4A7QA

Structure of human i113t sod1 mutant complexed with 4-(4-methyl-1,4- diazepan-1-yl)quinazoline in the p21 space group.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
153
structure length
153
Chain Sequence
b'ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCITGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
publication title X-Ray Crystallography and Computational Docking for the Detection and Development of Protein-Ligand Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 40
structure length 153
sequence length 153
chains with identical sequence F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 4a7qA00
1TO4A 5CU9A 4A7GA 5KBKA 1OALA 3H2QA 2GBUA 4OJAA 1SOSA 2AF2A 1IBDA 4OH2A 1PU0A 1E9OA 1E9PA 1YAZA 2Z7UA 3HW7A 2XJKA 2V0AA 1PZSA 1YSOA 1KMGA 1B4LA 1N18A 1UXMA 1IBBA 3GQFA 2AQPA 3CQPA 4A7GF 4A7UA 1JCVA 1SDAB 2AQNA 2E47A 5KBMA 1EJ8A 2Z7YA 2AQSA 3KH4A 1RK7A 3KH3A 3RE0A 3CE1A 3S0PA 1UXLA 1OZTG 2APSA 4BCYA 1Z9NA 2XJLA 1Z9PA 4A7QA 2E46A 4MCMA 2VR8A 3ECVA 2AQTA 3LTVA 1TO5A 2Z7ZA 3MNDA 3QQDB 2JCWA 1XTLA 1E9QB 1IBHA 3K91A 4MCNA 1S4IA 1SPDA 3GTVA 3SODB 1DO5A 3CQQA 1L3NA 1SRDA 3ECWA 3MKGA 1OAJA 4FF9A 2WKOA 1SDYA 1F1AA 1N19A 1JK9B 1HL5A 3KBFA 1Q0EA 1QUPA 2WZ0A 2WWOA 2R27A 1BZOA 3QQDA 1DSWA 2WZ6A 1E9QA 2C9UA 2GBVA 4A7TA 3KM2A 3ECUA 2ZKXA 1MFMA 1EQWA 2JLPA 3GZOA 2WZ5A 4B3EA 1U3NA 1JK9A 1SXNA 1OEZW 1SXCA 2VR6A 4U4IA 2VR7A 3PU7A 3KM1A 2C9VA 4N3TA 4N3UA 2WKOF 4A7VA 1SXZA 1XTMA 2K4WA 1IBFA 3GZPA 4BD4A 2AQQA 1AZVA 1P1VA 2ZKWA 3L9EA 1B4TA 1F18A 2NNXA 2WYTA 4BCZA 3HFFA 3L9YA 2AEOA 2Q2LA 1HL4A 2AQRA 1SXAA 3GTTA 4L05A 5KBLA 2WYZA 1OZUA 2LU5A 3T5WA 2SODB 1IB5A 1PTZA 3H2PA 1SXBA 4A7SA 1CBJA 2WWNA 1F1DA 1ESOA 1BA9A 1COBA 3GZQA 1XSOA 1CB4A 1FUNA 3F7LA 1E9OB 3HOGA 1E9PB 2C9SA 1F1GA 1YAIA 3F7KA 2Z7WA 2ZOWA 2GBTA 1SXSA 3KBEA 2ZKYA
chains in the Genus database with same CATH superfamily
5CWSA 4RDQF 4UIKL 3ALXA 5DHMC 3FFDB 3HZVB 5EU6B 5I19L 1TLKA 1X5KA 4NHCL 3FO9A 1QSEB 1FYHB 1PZSA 4P2QA 3GSQB 5ESVA 3PREA 5JZ7D 4KKLD 2PTTB 4HUUA 3O6FD 3V9EA 2G9HA 7CGTA 1CFVL 3CC1A 1U8QB 4P2RD 4Z7VE 1AXTH 3T3PE 4XBEH 1K85A 4I0KA 2GTZB 3C8DA 9PCYA 3TA4D 1KCLA 2WVVB 5AKSA 5HJ3A 1FG2A 1GHFH 1OAUL 4JKLA 2DLTA 3V5DA 4PD4J 5IM7A 2IBGA 2YARA 1PG7H 1UOVA 3D12B 1A14H 3TPUB 3QRBA 4XH2A 4F5CE 5IHUL 4D3CL 2G75A 3O3AA 4I87A 3RFZA 1OAZL 1DBJH 5HHPB 5LGHL 2IQAA 1QBMH 2CKBA 5GS1C 4K7FA 4JJ5A 4QRRA 1ZPUA 3ULVF 1OD9A 4AW4A 1KF9B 3G9VA 4N2DA 4U1HA 3RHWF 4DKFL 2IH3A 1BZQK 1GJUA 3PL6B 5IHHA 1F13A 4PWEA 3WNPA 4XPTL 4PRDB 5ADOH 3CQQA 4J6IA 1JZGA 4N0RA 1D9KD 1XF3A 1UB6B 1I8IA 1LEGA 2MCG1 4OUUA 2Y7SA 3G6JE 2BINA 2OMZA 3QEQA 4RVBA 5E8NB 2F2HA 4JGJA 1EZVY 1H3WM 2ADGB 1CXEA 4WEEA 3PWLB 3Q2LA 1D5RA 2VLJB 4OLVH 4DNLA 2HVKA 4N3UA 3MODH 2NZ9C 3U36B 3J07A 1EJFA 2FUTA 4EZLA 3RFZC 1AMXA 4GG8B 3GZPA 5GS2H 4AL8L 5I8EB 3U6RA 3ZE1F 2X4PA 1X9UA 1AACA 5DC4B 1ZVHA 2H1LM 3TFKC 1IJ9A 4GOSA 1PZCA 2Y4SA 3SN6N 3H4FA 2FBJL 3SQRA 2WXHA 4FTDA 5EIIA 1FQ9C 2ZWLT 3NFPA 1MHHA 2B59B 2XN0A 1FN4A 3IDIB 4NXSA 3BVWA 3BJLA 1PY0A 2AJ3B 4DN3H 1PCXA 4OGAC 2OTUB 2R29H 5KJ7E 5KVFH 4LCCC 2A6KA 2ZOUA 4X5XB 3SQOH 4UM9B 4KUCF 3FUNA 4Z77B 1OWRM 5HI4C 3WIAA 1NC4B 2HLFD 2UXTA 3O2VH 4L4TD 4JZOA 2NZ1A 2X1OA 3NPSC 3RL1A 2B1AH 3WS3B 3MYJA 1TJIL 2BFVL 3H4HA 4DETA 5KVGL 2DD8H 2XJKA 5CHNA 2XA3A 1MNNA 2BS8A 3WFDH 4LCIH 1UT2A 4GSDL 5DYOA 3WJLA 4EAEA 1H3PH 5E1IA 4MXWL 3DPBA 4A04A 3BEVA 5FFLA 2W88A 4QRFA 4JS7A 5FFGA 5J1AB 3WE1A 1B0GB 1F02I 4HIIB 1S9YB 1B9KA 1OF0A 2DYRB 3A22A 3T2NL 4ZMVA 3BKCL 4F2ME 4WWID 2O5ZH 1T7YA 3FQNB 4LCYA 4IDJL 5DC9B 4PJXE 4TL5A 2AQSA 3UMNA 3FQ1A 5CZVH 3Q13A 4LSVL 5K1NA 1C12A 2FJHA 3BIKA 2FT7A 3TBYA 4Y1TA 2Y7OA 1S2EA 4QWWD 1AR1D 4M7ZC 1AXSA 4YJZL 1WFUA 3L1GA 3BPOB 3U1PA 2X5PA 4E9TA 4WHYG 3QCTL 4AX3A 3KHOA 1N10A 1JD9A 3DSNB 4FKEA 4MCNA 5IJCC 4HJUA 3BT0A 1GZHA 4JDTL 4Z1PA 5MEQA 5DRXA 5JZ7C 1VEMA 2OP4H 2O72A 2Z9TA 4H2AA 3MC0A 1QSVA 3FO1A 1X4YA 3L54A 4JFFA 4WW2B 1CDJA 2UWEB 3WJLC 3JZ7A 3OKMA 4ALAH 1RK1B 4JRWA 3EJTA 3UTZB 1HXMB 3C12A 1PYWA 2X1WL 1KSRA 3TYGH 1A66A 1AP2A 1WHOA 1YPZB 4U1LA 4HHGA 1MUJB 3V5KA 5BOJA 2ENPA 3HZYB 5GRZA 4MYWB 4YBHA 2C3VA 3NZ8A 4E5XB 1BVNT 5AW1B 1RZFH 1TEGA 4NZDA 4UOW0 4KVNH 3VFPA 5I0ZA 5DGRA 4KNUA 4XE5B 1F6FB 3TWCH 4L05A 3SE3A 2F54B 3IJHA 3MQIA 3OXSA 3RIAF 1D9KC 3KCPB 1GZHC 1AIFA 2UWEF 1E6OL 3HNVH 1BVOA 1AIZA 1ROWA 1TQVA 1NWPA 4KKNA 2I60H 3ESUF 4I8DA 1RURL 1UZGA 4KXCA 4CADA 2P5EB 4S1QL 3FN9A 3PNWA 2RQEA 3CDGB 4LQ1A 4Q52A 3M86A 5GGSA 5C0FB 1RJLB 2ZX5A 2XA8L 3L16A 1YPZF 2X9YA 3RU8L 1ZTMA 3CH1B 1L9SA 4L4TA 5I6NA 1X44A 2AJSH 3F85A 1NSNL 3IRPX 3MRHB 4NUMA 5DJCA 3RZCD 5IGXL 4J8RB 4YHKL 4BFIB 2VO8A 1FFNB 3LEVL 4JO2H 3EYVB 1DDTA 5E03A 1TJHL 7TAAA 1RIVL 1J0HA 3V4PL 1L5GB 3LKRB 2R59A 4RISH 1JGLH 4ZO8A 5IT2H 1I75A 2WJ7A 4WENB 1Y0LB 3DKHA 3IFLH 2BSDA 3NEEA 1K5WA 4K2UH 1RZGA 4LMQE 2CALA 7PAZA 5H35A 3BH8A 3HE7D 4Y2OA 5IG7B 1IE5A 1ZCRA 3APNA 2CXGA 5DJ8A 1BQKA 3IXTB 4L1SA 5ANMA 5TDOA 1DQQB 4TYUA 3OX8B 5I1DA 4G7VH 1YEGH 4Z3IA 4XWOD 1G43A 3LNFA 1OL0A 4O2FA 2IDSA 2RIKA 4F7MA 3CBKB 1Z9LA 1I1FB 2W07B 5HYJA 3CXHJ 4MJ4A 2ICWB 5DUBA 5J6GA 2DQIL 2D0HA 5K69A 1U91B 4PRPA 2WNGA 1DQJA 1JI1A 3CFJB 4BK4A 2QQNL 5LQBH 2ZWSA 3CV5A 2A6JA 2WZ0A 3D33A 3HMXH 3ME0B 2CCLA 1E27A 5GRYA 3S8GB 1FNFA 4KV5E 2AJUL 3KLLA 3H3PL 3D8MA 4M5TA 2OI9B 1U58B 2J20A 5LNGA 2FHBA 4W9GC 3D0LB 3ATDA 1UQSB 2CE6A 4U0RB 4JRXA 4S0TD 4HAFA 1LJMA 3SBRA 3B2VL 3DHPA 4BDVB 2RB8A 4PRHA 4URTB 3KXFA 1OGSA 1T5WA 5KW9H 4ZMXA 1LO2H 3MRPB 3Q6FB 1XF5B 2CLZA 2ZP9A 5DZVA 2DM7A 4L23A 2CLRB 3UXFA 3CVCA 4H0LC 3AGWA 1TTAA 3UYPB 1RZIA 2HB0A 3G5YB 5F97E 4BFJA 3QO1B 4IK6A 3ZPDA 1D7DA 1A7BA 1LO4H 5C0DB 1D2OA 2K4AA 3HR5A 2GUOA 3HS0A 4KMTH 3W56A 4PJAB 3C2AH 2ERJB 5DHXB 3VW3H 3D6GA 1NGXB 5AVVB 2WNKA 3H42H 4L8DA 1SEBB 4F8QA 2R23B 1HDMB 2GBAA 4HIEB 3KYNB 3JWOC 2W0FB 1NGWB 3VMOA 4FEMA 3VGBA 1M2VB 4N87A 1D6EB 5SWSA 2PUQT 1O7SA 1TTBA 4IJ3C 1JERA 1R24B 3II2A 5BZZA 2WP3O 5HD8D 2VLJE 3UEQA 5DEFB 3I2CH 5F2FA 1H6UA 2JSFA 1CQYA 2AABH 1CLOL 2PPDA 4PJAF 4YPJA 2D3JA 3JTTB 4DN4L 1PDKA 1AFVH 3RWIA 3KPSB 5AZ2H 5FM5M 1CN4A 4MA7H 4RX4A 5GSVB 3HS0C 2AEWA 2FO4A 4QF1A 1V27A 1KIPB 5F96L 3HTLX 5I0VA 5I1HH 5IBLD 4G43A 3T6QC 3QJFB 2JMRA 5D1XA 1CD9B 4P9HL 3SE8H 2ZJSH 3JZYA 3BLBA 3U0PB 1NOLA 1LXMA 2ZYHA 2JXMB 1N3NA 3QB7C 4ZMAT 2CBTA 2F5BL 1YA5A 4LPWA 2CRIA 4GI6A 2C1PA 1DSFL 4XX5A 1JHTA 1T80A 1F90H 1EO7A 1FRGL 1E4WL 1U92B 5FYLE 3X1EA 4HUVB 1JZ3A 1KDJA 1KTRL 1EJOL 2CDGA 3WLWD 2WXGA 4H25B 3FF7A 1JDCA 5AW6B 3NCMA 2WTRB 3A6BL 3NESA 1DEEB 4DGYH 1R34A 1G7HB 1PF3A 2MCPH 5PAZA 1WYJA 2XKNA 5F70A 1RUKL 3RP1A 3VXOB 4MCYA 2J5LB 2FUQA 3MMEB 3RL2B 3S3JA 1IAKB 5DR5H 3WI9A 3QPQD 3JTSB 2A74A 3M7FB 5MEPA 3X13A 2F8VA 3EOTH 4IS6B 4HZ1A 4NKMA 5D1XC 1JG9A 1INDH 5I18H 4L0ZA 1IKFH 3VFOB 4K5OA 5CBEA 4YE4L 4N8VB 2WYTA 3F6JA 3NABH 1GPOH 3FT2A 4OCSL 3L2NA 3CXDH 1X5GA 4IKKA 1TVBB 3L2MA 1AE6H 1S7TA 1ID2A 4P5TD 1XZWA 3GLZA 3NIFB 3V0WL 2EO7A 2UZYB 4WWKB 2Y6TE 4X7TB 3SEPA 3AT0A 5F3HA 1X5AA 2P4AB 3B6SB 4ZZFA 1RVFL 4AMWA 2FE0A 3DTUB 4UT9L 1QSFA 4GQPH 1MHPH 1A47A 2AVFA 1T3FA 3UROR 2IPTH 5C9JB 4FQLH 1CGSL 2JJUA 1CLVA 4L8CA 2H3NA 3W5NA 1AR2A 4DPCX 2UWEE 5DJ0B 3VQ2C 1ZT1B 4NNXA 1F4XL 4RFNB 2PP8A 2NY7L 2YN5A 4DAGH 4FLOA 2A74C 1RH8A 1P4BL 2VLRB 1SEQH 2OULB 3H56A 4FE9A 2A9CA 3UJJH 1LQSR 4LESA 4H8WL 4MCZB 3BP6A 3X14A 4DF9A 1UT9A 2I85A 4UQIM 1YPZE 3H9HA 3MR9A 1CR9H 1GKOA 1U33A 1MRFH 3SKJH 3ZW3A 3O2WL 3KL5A 4TVPE 1YN6B 3MNMA 4KXDA 2RD0A 2EO1A 3AXIA 5LBVA 2CGRH 4AL8C 3BSGA 4IRSA 5D96C 5LVEA 4UQEA 1VADB 2GABA 3LSOB 4ZFZB 2F53B 4Y19B 4W9FC 1BXVA 5C97A 4LPCA 3OSKA 4M7LT 5JOPD 1MFDH 3L5WA 1NKRA 2CHDA 1UWGL 4H0IA 4I1PA 2QDVA 1KXTA 1C5DB 3GJEA 3VQMA 4A38A 2AQNA 3QHZH 2NUTB 5JO5B 3L5IA 4AYMC 4X4ZA 1OY3B 1JV2A 4HHWA 2BNRE 4NGHL 3QWNA 1AKJD 3EADA 3NP4A 4MD4B 1JZJA 4R4FL 3UTQB 4YQXH 1KLGB 4FXGB 4ETQB 4PJHA 1EEUA 5B8CB 2QMJA 1A8JH 4AENB 4E9YA 2JI3A 2FQDA 4O02L 2H32A 4EE2A 1TPXC 3PQYE 1FP5A 5FYKD 1KCRL 2Z34A 1KT2A 1MFUA 2QLVB 3BZ4B 2BNRD 4F33A 4PB0H 3KLAB 3AXLB 2CRYA 1CGXA 1P7BA 2RQ8A 1KTKE 1MLCB 3LIUA 4IRSC 4MMXB 5JW4Q 2A2QT 5E4EB 3U2SA 2R1XA 3FQXA 3QUXD 1DQVA 2QTEA 5DD5H 1HAUA 3VXRB 4HKXA 4AZ8A 4CNIA 2X44D 3PQYD 4NPYA 4OJDH 5DUML 2JKJA 1S7VB 3MUUA 1CE1H 2CHZA 1LEKA 1LK3H 5MI0B 3V0AC 3V95A 1MPAH 4A7VA 1MRCL 2XXFA 3GEFA 5DF0A 3UC0H 3WIFA 5J4MA 3QQXA 4IBLT 3BMWA 4K71C 4CDGC 3DV6B 3EKCA 5B1AB 2BIQA 3ZDZB 2UXVA 1A9EA 3DMMD 5EU5B 4X0NA 1HE7A 3NMEA 4B50A 5KYUB 4UUJB 4NENB 3S3DB 1JI2A 2LLLA 3DOHA 1J11A 2EKJA 5IB1A 2J73A 1JXDA 2PKDA 1JGVH 1XV8A 3LQAL 2ZSWB 1NL0H 1Z3GL 3OMZA 4AYFB 1U9KA 4OGXH 3TNNB 1M4KA 3F7VA 3OKLB 4S1DD 2DWXA 4JZNA 3WFEH 4J5VA 3F7LA 5KANI 1CL7L 3BI9X 3SPHA 3KYOB 4XB3A 4UV4L 4YDMA 2UX7A 4DCQB 1WF5A 4KXZH 5I1LA 3HJ0A 3ZDZF 3MV8D 1NGZA 1WAAF 4TNVK 3GMPA 5BW7A 3SB3A 1V8HA 3ZYJA 3KWVA 3W81A 1BD2E 1Q4NX 1FE8L 2VKWA 4FNLL 1SBBA 1NBQA 5JHDB 4PV8B 1FGVL 1URLA 1ZLSH 4P3CH 4UNTA 1K5NA 3IM1A 4JBSA 4LLUA 1UM4H 2EINB 2H7WA 4IU3A 4X6DE 1YEDB 4DFHA 1BD2D 4G8EB 5ICYA 3HAEB 3JYBA 5BRZA 3ZT7A 3QQ9D 1F4WL 4Q9CA 3Q2WA 4AV5A 1AQDB 1UZ8B 2OXHB 1HEHC 3QA3B 5TE7L 3RDTA 1Z9NA 5CCHE 3WLBA 2Y7NA 1N7ML 4WO4A 3WAJA 1T20A 2VR8A 3NCEB 5E00B 2HRGA 1L6PA 4GSUA 1ZMYA 2KERA 3DRQB 4K94H 2ZWKA 5BW7C 2EUWA 4G6FB 5DFTA 4LP4A 4JQVA 4LLVB 3OKOA 4JG1L 4TSBL 2FWUA 4Z7NB 1TZIB 3DC0A 3QUXA 4YVUA 4EDWL 4LSDA 2D0GA 2WYHA 2V2XB 1NCHA 3HNSL 5IMLB 5HPMB 5BNXD 1ACCA 4KNTA 1TITA 3OTTA 5MEOB 1JV5B 1E4XL 1FGNL 4KHTL 3THML 4YHML 2E8YA 5EC1A 3ARWA 3EOYG 1XAUA 3HVDA 4HMCA 4KH2A 4XNUH 5ANHA 2PCPB 4LLDB 3UPRB 1CF8L 5FUZH 3FUEA 3F2LA 3RDTC 5GRWA 5F0PB 1DANU 3J8F7 4JFWA 4WO4C 3KJ6L 2BSRB 5L88L 3VD5A 1GA2A 3FUFA 3CLEH 4NAQA 4YSEA 4JUTA 1JGUL 1AZBA 2WO4A 3HB3D 1BW8A 2AEQL 4M7KL 1GYAA 2DTMH 2HVBA 4Z7NF 3U4BL 5JIMA 1P69B 1CI5A 4ONFL 4XCNB 1F11B 3LB6C 1G7QA 3AT9A 1OB1A 3LIZA 3L5XH 1MJJA 3WL9A 2VN4A 5G4NA 3RVUC 2VDMH 1ZWIB 4ZPTB 5IFHH 1RIHL 3QUXC 4JRYA 4PJEB 3OR6A 5TDNA 4CSTA 4JFHE 3D0AA 2ZF9A 4JVPA 2OCCB 2BVPA 4ZMTA 1TTRA 3VD1A 1O7DE 3QZLA 1IGTB 5FEBA 1KCSL 3ZHDA 3MV8A 1XIWA 4MA1B 2MNJB 4HUXB 2VTFA 1WHPA 3GB7A 2VDQL 5EC2B 3TBWA 4JDEB 2C1OB 4EQ3A 4JFHD 4J27A 4G6ML 3DMMC 3JWDC 3VU2A 1E2ZA 4NQDE 4CL7A 2NX5A 3FKUS 4FQQB 5JOFA 2DQCL 5DS1A 1T1XB 3BVTA 5EZIH 3VG0L 2QKIA 1SHMA 1MLBA 4ONGL 4PJEF 1C8PA 4OF5A 4JFZH 5IB3B 4FQ1H 3V0GA 4TSAL 4W70A 4YUEL 3JUZA 1X5LA 3ZO0A 2MJWA 3NIFE 5GJTL 6FABL 3VD4A 1NOAA 1TKWB 3CFEA 4I3SL 1JPSL 1NCBL 4XCEB 1ETA1 3MOAL 4KVPA 3X11A 2X10A 3FHAA 4JKPL 4WWPA 3NBNA 4QCIA 1M7IB 4NX0A 1J9RA 2WWMD 1P7KA 5C6PB 1FO0H 2XRAH 2P8LB 1XIWC 3GLAA 3PJSA 1NC2D 3P54A 1T04B 4OV5A 1BOGA 2D2CC 3GBNL 4FJYA 1IC7H 5C07E 3O0RL 5LNDA 1SPDA 1SJVA 4M5YL 2VLRE 3AW5A 4D2NA 5FO8A 3D87B 3ARXA 2DEWX 1NIEA 4R3SA 4PI0A 5IFAH 4UOJA 4RAUB 2QKIC 3KW8A 5JHLH 5FOBB 1KGCE 2VGLM 3DBXB 2WHVA 3FPYA 3JV0A 2QSVA 3VDCA 2F68X 5A2FA 4LNRB 3ESPA 3EBGA 1X9QA 2F53E 3QQ9C 1HSAA 1XGPA 3NDYE 4PP2A 7FABL 5ECGA 2XG5B 4OZIA 2IBZX 4A68A 4GXVH 5I6KA 4P4RA 4IK7A 4DVRL 1XTMA 3G9AB 3MUHL 1Q9OB 1Z5LA 4A2GA 4PV1C 3QNYB 2NNXA 4KI5F 4IBZA 4P9HC 4PSRA 1BFSA 3AUVA 2VDNH 2P5WB 3FHEA 4JO1H 4Z7IA 4KY2A 3HPLA 4GAYB 4NT6A 4XOAA 3KR3L 3F04A 3VGGA 2AVGA 3VRLF 4NC1E 4A2FA 3SGJA 4OVUA 3GZKA 4M93B 3NK3A 5FK9B 1E8ZA 1JRHI 2GAZA 4X83A 1YG9A 4ZOCA 5IMOB 3V4UL 3DVGB 4LT7A 4PRAB 1UGKA 4GRWB 1O6TA 4JFOA 5AOMA 4ZDHB 3W9DA 4AQEB 2CD0A 3HHSA 3EF4A 2YMXL 5JXAL 1J8HA 1QTSA 2EYTA 5JQHC 1FDLL 2NSQA 4F7TA 3DRTA 1OALA 3P69A 1QPKA 2B0SH 2JB6A 4KFZC 3UABA 4WI0B 1CDIA 3X3GH 4FNUA 3VGHA 1MEXL 5DO2D 1MG3C 3HB3C 5A2LH 1FFPB 2X6AA 4X4ME 1S7SB 3FCTA 3ZDZE 5JIPA 4C56E 1R5WB 5JPNC 1XH3A 1HEJC 4LSQL 1S3KH 4NQXB 1CGWA 1Z3RA 4XN4A 3L4VA 4GRWF 3SGJC 3EFFA 3FOLA 1RERA 1E42A 2DZEA 2R69H 3R18A 4A6YH 5SX5H 4BE6A 2DQTL 2XHNA 4G59C 5CGMA 3DOSB 1EHLH 3EJQA 4HIXH 5G2NA 1ZVNA 3CU1A 2FL5B 3O6LH 1MAKA 1UXLA 4PJ7E 4OD3H 5IV2A 4JPKH 3L9RA 4AH2B 3VACA 3AU1A 4ZTOH 2FWOA 3MX0B 4C56D 1V55B 4RMTA 3TT3L 4DHLA 3W39A 2ZPKH 2VDRL 3IDGB 5KVMC 3IB4A 3SSGA 1IEHA 3HCVB 5DHEA 1XTLA 5I1GL 3JWNG 2VXUH 3GTVA 4O02A 2XFXB 3SODB 4CVUA 4EIZC 1M6OB 5DUJA 4BGDA 4JM4L 4H8WC 4UDTA 4MDIA 3PAVA 3OPZH 5HPOA 2B1OA 1CXLA 4FHBD 1QYGH 5D5ME 4JE4B 4ZFOL 3LXAA 2DQDH 2HJLB 1LE5A 5I74B 1FVEA 4OB5L 5C0AA 5EORH 1CD1B 4HEPG 3G5ZB 4P2OD 4M48H 1AO7E 4CN1A 1JP5A 5GRXG 1TU2B 3S5LB 4Z7UB 4HQQL 1XCQB 3BUBA 5FGSA 2AJZA 4UQ2B 2R2BA 3HI1A 5GRVL 5JQIB 1AGDA 4BCZA 5DEGA 3QDMA 4TOYH 5DC2A 5INCB 3OZ9L 4W81A 4IEFA 4EUPH 4XP5L 3OAUH 1LP9A 1Q0YH 3N85L 2X4TA 3AGVA 2O6DA 1UB5A 1AO7D 1KIRA 1CFSA 3UX9B 1DBML 1PIGA 4ODXA 3TO2A 3ATEA 4OIAA 1MAML 5FM4A 4NO2A 1M05B 3C5XA 4NUGH 5I0XA 4BWTA 5DJDB 1I31A 1Z32X 1FZOB 2KQMA 4QGTA 4B9GA 3ERXA 1CCZA 4J2QA 3WDHA 4PLNC 2ADIB 4P3WA 3VXTA 3A6CH 2E86A 4Z7UF 5C0IA 4GLRH 4FDWA 5BV7H 4JQIL 1DE4B 1G7LA 4HFWB 3IFOB 3F5WB 5G4OA 4N5ED 2VDLL 1EEZB 1NA8A 3MRKA 4OM0H 4PB9H 3OLIA 3VX0A 1AD0A 1K6QH 3OC8A 1HNFA 1PZ2A 3NCJL 2KC0A 1L0QA 4XNXH 1WP6A 1HOCA 3LD8C 5DJ2A 4AUJA 2VOTA 4M7LH 5GRJL 2HX8A 4X6FB 3GIVB 3IAPA 4Y8AA 1XXFC 2PABA 4NWUH 1CD0A 3HZKA 2VR9A 1D3CA 2YXVA 3GXTA 5D7IE 2X88A 2MCAA 3QWRA 3ZQXA 4ADGA 5HHVH 2CUAA 4RFEA 3GS4A 4D9LH 3LQAC 1TXKA 4AWJC 2YBRB 5CKAA 1DJHA 3RE0A 1GAFL 3E7JA 3T77B 1F58H 3UBFA 4EIBA 2JH2A 2JKRM 3OF6A 4LSRH 1OQOA 3H0TA 3QORD 4QHKJ 1RUMH 4R7DA 4AIOA 3RX5A 4GW1A 2NR6D 2R4SH 5ESQA 2QSTA 4XRCA 3E3QE 4RZCA 3VDBA 1YUKB 1HZHL 3WXWH 4YWGL 1A64A 4PBVC 4JHVA 4B9ZA 4ZMWA 5I15H 3MNZB 1SDYA 1RZ8A 5E4AA 3ZYZA 1GCYA 4NQED 3VM7A 5TE6H 3QQDA 1X7QB 5F7MC 4YFLF 4OZHE 5IMKB 2Y2WA 2R7EB 4LVHB 3CVHH 5E1AA 3OJDA 5E1HB 2H0EA 4N2GA 4DK6A 4HGKC 3MRRB 1SXCA 4P2OA 4OF7A 3LRLA 2FT6A 4H8UA 1T5KA 2DM2A 4N3TA 5AVYB 3RWCB 4HK0B 3CU7A 3P9MA 1REIA 2V33A 4PGCA 1KIUB 3QZBA 5E8PB 2OAAA 4YHPA 3DK0A 1L7TH 1MWAH 3EJPA 4NNYB 1P1VA 1S9XB 2ATKA 4E2OA 5KSVA 1YQVL 1RZPA 4OSUH 3VD9A 4MMZA 1XF2A 1G4MA 4R90L 4PMEA 2F0CA 1OZUA 1WFOA 2ZNXA 2CWRA 3FOMA 3LYRA 4KU1A 3ZJAA 5CO1A 2ENJA 1IB5A 1R5IA 2E5EA 5DRNA 4Y9BA 4QYOA 4FABL 2X9WA 5I8KH 2Q76B 1HI6B 4WW1A 3ECBA 3I6SA 1AGCA 4KI5E 4M9PA 1KJ2L 1MCWM 4DH2A 1NCWL 4S0HA 2OZ4A 1NEPA 4J3OD 5IW1B 4XVJL 5L0QC 3C9NA 4P2OC 3MBEB 5ETUB 2WQSA 4JEGB 4HBCL 4PUBL 4MZ2A 1ND0A 1J5HA 4S1SH 4BKTC 5AW7B 1T6BX 1A2YA 5BUPA 3PWNA 4MA8H 4LHJB 4XX1E 2VC2L 4XBGB 2E7HA 2X70A 5BJTA 3IDYC 3C87A 4MMZC 5BZWB 3UL4A 3ARBD 4Z3JA 1HIMH 1VACA 3NSYA 3RX8A 2IWFA 2PPCA 4MKMA 4FQPA 1XMEB 2J2ZB 1MW0A 3HLKA 2YD7A 3BFOA 4JGUA 1DUYA 2XICA 5F9DC 5TE4L 3SCMB 3VFGL 5KYYB 3WY4A 2DYPD 5LAXA 5HY9B 2HH0H 3UTSB 1X5MA 4K8RH 3OL2A 3TIEA 4LRNH 2H8PA 1RZQA 2XJLA 1HH6A 2YD8A 3GTNA 2XOTA 5DS8A 2FD6H 4Q74A 3H55A 2VDOB 1CICB 2FSEB 4N5EC 4XVUC 5HDWA 3WG7B 3LS4L 3ZKXC 3U46B 1IAOA 4FCHA 2WQWA 3QUMH 2E7CA 1FORH 4IKIA 2EDOA 2RA1A 1EO5A 4Z5RA 5A2JH 3PHOB 3QEUB 2HX7A 3EHBB 4NQEA 1DBBH 3ARDA 2F19H 1S7RB 2XWTB 3BPCA 4FYQA 4JG0H 4XXDA 2J4WH 3ZTEA 1FCCA 3NJVA 4UT7H 3N9GH 4G8FB 3HC0B 5T5FA 1CK0H 3FUJA 2WPGA 1TTCA 1BMGA 4WEBL 3SPJA 4OLUL 1IT9H 3OKEA 4HJTA 3OD3A 2ZUYA 1BQUA 1OEZW 1PLGL 4NZTH 3I6LE 1HXYB 2EICA 4Q6KA 2F58L 4R97B 4WI7A 3VXMD 4E41B 1FV1A 1USZA 2B1HL 2B7DT 3AFLA 4H7VA 1RP8A 1MCRA 3QORC 4PREB 4BZ2H 1ZJAA 3IDUA 4S1RH 5JXED 1X5JA 3NGBB 3ML9A 3QNXB 5IFJA 4HUCA 5GPRA 3GT6A 4NP4H 3DIDA 1CXIA 1TZHA 4ZK8A 1PTZA 3ZTJG 5CSZB 1XGQB 1SXBA 1PZ5A 4PJCF 1FZMB 3ARDC 4UTBL 5C0EA 3MJ9L 4APQB 3UH8A 5I5RA 5B1KA 5LGJA 1SVCP 1BF2A 4NHUB 3H9YA 4JHAH 4OJCA 2HRPH 1FL5A 2YUWA 2ZXDA 4I48B 3TEWA 1JCKA 3VSVA 4YXKL 5HI3D 2K0RA 3DETC 3P9LB 4TKWA 4BSJA 1JXFA 1ZLWK 4AIEA 2PYEB 1JWSA 1A6PA 2R56H 4KK9C 2BDNL 2GHWB 3LRGA 3VI3E 1KEGH 2NPLX 4W9JC 1KB5H 1HESA 4PG2C 1KN4H 2ZXGA 5BQDA 3MREB 4M6OH 4XTRD 3BX7C 3MLVH 2DLFL 2XY2A 4AZUA 1WV7T 2Q3XA 1WIUA 1JSYA 2HFEA 2UVEA 3B4NA 3UTTE 1SDDB 2O4EA 5E9AA 4O51A 2XCMC 2W65B 2IOOA 4J23A 4RGNC 2J5WA 2WP3T 2Z93B 3BAEH 4HEPA 4IBQA 3PUCA 4N28A 3IKCB 1R3LA 4LHUD 3QIBD 4NQCD 4P5KB 5AYQA 1HILB 5KSAB 1AQ8A 2R0LL 2QGBA 5FGRA 3VG9B 5CJXA 2R0WH 4OZFB 5KG9B 3T3ME 2V8MA 3UTTD 4KTDL 1I1AD 2XKUA 5T5NF 3OB0H 2IXQB 3D69A 1YMMA 2YK1L 4CGTA 3BPLB 1S6NA 5GJSH 1JUFB 1QACA 3K6FA 4OLYL 3V0VA 1FH5H 3MCKB 2OSLA 5EHFA 4ELKA 3ARBC 1J1XL 1FLRL 1OGAA 1ZA6B 4HWEL 2ZZUT 4DGIH 4WKZA 3WD5L 5DLLA 3VD2A 1UVQA 1AY1L 3BVNB 2ED8A 4HZLB 1ZT7B 3OKNB 1PZUB 2RACA 4Q9QH 3EF7A 3FBKA 1D5IL 4JKMA 1G1OA 2VR6A 4UZUA 4XMLL 3TBSA 4XAWH 1MCDA 1MFAL 5DMIL 2B9BA 3S35X 4WGWB 2WLMA 3L7FB 3LH9A 3S96B 2Z4QB 5CJXC 3RAJH 3SDXA 2H6UA 1PPIA 2P45B 5MERB 2Q6WB 5DRWA 4ZX5A 5MHSD 1G84A 4K9EC 4F37F 3CSYA 5DK0B 2FWLB 1EDHA 2BOCB 1IGCH 2VZVA 3EO0A 1ZDQA 2NDFA 3FFCA 2D31B 1UUNA 3QCUH 2MPVA 4MHHI 3KPRA 3ASOB 1U8HA 3PGCB 1A21A 1FIEA 3BP4B 5INDA 2MKLC 1HKLL 2CKBH 3ECQA 2WZPA 3VGEA 3KPPB 1ORSA 4N8PA 4AEHH 3QO0A 4NIYE 3WEOA 4L29B 1JPTL 1B2WH 3D39D 4WUUE 1VFBB 3BQUA 1SY6H 4M61A 3RIFK 3JV4A 3OMIB 2ZNWA 1HN1A 3LRHA 1GMIA 1T7VA 3BDXA 2Q0ZX 2XWEA 4I5BA 2VWEE 4IOSD 4JQIA 4YGAB 5IROD 4MFHA 3FAXA 5TK4A 3BE1L 1MH5A 2Z7UA 2CBPA 3AB0B 3ARGA 2B14A 2AI0L 1ZANL 3SPCA 4X2UA 2ATPB 4V1DB 4LLWB 3GSUB 2FEJA 1ECYA 3JT2A 4WUUD 1GS6X 4M1CD 2EXWD 5IQNA 2FX7H 3K74B 4UAHA 3SJVB 4L3AA 1TUPA 3D0VB 3EH1A 2W9DH 4YO0A 3TBCA 4DO5A 2Y2TA 4JB9H 1MCPL 4BH7A 3QIBA 2X4QB 1DLHB 4NQCA 4J3TA 4ZFQA 3UBXG 2WXPA 4HUMB 3K2UH 3GKWH 4LAQH 3QZWB 1M42A 4RDQG 5HI3C 4HPOH 4FI7A 4R7XA 3RTQA 4EIGB 1UA6L 2NY4C 3WDIA 3BQUC 5BVJA 4YC2B 2C4XA 1DVFA 3K6IA 2P5PA 4P0DA 3WY1A 3FT9A 3OR7A 4OFKA 2GCYB 3ZTNL 1PNCA 4YDJB 4XTRC 2R39A 2WM0A 3ISYA 3ARGC 3MRBA 1P6WA 3P0YH 5I1IH 2VLMD 3G5VB 4NLAA 2JJVA 5FM5O 5C0CA 3UZVB 3FRUA 4L8SB 1XEDA 4YN3A 4B95C 4FA8A 3FTUA 5IUSA 1XFPA 2TSAA 5EF2A 1EVTC 4KK5D 4N1CA 1HWHB 1XR8A 4MBOA 4F3FB 3HBPA 1UD6A 3IJYB 4RGOL 1RFDH 4XHQA 1IL1B 2XQYG 4MZ3A 3BQVA 3AMLA 4HOMA 4G11A 3QIBC 3ZQWA 5JQ6L 3A47A 4LSUL 4NB7A 1E50A 2XKSA 2VZSA 3IPFA 5K5YA 5HHNA 4CU6A 1OAQH 2WKOF 1EMTH 3OGOE 3IDMB 1N70A 3KS0H 1JXJA 5IEHA 2YAMA 5IMMB 3L3HB 1R3KA 4F7PA 3RUGB 4G1EA 2E6QA 3UTSE 1DVFC 1EDYA 4U6TA 2HX9A 3SO5A 2OJZL 1HOEA 4LFHD 4OKDA 4Y9CA 4XGZB 2IALB 5TDPA 3WTSA 1IGIL 1OLZA 4GRLD 2A4EA 2CJUH 3HG1A 5SX4I 1S8DB 5DSCB 2WINA 1VENA 1A6UH 2IOIA 4NO3B 5HGGS 1O9ZA 1XCTB 1N0LB 2C5DC 3VFSB 4JGMA 5BMFH 2YLKA 1A7RL 2EADA 1CLYH 1UH3A 2IANE 1NDGA 4QKXB 3UIYA 4BK8A 5KAQF 2Y3NA 3D39A 2IBZY 2P44B 3DUSB 5ISZB 5JMRA 4G80A 4H88L 4HLJA 4AMKH 4Z0BH 4HH9A 1JGDB 1JYVA 5CAYB 1QPXA 3FMGL 4IOSA 1BLNA 2L8AA 3RUGF 2AXGA 1UG9A 3P0GB 3AJ7A 2V9TA 1KCUL 3OM3B 4FQIH 4JLRB 4OLWL 4X9GA 2GITA 4Y2LA 5FYLL 1ZHKB 1B2YA 2BCMA 2IAND 4HK3J 1MOEA 1TQCB 4J4PD 4KGJA 4YIQA 4UWQB 1MFNA 3T0AA 4ANXA 1GTNA 2G4GA 2GTWB 4MQTB 2IEPA 4Y4KD 4JHWH 1P4LB 1WZAA 3MRQB 2WLIB 2CIKB 2KHAA 1KBBA 5BUAA 2DY2A 2N3JA 3SPVA 4UZSA 4M43H 2BRQA 2OCFD 4LHQB 1T4WA 2ITCB 3IS1X 2WB7A 3L3DB 2P9RA 2VL4A 2WN2A 4NWTL 4XP1L 3VFWB 1RUPL 4APXB 4HG4K 4XC1H 1AGFA 4QT5B 3HG2A 3DJTA 1NMCB 3MBXH 5J11C 1QFWH 1TO5A 3GMMA 3QQ4A 4F57L 2FGZA 2QQLH 2PYEE 3BWAB 4PS7A 4YHLH 5DMGD 3LKSA 4HCRA 2IPKA 3CZJA 2VJ0A 3VYOA 1AGEA 1TJGL 4EBQL 3U0TB 4BH8B 4M1CC 4YSDA 2UYLB 1FFOA 3PGFH 2H2PD 4DTGH 2GY5A 1Q0XH 4M1GL 1V5JA 5E2WL 4OUOA 2DM4A 4E36A 2IDQA 4JN2B 4NM8H 4KTEL 5AZEH 4HS3B 1AZUA 5IVXA 5I1AB 4M3KB 4QRQB 3LQZB 3V8CA 2HG5A 3AS1A 3V0DA 5I16A 3MRNA 3V5HB 3AMKA 4GW5B 4LF3A 4OQTL 1A7NL 1U30A 1K72A 4YHZH 3O3EB 4MVBC 3DLQR 3O3DA 4TVPL 1U8PB 5HI5C 1NCUA 1BCIA 4NRYA 3S36H 4QRTB 1C5CH 4G5ZH 4NKIH 1VB9A 2IWEA 4ANWA 3CCHB 4B96A 3NP3A 1YUHA 4G8AC 4GT7A 4KK5C 4X6CE 4OFPA 4N68A 5EH1A 3RPKA 2EDRA 1F6LL 4HPYL 2G2NA 3RJQB 2PXYD 1B88A 2XPYA 2RCSL 3EH3B 3QUYA 4F2MA 4F7EB 3VVWA 1EGJL 3FH8A 3ES6B 3CFDB 2ZUWA 2K70A 1UYWH 2VNCA 5D55A 2AV7A 1NOFA 3DSFH 2YLHA 2MCMA 3VI4E 1N67A 1J18A 1NCCH 3QR0A 3ZHNA 5C0BE 1M53A 3HW7A 3NJHA 3RVWD 4J4PA 2PWGA 1TTUA 2LVCA 4APXA 2LU4A 4Y4KA 3QNZA 4XVOA 1XH1A 1NJ9A 3NIGE 5E9DD 1RK0A 4GRLC 3A67H 2TRHA 3JWOH 2N1TE 3LAFA 2LLNA 3O41B 5IBTH 1MIEH 3WKNA 1G7JA 4GAFB 1A6WL 3T71A 2F74A 5GZOA 2L7EA 3FCBA 2V7HB 2KH2B 4GRMB 3ULVD 4N2OA 4OZ4A 5C0BD 3SOBL 1RZJC 1ZGLA 1TYEB 4E5XG 3AREA 4GXFA 3GJFA 2EDNA 5IEKB 1YEHL 4QUOA 1IJNA 2G5RA 2D7NA 3QUYC 2WLLB 2BW4A 4PN6A 1CDGA 4XP6L 1N4XL 4G6KH 4JREC 4NZRH 3QDJE 1OK0A 4XNQB 4R2GB 3H9SB 4NOFA 1HL8A 2X1PA 3ORJA 4J28A 4Q0XH 3TO4D 3MRDA 5ALCH 4MAYD 5DA4A 3NCBB 4PRIB 3CHSA 1UD4A 2ENSA 2HLEB 1OCCB 5DVNA 1BAFL 2R2EB 4ZD3L 2FR4A 1NFAA 4J4PC 3HUJE 2X4SB 2Y1ZA 5D93C 4Y4KC 4KOBA 1SZNA 3QDJD 4KGLA 1YYLH 4AGLA 1QKZL 2VISA 1EEYB 1FI8C 1JF1A 1OSZA 1NFDE 2OR9H 3FU7A 4XNAA 3ELQA 1IGML 3MV7D 2EE6A 3L6FB 1DUZA 3AREC 5IP4A 1VKXA 3LZPA 1UWEL 2VSKB 1UXWB 1U8IA 4MA3A 4UIKH 1KIQB 2OZNA 2OJEB 2BOLA 4X5LA 3KWTA 3BW9B 2OMYA 2DQFA 4U3SB 3OAZH 4WTWA 4EVNA 2H26B 2V17L 2YD0A 4NHCH 2DQGH 5EZJA 4F8NA 4RWYL 1RV6X 5CEZE 3VXQB 2Q20A 2VXQA 4TQHA 3BGMA 3LN5B 2VUYA 5D7JB 4AUYA 3L3IA 4Q4EA 2VLLB 3U9PL 5E6IB 3UBXA 4K3DL 4IIQA 1OAUH 1G7MA 2JJWA 3WU1A 3O9WB 1DCEA 3QXDA 3WFHA 3DARA 4TMPA 2EIEA 3A3YB 4X5WB 4MGXA 5FLVA 1FNLA 1KJMA 2O61B 1MW3A 1DANT 5HGBA 2AQ1A 4Y4HB 4FQJH 5CGBA 5CD5D 2VW7A 1YCSA 5C09A 5I28A 3ZRSA 3BC9A 4Y5VA 4YS4A 1DZ0A 3B9KD 3N55A 5D1QA 4FCAA 5EBMB 4ZXBA 1NCDL 1FNEA 3ZKQD 2EDQA 1NUGA 4OZGB 4KZEL 4NO0B 1ZY9A 3QFGA 5E1GA 4W4NA 5E9DA 3C60B 1AJ7H 2AMUA 1SOKA 2ADYA 3CFIC 5DFWH 5EU4A 5IJBC 1CLZH 2J88L 4P46D 2XQYA 4U05A 1FWXA 1QNZH 3FFDA 4KJYB 3MJ7B 5EU6A 4Q2ZB 3EYFB 1ZVYA 4H0HB 3FB6A 1QSEA 3D3VB 3IETB 2J12B 3GSQA 2XTJB 4LCWB 4M7JH 4M9OA 4NJ9L 5FDWB 5J3HD 2PTTA 5SWZD 2XPZA 1U93A 4X9FA 1U8QA 5ECJE 1H5BB 1N5YL 5ACZB 2WGNB 2IFFL 4HWUA 4AL8H 2GTZA 1ICTA 5F21B 1JPFA 5HHOB 5EEZA 4I0PB 4HIJB 4P59H 3C5ZB 3QRGH 3PIQA 4OZGF 4QLWA 3UEZA 3WEXB 5D1QC 3TPUA 3ZLQC 2RAMA 3BP5B 4ZXBC 1R0AL 4MD0B 2XLLA 4YMPA 4JY6B 1DR9A 1VZHA 5HHPA 2CDFB 3L9BA 3QG6B 4QHKI 1U8CB 3B9EA 4Q56A 9CGTA 4FFZL 1MVFA 4Y5XB 1J9TA 3MV7A 5KZCB 4ZW6A 4WHYH 3V7AG 4PRDA 3ULVC 1YRKA 5GS0D 4CU8A 3VE0B 4CKVX 1HQRA 1UB6A 2AXJA 1I7UB 3GXUB 4M8RA 1TJIH 3EDEA 4JGNA 2BFVH 4WDIB 5FA4B 1OCZB 4N0UE 5AB9A 1I8MA 1R19A 3N04A 1FNGB 2ADGA 1T4KB 3LN4B 1MF2H 3QIUD 4MAYC 1XX9C 4MRCA 3W9EB 1U2YA 2VLJA 2R51A 3TV3H 4MXWH 2O5YL 2NNAB 4GG8A 3IPEA 4UT6A 2IWKA 1SMDA 4KK8D 2HFTA 4XCYB 3FTSA 1N8ZB 3T2NH 4WJ5B 3BKCH 3HC4L 1TQWA 4C83B 4XMTA 1B6DA 3GS7A 4IDJH 3AABA 1Q72L 2XU9A 5ABZA 2QPEB 3BN9D 4N4YB 4JR9L 1H8NA 4O5LH 2CUIA 5A7BA 4K15A 5D6CB 3Q5OA 2BMKA 1OOAA 2H32H 1BIIB 2AJ3A 3HOGA 3JTBA 3KPQB 4AYBA 3O11B 2QADB 5CKGA 1BEXA 2CNYA 3L95B 3I74A 2VO5A 4X5XA 5FA3B 5ITFA 4UM9A 2WY3B 4JDTH 4XR8C 2GG1A 15C8H 3BVDB 4Z77A 1A4JB 2AGJL 3PPEA 4DZBB 4HIHA 1NC4A 3V79C 5IHZA 3GHBL 5LLIC 2BHYA 4XOCA 4JRLA 4ANVA 2VAAB 2VM9A 2VN6A 3T1WA 4OJFL 2ZXEB 2YAPA 3DVNA 3IMVA 2HTKC 5IB5B 2EC8A 3D08A 3JT0A 4NS0A 2XDHA 1CFTB 5HJBA 2H4EA 3ARZA 5CILH 2Q8BL 5I0WA 4N8VG 5EOCL 5HGDB 1YEEL 2NY0D 5E94A 1E5AA 3IJ9A 4PQXA 1MCBA 4U6VL 4ZS7H 4AYEC 5J1AA 1ZV9A 1SJXA 1S9YA 3Q43A 4BSVB 3IGLA 2F7RA 2BVOB 1KXQE 3FQNA 4IRJB 4JFQA 3NSJA 3NJXA 1YYML 4GXUN 2YRBA 2XQ0A 3BKJH 1E6OH 1GSKA 3B1UA 4AVIA 3FSOA 1PAZA 5IJDC 1KGXA 1IGFH 2P8PB 1WIPA 2V8LA 5J13C 2BP3A 4BZ1L 1R75A 2YPLB 4S1QH 4YGVB 4CC1A 1EFXB 3MRMB 5IW6B 1BXXA 3CXHK 3D52A 1KWKA 4ONOA 2IH1B 3E6FB 4N2IA 1JGEB 5KYWB 3CK0L 3RU8H 4KHXL 3DSNA 3OJMB 3VFRB 4CGUB 1A6AB 5J3HC 4LRIA 2ZP8A 4KITB 1U3NA 5D2LB 1UHVA 3TJPA 1MDAA 2WBJB 4U4IA 3QZOA 4YHKH 5I75B 1BREA 3EO1B 3LEVH 2EDTA 2UWEA 4PSPA 4MNQB 2CJ3A 4HD9A 1TJHH 5DLMH 1N6QL 1GGTA 1RIVH 1RK1A 1KN2H 4QO1A 3UTZA 1HXMA 3QIUA 3BDYH 3EH4B 3ETSA 3OLEA 1VGEL 1T83A 4BQ9A 3FQUB 3WAKA 2YQ2A 4OQTA 2OR7A 4WU5B 3UPAA 2E7DA 1EWHA 4UILL 5DDHB 5B21A 2MNWA 5DHYB 2QELA 3L48A 3V52L 4Y16B 1MUJA 3ULUD 3H6JA 4AGMA 1CTMA 1JN6B 4FYSA 4YNYB 3L08A 5HHMB 1H6FA 4JKNA 2ZUVA 4PRIE 5A2IH 3FO0H 2WWNA 1DEDA 3ARYA 5FF6B 2CR6A 1NCJA 2FQEA 2JKTM 3NZHL 3TX4A 2F54A 1G7IB 5GS2D 5ES4B 1NANH 3KCPA 3LVEA 5KVFE 4LRIC 3QJZA 1GYUA 1B90A 2GSGB 2YOAA 1EGJA 5GGTA 1NAMA 5AL0A 2P5EA 2RGSA 3CDGA 3H7BB 1P9MA 1TO4A 2ZUQB 1RJLA 2PYFB 3QIUC 3B7TA 4I4WB 2O6PA 2OL3B 3L5JA 1AS7A 1K8IB 1T83C 3CFKB 3TGXA 1ZK9A 5DVKA 4CSPA 1G9ML 2A6DB 1PJ9A 2AJUH 3CHQA 3H3PH 3UERA 3EYVA 1FZKA 3HHMA 1V7MH 2YFNA 4JO3H 5B39B 4UCFA 4YHOH 4KZDH 1L5GA 4UDUB 3KYAA 3KPOB 4PGJA 3BN9C 4A55A 2JCCB 2QLYA 4AQAB 1Y0LA 1SVZA 2DMCA 3PG2A 3PUUA 2XZCH 3HJEA 1TT6A 5GGQL 4MNGE 1KJ3L 4HGWB 4JFYB 4X7SL 3MUJA 5DZPA 1Z9PA 1NKOA 3IXTA 3O6ML 4P05A 1RPUA 3GSNB 3LIZH 3OX8A 1P9MC 1PIFA 2XNAB 3QIWD 3VXNB 1GKEA 1UCBH 4H20L 3ZDYB 2ZUTA 4UU9A 1ILUA 2WCSA 3CN2A 3S2AA 2ZCLL 4I9WE 2W07A 3B2MA 1RP9A 3LS5L 4ICWA 4GIOA 5GQBA 4LEEA 4OZGE 4P9MH 3QFDB 3WGVB 1FVCB 4PVBA 5DVLA 1TZGH 1U91A 2JCCF 1I1RA 2J55A 3K72A 4A1RA 1NCGA 3ABMB 2X89D 3CFJA 5BZXA 5K33A 1WS8A 3L4TA 4OCYL 5TF1H 5I1CL 1B4JL 4UBDC 2NY0C 1A5FH 5AAWA 3ME0A 2ZAIA 4I9WD 1R3HB 4DKTA 4LCWE 1XCWA 3MRIB 5E2JA 3ZUCA 2B4CL 3NTCL 1QFOA 1U58A 1ACXA 3DJ9A 2E6PA 2QVTA 3ZDYF 2E7MA 3D0LA 4KQ0A 2IBBA 1FIGH 5D72L 4N5UA 4HF5H 1CLOH 5H37G 3QXAA 4BDVA 3BVVA 4ZUWB 5HHOE 2V5MA 3WTUA 1VPOL 4Y8DC 3HAEG 2BH0A 2Q9OA 3MRPA 3Q6FA 5F96H 2BP8B 4NFDA 3TBVB 2HUHA 1WWCA 4HULB 2YRZA 4WZ9A 1PLAA 3O4LB 2CLRA 4NERA 5CCGE 3BUPA 5IIEB 3D85B 3OMNB 2J3SA 3G5YA 4P9HH 3S48A 3IVKB 4K3JH 2V9RA 3L4ZA 4KAQL 5C0DA 3DGDA 4WWKD 1D5MB 1SN5A 3F7KA 4PJAA 1CTOA 3BLPX 5AAWC 1DSFH 2EH8L 1FRGH 3Q44A 4EIUA 1NGXA 5F0LB 1E4WH 2OI9C 1PU0A 1LDPH 1RZKL 1SEBA 3P02A 3FQ2A 4HIEA 1ONQA 4GNKB 4YL9A 2W0FA 1NGWA 4NQQA 1ID5I 3GSRA 4L0PB 4U0RC 2AAAA 3NJMA 5JTWA 3A6BH 3HN5A 1M2VA 3ULUC 2FIKA 1ZOXA 1CXKA 1R24A 1RUKH 2E56A 2MQ3A 4QXWA 4KKAD 5CN1A 4NKDB 5BXFB 4A7GF 3ROOB 4PY7A 3APCA 4HWNA 4GH7B 2ICES 2FEEL 2CA3A 3KH4A 3JTTA 1G9NC 1C16B 3KPSA 3QDGB 3ARVA 3GBML 4G8GB 1PY9A 4WFHE 4WV1A 3HNTH 1OLLA 3Q8EA 3IGKA 1KIPA 1XMWA 3ECVA 3MXVL 5E8DL 4NNPH 1PS3A 2AERT 3MFFB 4GUCA 3BWZA 4HV8B 4X4KA 3QJFA 1G9HA 1LO0L 4S0SD 1RVFH 4PJ8D 1T0NB 2ZUUA 2JXMA 2I26N 4WFHD 4OJEH 2NYKA 3F3HA 4FFZA 4OV6F 1QUNA 4Y7MA 1U92A 1F6AB 2EKSB 3P4NB 4HUVA 2AKRB 1QHQA 4FYTA 2NY7H 4Y1AD 5J8OA 5CIPB 3GUFA 2QL1A 2ESVB 4H25A 1P4BH 3SKUD 1O6SB 4FC3E 2ORBL 4LDCA 4B97A 4YXLL 5EO1B 5GS3A 2WTRA 4H8WH 1G7HA 3QWOA 5AW5B 5ICZB 4PTUA 1ITBB 5IVNA 1BFOB 3VXOA 2A73B 3A6OA 3HE6B 3MMEA 5D7KE 3HZMB 3LN9A 4XO8A 4WV1C 3RL2A 1AD9B 3RY5A 5C0RL 2ID5A 2YKLL 3JTSA 3V4PB 1UENA 5KBPA 1E8YA 4IS6A 3D05A 4IGBD 4C4UA 3UZQB 2O5NA 2SODB 4XBPB 3ZDXB 1NBYB 2MNUA 2NY1B 4LARH 4N8VA 5DT1L 1P4IL 3FQYA 4AJYV 5D7KD 4NGHH 3WTXA 1TVBA 5AW9B 2CM6A 1QVOA 2UZYA 4WWKA 4R7LA 3S4SB 1JJUA 4EOWH 2XC8A 1ORQB 1FJ1B 3AAZB 4O02H 3TN0D 3VWJD 4QRPB 1ETZB 1RJZB 5FHAL 1IAIM 2IAMB 3GDBA 3EDKA 5D2LE 5C9JA 5L4IA 3UYRH 1PD6A 5E99L 5FB8B 5DJ0A 2Z64C 4PCYA 1ZT1A 5KS9B 2DAVA 3N50A 1UGNA 3ZDXF 1BWMA 3BWSA 1XZ0B 4MQ7B 4QHPA 3W0WB 2A6IB 1V3KA 4IDLA 2ZSVB 4F58L 2GK0B 3VQLA 5LO7A 3GJFK 1XF1A 4L3EE 1QFPA 2E9BA 2FLMA 4K7PX 5I24A 5D7LB 4MCZA 4XX1G 4KPHH 4LGRB 3WEBA 5CD3B 2BNUB 4PBDA 3EJSA 3BFQG 5D6DC 1YN6A 3IPBA 4XI5C 3QI9B 3BO8B 4PIRF 4X5QA 2ZX8A 1NBVH 2BSTA 4P04A 3KLQA 1PZBA 5F9WB 4LDOB 5D9SB 4ZMYA 2KS0A 3LSOA 3GPSA 3U7WH 4Y19A 3Q8FA 4WWKC 3ZMRA 2Q10A 3FUKA 3SKOA 2FJFB 4L3ED 2K6ZA 3WJJC 4MCMA 5CS7A 5JO5A 2HFFB 1QQDB 2KZKA 4KJQC 5KS9F 4RA3A 4NLHA 4Z95H 4F1SA 4MD4A 3CTTA 4PJ8A 3IK2A 3LQAH 1UCTA 1WAPA 4OTXH 3UBGA 3UTQA 1KLGA 1Z3GH 5EUOB 1T1YB 4ETQA 4RFNC 4W6WB 1HZLA 3L3GA 5B8CA 1UD3A 4YSOA 1MHCB 3FCSA 4DEUA 1EH9A 2O30A 4M8UA 1RULL 4BZ1A 1K8DB 3DI3B 1JZ2A 4Y1AA 4JFED 4UV4H 3T6ZA 3CZSA 3RVXD 1P1ZB 3QQ3A 2OQJB 3AXLA 3KLAA 3ZRCC 2APTA 5FECB 4XCCL 4FJZA 1AI1L 1MLCA 4M8QB 4LL1A 1RI8A 1IBGL 3QJVB 1B0RB 2L3BA 4OD1H 5E9NA 1ML0A 2IQ9L 3VXRA 3W37A 2X4RB 4K07A 3LNGA 2QFRA 1FE8H 5HJDA 4N0YL 5FIEA 5EUOF 1FGVH 3HS8A 4EI0A 4QOKE 2Z4TA 4POUB 4TUJB 3IN2A 4PJ8C 2BSED 1ZLUK 2CJSA 2H1XA 5AYTA 1T21B 5B8CC 2Q8AL 3PV6A 1WAAA 4IU2B 3ZDYE 4L1DA 5EU5A 5I76B 5KYUA 4C8XA 4UUJA 3RWEB 1F4WH 2VW6A 3CZGA 3HPJB 3ABKB 3GZQA 5TE7H 5FUOL 4HT1L 4P5SA 5F9OL 4AGNA 1N7MH 3MLUL 1LHZA 4QOKD 4Z7WE 5E5UB 1IE4A 2ZSWA 2J1YA 4JPIA 5F0JB 3SQBA 2OA9A 3UMTA 5EF1A 3E9UA 4AYFA 5E4EC 3TNNA 4P4KD 3ILPB 1IIIA 2WBXA 4KXZI 2XQYK 3SDDB 5TQ2H 3DURB 1BFTA 4TSBH 2C3GA 3AQZA 2CLVB 4DCQA 4XPGL 4EDWH 3T4AB 5MI0C 3RHWK 5SV3A 3UO1L 1MRDH 2YPVL 4GQ9L 1E4XH 4YH6A 3UP6A 1CYWA 3OKDB 5LWYH 5H2BB 2D3VA 3S5LG 4Y5YA 2EE0A 4A7UA 1IM9D 3L5HA 1X7SA 4HWBL 5C0NC 1RIUH 1WLHA 4X0KB 5JHDA 4GKSB 1FA4A 1CF8H 2QV4A 3KDMA 1Z9SB 2HPTA 3CN4A 4QHMB 3KJ6H 5L88H 3TN0C 1LK2B 3O4LE 4XVSL 3RGVD 5AFAA 3OQ3B 2FWSA 5H37A 3DOIA 2YEZA 5E4OA 1JMXA 3UCRA 2AEQH 4GW4B 1TYRA 4M7KH 1ZIBA 1YEDA 4NC2B 5K9JL 5K9QG 2EDDA 4G8EA 3HAEA 2R0ZH 4PI2A 1AQDA 1UZ8A 2OXHA 3D51A 3QA3A 4QXGL 1KGIA 2JV6A 1DO5A 4ERSL 2O6EA 4ELDA 3BWUF 2OZ4H 4LOUD 1LO5B 2R2CA 4FLSA 3EYSH 4YZFF 3DRQA 1AYOA 2AEPH 4JFEA 3LXBA 1G9MC 1O9VA 3FQRB 1Q90A 4DKEL 4LLVA 1F86A 2MFNA 1KCSH 1WAEA 2ICEB 4Y5YC 2ROYA 3BZDA 1SQMA 1TZIA 2EIMB 3X3FL 4MB4A 1AZNA 5JW3H 4FQXD 2V2XA 3KS0J 5AKRA 3UJTL 4ZQTA 5HPMA 5JHMA 4G6MH 2ZAGA 2ZXWB 5MEOA 1JV5A 2AEIT 4LBAA 3Q01A 5DGQA 1YVLA 2WCPA 3VG0H 1DJZA 4Y0GA 3T0XA 3NFSL 4ONGH 3BH9A 2PCPA 1Q9WB 2BSEA 4LLDA 3UPRA 4G8GE 4TSAH 2C3WA 5AB2A 1MQKH 2ZXQA 3M7OA 6FABH 1EPFA 2XV0A 4WO0A 4A6YB 2W0PA 1RHFA 1NCBH 3MOAH 2VLKE 1YEFL 1SM3H 4JKPH 4LBEB 4N8UA 1IBYA 4XO3A 1TLMA 2CZNA 1HS6A 4CBZA 3GINA 4XCNA 1F11A 2CO7B 2P5WD 4Z3GA 4FG6D 3N6YA 3SDCB 1ZWIA 4NN7C 4ZPTA 2XVBA 3MV9B 4PJEA 3P30L 3QP3A 1KENH 3I50H 3GBNH 2IGTA 3PXLA 3O0RH 1QLEL 3N43B 4M5YH 1MNUL 2VLKD 1P4UA 3O2DL 5F7EL 3CMGA 1PKQB 3P4MB 5KSBE 2D3LA 4HISA 2B4CC 3BRGC 3OWRA 2WUBL 1XDTT 3VD3A 3FXIC 5DZAA 4F20A 4HUXA 5CBAB 5EC2A 3CPUA 1WT5A 2Y7QB 4JDEA 2BY3A 2XWBB 4OFVA 2OMXA 1NCAL 4PM1A 1G6VK 1IM9A 2X0WA 2LT9A 3IE9A 4FQQA 1BECA 3DDFA 3ZDXE 1PFCA 3V6OE 1YDPB 4DVRH 2GK2A 2AZAA 1OP9A 3DNKA 5SWQA 1JHLL 5A2CA 1M7DB 3N43F 1YC7A 3HFMH 5DWUH 4HSCX 4PWKA 2WXFA 1W0WB 4M5ZL 3SIKA 4P5MB 4XCEA 3ZHLA 5B7EA 5IOPB 1C08B 4GUQA 1BVKB 1P7QD 5L2KB 3KR3H 1M7IA 1IEAB 3TA3D 2VDOL 3CZFB 2JIXD 4LOEA 1A65A 2JKWA 2CDEB 4S10A 2F1EA 2GIXA 1U0QA 1DCLA 2RJMA 4A2MA 3FZUC 3WE6B 1T04A 1WT5C 4AQZA 3RIAK 2Q87A 3W0WE 3M17B 1IQDB 1CVSC 3S7GA 2YMXH 2X6MA 1A6VL 2D9QB 2XWDA 5CZXC 5I30L 4ODVH 3PNRB 4RAUA 3BHBB 4CVXA 4GMTH 5FOBA 3DBXA 2WTOA 1Y18B 3NACH 3MTRA 1EHXA 4TQ8A 2D9CA 1MEXH 3IFPB 4M4RB 5T3ZH 4Z7QB 5FWQA 3KGTA 4LNRA 3RY4A 4BM7A 1KCBA 3U7YL 2Y22A 3RA7L 1RU9L 4G8IB 1GCFA 4FFTA 1NAKL 1E3FA 2CIIB 2XG5A 3GHEH 3GXDA 1BGXL 3WXVL 2HG0A 3IDXL 3QFJB 2LHAA 4LOUC 3LZLA 3TCXA 1Q9OA 4CMHC 4EXKA 5I66B 1P6FA 3T0ED 2QVMA 3MJ8B 5CR8A 2Z31B 3Q3GB 3QCVL 2EC9U 1XO8A 1HSBB 3LOWA 3DDGA 5EUOE 2P5WA 1V54B 1AVAA 3S97C 3TH2T 3VFNA 4GAYA 3WYRA 5DUPL 4G7QB 1U8OB 1EHNA 4GAAA 3PAUA 3VA2C 3BVXA 1E9PB 4HW6A 2VDRH 3HVNA 3U79A 5M7QA 5F6HJ 4Z7QF 4U6YB 3G04B 1S78C 2ZOWA 2OMBA 2GBTA 4G9FB 4LVOB 5FK9A 4MXQD 5JDSB 1WWAX 2JKIS 5IMOA 3DVGA 1A9BB 4PRAA 4PS8A 5K59F 2DQEL 3HBGA 1F2QA 2KBGA 1MHEB 4NBZB 4ZDHA 4AQEA 4IBSA 1UWXK 2YMOA 2DIEA 3STZB 3IYLW 1MDTA 5EBLB 3OZLA 5MEND 3V4VA 4MXVF 1ED3A 1I1YB 3CVHB 2LLGA 3G7TA 4R84A 4TTGA 4LCUA 4JY5H 4RIRB 5DJZB 2AQPA 2G5BB 2M83A 2HN7B 2VZTA 4ZMNA 1HYSD 2D4DA 1FFPA 1BQSA 3OKKB 4NM4H 2EABA 4CUCA 1W0VB 2X3AA 1R5WA 4PJ5D 2BS9A 4NQXA 1PMYA 1MWAB 4N90E 2WLJA 2E46A 4M93C 4DQOL 2BVQB 4XP5H 1M1XA 2XQBL 3WY3A 3WHXB 3IWUA 4U1MB 4LKXB 4Y9EA 2FL5A 1IM3B 1LDSA 3OG6B 4AH2A 5MP6H 3FCUB 4G1MA 1MAMH 2YGVA 4B7IA 2V7NA 4YHIA 2FATL 3IDGA 3O3UN 2R8SL 4N8CL 4CMMB 2IH8A 2PLTA 4UQ3B 2ILLA 5D1ZI 2BSBA 2WXNA 4JQIH 2WN3A 1FYTB 5T5NG 3VM5A 2QHRH 4WFGE 5GGVL 1E5CA 3NCJH 1EXGA 4X50A 2HJLA 1FPTL 3VYPA 3VDAA 3A5VA 3GSOB 5AYUH 5C6TL 2Z92B 1NMAL 2DICA 4ZI8A 2BIMA 5GRJH 1CD1A 4EN3B 3G5ZA 3GM8A 4PEEA 4Q6YA 3FULA 3S5LA 4Z7UA 5I1KL 5L4FA 1GGIL 2F9BT 3T0EA 1N59B 4UQ2A 3H2PA 5JW5A 1J48A 4WFGD 2YO3A 1OTSD 2ED9A 5F89B 4DOHB 4R6UA 5EBWA 2X1QA 1SHSA 2XZAH 4I3GA 4OCWH 4OZFG 1F97A 5INCA 3ZHKA 1GAFH 5HSFA 4GYBA 3W11D 5CCKL 4L9DA 2GJ6E 4U3CA 2WOYA 4MAZA 1NH6A 4XMWA 1M05A 1PEWA 3MGOB 5EFIB 1T2XA 4Z7OB 5DYFA 2ZKHH 1BBJB 1FZOA 2JK5B 2DJ4A 4YWGH 2BNQE 4HMDA 2ADIA 2YMTA 1DLFL 5I74C 3SGDH 1IFHL 2VSCA 4P23B 3WIHL 1JWMA 3VJ6B 1WH0A 5MENA 2QTVA 4NN5B 1DE4A 2GJ6D 4K5LA 2IDFA 2VXSH 5DQDL 3F5WA 2EP6A 4PJGB 3RI5F 3LPGA 1J05B 1BQ5A 4D9RE 1I7ZB 3IBEA 3FB5B 4AVHA 3T0EC 3R0NA 3QJXA 2C4FT 1AQKL 4HDIB 2Z8WC 2UZXB 3O3BA 2BNQD 2J44A 5J9PA 2NY5L 3PWPB 3PP4L 1LD9B 3QSKB 4PJ5A 5EBGA 5IHBA 2VXVH 5DZNA 2Z91B 1D5XA 2PCFB 3WFBL 2A9ML 4TM9A 4KI1A 3SY0B 3B3BA 4Z7OF 4HCGA 5DI8B 5H94A 3RWGA 5E95B 4JW3A 5CEZL 3UJIH 4R90H 4WAFA 3X1GA 1GS8A 3FUDA 3G6DH 4PWJA 4N0CD 4FABH 2D3NA 4EZJA 5LCVL 3T77A 2PR9A 3PHAA 4FHKA 4PJGF 2Z0BA 1EERB 2BVUA 4DP9X 2PO6B 4HUWA 5JA9A 4P57B 3MNWB 2JJSA 4ELME 3O8XD 1NCWH 1OSPL 3ZE2E 2R1WB 3SE4A 1HYSC 5IREA 4XVJH 5JNYB 3VCLA 4FFYA 2V6HA 4PUBH 2K6WA 4V11A 4NYLB 4GG6A 2W0LA 1X7QA 4PJFE 4P49A 5C0JB 2VMEA 5IMKA 1U8MB 3EUUA 2R7EA 1H3XA 4U6HB 2J1KA 4GKLA 3T2QA 4BUQA 4MKTA 1P5UB 3C6LD 1S9WB 4PWFA 2NLJB 3BDBA 4IKJA 3MRRA 5HJGA 1OAXL 1R3JB 5D1ZD 2OX5A 1KYOK 1B4TA 2Y06L 3EOAB 4PFEA 4WU7A 2W94A 4IMLB 1JWUB 4HETA 1VCAA 1KOAA 4JFXA 3QZWG 1KIUA 3M45A 4PJIB 5E8PA 4B7LA 4I3RH 2V5YA 3EGSA 3VFGH 4XHJC 4NNYA 4WCYL 4ZSOE 2X6UA 1WITA 4LSSL 3KHQA 1TIUA 3BD4A 1WBZB 4CW1B 2JJSC 5JLZB 3CSGA 4NO5A 1ZHNB 5FV2A 1MI5B 4TUOA 1ASOA 3RVVD 4EKJA 3VFMB 3ZTJH 1E9OB 3L3OB 3QG7L 2Q76A 4GP4B 4X8GA 1HI6A 3W2DL 1FBIH 4ODWB 1RUQL 4E9QA 4HEMA 3LNIA 4HCRH 3FS9A 4APQD 2WOBA 4IOIB 5E08H 1TSRA 2X40A 5GS0L 3S3BB 5TFSL 2F7OA 1MQ8A 3MLXL 5IW1A 4FI6A 2CMRL 3V6ZB 1V10A 1IGYB 4PJIF 3O2DA 3MBEA 5ETUA 3GSXB 3C5JA 4YDIL 3LXUX 2EIJB 2D0FA 2CUHA 4YL4A 5KAQG 4M62H 3KCWA 4OLUH 4WI2A 4GSQA 2VCOA 4NN6B 5K59E 2XV6B 1PLGH 4XBGA 2WQXA 4ZFOB 2F58H 5ACMA 4BFEA 1A1NB 4MSWB 4BFOA 1YJDL 3W11C 3FSVA 4HUUB 3VXSB 3F6IA 3SDAB 4BRJA 4DEPB 3SCMA 3WNLA 3TZVD 2R4RL 5KYYA 2K7PA 1GIGL 1GGBH 2KQNA 4X8JB 4FTVB 1FG2B 5HY9A 4RH4A 4XP9H 5DD3L 4KDWA 3UTSA 1IVTA 1QLFA 8PAZA 4G9FE 5IB2B 4TPRH 1RJCA 1NM9A 4KBPA 3MBEC 2FSEA 2E27H 3O8XA 3U46A 4BFFA 4U2ZA 4Y2DB 3L8QA 5E8OB 4U1JA 2O1AA 4MQXC 4JJ5B 3VSTA 3SE9L 1IC4L 4DPRA 3I02B 4YXKH 3QUGA 4JM2B 4X7CC 3TVMD 3QEUA 3EJZD 5DURD 2NY2B 2HRLA 1ET5A 2XN9E 3UG3A 5C2UB 1S7RA 2XWTA 4G7YH 3FTYA 1UXSB 3OAWA 2BDNH 3SKNB 3CPLB 1NEZB 1I8IB 4G8FA 1NGYB 4PJCA 3BAJA 4WUKL 1HHIB 3ZGHA 2DJUA 1RSFA 4LCCB 3ZL2A 3QEQB 2VDLB 1IQWL 1X3DA 4ZUVB 2UY7B 1HXYA 5T33H 2NY3D 4N0CC 2A5UA 1X5YA 2XN9D 2GUYA 2J8UB 4E41A 1IAIL 3DXAD 4NI3A 1MFCH 3GJFH 2W5PA 3F7RA 2IDCA 4PREA 3RKPA 4R7VA 1J5IA 4JM2F 4BK5A 3QNXA 3O8XC 4XBEL 1BLIA 4N6RA 5G5DB 3RWFB 2XBZA 3BZFA 1GHFL 4XN9A 2E7LA 3EHBC 1XGQA 2ITDB 1PG7L 4NPJA 4QHUB 5E5LA 1FZMA 1A14L 1A3RH 1MHHB 2NRDA 3D4GA 4APQA 4EUPA 2E9GA 2MOVA 5IB4B 1N12A 2H3KA 2DIAA 2Z7WA 1DBJL 2YK1H 4NHUA 3SE6A 4OLYH 4FGMA 1QBML 4I48A 4I77L 5LXGL 4JE0A 4TF4A 1DQKA 1FYTE 3P9LA 5BS0D 1J1XH 1FLRH 2BSSB 2J8UF 3DWTA 1NGPH 3WD5H 5HVHC 2WYIA 1MW2A 3LHPH 1TZAA 3NJFA 1AY1H 3A4EA 4R97C 2D7TL 3I3DA 2K7QA 4JZOB 3US9A 2DQMA 1TQSA 3WFZA 1A1OB 3EH2A 3HI6L 1B9ZA 2D03L 1UT1A 3I3BA 4IHBA 3FRPB 3AQDA 5BZDB 3NGBC 4BK5C 1MFAH 3CVDA 5D2NB 1FNSH 5DD6B 2E47A 3O6FB 4JAMB 3RVVC 4AE0A 2FEDD 4PG9A 3KYMB 4LKCB 5DK3A 5IF0A 3BUTA 1SUHA 3SYQA 3CHRA 2E7LC 5E8EB 4P2RB 2VXQH 4Z6AT 2W65A 2ZX7A 1H0DB 1SYVB 4AK1A 4OLVL 3C8KB 3INUH 1JHKH 3DGGB 1CURA 2Z93A 5T1MA 1J0JA 4R83A 4W9KC 5AW2B 4APQC 2HMID 3BEVB 1N0XL 3IKCA 3RZWA 5FM8A 4WI9A 1BVLB 4U33A 4LVEA 1B6UA 4P5KA 1HILA 4GBXD 5KSAA 3CHPA 1M2OA 2VL5B 1K4CB 1GZPB 3I9AA 2EEFA 2EUZA 4OZFA 4ABWA 4KKCD 4MJ5B 1KPRB 3F58L 3CDYA 4AV0A 1HTYA 4Z7VB 3T3PB 4A67A 3DYMA 3GMNB 4E9RA 5SX4H 2IXQA 4DN3L 4K8RD 4XB8A 2R29L 1JUFA 4FZEH 1JPTH 2ZOLA 3MCKA 2VRAA 5KVFL 3SQOL 2Z8RA 4TN9A 1D9KB 4FFWD 4WKXA 1HQ4B 3A0OA 3BP7B 1GZQA 3BE1H 1BVNP 5AEAA 4QLRA 1Q1JH 3FU5A 1KYFA 1ZT7A 3OKNA 4HZLA 2AI0H 1ZANH 3RBSA 4NJAH 3H9ZA 1SXZA 3OKMB 3PWPE 4MWFB 1U4FA 3RNKA 3ULVH 2PW1A 4KJWD 1NZRA 1PYWB 4WTQA 2QVKA 1AHWA 1HHKB 3D2UD 5KSAC 3DXAA 1L9MA 1HL4A 4Z7VF 3N40F 1HFUA 3LPPA 3T3PF 3V6FB 1AP2B 2HWZL 3D18A 3L7FA 3OGCA 3QUZD 4EPSA 4BZYA 3SPGA 4U1LB 1MCPH 1CZ8L 4U1NB 3EYQD 5DJYB 5IUCA 3R7QA 5BVPH 3G6JB 2Q6WA 5MERA 3V5KB 4G6JL 2ZCKL 1EO8H 1WRFA 2F7QA 3EXJA 3FYEB 1LNUB 4MASA 3BPLC 5F9AC 3EJZC 3VFPB 2A0LD 3R7RA 1NPJA 1U8NA 3M8OH 3VWKD 4F2FA 3QEHB 3DX9A 1QLRA 3OXSB 1KBPA 3UAAA 5CZVL 3PGCA 3C75A 3MRCB 5F3BA 3ZTNH 2C9RA 3T8VA 2EVIA 3EG9B 4CADB 5BS0A 5JPMB 3MBWB 2Y72A 2D8KA 4OIIL 2I5YL 4HCIA 2NT0A 5GGSB 3CDFA 4L29A 5AD0A 2DPKA 4G9DB 1VFBA 2NY3C 5FYJE 4F27A 3BAXA 4D8PA 1QP1A 5KJ4A 1AZZC 4L4TB 1AHWC 4RGOH 3G6JF 3GGWB 4J3VA 1KGWA 1CO1A 1G6RB 2VM3A 5JQ6H 5E2VL 3ARFD 2EJ1A 2MPAL 4ALAL 4YR6B 2ATPA 1UM6L 4V1DA 3UCQA 4LLWA 2KLRA 4ZMQA 3GSUA 1LMIA 1ACZA 4FAAB 3ZZ1A 5B1JA 3ZZSA 3II3A 3SJVA 5EOQH 3TYGL 4DP4X 3LKOB 4WNSA 3AG1B 3ULSB 2X4QA 1DLHA 1MI5E 3BKMH 1GMEA 4UT6H 2OJZH 5H35B 5J06A 4LQFL 4R26L 1IGIH 4I18C 5I73C 3MA7A 1MSPA 2WANA 3C08L 1QRNE 3TWCL 3WO4C 2V2WA 3ESVF 5F71A 2DKUA 2E8ZA 2WKOA 1WTLA 5LCVA 1AR1B 4P8QA 4R5XA 2VERN 3EGXB 2FYYA 2GCYA 4YDJA 4A7TA 4IIZA 4YHYB 2Y5EA 5DUBB 4DZ8A 5IJKA 3AB0C 1ZTXH 1B4RA 4PJXB 5TGBB 4YSAA 2NXZD 3UZVA 4L8SA 1R4XA 3A4AA 3FMGH 5J6HB 2FEDC 4RNRA 3WTYA 5B1JC 4F3FA 3IJYA 4N86A 3OBAA 5EB9A 1IL1A 3BESR 2AJSL 5IQLA 4OLWH 2NY5C 5FYLH 5EWIL 1CYXA 3CFNA 2BC4B 2ITEA 4P2QE 5FHBL 5E56A 3PV7A 2EYSB 4GBXC 5E2UL 5E5MA 5AZUA 4L5FL 4OVVA 3MRFB 3WJMA 3QUZA 3IDMA 3DX4A 2LU5A 5IMMA 3MACL 3L3HA 4NBYB 2VITB 5DFAA 1KV3A 1W8NA 5IT2L 1HL9A 4RMVA 1W6LA 4HD5A 5F7YC 4YC2C 5LGYA 3PRZA 3RUGA 4IJ3B 3KMDA 1NDTA 1T5WB 5IZ7A 4ZT1A 5F8RC 3E8VA 1SOQA 4PJXF 4QTFA 4P2QD 4XGZA 2CLZB 3VWKA 1QBAA 2J1ZA 5IJKC 3RX9A 3ELAT 2J6EA 1GY1A 3FL7A 3DX6B 3ZR5A 4FFWC 4ZUTB 4HG4J 4L8SC 4D94A 1ES0B 4GAJL 1WVZA 1N0LA 1XCTA 5JOEA 5J0BA 2IDUA 2G3MA 3VFSA 5CJOL 4BKSC 3GNMH 3PHQB 4H13C 5KBKA 4LLMA 1KYAA 4EBQH 5I17B 1LQBC 2VB5A 3DHMA 5DQJB 5ISZA 3DX7B 5CGYD 5AOZA 2V0AA 3IMRA 1JGDA 1ET8A 1A3LL 1JPEA 4HK3N 4M1GH 1M57B 4QRRD 3QEQE 3A24A 3QUZC 1KPVB 3RZCB 5LQBL 3N1PC 2J8OA 3ARFA 4AXWB 1T1WB 2FT8A 4JLRA 2LVEA 3HMXL 1CFBA 3LNDA 1GC1C 1N68A 2D7OA 2KKQA 1HXKA 2J8UE 4G83A 1XD0A 1RL1A 1UOKA 2CK0H 2GTWA 4WI3A 4ZTEA 4OGAD 2XG4B 3VWKC 4OQTH 1A7NH 5D7SH 3IGUA 4R5VA 3BXNB 1N64L 3BYTA 4P99A 3HE7B 1NMBH 1KXVA 4TVPH 3X12B 3L17A 5E1QA 1A22B 5CEXB 5HI4D 4OFDA 4XVTH 1LO2L 3R8QA 2ITCA 4QF1B 5C08D 3EBIA 3L3DA 1QFWI 1KNOB 32C2B 3T0WA 2DQJL 3LZRA 5GGUB 5A16A 4QT5A 2A77L 4HPYH 5DD0H 3GO1H 1Y1DA 2VN3A 2NUPB 1U8LA 1L9PA 1LO4L 1EGJH 3DHJA 3A21A 5GGTH 3ARFC 1NAMH 3BWAA 3ISWA 3S8FB 3SGKA 3VW3L 2LW3A 1TQCC 4HXBL 4J3WA 4BH8A 4I1NB 5I6XB 5ADPH 2Q7NA 2UYLA 4PGDA 3AQYA 5C6WH 1A6TA 2C9VA 3LX9A 4TULL 5CM1A 3KDPB 2WLHA 4JN2A 1I9RH 4OW6A 5KN5B 1KXVC 3S37H 2WC7A 3MAWA 4TLSA 5I1AA 1Q1PA 4MCYB 4HHAB 1ZEAL 4QRQA 1UWXH 3V5HA 5IQ7H 1A6WH 1Q38A 3CSTA 3GTTA 1ZLVK 3I2CL 3FT1A 5FOJA 2A74B 3SD2A 4UQCA 3O3EA 4MJHA 3SOBH 2L7JA 4POYA 2AABL 4A7SA 1QR4A 3PJLA 3QUHA 3GIZH 4ORZC 2VUKA 1U8PA 2WO3B 2BP0B 5F44A 4I1RA 1NLDL 1N4XH 4MA7L 4WTZG 3VXUD 4QRTA 3AACA 1SJEA 2NXZC 3SGKC 3VSUA 5D96B 2R9HC 4QHLA 3CCHA 1JTPA 1KLUA 1U6AL 4LVNC 4HWZB 1CGUA 1S7XB 1EAOA 5F3HB 1UATA 4PR5B 4D7BA 12E8L 5IK3B 4G70B 3G6AB 4L4JA 4F7EA 1MKFA 5F8QC 3ES6A 3CFDA 1UACL 1E7VA 3BAIA 1FHNA 3HG4A 2X28A 4L8CB 2OBGA 1F90L 1QKZH 2H3NB 3O6KL 4Q6IB 2OL3L 1A8ZA 3QAZC 1YY8B 2MMXA 4NNXB 4XMUA 5BO0D 5F7HA 4KV5F 3TYFB 2DI8A 3ZGIA 1F3RB 1SY6A 2C9PA 3UC2A 3COOA 2HKHH 3BP6B 3X14B 1MFBH 2ARJQ 3H9HB 3QEGL 2ZCHH 3O41A 4NAJA 2V17H 4PWHA 4JFFD 1NUDA 5ERWB 4JKKA 5IQ9A 3ULUH 3D4YA 3WNJA 1QA9B 5EN3A 4YVNA 1XR9A 2V7HA 4GRMA 1YEKL 2PCYA 3D3VD 4C4KO 4LIQE 1INDL 5C08A 1IKFL 4DPAX 3U9PH 1OIOA 4K3DH 5CGYC 3HLAB 1ZXQA 1I9IH 3GSNL 4XNQA 1S4IA 3CXDL 3H9SA 3QPXH 4FA7B 5B3JE 4I2XB 1AE6L 1G9NH 1QZ1A 1R6VA 2OK0L 4Z8FH 1VRSA 2IADB 4HKBB 4C58B 3DV4B 4K71B 1Z1WA 1DJSA 1URIA 3TONA 4HJGB 1QO3A 2H32B 2BZCA 2ZKXA 4L4TE 1UZ6F 2X4SA 1MHPL 2DS4A 3MROA 1CI3M 2IPTL 4YK4C 5HVGB 4FQLL 1YEJH 5FAAA 1EEYA 2AQ2A 3P3RA 1T0MB 1KTCA 2X1XR 3L1EA 2Y5QA 5ID0A 1OAKH 2D7MA 4KZEH 5JW4R 1PX8A 2WBKA 3L6FA 3R4DA 3AS3A 1SEQL 1F00I 5B39G 1AG0A 1G9EA 4HKXB 1FAKT 5G4MA 2KUTA 2J88H 1UXWA 3PGDB 2H2SC 2CNZA 1V3LA 1PD0A 5D4HA 2OJEA 1LEKB 4C59B 2EO9A 4U3SA 2G0LA 2HKAA 2H0JA 4D0DA 4R96B 4DW2H 4R2GC 2JQAA 4UNUA 4HALA 4B3VA 1OV8A 4NRXB 5ANME 3HG5A 3VXQA 4ZO7A 3VXUA 5ABAA 3LJ3A 3T65A 4Y7OC 1ESOA 1MFDL 2IFFH 3LN5A 1IMHC 5D7JA 4P5TB 3QHZL 5E6IA 3GMLB 3VRJB 1MJ7H 5HYJE 5IB1B 1UOWA 3O9WA 5A6MA 2N0MA 3R1GH 5GHWL 1R0AH 4X5WA 2O61A 4YQXL 4UTAA 1HJCA 4PRPE 4Y4HA 1KBWA 4G2AA 1QEXA 1U36A 1FFRA 4JPWH 2F8XC 1WD9A 4FFZH 4UOQA 3VFTA 5HYJD 1LEIA 4H8VA 5EBMA 1X9LA 2K78A 4OZGA 4YLCA 5EV7A 3ASNB 4E68A 1BHGA 4PRPD 1J10A 1MCEA 5DD5L 4GIAA 3HMWL 4JRXE 1F4AA 3B2PA 4CVZA 2AZUA 4JRFA 4PRHE 1JK8B 3RFRA 4HPHA 3KXFE 3TESA 2WWKO 3Q2NA 5EU7C 5E6IC 1CE1L 3WUWB 4QXVA 3MJ7A 4LEBA 2FZ3A 4Z78B 1UM5L 1SJHA 3PABB 3TP4A 3D3VA 4LCWA 5FDWA 1WZLA 5C7XH 4BQCA 1CDUA 2TRYA 1OARH 5B38B 1E4JA 1H19A 1V3JA 1H5BA 4Y4HC 1MELA 4JRXD 4IU3B 1AKJB 1CDYA 4YSSA 1AXIB 4PRHD 1G1KA 3FSZA 5HHOA 3EJCA 3KXFD 2AK4D 3NJNA 3C5ZA 2PR4L 4OF3A 5E7FA 3ZE0E 3EDDA 3WEXA 1EAPB 3ZSTA 1T20B 1XD1A 3BP5A 3EO9H 1NL0L 1DSWA 3S3SA 3PYCA 4JY6A 2CDFA 4WW2F 3QG6A 3V10A 1BG9A 1FSKB 3PAZA 1U8CA 2BO0A 2BNRB 2P1YA 4R7NA 1TQUA 1SXNA 1UURA 3AVEA 3U6XS 3WIIH 2ZOKA 2UX6A 3QUXB 1F42A 4BWWA 4HMEA 2IVFC 3T04D 2XTJC 3PQYB 3GHBH 4OAWB 3VE0A 3Q2CA 4DVBB 2AQQA