3G71A 2WP8J 1PH3A 2JEBI 2MFIA 3ULLA 2OCEA 3GD7A 3W1GA 5AJ3Q 2B63G 1YHBA 3FKIG 4YWLA 2JA6G 4JBWA 3G4SA 2UU9L 1OXTA 4LFBL 4TVAB 2E2IH 3I4MG 1RIPA 1L1OB 1Q1BA 3G6EA 3F2BA 2Y0SG 2XGTA 3OTOQ 1K3RA 1V43A 1MJEA 3A5ZB 3AQQA 4LW1A 1HZAA 3UDXA 4GNXB 3T1HL 5IWAQ 4PZ8A 5JJIA 3PUWA 4A3MH 5J3BA 2VNUD 1YJ9A 1XPRA 1L2FA 2ATWA 4IFDG 1OXSC 1L0WA 1CKMA 4P71A 2YU9H 3ULPA 1B8AA 3LGJA 2PI2A 1YJNA 1LM0A 4DNIA 4OXPA 1VQ5A 2R93H 3ER0A 2VUMG 2KENA 4X66L 2EQSA 2DUDA 4DAYB 3PUZA 1IXRA 4X66Q 3H15A 3NBHB 3FHWA 2D62A 4BBSG 1X3EA 2HQLA 1Y1VG 1KAWA 1Z9FA 2AKWB 3CMAA 1JMCA 1VQNA 3HOZH 1MIUA 4X65L 2N49A 4B3SL 3HKZG 4A4IA 1J5EQ 5IY0A 4JBMA 4LF9Q 1E24A 3TEHB 1SLJA 2PMZE 3I55A 1N8RC 2R7DA 3OYYA 3HFZB 5IP9G 1HJPA 3S2HH 1NBWA 4BBRG 3PGZA 4C2MH 1FVIA 1L1OC 1A8VA 1QVCA 1X55A 2E8GA 3NENA 3VDYA 3ERSX 2I0QA 3HOVH 1VQ9A 3S14H 1VQAA 4GNXC 4DV1L 3PO2G 3CPWA 4DR6Q 3BZKA 4FDBA 4LFCL 3TS2A 1UE1A 5EAYA 1CUKA 2HT1A 2R92H 3HOWH 4R4CA 3CCJA 4PMWA 2EXDA 4DUZQ 4DV4L 1SR3A 1P8LA 2ID0A 3DLLA 2JA8H 3STBC 2ALYB 4DV4Q 3H0GG 3RR5A 4B3ML 1VQPA 1FJGL 4B3MQ 3E0EA 4GLVB 4BY7G 1WFQA 1FJGQ 2CQOA 2OQKA 1XTDA 4BY1H 2RHQB 2UUCQ 3KFUA 3J7A5 2JJQA 1T9HA 2UXBL 3J81i 5IYDH 1A63A 2ZJRA 1EOVA 2R93G 1CSPA 1EIFA 2K52A 3PO3H 4O2DA 1L1OA 4APVA 5C4XH 4L5SA 3UDGA 1VQDA 1IBLL 1VQIA 1AE2A 4GKKL 1N32Q 1IBLQ 1MKHA 3PCOB 5C3EH 3HOUH 1XNRL 4OWXB 1Q12A 1DGSA 2LXJA 3J81c 1XNQQ 3GTLH 4DV2L 1PV4A 4L5QA 1EIYB 3M3YH 3FKIH 4DR1Q 4IOAA 1YI2A 5LMNQ 1VQ8A 1HH2P 4DKAC 3I4MH 1QVGA 3TRZA 3HOVG 4LWCA 1D8LA 4O0AA 3ULJA 1OTCA 3I4NH 5K36G 3HOXH 3KYHC 4L5TA 1QUQB 1VQFA 3M4QA 1KRTA 3HOWG 2F52A 4DR5L 1KHIA 2RHSB 4B3RL 1Y1WG 1ASZA 2B3GA 4GKJL 4P72A 3G48A 3CCLA 2MO0A 4IPCA 2QEXA 2VUMH 4GKJQ 2H5XA 2VQFL 2NZHA 4GLXA 4JCVE 2UU9Q 5JJKA 3M4PA 4IJHA 2K4KA 3FP9A 3GTPH 3F1ZA 1JB7A 4BBSH 1GM5A 4C3IH 3CP0A 2MQHA 4JI2L 4C3HH 4JI3L 3F2CA 4JI6L 4L5RC 4LF6L 4JI2Q 1R9TH 4JI6Q 3KJPA 2NVXH 4DR3L 2A8VA 1N33L 2ZJQA 2IT1A 2F4VL 4BBRH 4QIWE 3W5OA 4DR3Q 1IBKQ 4GS3A 5C4XG 1JT8A 3TS0A 2K5VA 2NVYH 2AWOA 3CAMA 4UP8A 4JYAQ 3M9BA 1SRUA 5ELOA 4DK3C 5C3EG 4DV7L 5JEAJ 4A3IG 4YWMA 3CF5A 2E5LL 3GO5A 1GVPA 1XMQL 3EN2A 3H3VI 4POGA 2JA9A 2E5LQ 1YZ6A 3GTQH 4AIMA 3DM3A 4A3KH 3KDFA 3GTOH 2I5MX 4RG1A 4YWKA 2OTJA 1VQMA 5H1SE 4JV5L 3S16H 3M7NA 3I7FA 1V9PA 2OQ0A 3H0GH 2JA5H 4JV5Q 1H95A 2ZM6L 1Q81C 1TWGH 3HOYG 4LFBQ 3JAMc 1EYGA 3GTKH 2ZM6Q 4UPAA 3JC66 3I4NG 1IZ6A 3HOXG 4WJ3M 3T1HQ 4DV5L 1Q7YC 4BY7H 1UE7A 4DV5Q 1X9NA 1I94L 2YTVA 5JJLA 4LUOA 1TXYA 3AEVA 1BBWA 1FL0A 3CCMA 1XPOA 4OWTB 4GN3B 2ZJPA 3STBD 1N34L 1EQQA 4Y52H 1Z47A 4NXNL 5IT9c 1N34Q 4A3GG 1WOCA 2YTXA 4IPHA 1X3GA 4NXNQ 1N36L 1Q8KA 1XMOL 1YVCA 4BXXH 1E22A 4GOPA 1PH9A 4DAMA 1VQLA 4EQ5A 1K8GA 1BBUA 1QUQA 4K0KL 5JEAG 1IYJB 4DR7L 1BKBA 4DPGA 2JA7H 5LMUL 3ICEA 4A3LH 1VQOA 4X65Q 5LMUQ 1SN8A 4B3SQ 2KHIA 1OXVA 1S40A 1YJWA 3L2PA 3S1MH 4Y7NH 1HNZL 3CD6A 4JI8L 1HNZQ 3S1QH 1IL2A 3S1NH 2WFWA 3U4VA 1QZHA 3J80c 4KLKA 3KJOA 4DV1Q 2NVQH 2VL6A 4LFCQ 4JI0L 4A3KG 3KF8B 2CKZB 4HJAA 5M5YH 4JI0Q 4OO1I 1Y1WH 1WCMG 2KCMA 4X62L 2N3SA 2WB1G 4HIKA 4DV6L 1S3OA 5IYBG 4B3TL 2JA5G 1I5FA 4UP9A 2VQEL 1CKOA 1YEZA 1SFOH 3RN5A 5FJ8G 1YBYA 3A5UA 4HJ7A 5M5XH 2VQEQ 3RNUA 4B3TQ 1PH5A 2GVAA 1Q86C 2KBNA 3PSIA 1KQSA 1OXXK 1NJIC 2AMCB 4PZ7A 4A93G 3MEFA 5GADC 3CPFA 3CW2C 1NE3A 4DK6C 4IJLA 3KDFB 5C44G 1BVSA 1PH2A 4XTCS 3D0FA 3L0OA 2UXBQ 2EIFA 1NMGA 1K9MC 2IHFA 1PHJA 1HZCA 1W3SA 1NTGA 1I6HH 2IHEA 1ASYA 2VZAA 3AFPA 3E9IA 3CC7A 3T1YL 4BXXG 4GKKQ 4A3FG 3T1YQ 4KI0A 3CCEA 4BA1I 5IE8A 4A3IH 2ES2A 4NXML 1K73C 2Q2TA 1TWAH 1XNRQ 2JA7G 1I3QH 1U5KA 2HHHL 4A3LG 1G291 4R4OA 1EQRA 1P16A 2HHHQ 2K5NA 1B7YB 2OTLA 4DV2Q 1D7QA 4UP7A 3RZDH 4P75A 4QY7A 3U58A 3J81j 1LYLA 3HOYH 4DV0L 3UDIA 3F2DA 4GOPB 4A3DH 3B6YA 5M3FG 4GN5A 4JI1L 1MJCA 4A3EG 3CCVA 3S15H 1PH4A 4AQYL 2L15A 2MO1A 3I2ZA 3PIPA 4AQYQ 3K80C 4LFAL 2KHJA 3CCSA 4H02A 1W2BA 1PH6A 4DR5Q 2R7ZG 4B3RQ 1S72A 3PUXA 4R4IA 1HZBA 1KD1C 1X3FA 2Z6KA 2WAQE 4MZ9A 3GTGH 4A3GH 3A0JA 4MTNA 3WWVA 2JQOA 2VQFQ 4P73A 2PQAB 4JOIA 2VS1A 1Q46A 4PG3A 4LF7L 3MXNB 4X64L 4WJ4A 1HR0W 1IBML 4LF7Q 4BA2I 4LUZA 4DR2L 4X64Q 2LXKA 1IBMQ 1LUZA 1J6QA 1VQKA 4JI3Q 1PYBA 4LF6Q 2UXDL 1X56A 2RF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WYD A;  2UXD Q;  4KHP L;  4OO1 G;  1N33 Q;  2F4V Q;  3CC2 A;  1CSQ A;  2D0P A;  3AYH B;  1Y14 B;  3JAM i;  2B29 A;  4HIM A;  2E2H H;  1YIT A;  4GOP C;  4DV7 Q;  1KL9 A;  3PUY A;  4IPG A;  4JG2 A;  4MNO A;  4R1J A;  1SMX A;  1K0R A;  4YCU A;  2I5L X;  4ALP A;  1XPU A;  1YHA A;  5M5W H;  1XMQ Q;  1SE8 A;  1G6P A;  1VQJ A;  5LMN W;  1WCM H;  4YY3 L;  4HID A;  4AH6 A;  2NN6 G;  5IYB H;  4YY3 Q;  2HIV A;  1GD7 A;  3PUV A;  1EFW A;  3UE0 A;  4YHH L;  5FJ8 H;  1JE5 A;  3K7A H;  1G51 A;  2BA1 A;  4JC0 A;  4YHH Q;  4A3D G;  4OX9 L;  3HKS A;  2ZTC A;  1E3P A;  2QA4 A;  4A93 H;  4AYB E;  1VQH A;  4GN4 B;  1I94 Q;  1E1T A;  2V1C C;  2QGQ A;  1LTL A;  2CWP A;  5C44 H;  3H3V H;  1PA6 A;  4A3C H;  1JJC B;  1M90 C;  4HJ9 A;  5GAH C;  3CCU A;  1UEB A;  2F3I A;  3UE1 A;  2NZO A;  1V1Q A;  5IP7 G;  2K75 A;  3OTO L;  3L7Z C;  1N36 Q;  4LF4 L;  2UXC L;  5IWA L;  1XMO Q;  2D0O A;  3K0X A;  3U4Z A;  2ZTD A;  4HJ8 A;  4A3F H;  1JJ2 A;  4A3J G;  4LF4 Q;  2UXC Q;  4QQB X;  3J80 i;  4K0K Q;  1PFS A;  1PH7 A;  4LF5 L;  4DR7 Q;  4LF5 Q;  2WAQ G;  5HGQ A;  5GAE C;  1VQ7 A;  4A76 A;  2BH8 A;  1O7I A;  2K5H A;  4LNQ A;  3Q8D A;  2AHO B;  1Q1E A;  2K14 A;  5GAG C;  4EX5 A;  3U50 C;  2PQA A;  3BU2 A;  1E1O A;  3CCR A;  4PZ6 A;  4JI5 L;  5M3F H;  3EIV A;  1GKH A;  1NY4 A;  3D31 A;  4JI8 Q;  4A3E H;  1KXL A;  4JI5 Q;  4IO9 A;  4LF8 L;  3KF6 B;  1KIX A;  2OWO A;  2IY5 B;  4QL5 A;  4LF8 Q;  4X6A H;  1TWC H;  2GVB A;  1VQB A;  1CKN A;  5GRO A;  3CCQ A;  1X54 A;  2I5H A;  2JK8 A;  4JI7 L;  1VQG A;  3IRB A;  1WI5 A;  3KOJ A;  1J5E L;  3M85 A;  4LF9 L;  4JI7 Q;  2R7Z H;  4X62 Q;  2JE6 I;  4DR4 Q;  5FLM G;  4DV6 Q;  3S24 A;  2RCN A;  2GN5 A;  4IOC A;  5HY6 A;  1E7Z A;  3EBE A;  2UUB L;  5C0X I;  1VQC A;  2Q2U A;  1TWF H;  2UUB Q;  4DR6 L;  3GDE A;  4GLA C;  3W1B A;  3PF4 A;  1B70 B;  2ZTE A;  4YCW A;  1A62 A;  1OXU A;  1YHQ A;  5M3M G;  2CCZ A;  2NN6 I;  2BA0 A;  2FXQ A;  4A3C G;  5BR8 L;  1EWI A;  2R7F A;  2N8N A;  4DUZ L;  1RL2 A;  4HJ5 A;  5BR8 Q;  1PH1 A;  2LSS A;  1AE3 A;  2Z6K C;  2K50 A;  2YTY A;  1KRS A;  3RLN A;  1HZ9 A;  3CXC A;  1HNX L;  3GTJ H;  1PVO A;  2PI2 E;  4AYB G;  4LUV A;  4JOI C;  2Q2I A;  1HNX Q;  4OWW B;  1X65 A;  3RLO A;  3AFQ A;  1I50 H;  2YYZ A;  4A3M G;  3K81 C;  4NXM Q;  3NEM A;  2UUC L;  4J15 A;  1YNX A;  2JEA I;  3ZJY C;  1HR0 L;  5GQO A;  1U0L A;  2CWA A;  3RLF A;  3TQY A;  1HR0 Q;  2E2J H;  1VCI A;  4POF A;  4HIO A;  3CME A;  1XJV A;  4NB3 A;  1JJG A;  1GO3 E;  4KHZ A;  4JBK A;  2PNH A;  4JBJ A;  4ME3 A;  3UDF A;  4IPD A;  2R6G A;  4DV0 Q;  1FGU A;  5ELN A;  5IYC H;  1N9W A;  1N32 L;  1QVF A;  4GNX A;  2Y0S E;  5C0X J;  1UE5 A;  3I4O A;  4JI1 Q;  2YV5 A;  4C3J H;  4IFD I;  1AH9 A;  3J7Z C;  1TWH H;  4A75 A;  1A0I A;  1UWV A;  4LFA Q;  1XNQ L;  2Z0S A;  1EUJ A;  3HOZ G;  4A3B H;  1K83 H;  1X6O A;  5FLX c;  2N78 A;  4DR1 L;  2B63 H;  1M1K C;  4YCV A;  5LMN L;  3BJU A;  2IX0 A;  4R4Q A;  3K7U C;  4R4T A;  2JA6 H;  5IP7 H;  1C7Y A;  2A1A A;  4NPS A;  4QGU A;  1PYS B;  2A19 A;  2Q2H A;  2IX1 A;  1VQ6 A;  4A3J H;  3KF6 A;  4RMF A;  3S1R H;  3S2D H;  1CKN B;  4DV3 L;  4DR2 Q;  4XIG S;  2XTI A;  2R92 G;  4DV3 Q;  2MNA A;  2KCT A;  1K8A C;  2UUA L;  2JA8 G;  2BH2 A;  3BZC A;  1KC8 C;  2UUA Q;  4KHP Q;  3HKZ E;  3S17 H;  4P74 A;  3TRE A;  1WJJ A;  4UY8 C;  1SRO A;  1Q82 C;  3PIO A;  3PV0 A;  4OON A;  4DUY L;  1QZG A;  5C0X G;  4JI4 L;  5DLQ E;  4DUY Q;  2NVT H;  4IFD J;  4BY1 G;  4JI4 Q;  5E7N A;  1PH8 A;  1Y1V H;  1HNW L;  3PF5 A;  3K8A A;  5IYD G;  2VW9 A;  1HNW Q;  1C0A A;  5FLM H;  2VY3 A;  2DGY A;  1C9O A;  3I56 A;  1IBK L;  3PO3 G;  3RN2 A;  5IP9 H;  3A74 A;  1VQE A;  4QJF A;  1VQ4 A;  3M4O H;  3CC4 A;  5IYC G;  2WB1 E;  3KLW A;  3RZO H;  3F8T A;  4JYA L;  1VS0 A;  2AWN A;  1UE6 A;  4OX9 Q;  3E9H A;  2CFM A;  4DR4 L;  5C4J H;  3NEL A;  1YIJ A;  1NMF A;  3CQZ H;  3HOU G;  3OW2 A;  3SGI A;  3PO2 H;  2ASB A;  5M3M H;  2C35 B;  2HIX A;  4TQU S;  3GTM H;  4A3B G;  5AJ3 L;  3G71 A;  2WP8 J;  1PH3 A;  2JEB I;  2MFI A;  3ULL A;  2OCE A;  3GD7 A;  3W1G A;  5AJ3 Q;  2B63 G;  1YHB A;  3FKI G;  4YWL A;  2JA6 G;  4JBW A;  3G4S A;  2UU9 L;  1OXT A;  4LFB L;  4TVA B;  2E2I H;  3I4M G;  1RIP A;  1L1O B;  1Q1B A;  3G6E A;  3F2B A;  2Y0S G;  2XGT A;  3OTO Q;  1K3R A;  1V43 A;  1MJE A;  3A5Z B;  3AQQ A;  4LW1 A;  1HZA A;  3UDX A;  4GNX B;  3T1H L;  5IWA Q;  4PZ8 A;  5JJI A;  3PUW A;  4A3M H;  5J3B A;  2VNU D;  1YJ9 A;  1XPR A;  1L2F A;  2ATW A;  4IFD G;  1OXS C;  1L0W A;  1CKM A;  4P71 A;  2YU9 H;  3ULP A;  1B8A A;  3LGJ A;  2PI2 A;  1YJN A;  1LM0 A;  4DNI A;  4OXP A;  1VQ5 A;  2R93 H;  3ER0 A;  2VUM G;  2KEN A;  4X66 L;  2EQS A;  2DUD A;  4DAY B;  3PUZ A;  1IXR A;  4X66 Q;  3H15 A;  3NBH B;  3FHW A;  2D62 A;  4BBS G;  1X3E A;  2HQL A;  1Y1V G;  1KAW A;  1Z9F A;  2AKW B;  3CMA A;  1JMC A;  1VQN A;  3HOZ H;  1MIU A;  4X65 L;  2N49 A;  4B3S L;  3HKZ G;  4A4I A;  1J5E Q;  5IY0 A;  4JBM A;  4LF9 Q;  1E24 A;  3TEH B;  1SLJ A;  2PMZ E;  3I55 A;  1N8R C;  2R7D A;  3OYY A;  3HFZ B;  5IP9 G;  1HJP A;  3S2H H;  1NBW A;  4BBR G;  3PGZ A;  4C2M H;  1FVI A;  1L1O C;  1A8V A;  1QVC A;  1X55 A;  2E8G A;  3NEN A;  3VDY A;  3ERS X;  2I0Q A;  3HOV H;  1VQ9 A;  3S14 H;  1VQA A;  4GNX C;  4DV1 L;  3PO2 G;  3CPW A;  4DR6 Q;  3BZK A;  4FDB A;  4LFC L;  3TS2 A;  1UE1 A;  5EAY A;  1CUK A;  2HT1 A;  2R92 H;  3HOW H;  4R4C A;  3CCJ A;  4PMW A;  2EXD A;  4DUZ Q;  4DV4 L;  1SR3 A;  1P8L A;  2ID0 A;  3DLL A;  2JA8 H;  3STB C;  2ALY B;  4DV4 Q;  3H0G G;  3RR5 A;  4B3M L;  1VQP A;  1FJG L;  4B3M Q;  3E0E A;  4GLV B;  4BY7 G;  1WFQ A;  1FJG Q;  2CQO A;  2OQK A;  1XTD A;  4BY1 H;  2RHQ B;  2UUC Q;  3KFU A;  3J7A 5;  2JJQ A;  1T9H A;  2UXB L;  3J81 i;  5IYD H;  1A63 A;  2ZJR A;  1EOV A;  2R93 G;  1CSP A;  1EIF A;  2K52 A;  3PO3 H;  4O2D A;  1L1O A;  4APV A;  5C4X H;  4L5S A;  3UDG A;  1VQD A;  1IBL L;  1VQI A;  1AE2 A;  4GKK L;  1N32 Q;  1IBL Q;  1MKH A;  3PCO B;  5C3E H;  3HOU H;  1XNR L;  4OWX B;  1Q12 A;  1DGS A;  2LXJ A;  3J81 c;  1XNQ Q;  3GTL H;  4DV2 L;  1PV4 A;  4L5Q A;  1EIY B;  3M3Y H;  3FKI H;  4DR1 Q;  4IOA A;  1YI2 A;  5LMN Q;  1VQ8 A;  1HH2 P;  4DKA C;  3I4M H;  1QVG A;  3TRZ A;  3HOV G;  4LWC A;  1D8L A;  4O0A A;  3ULJ A;  1OTC A;  3I4N H;  5K36 G;  3HOX H;  3KYH C;  4L5T A;  1QUQ B;  1VQF A;  3M4Q A;  1KRT A;  3HOW G;  2F52 A;  4DR5 L;  1KHI A;  2RHS B;  4B3R L;  1Y1W G;  1ASZ A;  2B3G A;  4GKJ L;  4P72 A;  3G48 A;  3CCL A;  2MO0 A;  4IPC A;  2QEX A;  2VUM H;  4GKJ Q;  2H5X A;  2VQF L;  2NZH A;  4GLX A;  4JCV E;  2UU9 Q;  5JJK A;  3M4P A;  4IJH A;  2K4K A;  3FP9 A;  3GTP H;  3F1Z A;  1JB7 A;  4BBS H;  1GM5 A;  4C3I H;  3CP0 A;  2MQH A;  4JI2 L;  4C3H H;  4JI3 L;  3F2C A;  4JI6 L;  4L5R C;  4LF6 L;  4JI2 Q;  1R9T H;  4JI6 Q;  3KJP A;  2NVX H;  4DR3 L;  2A8V A;  1N33 L;  2ZJQ A;  2IT1 A;  2F4V L;  4BBR H;  4QIW E;  3W5O A;  4DR3 Q;  1IBK Q;  4GS3 A;  5C4X G;  1JT8 A;  3TS0 A;  2K5V A;  2NVY H;  2AWO A;  3CAM A;  4UP8 A;  4JYA Q;  3M9B A;  1SRU A;  5ELO A;  4DK3 C;  5C3E G;  4DV7 L;  5JEA J;  4A3I G;  4YWM A;  3CF5 A;  2E5L L;  3GO5 A;  1GVP A;  1XMQ L;  3EN2 A;  3H3V I;  4POG A;  2JA9 A;  2E5L Q;  1YZ6 A;  3GTQ H;  4AIM A;  3DM3 A;  4A3K H;  3KDF A;  3GTO H;  2I5M X;  4RG1 A;  4YWK A;  2OTJ A;  1VQM A;  5H1S E;  4JV5 L;  3S16 H;  3M7N A;  3I7F A;  1V9P A;  2OQ0 A;  3H0G H;  2JA5 H;  4JV5 Q;  1H95 A;  2ZM6 L;  1Q81 C;  1TWG H;  3HOY G;  4LFB Q;  3JAM c;  1EYG A;  3GTK H;  2ZM6 Q;  4UPA A;  3JC6 6;  3I4N G;  1IZ6 A;  3HOX G;  4WJ3 M;  3T1H Q;  4DV5 L;  1Q7Y C;  4BY7 H;  1UE7 A;  4DV5 Q;  1X9N A;  1I94 L;  2YTV A;  5JJL A;  4LUO A;  1TXY A;  3AEV A;  1BBW A;  1FL0 A;  3CCM A;  1XPO A;  4OWT B;  4GN3 B;  2ZJP A;  3STB D;  1N34 L;  1EQQ A;  4Y52 H;  1Z47 A;  4NXN L;  5IT9 c;  1N34 Q;  4A3G G;  1WOC A;  2YTX A;  4IPH A;  1X3G A;  4NXN Q;  1N36 L;  1Q8K A;  1XMO L;  1YVC A;  4BXX H;  1E22 A;  4GOP A;  1PH9 A;  4DAM A;  1VQL A;  4EQ5 A;  1K8G A;  1BBU A;  1QUQ A;  4K0K L;  5JEA G;  1IYJ B;  4DR7 L;  1BKB A;  4DPG A;  2JA7 H;  5LMU L;  3ICE A;  4A3L H;  1VQO A;  4X65 Q;  5LMU Q;  1SN8 A;  4B3S Q;  2KHI A;  1OXV A;  1S40 A;  1YJW A;  3L2P A;  3S1M H;  4Y7N H;  1HNZ L;  3CD6 A;  4JI8 L;  1HNZ Q;  3S1Q H;  1IL2 A;  3S1N H;  2WFW A;  3U4V A;  1QZH A;  3J80 c;  4KLK A;  3KJO A;  4DV1 Q;  2NVQ H;  2VL6 A;  4LFC Q;  4JI0 L;  4A3K G;  3KF8 B;  2CKZ B;  4HJA A;  5M5Y H;  4JI0 Q;  4OO1 I;  1Y1W H;  1WCM G;  2KCM A;  4X62 L;  2N3S A;  2WB1 G;  4HIK A;  4DV6 L;  1S3O A;  5IYB G;  4B3T L;  2JA5 G;  1I5F A;  4UP9 A;  2VQE L;  1CKO A;  1YEZ A;  1SFO H;  3RN5 A;  5FJ8 G;  1YBY A;  3A5U A;  4HJ7 A;  5M5X H;  2VQE Q;  3RNU A;  4B3T Q;  1PH5 A;  2GVA A;  1Q86 C;  2KBN A;  3PSI A;  1KQS A;  1OXX K;  1NJI C;  2AMC B;  4PZ7 A;  4A93 G;  3MEF A;  5GAD C;  3CPF A;  3CW2 C;  1NE3 A;  4DK6 C;  4IJL A;  3KDF B;  5C44 G;  1BVS A;  1PH2 A;  4XTC S;  3D0F A;  3L0O A;  2UXB Q;  2EIF A;  1NMG A;  1K9M C;  2IHF A;  1PHJ A;  1HZC A;  1W3S A;  1NTG A;  1I6H H;  2IHE A;  1ASY A;  2VZA A;  3AFP A;  3E9I A;  3CC7 A;  3T1Y L;  4BXX G;  4GKK Q;  4A3F G;  3T1Y Q;  4KI0 A;  3CCE A;  4BA1 I;  5IE8 A;  4A3I H;  2ES2 A;  4NXM L;  1K73 C;  2Q2T A;  1TWA H;  1XNR Q;  2JA7 G;  1I3Q H;  1U5K A;  2HHH L;  4A3L G;  1G29 1;  4R4O A;  1EQR A;  1P16 A;  2HHH Q;  2K5N A;  1B7Y B;  2OTL A;  4DV2 Q;  1D7Q A;  4UP7 A;  3RZD H;  4P75 A;  4QY7 A;  3U58 A;  3J81 j;  1LYL A;  3HOY H;  4DV0 L;  3UDI A;  3F2D A;  4GOP B;  4A3D H;  3B6Y A;  5M3F G;  4GN5 A;  4JI1 L;  1MJC A;  4A3E G;  3CCV A;  3S15 H;  1PH4 A;  4AQY L;  2L15 A;  2MO1 A;  3I2Z A;  3PIP A;  4AQY Q;  3K80 C;  4LFA L;  2KHJ A;  3CCS A;  4H02 A;  1W2B A;  1PH6 A;  4DR5 Q;  2R7Z G;  4B3R Q;  1S72 A;  3PUX A;  4R4I A;  1HZB A;  1KD1 C;  1X3F A;  2Z6K A;  2WAQ E;  4MZ9 A;  3GTG H;  4A3G H;  3A0J A;  4MTN A;  3WWV A;  2JQO A;  2VQF Q;  4P73 A;  2PQA B;  4JOI A;  2VS1 A;  1Q46 A;  4PG3 A;  4LF7 L;  3MXN B;  4X64 L;  4WJ4 A;  1HR0 W;  1IBM L;  4LF7 Q;  4BA2 I;  4LUZ A;  4DR2 L;  4X64 Q;  2LXK A;  1IBM Q;  1LUZ A;  1J6Q A;  1VQK A;  4JI3 Q;  1PYB A;  4LF6 Q;  2UXD L;  1X56 A;  2RF4 A; 
#chains in the Genus database with same CATH topology
 4OEM B;  3JAM i;  1ICW A;  4R8I A;  1SEB D;  4IPG A;  4JG2 A;  1XPU A;  1XMQ Q;  4RKL A;  1F9S A;  5C5L A;  1QE6 A;  3HRZ C;  2NN6 G;  5EKK A;  1GD7 A;  1EFW A;  3UE0 A;  3NTK A;  3VA7 A;  2PZT A;  3V2T A;  1E3P A;  4KN7 C;  5JVG 3;  3RMH A;  2XIW A;  4N8F A;  4CKB A;  1E1T A;  2WKD A;  2CWP A;  1B3A A;  4HJ9 A;  5KNB A;  5I2X A;  3CCU A;  1C4Q A;  1UEB A;  2XWJ B;  2F3I A;  5IP7 G;  3OTO L;  3C2P A;  5IWA L;  2ZTD A;  2UXC Q;  3J80 i;  4K0K Q;  2FIN B;  3VR5 A;  2WAQ G;  5DM7 3;  4LK1 C;  3Q8D A;  1Q1E A;  2K14 A;  3U50 C;  2PQA A;  1BQQ T;  2J7Z A;  5EPJ A;  5M3F H;  4JI8 Q;  3D31 A;  1H9K A;  1Q8I A;  3KF6 B;  1WTV A;  2OWO A;  2B2U C;  5KGU A;  5KRU A;  1TWC H;  5GRO A;  1CKN A;  4N9T A;  2JK8 A;  1VQG A;  4LF9 L;  5EPL A;  1FNW A;  4X62 Q;  1PYW D;  4KY7 A;  5HY6 A;  5M3F B;  2AQ1 B;  1E7Z A;  1ENA A;  2UUB L;  1VQC A;  1SBB B;  3GDE A;  1TWC B;  5CMD A;  2OF1 A;  1Q90 A;  2G9H D;  2K1B A;  5M3M G;  1PRT D;  2LFN A;  2SNS A;  2R7F A;  4HJ5 A;  1DOL A;  1PH1 A;  1CHQ D;  4OO1 H;  2Z6K C;  3RLN A;  4AYB G;  1HNX Q;  5IGC A;  3SK4 A;  1X65 A;  3RLO A;  4NXM Q;  2UUC L;  4J15 A;  3MAQ A;  1HA5 A;  2EY2 A;  1HR0 L;  4K6D A;  4N8X 1;  3RLF A;  4HSP A;  4FYD A;  4RFB A;  1VCI A;  4HIO A;  3CME A;  5JJZ A;  1JJG A;  5KND A;  1JB3 A;  2LY7 A;  2D9U A;  2EOT A;  4DNT B;  1I4G A;  1N9W A;  1N32 L;  2Y0S E;  5C0X J;  3I4O A;  4K6L A;  2YV5 A;  1TR5 A;  3J7Z C;  1HRJ A;  1LLR D;  4IUR A;  1HPC A;  4FXK C;  2BE5 C;  2EY5 A;  4KK7 A;  2PZU A;  2B63 H;  3PO3 B;  3BJU A;  4R4T A;  4U68 A;  2A1A A;  2A19 A;  4L8J A;  1VQ6 A;  3KK7 A;  3OSO A;  4B9X A;  3S1R H;  1II3 A;  2TMP A;  1CKN B;  2R92 G;  3KBX A;  3TSS A;  2B63 B;  5CV9 A;  1BF4 A;  3PIO 3;  1IHZ A;  3BVZ A;  1Q3L A;  4P74 A;  2NTT A;  2A74 C;  1Q82 C;  3S1R B;  5I9P A;  2NVT H;  5K5P A;  1LTS D;  4HR7 B;  1K28 A;  3K8A A;  5IYD G;  1HNW Q;  1C0A A;  4ZUI A;  2DGY A;  1C9O A;  1B9M A;  3M4O H;  1VQE A;  3CC4 A;  3KLW A;  1TS4 A;  4JYA L;  3SHL A;  3E9H A;  2CFM A;  3NP8 A;  2NVT B;  1YIJ A;  3HOU G;  1ZYR C;  3O13 A;  1GUT A;  3OW2 A;  4DAV A;  2C35 B;  3G71 A;  1PH3 A;  3W1G A;  5CV7 A;  4YWL A;  1ICF B;  3NPP A;  1I4R A;  2QCP X;  4QCL A;  1RDP D;  1BBX C;  4UAI A;  3NTI A;  1I4H A;  5JJI A;  4LJZ C;  2VNU D;  1EL0 A;  5CBA E;  4IFD G;  1CKM A;  2YU9 H;  1SMY C;  1NCV A;  1CTM A;  1LM0 A;  3MHB A;  3VA5 A;  3C3L A;  1EYC A;  2Z8L A;  1LT6 D;  3T4A C;  3LNN A;  3SR1 A;  2FFK B;  2HQL A;  4G4K A;  3DEP A;  4F87 A;  1JMC A;  3CMA A;  3HOZ H;  1O7Z A;  1MIU A;  4X65 L;  3HKZ G;  4A4I A;  1J5E Q;  1E24 A;  1A3T A;  1A15 A;  1D5M C;  1HJP A;  5I6W A;  3X3N A;  4KKS A;  3NEN A;  3HOV H;  4RCN A;  1VQ9 A;  3S14 H;  3CPW A;  1J8I A;  3TS2 A;  3HOW H;  3MXG A;  4DV4 L;  1SR3 A;  2ID0 A;  2Z4H A;  3C1F A;  2JA8 H;  3STB C;  4EQO A;  3HOV B;  3S14 B;  1GUN A;  1FJG L;  1KNE A;  3E0E A;  5CV4 A;  2V4D A;  4KTA A;  2HDL A;  4QUC A;  1XTD A;  3HOW B;  2K5D A;  5DEH A;  4BY1 H;  1JOK A;  1TS2 A;  3H09 A;  1A63 A;  2ZJR A;  2K7V A;  3A7A B;  4APV A;  1L1O A;  5C4X H;  3EJI A;  3VR3 A;  5CC4 A;  4GKK L;  1MKH A;  4BY1 B;  3I4L A;  2EPB A;  4CJ1 B;  1Q12 A;  1DGS A;  2LXJ A;  1XNQ Q;  3WDN A;  3GTL H;  3M3Y H;  2X6G A;  1IYU A;  4IOA A;  5C4X B;  3GV6 A;  3RUZ A;  3KBG A;  1I4X A;  2F0H A;  3I4M H;  1QVG A;  1SJE D;  4LWC A;  4BWG B;  1OTC A;  3KYH C;  4G7Z C;  3GTL B;  3I73 A;  2G5D A;  4TKO B;  3M3Y B;  2XSC A;  4B3R L;  1Y1W G;  1SXT A;  3I4M B;  2Y0S B;  2MO0 A;  2VUM H;  4GKJ Q;  2NZH A;  1S5F D;  3M4P A;  4KD3 A;  2L5T A;  3QOJ A;  3F1Z A;  4DXG A;  1GM5 A;  4RGN A;  4C3I H;  2B39 A;  2MQH A;  1QNK A;  4JI2 Q;  5E4W C;  1DXM A;  4JI6 Q;  3Q0A A;  2VUM B;  1MHW C;  2K6A A;  1IKL A;  3OIQ A;  4DR3 Q;  4GS3 A;  1JT8 A;  3UI2 A;  1RD9 D;  1UEA B;  1CK1 A;  2AWO A;  4F8M A;  1Y8P B;  4C3I B;  5JEA J;  4A3I G;  3CF5 A;  3H3V I;  1XWE A;  2B2V C;  1XMQ L;  5JVH 3;  1RF2 D;  4HMI A;  1SE2 A;  4ZLT F;  3GTO H;  3D4R A;  1PZK D;  2XWB B;  3TME A;  5ELD A;  3M7N A;  2JA5 H;  1Q81 C;  2MPM A;  1STE A;  4UPA A;  3HOX G;  1HUN A;  4CDF C;  4BY7 H;  2F0I A;  1UE7 A;  4DV5 Q;  2CW0 D;  2K05 A;  4LUO A;  2E76 C;  3GTO B;  2O5J C;  1XPO A;  2ZJP A;  2JA5 B;  4A3G G;  3T13 A;  3K57 A;  4BY7 B;  2E2D C;  4GOP A;  4DAM A;  4K0K L;  1K8G A;  1BBU A;  1QUQ A;  1U4L A;  1BO0 A;  4C3H G;  4DPG A;  2JA7 H;  1EZ8 A;  1ROD A;  3Q23 A;  4V19 0;  5CGK A;  1SN8 A;  1H9M A;  1PDQ A;  2EY1 A;  2VB3 X;  3CD6 A;  4ME5 A;  2K28 A;  4JI8 L;  2WFW A;  3U4V A;  2JA7 B;  4DV1 Q;  3KJO A;  2NVQ H;  4LFC Q;  4ZRZ A;  4JI0 L;  3ND9 A;  1ONL A;  4X62 L;  2WB1 G;  2Z1C A;  1S3O A;  5IYB G;  4B3T L;  4ZK9 B;  4CDE C;  4HJ7 A;  2DN8 A;  1TVX A;  4LAA A;  4B9W A;  1PH5 A;  1HHV A;  2AMC B;  2NVQ B;  2RCF A;  3MEF A;  5GAD C;  4DK6 C;  5C44 G;  1BVS A;  2QW7 A;  3D0F A;  3L0O A;  2CH4 W;  5J39 A;  2XNA C;  2EE1 A;  4IUU A;  1B4O A;  2IHE A;  1ASY A;  4BXX G;  3T1Y L;  4FO2 A;  4OEL B;  1A3V A;  2Z9H A;  3CCE A;  2LMC B;  4ZYS A;  3WOF A;  4NXM L;  1K73 C;  2Q2T A;  4MN3 A;  1S5D D;  4IAL A;  4A3L G;  3K0Y A;  4R4O A;  1X3P A;  2K5N A;  3MWY W;  4UP7 A;  3RZD H;  2F0V A;  3C1E A;  4QY7 A;  3U58 A;  1E2W A;  3TBI B;  2EYP A;  4GOP B;  1TU2 B;  4GN5 A;  1U9R A;  3I2Z A;  1PRT C;  3H6M A;  2JYO A;  3RZD B;  1W2B A;  1PH6 A;  1EY5 A;  4QMG A;  2F0Q A;  2B2T A;  3WWV A;  4TRD A;  1F2Z A;  2JQO A;  5ISR A;  4JOI A;  3BYY B;  3CU7 A;  4WJW A;  4LF7 L;  2PQE A;  4WJ4 A;  4LUZ A;  4R8N A;  1TQO A;  4X64 Q;  3A8K E;  3HGB A;  3KF8 A;  3TP5 A;  2MUY A;  5COR A;  2K5W A;  2UXD L;  1X56 A;  1SMX A;  1SYB A;  2F4V Q;  3CC2 A;  3FDT A;  1X32 A;  3OW7 A;  2B29 A;  4HIM A;  1KL9 A;  4QUF A;  4ALP A;  4C56 C;  4CGY B;  1YHA A;  5M5W H;  4OIK A;  3S1M B;  4ABN A;  4HED A;  5LMN W;  1WVL A;  2CVR A;  3DUZ A;  4HID A;  4AH6 A;  3K6O A;  4YY3 Q;  2HIV A;  4UHV A;  4YHH L;  1B44 D;  4J6H A;  1EU3 A;  3K7A H;  2BA1 A;  4JC0 A;  2QA4 A;  2BCO A;  3N52 A;  3I70 A;  2V1C C;  3I90 A;  5BN4 A;  3H3V H;  1JJC B;  1M90 C;  4CHT B;  5ELC A;  1UUP A;  3SK8 A;  3K7A B;  1SNO A;  1V1Q A;  1CZW A;  4I7Z C;  2EYH A;  2K75 A;  1STG A;  4ZUJ A;  3L7Z C;  3QB3 A;  3Q24 A;  1N36 Q;  4LF4 L;  3U4Z A;  4A3F H;  4HJ8 A;  1JJ2 A;  5JPN C;  4A3J G;  1U4M A;  2KVM A;  1PFS A;  1PH7 A;  4LF5 L;  1SYF A;  2A69 D;  1CT1 D;  5HGQ A;  5GAE C;  1CI3 M;  2DNC A;  3NWT A;  2BH8 A;  5GAG C;  1TKW B;  3BVM A;  1B1Z A;  1KLG D;  4KN4 C;  1LTI D;  4A3F B;  3CCR A;  4JI5 L;  1SJH D;  5C4Z A;  3EIV A;  1EY8 A;  1R4Q B;  1CFM A;  3CHB D;  1KIX A;  4QL5 A;  4LF8 Q;  4X6A H;  5IOC A;  1VQB A;  4JI7 L;  2NUC A;  1WI5 A;  1J5E L;  2F0N A;  5FLM G;  3S24 A;  1KNA A;  4IOC A;  4PMB A;  1UNS A;  2B8F A;  3OMG A;  2WAC A;  1EQV A;  4UDU C;  4WFN 3;  2M00 A;  4X3S A;  3PF4 A;  5CV8 A;  2CCZ A;  2BA0 A;  2EJG C;  2N8N A;  1RL2 A;  1F2M A;  5BR8 Q;  4K8J A;  4RHR A;  1WTO A;  1SDF A;  1MSG A;  3D4D A;  2K50 A;  3CXC A;  2PI2 E;  1V1O A;  4KD4 A;  2QIL A;  2F3V A;  1I50 H;  4A3M G;  3K81 C;  1RTO A;  3NEM A;  1TY0 A;  1CA6 A;  1BR9 A;  2R92 B;  3J81 L;  1F2Y A;  3C46 A;  1PTO C;  3TQY A;  2TSS A;  4POF A;  4IUV A;  2JXM B;  1XJV A;  4JBK A;  1NNX A;  2ICE C;  3UDF A;  4IPD A;  1I50 B;  5ELN A;  4GNX A;  5I6Y A;  3LX0 A;  1TWH H;  4A75 A;  1UWV A;  1XNQ L;  2B2Y C;  2B2W A;  4KY6 A;  1EY4 A;  4YCV A;  5IGB A;  1AZP A;  2IX0 A;  3DMU A;  3K7U C;  1GUW A;  4DAY A;  5EBD A;  2E74 C;  2I07 B;  3NBH A;  1MD2 D;  3KF6 A;  1TWH B;  3J81 E;  3S2D H;  4DR2 Q;  4XIG S;  2BDO A;  5IGG A;  4DV3 Q;  2MNA A;  4IFD H;  2KCT A;  1ILP A;  1FNV A;  3BZC A;  2UUA Q;  3S17 H;  3TRE A;  3ERO A;  1FGB D;  1SRO A;  4K2L A;  3PIO A;  3PV0 A;  3S2D B;  3BG3 A;  4OON A;  5FOB B;  4DUY L;  5C0X G;  4JI4 L;  5DLQ E;  2F0S A;  3R3O A;  3IL8 A;  1WD0 A;  3PF5 A;  1VDZ A;  2VW9 A;  1T5X D;  3S17 B;  5IGE A;  3I56 A;  4EQN A;  3RN2 A;  4NW2 A;  2WB1 E;  2O4X A;  2AWN A;  4OL7 A;  3R8B A;  4DR4 L;  3NEL A;  1B50 A;  3SGI A;  1F9R A;  2WP8 J;  3QO2 A;  5J22 A;  3ULL A;  2OCE A;  5AJ3 Q;  1E2Z A;  2VB2 X;  3FKI G;  1GHJ A;  2JA6 G;  5IT9 L;  4XT3 B;  3A55 A;  2UU9 L;  1OXT A;  2E2I H;  1L0X B;  2C5C A;  1MJE A;  2XGT A;  3A5Z B;  4LW1 A;  4GNX B;  2O2L D;  5J3B A;  1XPR A;  1L2F A;  2EZV A;  4RAU C;  3NTH A;  4M1U B;  1QNU A;  5ELF A;  2PI2 A;  2IL8 A;  2E2I B;  3R2I A;  3MA2 B;  1VQ5 A;  1NAP A;  2PW7 A;  3ER0 A;  1TWG B;  2KEN A;  4X66 L;  2F0P A;  2DUD A;  4DAY B;  4DFA A;  3PUZ A;  1IXR A;  3H15 A;  3NBH B;  5AFW A;  4BBS G;  1Y1V G;  1Z7T A;  2FHT A;  4K5X A;  2AKW B;  3FEW X;  4RGT A;  5IT9 E;  1STB A;  5IY0 A;  3TEH B;  1SLJ A;  1SYE A;  4G57 A;  3FVQ A;  3HFZ B;  5IP9 G;  4BBR G;  3PGZ A;  2AQ3 B;  1QVC A;  1L1O C;  2E8G A;  1X55 A;  4XDX A;  5D3D A;  3ERS X;  3P7J A;  3P75 A;  4DV1 L;  2HCC A;  4LFC L;  2CW0 C;  2HT1 A;  1ZEQ X;  2RKS A;  3AMU A;  4R4C A;  3T56 B;  3CCJ A;  4DUZ Q;  1L0Y B;  2ALY B;  3H0G G;  1A3U A;  4B3M L;  2A6E D;  2OQK A;  4IQZ A;  2RHQ B;  4ILW A;  1HCZ A;  1T5E A;  3TDQ A;  1T9H A;  1Y1W B;  3E0J A;  3J81 i;  3SK5 A;  1EOV A;  2R93 G;  1JWM D;  1CSP A;  1EIF A;  2K52 A;  3PO3 H;  5I4D A;  3FRP B;  3A54 A;  1BOS A;  2E75 C;  1KAB A;  4NP5 A;  3OOC A;  1W6K A;  1IBL Q;  1CM9 A;  2EJM A;  5LL6 S;  3J81 c;  1PV4 A;  4L5Q A;  1RTN A;  2JP1 A;  4V0B A;  4DR1 Q;  4DK1 A;  3I3C A;  5LMN Q;  1VQ8 A;  4DKA C;  4ZKC B;  3TRZ A;  4H13 C;  2PW5 A;  4F88 A;  3ONA B;  4CDC C;  3HOX H;  4L5T A;  2F52 A;  1JWS D;  1I4P A;  3EFX D;  4RA8 A;  1DOK A;  2RHS B;  3H91 A;  4P72 A;  2XVS A;  2QEX A;  3MFG A;  3TN2 A;  2H5X A;  2IWH A;  4GLX A;  2KCC A;  3HOX B;  1MGS A;  3GTP H;  5D3I B;  1JB7 A;  4GZY C;  3CP0 A;  3EA6 A;  5COY A;  3LWE A;  4K14 A;  1CZG A;  4C3H H;  3F2C A;  1EY6 A;  1SNM A;  3KJP A;  2XRS D;  4KKU A;  2A8V A;  2EYJ A;  2F4V L;  1IKM A;  5L37 A;  3TS0 A;  4FVM A;  3MTS A;  3NUC A;  2NWG A;  3CAM A;  4UP8 A;  3GTP B;  4DK3 C;  5C3E G;  1G8Z D;  1GVP A;  4C3H B;  4XQQ A;  2E5L Q;  2C9O A;  4XQJ A;  2I5M X;  4RG1 A;  4YWK A;  4YIJ A;  4ZCK A;  3S16 H;  3I7F A;  1V9P A;  4JV5 Q;  2ZM6 L;  4LFB Q;  3HOY G;  5A35 A;  3T1H Q;  4KKT A;  1X9N A;  3I91 A;  5EJW A;  1TXY A;  3VYR A;  3K5O A;  3AEV A;  1BBW A;  3CCM A;  2WB1 B;  3S16 B;  5BN3 A;  1AP0 A;  3ND8 A;  5IT9 c;  4IZ8 A;  1N34 Q;  1WOC A;  3QIA A;  2YTX A;  5EQ0 A;  1X3G A;  5F2D A;  3URY A;  5JPM C;  1N36 L;  4NXN Q;  1YVC A;  5DAU A;  2A68 D;  4BXX H;  4G7H C;  3G6J B;  3Q6S A;  1VQL A;  5JEA G;  1BKB A;  1ET9 A;  5LMU L;  3ICE A;  4A3L H;  1VQO A;  5ELB A;  1K3B C;  3J7Y W;  5KYI A;  2KHI A;  4B3S Q;  3CRL C;  4KHV A;  3S1M H;  3BDL A;  4Y7N H;  1FR3 A;  3KLR A;  1HNZ L;  2F03 A;  1KDB A;  3K5L A;  3S1Q H;  3S1N H;  3MXN A;  1STN A;  2N88 A;  1GOZ A;  1NR4 A;  4A3K G;  2CKZ B;  1D5Z C;  4DXF A;  1BCP B;  1EFI D;  2RDF A;  2KCM A;  1AZQ A;  2N3S A;  1A2U A;  3HG9 A;  4UP9 A;  1EEI D;  1MBY A;  4Y7N B;  2DJF C;  2VQE L;  3RN5 A;  1SFO H;  1YBY A;  3A5U A;  4DN4 M;  5M5X H;  1B2T A;  3S1Q B;  3OIP A;  5I9O A;  3S1N B;  3V96 A;  2KBN A;  1KQS A;  1NJI C;  4PZ7 A;  3TP8 A;  1RCV D;  2F0E A;  3U9S A;  1EIG A;  1NE3 A;  2A69 C;  5EPK A;  3H3V C;  4XTC S;  2UXB Q;  1EY7 A;  2EIF A;  4QF4 A;  1SFO B;  2X6L A;  5M5X B;  1QIL A;  1W3S A;  4EVO A;  4S3S A;  2M9V A;  4BA1 I;  4B08 A;  3PQI A;  3QOL A;  1XNR Q;  5IGD A;  1G29 1;  3FMC A;  2JSO A;  2HHH Q;  1B7Y B;  4DV2 Q;  1F9Q A;  4P75 A;  1JWU D;  2QDB A;  4KV6 A;  4H44 C;  4HMJ A;  1H9S B;  1JR0 D;  5M3F G;  1MJC A;  3S15 H;  1PH4 A;  4ODG A;  2MO1 A;  4AQY Q;  2ZXR A;  3M4Y A;  3PUX A;  4R4I A;  1Y8O B;  1TY2 A;  2Z6K A;  1KD1 C;  2RA4 A;  2WAQ E;  4MZ9 A;  3GTG H;  4MTN A;  2VQF Q;  4P73 A;  1E2V A;  3S15 B;  3MXN B;  2EYL A;  4DR2 L;  1FNU A;  1Y8N B;  1IBM Q;  1VQK A;  4JI3 Q;  3GTG B;  1WYD A;  5FO8 B;  4OO1 G;  1B53 A;  1F9P A;  1CSQ A;  5C3X A;  4HCS A;  3AYH B;  1Y14 B;  3HP3 A;  2E2H H;  2R61 A;  4DV7 Q;  4H0L C;  1WTP A;  3ERQ A;  1DON A;  4MNO A;  4R1J A;  1K0R A;  4JW0 A;  2EDG A;  1G6P A;  2KQ3 A;  4HTH A;  5TSS A;  1WCM H;  4DU9 A;  2PO4 A;  2HDM A;  3NXW A;  3PUV A;  2L55 A;  2EYO A;  5FJ8 H;  2E2H B;  1JE5 A;  2A73 B;  4C1N I;  4A3D G;  1BDO A;  2K5Q A;  3HKS A;  4A93 H;  4AYB E;  1VQH A;  1O7Y A;  2F0J A;  2MGS A;  1WCM B;  2QGQ A;  1LTL A;  1QG7 A;  1PA6 A;  1Y69 U;  2K04 A;  4K5W A;  1LTT D;  2NZO A;  3VYS A;  1BXT A;  4A93 B;  5A2Q L;  2UXC L;  2D0O A;  3K0X A;  3OPO A;  1D2B A;  1PZI D;  5C4J B;  4QQB X;  3GTM B;  4TSS A;  1D1K A;  5CBE E;  1Z6H A;  2CQA A;  4XQN A;  2NYZ D;  1O7I A;  4LNQ A;  3J7A F;  1MSH A;  4OIJ A;  3BU2 A;  5EKL A;  1E1O A;  1V8Q A;  4PZ6 A;  1NY4 A;  4A3E H;  1KXL A;  4IO9 A;  2IY5 B;  2GVB A;  3CCQ A;  3W3A A;  1X54 A;  2I5H A;  5D14 A;  4IUP A;  3IRB A;  3NQT A;  2R7Z H;  4DV6 Q;  2RCN A;  5A2Q E;  3EBE A;  3SEB A;  3KLS X;  4A3E B;  2Q2U A;  4ID6 A;  2UUB Q;  4GLA C;  1B70 B;  2ZTE A;  1A62 A;  1OXU A;  1YHQ A;  4A3C G;  2R7Z B;  2FXQ A;  4DUZ L;  1SYD A;  5K36 H;  1HUM A;  1AE3 A;  2YTY A;  4DNR B;  1HNX L;  1D1I A;  3I8Z A;  1PVO A;  1QB5 D;  2SOB A;  4OWW B;  3AFQ A;  1A6X A;  2YYZ A;  2H4O A;  1YNX A;  2JEA I;  1DD2 A;  3ZJY C;  5GQO A;  1U0L A;  2CWA A;  4DAP A;  2E2J H;  1HR0 Q;  4DA2 A;  2NN6 H;  4KHZ A;  2PNR C;  2F0T A;  4ME3 A;  1ML0 D;  4LMQ D;  4JK1 C;  4DV0 Q;  2Q8R E;  3IFD A;  5IOD A;  4IFD I;  1AH9 A;  2E2J B;  4LFA Q;  3HOZ G;  3IAY A;  1X6O A;  4DR1 L;  1VF7 A;  2N78 A;  5LMN L;  2JA6 H;  4R4Q A;  1QJO A;  5IP7 H;  3IKJ A;  1LAB A;  2VXW A;  1PYS B;  2Q2H A;  2IX1 A;  4K2K A;  4CJ2 C;  3T51 B;  4RMF A;  1ZYR D;  1O78 A;  2EY6 A;  2XTI A;  1G2S A;  1JE4 A;  2JA6 B;  2JA8 G;  4KY5 A;  3DWQ A;  2BH2 A;  2SDF A;  1KC8 C;  3FPU B;  4KHP Q;  3HKZ E;  3IFT A;  5T1G A;  4JVZ A;  4UY8 C;  2FJ2 A;  4HAE A;  1AN8 A;  4MTK A;  2WAQ B;  4BY1 G;  4RKB A;  5E7N A;  1PH8 A;  1Y1V H;  1EY9 A;  2HUG A;  3BS1 A;  1HNW L;  2A6H D;  2VY3 A;  1BCP F;  1RHP A;  5IP9 H;  3JAM L;  3A74 A;  2Q8I B;  5IYC G;  2F0M A;  4OX9 Q;  4C3J G;  2F0D A;  3NHH A;  1Y1V B;  3SK6 A;  5M3M H;  4TQU S;  2HIX A;  4A3B G;  3LWU A;  2JEB I;  1YHB A;  3G4S A;  4BBR B;  5EGT A;  4LFB L;  3I4M G;  1RIP A;  1EOT A;  1Q1B A;  2NZ1 D;  2XN9 C;  2Y0S G;  3G6E A;  4WJ3 M;  1CQF A;  1K3R A;  3UDX A;  1SNQ A;  3T1H L;  1IYV A;  3A8I E;  1V1P A;  2EJF C;  5M3M B;  2DY8 A;  1YJ9 A;  4K5V A;  4ZKB B;  2ATW A;  1NSN S;  1EY0 A;  1L0W A;  1SE4 A;  1LT3 D;  2Z6B A;  3GV3 A;  1B8A A;  3LGJ A;  4OXP A;  2R93 H;  4MIU A;  4AYB B;  1KDC A;  2VUM G;  2EQS A;  3J80 L;  3FHW A;  2D62 A;  2JN4 A;  1X3E A;  2B2V A;  4C3I G;  5C4H A;  3J7A V;  1VQN A;  2N49 A;  4B3S L;  2R93 B;  2F0G A;  3I55 A;  2WIN B;  1SSO A;  1N8R C;  1NBW A;  3QWN A;  1FVI A;  2KHS A;  1A8V A;  3H94 A;  3W2D A;  3VDY A;  1WTQ A;  2X69 A;  2RSO A;  2I0Q A;  2KA7 A;  1WTW A;  1VQA A;  3PO2 G;  4DR6 Q;  3BZK A;  3M7G A;  4FDB A;  5EAY A;  4DGZ A;  1HA6 A;  1LV9 A;  4MHE A;  2R92 H;  4PMW A;  2KEC A;  1P8L A;  2IX3 A;  5KIX A;  4NMZ A;  4DV4 Q;  2CHB D;  4KJO A;  1XYI A;  5HUR A;  4IUT A;  1B9N A;  1VQP A;  2F0W A;  3E6Z X;  2A68 C;  1EQT A;  4GLV B;  4BY7 G;  1WFQ A;  1FJG Q;  2CQO A;  1VMC A;  3KFU A;  3J7A 5;  5C6A A;  3SE0 A;  2JJQ A;  1PLF A;  2L4N A;  5KEE A;  2UXB L;  3CRK C;  1WTH A;  5IYD H;  2N55 A;  4O42 A;  4L5S A;  1DOM A;  2B8G A;  3MXU A;  4J1M A;  3UDG A;  1E0B A;  1HFG A;  1VQD A;  1V1P B;  1VQI A;  1AE2 A;  4M8A A;  2RSN A;  4ZAI A;  5C3E H;  3HOU H;  1XNR L;  4OWX B;  3QG1 A;  3VR2 A;  1HTP A;  4DV2 L;  1EIY B;  1YI2 A;  2AUJ D;  2I46 A;  3P20 A;  5C3E B;  3HOU B;  1PMR A;  4ZQ3 A;  5E4X A;  3M4Q A;  1KRT A;  1TS3 A;  4EQP A;  1KHI A;  3GQB A;  1ASZ A;  2B3G A;  5M9O A;  4GKJ L;  5BN5 A;  3NE5 B;  4R9W A;  5E1F A;  2VQF L;  4JCV E;  2F0O A;  4PQX A;  1JOR A;  2L11 A;  2AQ2 B;  2K4K A;  2HD3 A;  4JI2 L;  4JI6 L;  4JI3 L;  4L5R C;  4RH6 A;  3VR4 A;  1R9T H;  2HQE A;  4O1N A;  4DR3 L;  2ZT9 C;  2ZJQ A;  2IT1 A;  4QIW E;  3W5O A;  1IBK Q;  2K5V A;  2NVY H;  3S9W A;  5JAV A;  4DV7 L;  5ELO A;  3K5M A;  4YWM A;  2ZXO A;  3GO5 A;  3EN2 A;  1GUG A;  3HKZ B;  1R9T B;  4AIM A;  3DM3 A;  3A56 A;  4A3K H;  1PFB A;  3VR6 A;  1KDA A;  2NVY B;  1TWG H;  3JAM c;  1EYG A;  3GTK H;  3I4N G;  3JC6 6;  1IZ6 A;  4DV5 L;  1AEX A;  1Q7Y C;  1GXD C;  1O7L A;  1HXY D;  4A3K B;  1QWY A;  5LL6 X;  1I4Q A;  1SNC A;  3GP7 A;  5C5M A;  4OWT B;  1EQQ A;  4Y52 H;  1HTL D;  4XYQ A;  3GTK B;  4IPH A;  2RQX A;  1STY A;  2PPB C;  1E22 A;  1LT5 D;  5FO9 B;  1CQV A;  1IYJ B;  4J8Q A;  3T53 B;  1S40 A;  3ITP A;  1DM0 B;  1KTK A;  1EYD A;  4OHJ A;  1SYC A;  3N6R A;  5KYL A;  4L63 B;  3SDZ A;  5C3W A;  2L0C A;  1QZH A;  3J80 c;  1LT4 D;  3BVG A;  4KJN A;  2HCI A;  4JI0 Q;  1Y1W H;  3I72 A;  4DV6 L;  1MI2 A;  1I5F A;  4CJ0 B;  1YEZ A;  4B3T Q;  3RNU A;  1F77 A;  4U67 3;  3MC0 B;  2K03 A;  3CPF A;  1STA A;  1PRT B;  1AFP A;  2PCF B;  4BS9 A;  1ESF A;  4PV1 C;  1EYA A;  1I6H H;  1HQM C;  3AFP A;  2SEB D;  1HQR D;  4A3F G;  1NUC A;  3T1Y Q;  2ES2 A;  4A3I H;  3E5S A;  3NWS A;  2QF7 A;  1I3Q H;  2DY7 A;  1ET6 A;  1EQR A;  1P16 A;  5FKA C;  5FLX L;  1LTB D;  2OTL A;  1D7Q A;  1S5B D;  1I6H B;  2QKI C;  3J81 j;  3PIP 3;  4DV0 L;  4CBV A;  4A3D H;  4A3I B;  4NKL A;  2OT2 A;  3CKI B;  1I3Q B;  4G7O C;  2J4X A;  4H7B A;  4LFA L;  2KHJ A;  1IL8 A;  2PYK A;  4DR5 Q;  5CV5 A;  1HZB A;  1A2T A;  1SND A;  4A3G H;  4A3D B;  4WOR A;  3G7L A;  2PQA B;  2VS1 A;  4IUN A;  2MHV A;  4X64 L;  1HR0 W;  4K8I A;  4LF7 Q;  4BA2 I;  4FXD A;  5FLX E;  2LXK A;  1K8M A;  1J6Q A;  5EBC A;  1PYB A;  4LF6 Q;  1RKN A;  4A3G B;  2RF4 A;  2MJ8 A;  2DNE A;  4CKE A;  5LHY 1;  2UXD Q;  4RGO S;  1VMP A;  4KHP L;  1N33 Q;  1ENF A;  1LTA D;  3DWP A;  2D0P A;  3DWA A;  1YIT A;  5NUC A;  4Q5V A;  4GOP C;  3MFY A;  3PUY A;  1GUS A;  4YCU A;  3Q22 A;  2I5L X;  1SE8 A;  1VQJ A;  2B2Y A;  1JQY D;  1IW7 D;  4YY3 L;  5IYB H;  1G51 A;  4YHH Q;  1D5X C;  4OX9 L;  1PXU A;  2ZTC A;  1H9J A;  1I6V C;  4XYO A;  1TT2 A;  4GN4 B;  1I94 Q;  4QIW B;  5C44 H;  4A3C H;  4DF7 A;  3E3X A;  5GAH C;  1S5C D;  3UE1 A;  3SXH A;  3M4O B;  2H1E A;  1H9S A;  1XMO Q;  1SNP A;  1YNJ D;  4LF4 Q;  5C44 B;  4DR7 Q;  3V05 A;  1W6J A;  4LF5 Q;  5JOB A;  1PTO H;  1VQ7 A;  3L9A X;  1ILQ A;  4A76 A;  2A6H C;  2K5H A;  1VF5 C;  2AHO B;  3K58 A;  4EX5 A;  1TII D;  2WV6 D;  3DM1 A;  1GKH A;  2BDN A;  2F1M A;  4JI5 Q;  4LF8 L;  1JOO A;  1PFN A;  1LTR D;  2KJX A;  2YU9 B;  1PTO B;  4HCE A;  3DEO A;  3OWF A;  3KOJ A;  1BCP D;  1PTO D;  1KAA A;  3M85 A;  4JI7 Q;  2JE6 I;  2GN5 A;  4Q0F A;  1DJR D;  5C0X I;  2D5D A;  5G3L F;  1TWF H;  4DR6 L;  3W1B A;  2O5I C;  4YCW A;  3QJY A;  1OO9 B;  2NN6 I;  4FP5 D;  3HOZ B;  5BR8 L;  1EWI A;  3QR8 A;  2LSS A;  2B2T C;  5D65 A;  1KRS A;  1HZ9 A;  4IUQ A;  3GTJ H;  4LUV A;  1TWF B;  4JOI C;  2EYF A;  2Q2I A;  1C8C A;  5HGT A;  3VYT A;  2B2U A;  1X3Q A;  5DNF A;  1EU4 A;  3TZD A;  1YNN D;  1GUO A;  1S5E D;  4HSV A;  1GHK A;  4I65 A;  2JA8 B;  2F0L A;  1JIC A;  3BZD B;  4NB3 A;  1GO3 E;  3GTJ B;  2PNH A;  4JBJ A;  4RWS C;  2R6G A;  1FGU A;  5IYC H;  1QVF A;  5CYU A;  3MXP A;  1UE5 A;  4JI1 Q;  4C3J H;  4RCO A;  5DM6 3;  1A0I A;  4A3B H;  2Z0S A;  1EUJ A;  3D6C A;  3A7L A;  1K83 H;  5FLX c;  1M1K C;  2QEJ C;  2WKC A;  1C7Y A;  4NPS A;  4QGU A;  2K01 A;  2GA4 B;  3MEH A;  4C3J B;  4A3J H;  1STH A;  1PFM A;  4A3B B;  2AUK A;  4DV3 L;  1K83 B;  2EXZ A;  1K8A C;  3ZYY X;  4P2C B;  2UUA L;  4Z9C B;  1EWC A;  3F2U A;  5J1Z A;  3U9O A;  2MP1 A;  1WJJ A;  4A3J B;  3BDC A;  4OGQ C;  2SNM A;  1QZG A;  2EVB A;  4DUY Q;  4IFD J;  4JI4 Q;  2RDH A;  3AB9 A;  5CV6 A;  2F0K A;  3K59 A;  1UAP A;  5FLM H;  1EEF D;  1IBK L;  3PO3 G;  4QJF A;  1VQ4 A;  1DCZ A;  3RZO H;  3F8T A;  1VS0 A;  3PMF A;  1UE6 A;  4FNF A;  1K0S A;  2LKV A;  5C4J H;  1NMF A;  3CQZ H;  5EKI A;  3PO2 H;  4DR4 Q;  2ASB A;  3GTM H;  4JPB W;  4L6T B;  2PZW A;  5AJ3 L;  1D6E C;  2MFI A;  3GD7 A;  1PRT F;  2B63 G;  4JBW A;  1EWH A;  4F7X A;  1EIH A;  3RZO B;  4TVA B;  1L1O B;  3F2B A;  2UU9 Q;  3OTO Q;  1V43 A;  1FD7 D;  3AQQ A;  1HZA A;  3CQZ B;  5IWA Q;  1WTX A;  3PO2 B;  4PZ8 A;  3PUW A;  4A3M H;  2ZXP A;  1OXS C;  2F3W A;  4P71 A;  3ULP A;  1YJN A;  4I7A A;  4DNI A;  1U4R A;  4X3K A;  3HEJ A;  3SVM A;  2J0T D;  1KLU D;  4DK0 A;  5IIF A;  4X66 Q;  4A3M B;  1CA5 A;  3WOE A;  1AW7 A;  1KAW A;  1Z9F A;  3A8J E;  1TS5 A;  1F2L A;  3BYT B;  4JBM A;  4LF9 Q;  2PMZ E;  3NQI A;  1BUV T;  2R7D A;  3OYY A;  3S2H H;  2Q8T A;  4C2M H;  4CKC A;  2EYM A;  4C1N K;  4FF4 A;  4EGV A;  4GNX C;  1JCK B;  1DYQ A;  3P1H A;  1UE1 A;  1CUK A;  2BE5 D;  2KOL A;  2EXD A;  2B2W C;  2F0F A;  1NR2 A;  4FF1 A;  2RVL A;  3DLL A;  3S2H B;  4C2M B;  3OHX C;  4XXE A;  3RR5 A;  4IN3 A;  2RBM A;  1K8O A;  4B3M Q;  3HS0 C;  5C0X H;  1EZ6 A;  1SAP A;  2P5Z X;  3KLS A;  2UUC Q;  1DZ1 A;  4FF3 A;  4X3U A;  4NDX A;  3EVQ A;  4O2D A;  3L3O C;  1HFN A;  3DHQ A;  1IBL L;  1N32 Q;  1QOH A;  3PCO B;  4KMU C;  1ZXT A;  3R2T A;  3FKI H;  1BNZ A;  5I2Y A;  3BDO A;  1HH2 P;  3HOV G;  1D8L A;  2A6E C;  4O0A A;  3ULJ A;  1LAC A;  1SYG A;  2BOS A;  1LTG D;  3I4N H;  2QDL A;  3RD4 A;  2K32 A;  2KCN A;  1QUQ B;  1VQF A;  4WRD A;  3OWE B;  3HOW G;  3FKI B;  4DR5 L;  3G48 A;  3CCL A;  4IPC A;  3HZX A;  4ULL A;  3I4N B;  5JJK A;  4IJH A;  3FP9 A;  1FYC A;  1S4Z A;  4BBS H;  2FMM A;  5CR3 A;  1GJX A;  1SMY D;  4LF6 L;  2K33 A;  4RHS A;  1PZJ D;  2NVX H;  1PTO F;  5FO7 B;  2D2C C;  1N33 L;  5C4X G;  4BBR H;  1M8A A;  5IGF A;  2NTS A;  4JYA Q;  3M9B A;  1SRU A;  4BBS B;  2E5L L;  4POG A;  2JA9 A;  1YZ6 A;  2G9D A;  2M2L A;  1J9O A;  2R3Z A;  3TP6 A;  3AU7 A;  3GTQ H;  2NVX B;  3NBI A;  3KDF A;  3T16 A;  4N9P A;  1H9R A;  2OTJ A;  1VQM A;  5H1S E;  4JV5 L;  2OQ0 A;  2Z4I A;  3H0G H;  2ZM6 Q;  3OMC A;  3MVV A;  2KEE A;  3D6W A;  2CH4 A;  5M5W B;  3D8G A;  2YTV A;  1I94 L;  3GTQ B;  5JJL A;  3KUP A;  1FL0 A;  4CDD C;  4GN3 B;  3JAM E;  3H0G B;  3STB D;  1N34 L;  1M4V A;  1Z47 A;  5T1I A;  4NXN L;  3NK9 A;  5FK9 C;  2F0U A;  1Q8K A;  1G91 A;  1XMO L;  1PH9 A;  4EQ5 A;  3K5N A;  1WTR A;  2IJ0 A;  4DR7 L;  2RDG A;  4X65 Q;  5LMU Q;  1IW7 C;  1OXV A;  1U4P A;  1ENC A;  1YJW A;  2KED A;  4FF2 A;  3L2P A;  4HN7 A;  2OEO A;  3D4W A;  1G2T A;  1B3Q A;  1HNZ Q;  1WD1 A;  1IL2 A;  2IPK D;  4KLK A;  1JOQ A;  2F4I A;  2LS0 1;  2VL6 A;  5E3F A;  3KF8 B;  4HJA A;  2KUM A;  5M5Y H;  2IW3 A;  1XTC D;  4OO1 I;  1ZKO A;  1WCM G;  4HIK A;  1G6Z A;  2JA5 G;  1LO5 D;  1O80 A;  1CKO A;  2L9H A;  3EQL C;  4X3T A;  5FJ8 G;  3J80 E;  1H95 A;  2VQE Q;  2GVA A;  2OXP A;  1Q86 C;  3PSI A;  1OXX K;  3MZ5 A;  4A93 G;  1YNJ C;  2XRQ D;  2PMZ B;  3CW2 C;  5M5Y B;  4IJL A;  3NSW A;  3KDF B;  1PH2 A;  3TP7 A;  1NMG A;  1K9M C;  2IHF A;  1PHJ A;  1HZC A;  1NTG A;  2VZA A;  3E9I A;  3CC7 A;  4PMC A;  4GKK Q;  4KI0 A;  5IE8 A;  2JA7 G;  1TWA H;  2NB0 A;  1U5K A;  2HHH L;  3VYU A;  2WII B;  4PNY A;  1BCP C;  4FXG C;  4XT1 B;  3D3R A;  5KNC A;  1LYL A;  3TZU A;  3HOY H;  2ICI A;  1R4P B;  3UDI A;  2ENB A;  3F2D A;  1SE3 A;  3B6Y A;  1CHP D;  1TWA B;  4JI1 L;  4A3E G;  1C48 A;  3CCV A;  4AQY L;  3R93 A;  2L1B A;  4E6I A;  2L15 A;  1XX8 A;  3PIP A;  3K80 C;  3CCS A;  1QCB D;  4H02 A;  2NBF A;  2R7Z G;  4B3R Q;  1S72 A;  1ESR A;  3HOY B;  1X3F A;  1JC7 A;  3A0J A;  4RGM A;  5G3L D;  2A5H A;  2L12 A;  1Q46 A;  1XXG A;  2DJG C;  2FMC A;  4PG3 A;  1RJT A;  3DXJ C;  1IBM L;  5JEA H;  5ELE A;  1LUZ A;  1YNN C;  4QB4 A;  3FPP A;  5K36 G;  3X3M A; 
#chains in the Genus database with same CATH homology
 1WYD A;  2UXD Q;  4KHP L;  4OO1 G;  1N33 Q;  2F4V Q;  3CC2 A;  1CSQ A;  2D0P A;  3AYH B;  1Y14 B;  3JAM i;  2B29 A;  4HIM A;  2E2H H;  1YIT A;  4GOP C;  4DV7 Q;  1KL9 A;  3PUY A;  4IPG A;  4JG2 A;  4MNO A;  4R1J A;  1SMX A;  1K0R A;  4YCU A;  2I5L X;  4ALP A;  1XPU A;  1YHA A;  5M5W H;  1XMQ Q;  1SE8 A;  1G6P A;  1VQJ A;  5LMN W;  1WCM H;  4YY3 L;  4HID A;  4AH6 A;  2NN6 G;  5IYB H;  4YY3 Q;  2HIV A;  1GD7 A;  3PUV A;  1EFW A;  3UE0 A;  4YHH L;  5FJ8 H;  1JE5 A;  3K7A H;  1G51 A;  2BA1 A;  4JC0 A;  4YHH Q;  4A3D G;  4OX9 L;  3HKS A;  2ZTC A;  1E3P A;  2QA4 A;  4A93 H;  4AYB E;  1VQH A;  4GN4 B;  1I94 Q;  1E1T A;  2V1C C;  2QGQ A;  1LTL A;  2CWP A;  5C44 H;  3H3V H;  1PA6 A;  4A3C H;  1JJC B;  1M90 C;  4HJ9 A;  5GAH C;  3CCU A;  1UEB A;  2F3I A;  3UE1 A;  2NZO A;  1V1Q A;  5IP7 G;  2K75 A;  3OTO L;  3L7Z C;  1N36 Q;  4LF4 L;  2UXC L;  5IWA L;  1XMO Q;  2D0O A;  3K0X A;  3U4Z A;  2ZTD A;  4HJ8 A;  4A3F H;  1JJ2 A;  4A3J G;  4LF4 Q;  2UXC Q;  4QQB X;  3J80 i;  4K0K Q;  1PFS A;  1PH7 A;  4LF5 L;  4DR7 Q;  4LF5 Q;  2WAQ G;  5HGQ A;  5GAE C;  1VQ7 A;  4A76 A;  2BH8 A;  1O7I A;  2K5H A;  4LNQ A;  3Q8D A;  2AHO B;  1Q1E A;  2K14 A;  5GAG C;  4EX5 A;  3U50 C;  2PQA A;  3BU2 A;  1E1O A;  3CCR A;  4PZ6 A;  4JI5 L;  5M3F H;  3EIV A;  1GKH A;  1NY4 A;  3D31 A;  4JI8 Q;  4A3E H;  1KXL A;  4JI5 Q;  4IO9 A;  4LF8 L;  3KF6 B;  1KIX A;  2OWO A;  2IY5 B;  4QL5 A;  4LF8 Q;  4X6A H;  1TWC H;  2GVB A;  1VQB A;  1CKN A;  5GRO A;  3CCQ A;  1X54 A;  2I5H A;  2JK8 A;  4JI7 L;  1VQG A;  3IRB A;  1WI5 A;  3KOJ A;  1J5E L;  3M85 A;  4LF9 L;  4JI7 Q;  2R7Z H;  4X62 Q;  2JE6 I;  4DR4 Q;  5FLM G;  4DV6 Q;  3S24 A;  2RCN A;  2GN5 A;  4IOC A;  5HY6 A;  1E7Z A;  3EBE A;  2UUB L;  5C0X I;  1VQC A;  2Q2U A;  1TWF H;  2UUB Q;  4DR6 L;  3GDE A;  4GLA C;  3W1B A;  3PF4 A;  1B70 B;  2ZTE A;  4YCW A;  1A62 A;  1OXU A;  1YHQ A;  5M3M G;  2CCZ A;  2NN6 I;  2BA0 A;  2FXQ A;  4A3C G;  5BR8 L;  1EWI A;  2R7F A;  2N8N A;  4DUZ L;  1RL2 A;  4HJ5 A;  5BR8 Q;  1PH1 A;  2LSS A;  1AE3 A;  2Z6K C;  2K50 A;  2YTY A;  1KRS A;  3RLN A;  1HZ9 A;  3CXC A;  1HNX L;  3GTJ H;  1PVO A;  2PI2 E;  4AYB G;  4LUV A;  4JOI C;  2Q2I A;  1HNX Q;  4OWW B;  1X65 A;  3RLO A;  3AFQ A;  1I50 H;  2YYZ A;  4A3M G;  3K81 C;  4NXM Q;  3NEM A;  2UUC L;  4J15 A;  1YNX A;  2JEA I;  3ZJY C;  1HR0 L;  5GQO A;  1U0L A;  2CWA A;  3RLF A;  3TQY A;  1HR0 Q;  2E2J H;  1VCI A;  4POF A;  4HIO A;  3CME A;  1XJV A;  4NB3 A;  1JJG A;  1GO3 E;  4KHZ A;  4JBK A;  2PNH A;  4JBJ A;  4ME3 A;  3UDF A;  4IPD A;  2R6G A;  4DV0 Q;  1FGU A;  5ELN A;  5IYC H;  1N9W A;  1N32 L;  1QVF A;  4GNX A;  2Y0S E;  5C0X J;  1UE5 A;  3I4O A;  4JI1 Q;  2YV5 A;  4C3J H;  4IFD I;  1AH9 A;  3J7Z C;  1TWH H;  4A75 A;  1A0I A;  1UWV A;  4LFA Q;  1XNQ L;  2Z0S A;  1EUJ A;  3HOZ G;  4A3B H;  1K83 H;  1X6O A;  5FLX c;  2N78 A;  4DR1 L;  2B63 H;  1M1K C;  4YCV A;  5LMN L;  3BJU A;  2IX0 A;  4R4Q A;  3K7U C;  4R4T A;  2JA6 H;  5IP7 H;  1C7Y A;  2A1A A;  4NPS A;  4QGU A;  1PYS B;  2A19 A;  2Q2H A;  2IX1 A;  1VQ6 A;  4A3J H;  3KF6 A;  4RMF A;  3S1R H;  3S2D H;  1CKN B;  4DV3 L;  4DR2 Q;  4XIG S;  2XTI A;  2R92 G;  4DV3 Q;  2MNA A;  2KCT A;  1K8A C;  2UUA L;  2JA8 G;  2BH2 A;  3BZC A;  1KC8 C;  2UUA Q;  4KHP Q;  3HKZ E;  3S17 H;  4P74 A;  3TRE A;  1WJJ A;  4UY8 C;  1SRO A;  1Q82 C;  3PIO A;  3PV0 A;  4OON A;  4DUY L;  1QZG A;  5C0X G;  4JI4 L;  5DLQ E;  4DUY Q;  2NVT H;  4IFD J;  4BY1 G;  4JI4 Q;  5E7N A;  1PH8 A;  1Y1V H;  1HNW L;  3PF5 A;  3K8A A;  5IYD G;  2VW9 A;  1HNW Q;  1C0A A;  5FLM H;  2VY3 A;  2DGY A;  1C9O A;  3I56 A;  1IBK L;  3PO3 G;  3RN2 A;  5IP9 H;  3A74 A;  1VQE A;  4QJF A;  1VQ4 A;  3M4O H;  3CC4 A;  5IYC G;  2WB1 E;  3KLW A;  3RZO H;  3F8T A;  4JYA L;  1VS0 A;  2AWN A;  1UE6 A;  4OX9 Q;  3E9H A;  2CFM A;  4DR4 L;  5C4J H;  3NEL A;  1YIJ A;  1NMF A;  3CQZ H;  3HOU G;  3OW2 A;  3SGI A;  3PO2 H;  2ASB A;  5M3M H;  2C35 B;  2HIX A;  4TQU S;  3GTM H;  4A3B G;  5AJ3 L;  3G71 A;  2WP8 J;  1PH3 A;  2JEB I;  2MFI A;  3ULL A;  2OCE A;  3GD7 A;  3W1G A;  5AJ3 Q;  2B63 G;  1YHB A;  3FKI G;  4YWL A;  2JA6 G;  4JBW A;  3G4S A;  2UU9 L;  1OXT A;  4LFB L;  4TVA B;  2E2I H;  3I4M G;  1RIP A;  1L1O B;  1Q1B A;  3G6E A;  3F2B A;  2Y0S G;  2XGT A;  3OTO Q;  1K3R A;  1V43 A;  1MJE A;  3A5Z B;  3AQQ A;  4LW1 A;  1HZA A;  3UDX A;  4GNX B;  3T1H L;  5IWA Q;  4PZ8 A;  5JJI A;  3PUW A;  4A3M H;  5J3B A;  2VNU D;  1YJ9 A;  1XPR A;  1L2F A;  2ATW A;  4IFD G;  1OXS C;  1L0W A;  1CKM A;  4P71 A;  2YU9 H;  3ULP A;  1B8A A;  3LGJ A;  2PI2 A;  1YJN A;  1LM0 A;  4DNI A;  4OXP A;  1VQ5 A;  2R93 H;  3ER0 A;  2VUM G;  2KEN A;  4X66 L;  2EQS A;  2DUD A;  4DAY B;  3PUZ A;  1IXR A;  4X66 Q;  3H15 A;  3NBH B;  3FHW A;  2D62 A;  4BBS G;  1X3E A;  2HQL A;  1Y1V G;  1KAW A;  1Z9F A;  2AKW B;  3CMA A;  1JMC A;  1VQN A;  3HOZ H;  1MIU A;  4X65 L;  2N49 A;  4B3S L;  3HKZ G;  4A4I A;  1J5E Q;  5IY0 A;  4JBM A;  4LF9 Q;  1E24 A;  3TEH B;  1SLJ A;  2PMZ E;  3I55 A;  1N8R C;  2R7D A;  3OYY A;  3HFZ B;  5IP9 G;  1HJP A;  3S2H H;  1NBW A;  4BBR G;  3PGZ A;  4C2M H;  1FVI A;  1L1O C;  1A8V A;  1QVC A;  1X55 A;  2E8G A;  3NEN A;  3VDY A;  3ERS X;  2I0Q A;  3HOV H;  1VQ9 A;  3S14 H;  1VQA A;  4GNX C;  4DV1 L;  3PO2 G;  3CPW A;  4DR6 Q;  3BZK A;  4FDB A;  4LFC L;  3TS2 A;  1UE1 A;  5EAY A;  1CUK A;  2HT1 A;  2R92 H;  3HOW H;  4R4C A;  3CCJ A;  4PMW A;  2EXD A;  4DUZ Q;  4DV4 L;  1SR3 A;  1P8L A;  2ID0 A;  3DLL A;  2JA8 H;  3STB C;  2ALY B;  4DV4 Q;  3H0G G;  3RR5 A;  4B3M L;  1VQP A;  1FJG L;  4B3M Q;  3E0E A;  4GLV B;  4BY7 G;  1WFQ A;  1FJG Q;  2CQO A;  2OQK A;  1XTD A;  4BY1 H;  2RHQ B;  2UUC Q;  3KFU A;  3J7A 5;  2JJQ A;  1T9H A;  2UXB L;  3J81 i;  5IYD H;  1A63 A;  2ZJR A;  1EOV A;  2R93 G;  1CSP A;  1EIF A;  2K52 A;  3PO3 H;  4O2D A;  1L1O A;  4APV A;  5C4X H;  4L5S A;  3UDG A;  1VQD A;  1IBL L;  1VQI A;  1AE2 A;  4GKK L;  1N32 Q;  1IBL Q;  1MKH A;  3PCO B;  5C3E H;  3HOU H;  1XNR L;  4OWX B;  1Q12 A;  1DGS A;  2LXJ A;  3J81 c;  1XNQ Q;  3GTL H;  4DV2 L;  1PV4 A;  4L5Q A;  1EIY B;  3M3Y H;  3FKI H;  4DR1 Q;  4IOA A;  1YI2 A;  5LMN Q;  1VQ8 A;  1HH2 P;  4DKA C;  3I4M H;  1QVG A;  3TRZ A;  3HOV G;  4LWC A;  1D8L A;  4O0A A;  3ULJ A;  1OTC A;  3I4N H;  5K36 G;  3HOX H;  3KYH C;  4L5T A;  1QUQ B;  1VQF A;  3M4Q A;  1KRT A;  3HOW G;  2F52 A;  4DR5 L;  1KHI A;  2RHS B;  4B3R L;  1Y1W G;  1ASZ A;  2B3G A;  4GKJ L;  4P72 A;  3G48 A;  3CCL A;  2MO0 A;  4IPC A;  2QEX A;  2VUM H;  4GKJ Q;  2H5X A;  2VQF L;  2NZH A;  4GLX A;  4JCV E;  2UU9 Q;  5JJK A;  3M4P A;  4IJH A;  2K4K A;  3FP9 A;  3GTP H;  3F1Z A;  1JB7 A;  4BBS H;  1GM5 A;  4C3I H;  3CP0 A;  2MQH A;  4JI2 L;  4C3H H;  4JI3 L;  3F2C A;  4JI6 L;  4L5R C;  4LF6 L;  4JI2 Q;  1R9T H;  4JI6 Q;  3KJP A;  2NVX H;  4DR3 L;  2A8V A;  1N33 L;  2ZJQ A;  2IT1 A;  2F4V L;  4BBR H;  4QIW E;  3W5O A;  4DR3 Q;  1IBK Q;  4GS3 A;  5C4X G;  1JT8 A;  3TS0 A;  2K5V A;  2NVY H;  2AWO A;  3CAM A;  4UP8 A;  4JYA Q;  3M9B A;  1SRU A;  5ELO A;  4DK3 C;  5C3E G;  4DV7 L;  5JEA J;  4A3I G;  4YWM A;  3CF5 A;  2E5L L;  3GO5 A;  1GVP A;  1XMQ L;  3EN2 A;  3H3V I;  4POG A;  2JA9 A;  2E5L Q;  1YZ6 A;  3GTQ H;  4AIM A;  3DM3 A;  4A3K H;  3KDF A;  3GTO H;  2I5M X;  4RG1 A;  4YWK A;  2OTJ A;  1VQM A;  5H1S E;  4JV5 L;  3S16 H;  3M7N A;  3I7F A;  1V9P A;  2OQ0 A;  3H0G H;  2JA5 H;  4JV5 Q;  1H95 A;  2ZM6 L;  1Q81 C;  1TWG H;  3HOY G;  4LFB Q;  3JAM c;  1EYG A;  3GTK H;  2ZM6 Q;  4UPA A;  3JC6 6;  3I4N G;  1IZ6 A;  3HOX G;  4WJ3 M;  3T1H Q;  4DV5 L;  1Q7Y C;  4BY7 H;  1UE7 A;  4DV5 Q;  1X9N A;  1I94 L;  2YTV A;  5JJL A;  4LUO A;  1TXY A;  3AEV A;  1BBW A;  1FL0 A;  3CCM A;  1XPO A;  4OWT B;  4GN3 B;  2ZJP A;  3STB D;  1N34 L;  1EQQ A;  4Y52 H;  1Z47 A;  4NXN L;  5IT9 c;  1N34 Q;  4A3G G;  1WOC A;  2YTX A;  4IPH A;  1X3G A;  4NXN Q;  1N36 L;  1Q8K A;  1XMO L;  1YVC A;  4BXX H;  1E22 A;  4GOP A;  1PH9 A;  4DAM A;  1VQL A;  4EQ5 A;  1K8G A;  1BBU A;  1QUQ A;  4K0K L;  5JEA G;  1IYJ B;  4DR7 L;  1BKB A;  4DPG A;  2JA7 H;  5LMU L;  3ICE A;  4A3L H;  1VQO A;  4X65 Q;  5LMU Q;  1SN8 A;  4B3S Q;  2KHI A;  1OXV A;  1S40 A;  1YJW A;  3L2P A;  3S1M H;  4Y7N H;  1HNZ L;  3CD6 A;  4JI8 L;  1HNZ Q;  3S1Q H;  1IL2 A;  3S1N H;  2WFW A;  3U4V A;  1QZH A;  3J80 c;  4KLK A;  3KJO A;  4DV1 Q;  2NVQ H;  2VL6 A;  4LFC Q;  4JI0 L;  4A3K G;  3KF8 B;  2CKZ B;  4HJA A;  5M5Y H;  4JI0 Q;  4OO1 I;  1Y1W H;  1WCM G;  2KCM A;  4X62 L;  2N3S A;  2WB1 G;  4HIK A;  4DV6 L;  1S3O A;  5IYB G;  4B3T L;  2JA5 G;  1I5F A;  4UP9 A;  2VQE L;  1CKO A;  1YEZ A;  1SFO H;  3RN5 A;  5FJ8 G;  1YBY A;  3A5U A;  4HJ7 A;  5M5X H;  2VQE Q;  3RNU A;  4B3T Q;  1PH5 A;  2GVA A;  1Q86 C;  2KBN A;  3PSI A;  1KQS A;  1OXX K;  1NJI C;  2AMC B;  4PZ7 A;  4A93 G;  3MEF A;  5GAD C;  3CPF A;  3CW2 C;  1NE3 A;  4DK6 C;  4IJL A;  3KDF B;  5C44 G;  1BVS A;  1PH2 A;  4XTC S;  3D0F A;  3L0O A;  2UXB Q;  2EIF A;  1NMG A;  1K9M C;  2IHF A;  1PHJ A;  1HZC A;  1W3S A;  1NTG A;  1I6H H;  2IHE A;  1ASY A;  2VZA A;  3AFP A;  3E9I A;  3CC7 A;  3T1Y L;  4BXX G;  4GKK Q;  4A3F G;  3T1Y Q;  4KI0 A;  3CCE A;  4BA1 I;  5IE8 A;  4A3I H;  2ES2 A;  4NXM L;  1K73 C;  2Q2T A;  1TWA H;  1XNR Q;  2JA7 G;  1I3Q H;  1U5K A;  2HHH L;  4A3L G;  1G29 1;  4R4O A;  1EQR A;  1P16 A;  2HHH Q;  2K5N A;  1B7Y B;  2OTL A;  4DV2 Q;  1D7Q A;  4UP7 A;  3RZD H;  4P75 A;  4QY7 A;  3U58 A;  3J81 j;  1LYL A;  3HOY H;  4DV0 L;  3UDI A;  3F2D A;  4GOP B;  4A3D H;  3B6Y A;  5M3F G;  4GN5 A;  4JI1 L;  1MJC A;  4A3E G;  3CCV A;  3S15 H;  1PH4 A;  4AQY L;  2L15 A;  2MO1 A;  3I2Z A;  3PIP A;  4AQY Q;  3K80 C;  4LFA L;  2KHJ A;  3CCS A;  4H02 A;  1W2B A;  1PH6 A;  4DR5 Q;  2R7Z G;  4B3R Q;  1S72 A;  3PUX A;  4R4I A;  1HZB A;  1KD1 C;  1X3F A;  2Z6K A;  2WAQ E;  4MZ9 A;  3GTG H;  4A3G H;  3A0J A;  4MTN A;  3WWV A;  2JQO A;  2VQF Q;  4P73 A;  2PQA B;  4JOI A;  2VS1 A;  1Q46 A;  4PG3 A;  4LF7 L;  3MXN B;  4X64 L;  4WJ4 A;  1HR0 W;  1IBM L;  4LF7 Q;  4BA2 I;  4LUZ A;  4DR2 L;  4X64 Q;  2LXK A;  1IBM Q;  1LUZ A;  1J6Q A;  1VQK A;  4JI3 Q;  1PYB A;  4LF6 Q;  2UXD L;  1X56 A;  2RF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...