4A7QA

Structure of human i113t sod1 mutant complexed with 4-(4-methyl-1,4- diazepan-1-yl)quinazoline in the p21 space group.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
153
structure length
153
Chain Sequence
b'ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCITGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
molecule tags Oxidoreductase
source organism Homo sapiens
publication title X-Ray Crystallography and Computational Docking for the Detection and Development of Protein-Ligand Interactions.
pubmed doi rcsb
total genus 40
structure length 153
sequence length 153
chains with identical sequence F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 4a7qA00
2ZKYA 2VR6A 3KH3A 2XJLA 3LTVA 2LU5A 1EJ8A 4A7TA 1OZUA 2AQPA 4L05A 2WWOA 4OJAA 2R27A 2JLPA 3HW7A 3SODB 1JCVA 3L9EA 4MCMA 1PU0A 1N19A 1PZSA 1TO4A 1SXBA 2AQRA 3CE1A 1SPDA 1IBDA 1S4IA 4BCYA 2WZ0A 2AF2A 1F1AA 2GBVA 1TO5A 3MKGA 3CQQA 2XJKA 1YSOA 3GZOA 2E46A 1Z9NA 1OEZW 2WKOF 3ECWA 1DSWA 3F7LA 2C9SA 5KBLA 1CB4A 1L3NA 1YAIA 2VR8A 1OAJA 4BD4A 3CQPA 1JK9B 1IBBA 1UXLA 4N3TA 1E9OB 2AQNA 1MFMA 4B3EA 3HFFA 2ZKXA 1E9PA 3RE0A 3KBEA 1CBJA 1PTZA 1Z9PA 3GQFA 3KM2A 1FUNA 2Z7ZA 3QQDA 4A7VA 2AQTA 1F18A 1E9PB 3GTTA 2WWNA 1BA9A 4A7QA 3QQDB 1E9QA 2VR7A 1F1GA 2V0AA 3K91A 3KH4A 1U3NA 1F1DA 3L9YA 1XTMA 4N3UA 1YAZA 2K4WA 4A7GF 3S0PA 3H2PA 2NNXA 1SXSA 1KMGA 2WZ6A 3H2QA 3GTVA 3HOGA 3KM1A 4A7GA 1SOSA 1HL5A 1AZVA 2ZKWA 1SDAB 3MNDA 2GBTA 1OZTG 1SDYA 3PU7A 1EQWA 3ECUA 4A7SA 2WYTA 2Z7UA 3KBFA 3ECVA 4U4IA 1IB5A 2ZOWA 2SODB 4OH2A 2Z7YA 1JK9A 1ESOA 2APSA 2WKOA 1B4TA 1BZOA 2AEOA 1SXNA 1UXMA 4BCZA 2JCWA 1B4LA 1Q0EA 5CU9A 1XSOA 1DO5A 3F7KA 4MCNA 2Z7WA 2C9UA 1SRDA 2GBUA 1IBHA 4A7UA 1IBFA 2AQSA 1OALA 1HL4A 1QUPA 3GZQA 4FF9A 3T5WA 2WYZA 1E9OA 1RK7A 1E9QB 1N18A 1XTLA 1COBA 3GZPA 1SXCA 2Q2LA 2C9VA 5KBMA 2WZ5A 5KBKA 1P1VA 2E47A 1SXZA 2AQQA 1SXAA
chains in the Genus database with same CATH superfamily
2J44A 3RDTA 5MEQA 3H7BA 3NGBC 3RNKA 2WINB 4DQOL 3TEUA 4BZYA 5H94A 4AK2A 4NBZB 5I5MA 1P6WA 1JFQL 4MJIA 2OJEA 3FQRA 4NT6A 3SJVD 3Q7JA 1GGBH 3HBZA 4IK6A 4WTZA 2DMGA 5I15H 4NKOA 3BSZL 5CJBA 2QVMA 3QJZA 3TASA 2XKNA 3ATDA 1OGTB 4HC1H 4LCIH 4N90D 2JCCA 4DGIH 2AF2A 3AXIA 1HKFA 5EC2B 5KVFH 3CQQA 4Q9RL 5A2JH 2R69H 4LFHG 4XI5D 1MCIA 2MKWA 2BY0A 3FF8A 3QPQD 1LL1A 3FU8A 2UVFA 4YVUA 3J7HA 2MPVA 3GIZH 1OAQH 5E4EC 2H6PA 5FOJA 1JK9B 5CR1A 5B1JA 1PG7X 4K3JL 2G0LA 3RP1A 2H32B 1NL0L 2OW7A 1RVFL 2GY7B 4NQXB 1F3DJ 3HUJA 4XNQA 4L4TB 5E2WL 1U0QA 3DPBA 4MB5A 4NIKB 3LKRB 4XP6H 1E4XL 1AHWC 3A6BL 1DL7L 1RFDL 4R2GD 4PJ7E 4TUOB 3QJHA 4BE6A 2ADJA 2Y2YA 4G8IB 3QZWB 1JPSL 3MOAH 2CQVA 3A22A 3KPNB 4OZHB 4D0DB 2FE0A 3CBJB 4QTHB 1AZZC 3CLEH 2OMUA 3P11H 4DP0X 2VLJE 5GGRY 3KPOA 3P02A 3W81A 5IUCA 3BYYA 1QOKA 1AGDB 4RIRB 1PZBA 3BEWA 2DEXX 4PREA 4P05A 3ZGIA 4QR7A 2PYFB 4F2MB 3TZVC 3BPNB 3ZE1B 2B14A 1NCUA 1SJHA 3LPOA 4FKHA 2JB6B 2QQNH 4MAZA 4PJDA 2Z4TA 1I9RH 1N10A 2Z93A 4Y16A 5SX5H 3L4UA 5EU6A 5GIRA 2D7TL 3OC8A 3VXPB 1KGIA 3D69A 1CD0A 1EAJA 1IL1B 5AD0B 1G87A 3GNMH 3WNLA 1F4XH 1KIPA 3TEZA 2FJGA 4S1DC 4UDUB 5CU9A 3V0FA 2YAEA 2OA9A 4YHKH 5IBTL 4JM0A 1DSFL 5LQBH 3V4VA 5D7IE 3NJLA 5F21B 2ZX5A 5IR1B 4W9KC 1RZGB 2HJKB 2I9LB 2OMVA 5ADOL 5HI5C 3HJEA 1SOQA 1WTGT 2YD0A 5DGQA 4LLVB 5L9DH 3EJZD 5IJKA 1U8OA 4AG4L 5D7LA 2NPLX 3MMEA 4NO5A 5AVTB 1JNLL 5B1BB 2NZ9D 3Q9PA 3AREA 3CN1A 1C5DB 4G1EB 5E5UB 4O4YH 2VN4A 1CGVA 4DT2A 1ZT4B 3CLFH 4P9MH 3V0GA 1NCAL 1NCBL 4HUUA 4M1DL 1YPZA 1M6OB 4XMWA 4ENED 4AV0A 2UYLA 3F5WA 4KKNA 5IHZA 2BS9A 2F53D 8FABA 2J8OA 4ANVA 4HJ0D 4X9IA 3T04D 1AS7A 4QRSB 3A0OA 3P4LA 4I3SH 3RNQB 2WXQA 4W9FC 4HWBL 2MCPL 1NCCH 3RJOA 1XSKA 3BMVA 5FUOH 2AEQL 3N41B 4X4XA 1A3ZA 1VLXA 3MKGA 4U6YB 4K0OA 5D7IF 2OXHB 2CM6A 2MQCA 4HH9B 2DQDL 3GS4A 5CEZH 4PJGF 4WWOA 5GRUH 4Z7QB 1P7HL 3L9RA 3O9WB 4DERA 4N2IA 3TF4A 2FZ3B 2NRDA 1PIGA 4J3OC 4ELDA 5BW7C 2HKHH 4AUYA 1AVAA 5EWIL 4FQ2H 4RGMB 5BRZD 3DTUB 1KLFA 1KLGA 2Q8BH 4DWHA 3QXWA 2X4SB 2PCXA 4ERSL 1YEEL 4YE4H 3FB5B 2B8OT 3ZVVA 1A5FH 5IF0A 4HFWA 3CX5K 4MYWB 5EEZA 4EI0A 4ZUUB 3Q48A 1JGDB 1YAZA 3T0EC 3L4ZA 3WY1A 3D30A 5K59F 3SDAB 4H1LG 4P2QA 5EDSA 2HT4D 2VDQB 5BS0D 1GC1H 1ODUA 4O02H 5GGUB 4CJ0A 1HYSD 3VFPA 5JIQA 2WOYA 1SOSA 2ZKWA 2AVGA 3WSQL 2XN2A 1FLTX 5BUGA 3TM6A 1ZV2A 3OGCB 2XFGB 4Y5VC 5LGJA 3ULVD 4QJ4B 2EDOA 3IDXH 4PG2C 3KLLA 3O4LD 3TFBA 3PU7A 2WC7A 8CGTA 2NNAA 3EUUA 3QIUA 1YG9A 3BH8A 1KCWA 3FFCA 1A64A 4HUMB 3DRQB 3D2UD 5EIIG 1F6LL 5FGCB 2YD3A 3QDHA 5D7HA 4JDTH 2FEDC 4ONHA 5TE4H 5F6HJ 5CUSL 1QTSA 5E8EB 4G7RB 5DUMH 4UIMA 1HHIB 1OF2B 3NCFB 3T3PE 5IT2L 4XX1G 1CICC 1QP1A 4FP8H 5DCCA 4ZMOA 1KPRA 4JDZA 5I19H 5SWZE 2ZOLA 3HLKA 1LO5A 5CILH 5E70A 1LK2B 1YEFH 3OKLA 4XVUD 1UENA 1AQKL 2DM7A 3D85D 3QWNA 4HIHA 1WA1X 4PJAA 1TCMA 5D5MF 1BMWA 3ZHFA 1CT8A 5LCVL 1A66A 5AUMB 4IBWA 2K70A 4GSQA 3LNEA 1DDTA 2ZCHH 2B7DT 4H5SA 5H35B 3S35H 2QGBA 2COVD 3MBEB 3KH3A 5IQ7L 2APWA 2FB4L 1J0HA 3L3OB 4IDJL 1K8IA 3LKOA 3O4OC 2OL3L 1XGTB 2BWQA 1EAQA 3MVSA 3FSVA 4R90H 4X9YA 4LEXH 4RNRA 4WSJA 2Y07L 3WFEL 2P28B 4PJ5A 4LP5A 4OJAA 3NEXA 3IU3B 4JKNA 4MJ6B 1T3FB 3PHOB 4ZS6C 3S98A 3QCVH 3O2DL 5F7FA 1AJ7L 2NY4D 5GQBA 4JFPA 4RH4A 5HJ3A 1KCRL 2CUIA 4XZ4A 5C08D 1ZTXH 2ZF8A 4W9DC 4WUUB 4MHHI 4L2LA 1RJCA 2H0FA 1CGSH 1U3HB 5D1ZA 2XJKA 4R6UA 4NXSA 1TJXA 4M48H 1O6SB 1XEDA 3GSUA 3PL6D 1Y1DA 2ZWLT 1NIBA 5C0CD 2VR8A 4JDVB 4AENB 3RI5F 2YPLD 3FT2B 2OSLB 5CIPA 2VN5A 4LFHD 1F8TL 3MLYL 4OZIF 1YMHB 4PRID 1OP4A 1HILB 2WD0A 4JFHE 2OM5A 3BFOA 5FO9A 4POZC 4A2DA 3A67L 5LGKA 4UQ3A 3KGRA 5DA0B 5A3ID 3VFGH 2OK0L 4OLVL 1LLAA 4MDIA 4LHUB 2NY2B 3K72B 3S9DB 5KVFL 2X1OA 3FRUA 4LLYA 4PWJA 3T6QC 2L3BA 4WKZB 4XC3H 3H2PA 1MHPL 1P9MC 4KC3B 3ZXAC 2BO0A 5DT1H 3HB3B 2COQA 1AGFB 3HE7C 4B41A 5ESVA 5IVXF 1NPNA 1X4ZA 2FNWA 2UZYB 3BAJA 3OMNB 4NI3A 4HIEB 5C07D 2FL5A 4NM8L 2BOBB 1SMDA 1VGEH 1S9XA 2BIQA 4N22A 1E4XH 3AY2A 1RHFA 1AACA 1ZJBA 1KCBA 5FX3A 5DUBB 3RIFF 4MB3A 1M7UA 4Z7QF 4MXWH 1SXNA 2ATPB 2B4CH 1CVRA 5E0FA 2PWDA 2APTA 3LSOB 3WL9A 4MJIE 4DESA 5E2TH 1X7TA 2DLFH 4IGBC 5I2IB 4YWGH 3UJTL 3LPFA 2Z7WA 5HDBE 3O3EB 4MQ7B 4OLZH 1A3LL 2UZIH 4PJ9B 5T5FA 1L5GB 4KVPA 4ZFGH 1UUNA 5CJXA 1W72B 2XTLA 3CQFA 5H37H 1U8MA 1GIGL 6FABL 4D0BB 2AJVH 4XPFH 4JG0L 1KPVB 5KVMC 2D3JA 1NCWH 3ZDYB 1BIHA 1KC5H 3UC0L 4PCKA 4XHJC 1R1CA 3NCXA 2WQ8A 4XP1L 1NUFA 3GXUB 3MXWL 1NMAL 3L17A 1CYXA 4MNGA 2NY4C 4TQHA 3LB6D 3QJSB 4R4BA 4FJYA 1R6VA 3BUYA 4N0UE 2GAZB 5I5IA 4ZZFA 5EIVA 1ZV9A 4HBCL 1YQ2A 1M7DA 1HEZB 4JHBA 1U3JA 2VLLB 1HHJB 1G7HB 3B5GA 3FMGL 3T6WA 4LIQH 4U1LB 4U2ZA 3S4SA 1C5BL 4FA6A 3K8KA 1DZ0A 1XSJA 1OARH 3L3DB 4LHUG 5G4OA 3RX9A 4LARL 1UATA 2X2IA 4IOIB 3ARPA 3DUSB 2O26U 1KBBA 4Z7VA 3GUTA 4B53A 1GW6A 4GRLC 3BKJL 1PD6A 4N2BA 1GZHA 3TBVB 2F8XC 1RXLA 2BCKA 3L3GB 3FTSA 5AOMA 4C4KO 2LLLA 2IOIA 3INUH 5B1JC 3G04B 4L2YA 3VTMA 1E8ZA 4JY6A 2WLLA 4W9ZA 1CD8A 3Q2LA 2ZNWA 5ADPL 3FH5A 4NC2B 3T65A 1E9QA 2YMXH 1B0RB 2OP4H 2YD8A 1JYXA 4A2HA 1BJ8A 3FL7A 3VXQA 1GHFH 2A1WH 2OTWA 2LFEA 1VA9A 1H8NA 1ZS2A 4XO8A 4Y2DB 2J1XA 3GB7A 2UWEF 4F91B 5LWYL 3N40P 5C9KA 4DF9A 5GSRA 4UQEA 1M2OA 5D6CB 2XN9E 4PI0A 1TYRA 1ETB1 5DD6B 3RUGB 1J48A 2DIJA 5IESL 4FD0A 5E94B 4TLSA 5F3HB 4PGZA 4XB7A 4YDVA 1A4JA 4NQEE 3H53A 1Y0LB 5BVJB 3VGBA 2Z7UA 1FFRA 3NK3A 1I8MA 1LO3L 4AQAB 3HI6H 5K9KA 5FF6A 5EUOA 4KNSA 1AGCA 2DWDA 4B9JA 3WTYA 1KYAA 3TA4D 4OKDA 4IBLT 1KTLA 2RB8A 3H6JA 3OLEA 4JHVA 3H0TB 5TK2A 1FYTD 4TYUA 2D7NA 1BVLA 1Q1JL 4KPHH 4WFEE 5FO8B 5A6MA 1SBBA 2BPBA 3EFDL 1F11A 3DX1A 2M1KA 4KXZH 4NHUA 3MZGB 1RK7A 1BQHB 5E8OA 1H6FA 1D5ZB 2VAAA 4K7PH 4XWOC 4HV8A 5J57B 4G5ZL 1E7UA 4I8DA 4ACTA 3VXSD 2WZ5A 5J4MA 2R2HA 1QD0A 2FO8A 4I0PA 5C86A 1GYVA 5D1XA 5LNEA 1EJ6A 3BZ5A 5IJKC 3IAPA 4EDWL 3ILPA 4M00A 1IBGH 4FNRA 3QRLA 1ADQA 2F5AH 4OIBA 1VADB 2V7HB 1OL0A 3BZFB 2GJPA 3CFBB 2J5LC 3LH2L 1NFIB 4GQ9H 4K2UH 4YIQB 1VFMA 3WY3A 3CE1A 1AYRA 3WJJA 1KGWA 4JR9L 4KVCH 3GSXB 1BPVA 4PLJD 5KVDE 1XF2A 1MY7A 3CZFA 4JQXA 4WHTA 5HDRA 3VB9A 1HNFA 4UZSA 3TNNB 4E68A 3S97C 2IV9A 3R4DA 1OP5H 1TMCB 1CD1A 2YUZA 1AZCA 2WBKA 3IJHB 4OAWA 4XBMA 2X4UB 5AOKA 5HHQA 2WN3A 1WT5A 2BSBA 1ZTXE 5SWSA 5DUPL 3VU1A 4HUVA 2Q86A 4NPYB 2WXFA 3H9SD 3UGXA 3DJZA 4EKJA 4PJCB 3LS5H 3WN5C 3IAQA 4OFDA 2WIIA 3EG9B 3GMOA 5KVEL 3I9AA 3P69A 4PGCB 1HHKA 4L8CA 4WLCA 5ERWA 3GTTA 5F2FA 3LIZL 5TQ0L 2VSCA 3BHBA 4G6KL 4N8PA 1ZLVH 1HWGB 3SIKA 2AXJA 2O6FA 4AW7A 4HS6A 4C47A 4P2YA 2EDWA 3CHSA 3T1WA 5DMYA 3NACL 3X1GA 3QULB 5T1LB 2I25N 2BRRH 1XD1A 1IAOB 2G4EA 1MFDL 3JTSA 3QCUL 4AIZB 1MHCA 4QRFA 3GWJA 1Z5YD 3BWZA 3NK4A 4TL4A 5DRZA 3BFWA 3RGVA 2UZPA 4K9EH 1YO4A 5AVUB 3ULSB 3ZO9A 3AMKA 2E6JA 3HS0B 1MNUH 3HCVB 3QZNA 3D33A 3MLYH 5ECGA 3AG1B 2XX1A 5KYXB 3WTSA 4J1UA 2VC2B 5HGHB 2P5WD 2DQFA 2Z3FA 2SODB 2EDRA 3E8UL 3MLTA 4HJSA 2RFXA 3TN0B 4L8SB 1ED3A 4DAGL 3IFOA 4O02B 2DTMH 4OF7A 4ZOBA 1ZEAL 3I6GB 1MOEA 2HMID 4I77L 2W0KA 4WJ5B 5IVZB 2H3NB 2X9ZA 4G6JH 2VZUA 1BMZA 2P5ED 1EVUA 1TITA 1UGNA 1MCFA 3SYAA 3WKQA 5J8OA 3CXFA 4H26B 1ZHNB 2OFQA 3L5XL 2BNRE 3F7YB 3GSNA 4YSRA 1AKJA 2Q2LA 2B1OA 3WJMB 4Q6IB 2DQTL 2TSAA 3B2UC 1DJHA 1VGEL 4BH8B 3B7SA 4BZ2A 2FVNA 3WS3A 1B0GA 1J8HE 1MJUL 1IQWH 4AEHH 4OCXH 4GMSL 1G7MB 2AK1L 2D4FA 2H47C 4YL4A 5D2NE 2XKNB 4NWTL 3N42B 2ODHA 2JCCB 3D12B 4MVBD 1R5WA 1N4XH 3SSGA 1BZDA 3EGDA 2XC8A 2DD8H 2O5NA 3G6JA 4E41E 3D4ZA 3O6LH 2J5WA 1SEQL 4F57L 2LHAA 2YPVH 5FYJU 2EKJA 4GT0A 1FVEA 2UZIL 1A3LH 1M56B 4OJFL 1KY7A 2C1OA 1TZOA 1RHHB 3ETBF 3KWWA 4RAVA 1MCOH 4XNDA 4FQQB 1UCTA 5B38B 2KZ1B 3A4AA 4JKWA 5JW4R 5FYLL 2IDQA 3TBCA 3X1NA 3NN8A 1T2QL 1XIWC 1NUDA 2R0KH 4QRUB 3EO1A 3OKNA 4LIQE 4KMTH 4B3EA 1J5IA 3HFFA 4WTZG 3TT3H 3LOWA 4HEPA 3QJHB 4YAQA 1C1EL 3QZWA 3KPPA 3QDJD 1A7NL 2CDGB 4BWUA 2UWEA 2D2CC 3KPNA 4FQ1H 1EBPA 3ECBB 2QVTA 3VXUA 5CIPH 3US1A 3BAIA 2UXGA 4JN2B 4X4ME 4YFDB 2EDNA 3L2MA 5B3SB 1OGAD 4XPGL 1EEYB 3CFKB 2X4PA 3Q8CA 4WCYH 5T3ZD 4FLSA 3ARDB 4B7IA 4WW1B 4JHUA 3MRGB 4NHCH 4OQTA 4BV1A 1U8HB 3DIVA 1H9DA 1RIVL 1WHPA 2QPEB 3VMOA 2JB6A 4HT1H 4FQCH 4JFFD 2X2UA 2H7WA 4BFRA 3SY0A 2N4IA 3KPMB 2B2XL 4JO2H 4U1KB 3OG6B 4BA0A 3D69B 4MJHA 5HSFA 1NBYB 3O3UN 4L5FE 5JHDB 1FFOB 2VL5A 4D8PB 3EFOA 4KJWD 5EEVA 5LUMA 3VD7A 1MH5B 3HMWL 3REWB 4BFNA 2OX5A 3GK8L 3V0DA 3CDCA 3HHMA 5FEBA 3QNXA 2R29A 1MCNA 1JZGA 1MCBA 4H0LC 4I3RH 4JZJA 4L1SA 4Y4FD 3BD5A 1VGKA 1JMZA 3N5AA 4XVOA 1CGYA 3HUJF 5GZOD 4MDRA 4NO3B 2CO6A 3A24A 4DN4L 3LN4B 4HGKC 5EU7E 3NZHH 4GRLD 3NJIA 4XCNA 5JHMA 3UL4A 2FX9L 5D2LE 4JRXB 1K2DB 5SWZD 1JD7A 2IG2H 4YEEA 2GIYA 3BVNB 5EOQH 2XY2A 3JT2A 4J3XA 1D7BA 1PZ5A 3E6FA 4TUKL 4KKQA 4P4KB 5K9JL 3RY5A 3WNNA 5FV2A 2JI1A 2QGCA 3VX0A 3GBNH 1IARB 2XTJC 4HAGA 1E2WA 5TE7H 4MCMA 5BVPH 3F04A 5KJ4A 5DMIH 4PQXA 4XNBA 1JZFA 3DVGA 2NLJA 1FG9C 1IBDA 3QIBA 2XRAH 3AVEA 4EN2A 1UTDA 5DYOA 1OOWA 5C6WH 2DJUA 4WNJA 3U0TA 3C5SA 5I17A 4PJ6A 2B1AH 1QFWL 4MZRA 3D2UA 3L9RB 2WTPA 1R5IB 2NR6D 3DO7A 2AK4E 2FBOJ 1BG1A 1BZQK 5I5JA 1F3JA 2APXA 3QNYA 1AIFA 2IOOA 5IW1A 4G80B 5K69A 1S8DB 2X3AA 4UQBA 2HRLA 4WFED 2VXTL 4RFNB 3K2UL 3QQ4A 3W0WA 4K7PY 4L18A 2X4SA 1QO3A 1NSNL 1AXIB 4GRLA 2JJVA 5J9PA 4M9OA 3GQFA 4ZW5A 3QUYD 4QUOA 3VU2A 2EUZA 2P80A 4QYAA 5ETUB 3TYFA 2F1BA 2JVUA 5B1CA 2AGJH 5IBLC 3RUGF 1A6UL 7PAZA 1JGDA 1N64H 5D70L 4PTUA 3AU1A 1ZLSH 4YUEL 4KITB 1S5HB 5AL0A 3RZCA 2R7EA 3DMMD 2DM4A 2J2ZB 1PNCA 4M8RA 1DBKL 4TRPH 5ID1B 2XXMB 3VFVB 3MRHB 4LSVL 5IMMA 1ZDSA 5HI4D 2PW2A 1PY4A 4AYMC 4KQ4H 1NPJA 5L8LB 5E24E 4F7EB 1K6QH 4J3OD 1MZYA 3GXMA 3ZZLA 4X8CA 4JUSA 3IWVA 3D3VA 1HI6B 3C09B 1UWGH 4UT6H 4XNMA 4ZDHA 3IS1X 2G30A 1JOIA 1MI5B 1FBIH 4RQQB 1X3DA 2WVSA 5AOZA 3VD5A 3TVMD 5F1IB 2WO3B 4RDQF 4HHWA 2R56H 2WXJA 1IJNA 4PTTA 5ESAA 3VXTB 1CK0L 2NSQA 4XCEB 5DFAA 4DKAA 5I1EH 3D39A 4PJAB 1HZHH 4CSTA 1CL7I 3MNWA 3QDJA 4NQDD 4L8SC 4PJIB 5CMAB 3H7LA 2H6UA 4OTXH 2PPEA 1COBA 2ZXAA 3AC0A 1C12A 4RGOH 3V6OC 1XMWA 4RESB 1MCJA 1XGTA 2X44D 4E42B 1TZHA 3NQIA 5D93C 3Q44A 3AWEA 5EG6C 3IU3A 3MBED 3QR0A 4HIXL 1I7TB 3OPZL 2VLME 5HHOD 3L54A 4N9GA 3QWRD 3MBXH 4EE2A 3DBXB 5EZLA 4C4BA 3K6SB 3QORA 2JXMA 5BZWB 2ISDA 1ZE3C 2J88L 3Q1SH 4G9FA 1OP3H 4ZOAA 2BIIA 2QQLL 3FQTB 4LVHB 5DJ6B 3RGVC 4F20A 5JW3H 3QEHA 2JI2A 3II2A 4JS7A 1UWYA 3II1A 2SEBA 1XZ0B 2G9HA 4PB9H 1PLBA 1YRKA 4AVKA 3GMPB 1HDMB 1NC4B 1U91A 3WJLA 3HC4H 4FA8A 2XVGA 4IIZA 1Y18A 4JDVA 1F41A 3B3BA 3QIWC 5HVWA 1DJWA 5J6HB 2JJTA 4XVSH 4JM2C 3QK0A 1MRCL 3EJRA 3FTXA 4FABL 1I3RB 2CLZB 4WUKL 3QHFH 1KGCD 4PPTA 1HILA 3UTQB 3E1ZA 1SQMA 3HPLB 3S34H 1UZ6F 1AR1C 4L29B 2ZUQC 3V5KA 2DMKA 2EADA 1MG2C 3PWJB 3TCLA 3MRQA 1QBML 7PCYA 4FI6A 3RDTB 2BERA 3ARFB 3TBSB 3ZJAA 3WEOA 3BLBA 3SD2A 2VR7A 4ZMNA 4M1CD 4NZTH 3L7EB 5J11B 3CZKA 3ESOA 4TV3A 5L88H 2B20A 1T83A 5D1QB 1DQTA 3F7RA 1DR9A 5C0AE 3ULVC 2ITFA 3KPOB 4GLRI 1A9EB 2QKIB 4CGUB 4YQXL 1ND0A 5ITFB 3UG4A 1J0YA 4HU2A 1KIRA 2BX5A 1QRKA 1KLUA 4FMKA 3SGEH 4DKEL 1G9ML 3CDGB 3PWUA 4Z7QE 1N7ML 5AG8A 3PYCA 4OZIB 1PD0A 2ATPA 2NUPB 3EH5B 3HS9A 4LNVA 4OCRH 1N6VA 2B77A 3U7WH 4WEUD 5C07E 3W11C 1KG0B 1U8CB 5HHMD 1ZTMA 4PJ9D 4O2EA 2B1HL 1U8JB 1DUYB 2ZKMX 3SJVA 5L2KB 2E27L 1SJXA 2XV2A 2DWSA 1OO2A 4H2AA 2ADJB 2VUKA 1MW2A 3L3HB 4Y5YA 1WZ1H 4WK2B 1RZGA 1WFNA 35C8H 2BIMA 1A7PL 4LCYA 3FF7A 5I71C 3QZBA 3HAEA 4XMXA 2QLYA 4ZMQA 1MCWW 1K5WA 3BRGC 5D7LB 4AMKH 3A6CH 3L4TA 4LSQH 3VD2A 1D5IL 1DCLA 3HPJB 1CGUA 3FKUS 3KWXA 4IHBA 3IDUA 4AGQA 3SODB 3B9DA 4OQTH 4KO9A 4CA4A 1GJUA 4GP4B 4OFYA 1SJHB 1ZT4A 1DFBL 3LY6A 3QC5X 5KN5B 4Y1AE 4H0HB 1HSAA 5CSBA 4MDJB 5I66B 4K15A 3KS0J 4GKZA 3V5HA 1HE7A 1JD9A 3EW3B 3MUGA 3P2TA 4WI6A 2VERA 4OF3A 5KYUA 4ZI8A 1MCHA 1EGJH 1KIQA 1X7QB 1NM9A 3PWLB 3QIWB 1AP2B 4O4YL 3FU9A 4UDUA 2ETWA 3CZEA 5BOPA 3V4VL 4FNLL 4GAFB 4CN4A 4XBEH 3VXME 5J7CC 1BZ8A 5T1DL 3MDJA 3PRZA 1MHHB 3VG9B 4I0PD 5AB9A 1KTDA 3P1VA 3P73A 2VN6A 4DQOH 2VLKB 4X7TB 2GSIB 1JERA 3QAZC 3KEDA 4XNYL 3RPKA 2JTDA 2LT9A 3ARFC 3ARUA 4H8UA 1BVKA 2JKIS 5DR5L 1PGRB 4JFHD 4M7LH 4AGNA 1EMTH 5TE6H 1X9RA 2WUBL 5E00A 1FP5A 2E86A 2OXGB 4NNXA 3WIAA 3CSFA 1S9YA 2BY2A 2R1WB 2BNUB 4HUUB 3HN3A 3QDMB 1RJLA 1J1PL 3TP4A 3M86A 4AJ0A 4OD3L 4YBLB 4OVVA 1IGJA 4F7MA 2YFNA 1KF9B 5C08B 3QCTH 1ZDQA 4OI9A 1KYDA 1DLFL 3GIZL 4K71B 1BVOA 4RMRA 2O6DA 2JKRM 1WAEA 4HVBA 4QRPD 4I48B 4JFWA 3AITA 4N90E 4YE4L 1Q9OB 3QJQB 4HF5H 4LPYA 5FDYA 2L7JA 4MXQD 3I84A 5IROA 3ARWA 2OI9C 1MLBB 3MLPA 3GO1L 5L8JB 3JVGC 4MA1B 4RGNB 3ZT5A 1E6OL 2W91A 3H0TA 1UB6B 2AEOA 3I02B 4F8NA 4ZAKB 5F72S 4AKPA 1IC1A 2YPKB 1F11B 4PJXE 1TFPA 2HH0L 1D5ZA 2VAAB 25C8L 3QEGH 4CKQA 5D7IB 1SM3L 2ZSVA 3DMMB 4LDCA 3V4LA 1MLCA 1T1XB 3GMLA 3ARGC 1WFMA 1JVOA 1UGKA 2PLTA 3O0RL 3V7AG 4QRPA 5LGHL 4MA8L 5BMFL 5D1XB 4HFWB 4IRJC 1JHKH 4GT7A 3FBKA 5H37G 5AUMA 4WV1A 5DHDA 1HKLH 3PJSA 1FL6A 5GS0D 4JY5L 3EH1A 1WWWX 1PPIA 1OGAE 3BOVA 4Y0GA 1T22B 2H6OA 2JLPA 1MVUA 3KPRD 4K8RH 2DYPA 1IC4H 3AS3A 3FH8A 4JZNA 1F4XL 4Y9EA 4CVXB 5I30H 2ZCZA 5KBNC 3BGAA 4Z3EA 1Q38A 3KYOB 4Z3JA 1FJ1B 2XWBA 3F01A 3FFCB 5D2NB 4PJHB 3T4AB 4KO6A 3BW9B 3AQZA 3D4YA 4PJIF 5DHVB 1OAUL 1OCOB 5E4AA 4MAYC 1J8HB 1NGYB 4FGMA 4WGVB 1JZ3A 5TPWL 1O6SA 3MKKA 4MJ2A 3KLHD 1CTNA 3IXAB 1AG0A 3OWEA 1KJ3H 2WIIB 3D1MC 4MD4A 2A5UA 4PLKD 2K6WA 2MFNA 4G8GB 3DOHA 4HIHB 2KKQA 4PGCA 5E95B 1L9NA 2E3VA 4YX2L 1R3HA 5D7KD 1MIMH 2ZYIA 2OBGA 3IU4L 3LEYH 4P4KD 1TF4A 3MV8E 2ADFH 3NOIA 3VD1A 2GFBA 4TVPD 3B2VH 4PB9L 4WKXA 4FJ6A 3RU8H 5J3HD 1O5DT 1EXHA 4Y88A 3VUAA 4FXTA 3MLUH 5T1LA 2RCSH 2EVJA 4C4KT 1AZRA 5C7ZA 2NY2C 5T33L 2EACA 4LU5L 4LHUA 4Q6IC 4JHWH 2P7TA 2X41A 5FHAH 2G3XA 3KLQA 1L6XA 3KYMB 3VAEA 5JDSB 5GJTH 2YOAA 3PQYD 4OLEA 1XL4A 1T2XA 1WBXA 2UXTA 5KBDA 5KW9L 1YLBB 3TIDB 3AM8C 3U0PB 2Y5TB 2C4FT 5D1QC 4HIEA 1GMEA 1RIHL 4AEIL 3WLBB 3ULUF 1MNNA 2FECL 1ZOXA 3ZRSA 5HBBA 1YCSA 1O7SA 1PKQB 1PLGL 4G3YH 2J43A 1OHQA 4BDVB 4K5OA 2VJXA 1JUFB 2YBRB 3D4GA 3FDWA 5F1NB 2Z8RA 4PRHB 4UYPA 3QVAA 4PP1D 4OCLC 4HOMA 5ACLA 1IBFA 4ES8A 3WTWA 4OZFG 3GMMB 5FAAA 3IYLW 3UOAB 2A3TA 3EJTA 4MDIB 1QX1A 5EFIA 2Q5BA 4YQXH 4MGXA 2IANA 3TYGH 4RZKA 1Q9KA 3OHXA 1ZD6A 1B0GB 1MEXH 3QA3B 4KH2A 4YR6A 1GSMA 2ZPKL 3HG4A 1A47A 4ZTPL 1U9KA 5I1KH 4UB0L 1ET7A 4O51A 3OJVC 2F61A 3BKCH 3X11A 4DCQA 1UJ3A 4JL1A 2BP0A 2XKUA 2X53A 3L4YA 4GQPH 5IFJB 3G6JB 4H25A 5D1ZD 4M93C 4JUTA 2R0LL 3ZK0A 4KMQA 2VN3A 2ZWYA 2IDFA 4Z3GA 5CILL 3QORD 1A4KA 3GBML 1Q0YL 4J8RB 4BHUA 4XPAL 5DVMA 1OTSC 5DUBA 5B38A 1P1ZB 1D7FA 1SLWA 1GKEA 1MG3C 3VDBA 4LRIC 5TH2A 3T77A 3LQAC 1DSWA 4M3HA 2KH2B 4P46A 2QEJA 2WLJA 5I2IA 4GO6B 1CFVH 5B8CC 5FLUA 3D0VA 3SYPA 3L3DA 3FTWA 4XCYB 3OKMB 4NUJB 1NEZG 2ZKXA 2NY7L 2UY6B 1NA8A 4OUOA 3HHRB 1CE6A 1G5GA 5D7KE 3LZNA 5EO0A 2WVTA 2VQ4A 1SJEB 4LLUB 1AJ7H 1FA4A 3PWNB 2YA0A 2HT4C 5JQHC 2VXVL 4E9VA 3LKQA 4AYEC 2NZ1A 2NQDA 4FDWA 4OUUB 1EEYA 3O6KL 4L23A 4WU5A 3SDYL 1A14L 1XEUA 1XWVA 4OF0A 2A9AA 1ZLUH 1NJ9A 5HGBA 2VE6A 1QLEH 4M62H 3BP6B 2GAZA 2OJZL 3NYKA 4H88H 5EEYA 1U8KB 5I18H 1JVLA 2EVIA 4YXLH 2EEDA 3DNKA 3BP5A 3NTCH 5HTSA 3RVXC 1IKNA 2YMXL 1E28A 5DR5H 3QEUB 3QUMA 3F65A 3BGMB 2P49B 1QVOB 2C1PA 1FLRH 1Q9LB 1YNTF 3BCDA 3TBVA 4HOZA 4AQAA 2N01B 3IRPX 5TDOA 2P8MA 4H8WC 4OLUL 4MHHG 5C09B 4XCFL 1TTRA 4OZFA 5EBGA 3MV8B 5IHBA 2R9HD 4LPXA 3DXAE 4FQIH 4PCTA 3UERA 2X42A 3HI6L 4KKCD 1CE1H 3L3OC 2C3VA 5M95B 1CL7L 1B88A 2DJMA 1YEIL 1PZ2A 5MEND 1NCDH 1LO4L 1JGEA 1Q72H 1HVXA 1YMME 3RGBA 2R2HB 5C0NC 4UNTA 1OTSD 1VJSA 5D6CA 3MV9B 3M1BB 4QKXB 4ZPTB 2IPUK 2AXHA 3DVGB 5CJQL 3FXIC 1A3QA 3T8XB 3GSQA 3EFDH 1XH1A 4OD1H 4ODWB 2PW1A 3FFDB 1P4BL 3K4DA 3FOLA 4UQDA 1NBQA 5CGYD 5I17B 4MLSA 4P5KB 4WHYG 4KZDH 3MJWA 1O9VA 4P2RD 5K9KB 3T2OA 1NGXA 1IQDB 4G8GE 5F7DA 2RMNA 4GW5A 5HDLA 2GEQA 4B9YA 3GZOA 1WBYA 3A5VA 5JORB 1QQDA 2GC4C 4BIKA 3STLB 3S3CB 2ICEB 1KJ2L 4WWPA 5DJZA 2J1WA 3V0IA 4Q9CA 4AE0A 4BK5A 3F6JA 1J05A 4FL4B 2HFEA 4P23C 5C2UB 3CCHB 5KJRH 3C09C 3NAAL 3ULUC 4X8JB 2MKLC 3UABA 4ODUB 5ELIA 3HI1B 3MBWB 2VJ8A 2HUEA 2EYTA 2MCMA 1T66D 1VESA 4LZKA 1G1YA 3KE0A 1JF5A 1XCWA 1BBDL 2ICWJ 3CFEA 1DVSA 1JXFA 3IKCA 4AT6B 1U92A 2Z31A 2YXWA 3KPSE 3T3PB 4Z7OE 3B43A 2EIBA 1TETH 5EU6E 3FPYA 3AU1B 3UTPE 1V10A 5I1LB 2LTQB 3OB0H 1KDIA 2O6EA 1I9EA 5TTRA 3ILPB 4FQJH 4UI2A 3FUHA 4QRRB 5IQOA 3BDBA 2DV6A 4LIQL 2AEWA 2XN9A 4WFFD 3CDZA 6PCYA 4IDJH 4HS3A 2IWFA 3QXVA 1ERNA 2CHXA 5DZ9A 4XT1C 3T0EE 4PJIE 2R1YB 1XL6A 5KVEH 3ESPA 4HCRA 1GTNA 1YN7A 4ZDHB 1OIOA 2AI0H 4JVUA 1UZ6E 1XCTB 3ZTDC 4RQQA 2HG5A 5CP3A 1NFDF 4JFUA 4D9QD 5DI8A 5DJDA 4EVNB 5IB2B 5JOEA 5B39B 1MIEL 2ORBH 3L9BA 2IBZX 5L4MA 2OCJA 5SWSB 4ODSH 4TQPA 4E41A 1KIUB 2BIPA 2P5EB 3U1QA 1CIDA 4UYQA 4AEEA 1UT1A 3BGFB 3B9EA 4CC4C 3WIHH 1S9WB 3W9DB 3LVEA 1OAQL 1A65A 3EG9A 1GHFL 1HFUA 1V8HA 2A1WL 1JZ4A 3T3ME 4YDLC 2JJSC 3R0MA 4I1PA 2G5RA 3LQAL 4Z7UB 3S7GA 4JL2A 4EN3D 4E42A 4PCYA 4G5AA 3QUZC 4UZUA 2Y9RT 3DDFA 1KJ2B 5A2KH 1F2XK 4CC0A 1S2EA 4YDJB 2PMZA 4HXBL 1IAOA 3V0AC 3KCPB 2WANA 4Q6IA 5T1LD 3FQTA 1IJ9A 3QR1A 4RRPG 5HJGA 3NIGF 5IK3B 4KK9C 3RJQB 3U7YH 4EQ3A 4UV7H 4PG2A 5EA0H 4OBSA 3MTRA 3EYOB 5JIHA 4KRPD 2FT8A 2XFXB 4CILA 4YSCA 1IGYA 4RLDA 1JPGA 1LDSA 3DIFA 4Q89A 2H1LM 3X3FL 1VCAA 1WC7B 5CZXC 2F8OA 1JZ2A 4POUB 4M4RB 1ED3B 3LEVL 2AZAA 1NANH 2GJJA 2HFTA 5DVOA 4XRCB 1I9RL 5HPOA 1FSKC 2HT2C 5IVZA 3FUEA 1S7WA 4IIQC 4HW6A 3VXNB 4HHGA 4X7EC 4XO9A 4ONFL 4DK6A 5AENA 2UY7A 1DJIA 4PHZA 2OMNA 1E40A 2ZUXA 3MRQB 4HK0B 5AKVA 1PSKL 3UTPD 1J9RA 2WXKA 2NY0C 5IBTH 5LQBL 5K1JA 3U82B 2VDPB 3ARFA 3TBSA 1ZPLA 1UOKA 3IMVA 3PGFH 4ZQKA 3QWQB 4P3CL 5E5RB 3UBFA 5DJYB 4Y9FA 1YNLH 4WI5A 1OQOA 3EGSA 3ZYIA 2XG4B 3RAJL 1RP8A 4KUCF 4HSAC 1Q0YH 2UWEB 3UAEA 2FJFA 4N0RA 1HCYA 1JNHA 2CO7A 4LKXB 4M7JH 3GEWB 4D94A 5AAWC 3DHJA 5AYUL 4ZXBA 1UM4L 2AJSH 4G9DA 4FHBD 2WINA 2O5ZH 4E9RA 4JE4B 4Y5XB 3BX7C 1QNZH 2BNQB 3ARDA 3BVDB 4I5BA 1Z7JA 4FXGC 2ZUYA 3LXAA 5K1NA 2O5YH 2ZG1A 4UAOC 3EBGA 3L5HA 4XVTH 4LMQE 3KPQA 1SGKA 1X5ZA 4Y8DC 5BUPA 4YK4C 4NT6B 3TH3T 3MRIB 4YEFA 3KYNB 3F3HA 3KPMA 3RYMA 1PCXA 1FFNA 2EDLA 3WJLC 1KN4H 5JHDE 3FO9A 3PP4L 3OG4B 3V2AR 3X12B 3KS0H 3NJXA 1FAIH 5H8DA 3FHEA 2HVBA 1F90H 2P5WA 5CGYC 1O0VA 2C4FU 4WO4A 5E8PB 3TT1L 1BFOB 4PJFF 1GTFA 1T21B 4YGVB 2BCMA 1S9KC 1VGKB 3CFCL 3LKRA 2YJQA 3W0WE 3RTQB 3VFWA 5IB5A 3W5MA 3SDAC 3S3PA 4Q8BA 2VMCA 4DP1X 5DD5H 4U1HB 2DWTA 4WW1A 2MPAH 3KMDA 1T0NA 1U21A 2VLMD 3HS8A 4DH2A 3CHPA 4BQBA 4OZHA 4D0DA 2CRIA 2DTML 4I2XB 4P4KA 4X5RA 1Q1PA 4O02L 4FFZA 1PBYA 4F8TA 3GS7A 1NBYA 2BP3A 3E9TA 4JRLA 5JHDA 4ZTOL 3ILDA 3Q2CA 4R0LC 2A74B 1CZ8L 4R26L 1QW8A 3SQBB 3REWA 3HAEG 2NLJB 4LLMB 1JPEA 2EE3A 4FG6C 3IETA 5J89A 2HX7A 5FUCE 1VKXA 4ZFOL 1DQDL 1N3NA 4ISVB 3LZFH 4G2AA 5HDWA 4Y16B 3N1PC 1KTDB 3ERXA 5LNDA 2WLIB 2YAOA 2NCMA 3K1KC 1SN0A 3GBNL 1JHLL 2OMZB 1H15B 2Z8WC 1ILUA 2QVFB 3CBKB 3WEXA 1FG2A 1RZJH 4JN1L 5FOBB 3MYJA 4EIBA 2Y4SA 1ROCA 4OCWH 1F3JB 3KXFE 5JIIA 1WIUA 3LNHA 4HC1L 2OXGA 1S8DA 4DGIL 3R1GL 4K5MA 3QUZB 5SWZB 3F7VB 4GLRH 4LCCB 4BYHA 4YDKH 2NNRA 3WLWD 5E4IA 2I7SA 4KZDL 1A02N 2I5YH 1MCPL 5DHYB 1F1GA 2DYRB 3O3DA 4F7MB 2YLKA 3SDCD 2YN5A 4Z0XA 2HLAA 3SO5A 3HR5A 2FGWH 3AREB 1ADQH 2XU9A 2CJ3A 2DWEB 3MUJA 2WNKA 3K5SA 1NZRA 1T04A 2Z92A 2GI0A 2DOCA 4PY7B 3MV11 3VFOB 3ABKB 4LVHC 5DYOB 2YA2A 4NOBA 1HAUA 3IXTB 4YXKH 3VQ2C 4Z7UE 1IZJA 3CPLA 1A6UH 4IU3A 5CJ8A 5F96H 3TT3L 4DEUA 3GXIA 5HYIA 3TWYA 4QKTA 4HDIB 3SGKA 4O58L 3IN2A 1TETL 4KXAA 5CZVL 3O4LB 1AIFB 1B2WH 5IW1B 3DBSA 4NQQA 4A66A 3LN9A 2EZ0C 3ZOAA 1MI5A 1FZMB 2E9JA 4WY7H 2QSCH 3B7UX 5EZOL 5A2AA 2DBLL 1W6LA 2FLRT 5BS0B 1EO5A 1FGNH 3Q5TA 1HL4A 1TVHB 4WGKA 2QFRA 1UB5B 4L4VD 1Z9SB 2OZ4A 4X9BA 3KYKL 3D0LA 3QDJB 1YPZF 4HIJA 2W60B 4P23D 4WNQA 3IFPA 3P30L 2EVFA 3V9FA 5IV2B 4MFHA 4NQCB 4PVLA 2KYIA 3MLVL 2VZOA 4JZNB 1O6VA 1CBVH 2YGOA 5JPNA 2WWOA 1FV1A 3MRDA 4HKZA 2D03L 1E4WL 4PJHA 4RMUA 3DX6B 4ORGA 4ZSOA 4MXVE 4JPIA 2FD6H 1MXGA 1HQRB 2E4FA 5DRNB 4CAGA 2O61A 4F8QA 1I7RB 4TMPA 4R84A 5D5MB 3C2SA 1WYJA 5C92A 1I1RA 4Q0XL 4LSPH 1EZLA 5E9NA 3RIFK 1FYTE 3DI2B 3GXDA 4D9LL 4KNQA 5CF3A 5EU3B 5DZNA 5GS1A 1GGCL 2Q3XA 3ZDXB 1UADC 3N91A 1XQ4A 1ULVA 2EVGA 3VI4E 4PJIA 1S7VA 3SE3A 5I1CH 5FW8A 4WI7A 4XPTL 5E8EA 5EO9A 3RA7H 2CDEA 3DOSA 5AOIA 3ABZA 1I3RA 2DLFL 3W9EB 2WXHA 5T3XE 2GFBB 3W38A 2LLGA 3FO1A 3RE0A 4GW1B 3KR3L 4YMPA 1Z9LA 4M6NH 5C0BD 1HSBB 4TSBL 1A6ZB 5GGVL 2A9CA 4LL9A 3HC3H 3U9PL 3MV9E 3CU7A 3MCLH 1GPOL 4H5SB 5TF1L 4Q4EA 1P5VA 5GS2D 3MBEA 3GF8A 3OMZA 4NAMA 5DTFA 4DHLA 3ESNA 4X6CA 1B0IA 2VT0A 4PGJA 1R75A 3UDWC 2NYZA 1MJUH 4R7NB 3L3KB 3DGGA 1GGBL 3UTSB 5ICYB 2YD1A 3BIKA 4ZNEE 3VFTA 1F4WL 2Y5TA 5KOMC 5KSAA 1LP9E 1CYWA 1NCGA 4JQXC 3WE6B 2GBTA 4AOFA 4HK3J 3UCRA 2IBBA 2A77L 1GYCA 3IMBA 5J6HA 4YLCA 5HJ3B 1KENH 3AAZB 5ILTL 5CJOL 1OGSA 3NSXA 1N5AB 1L7IH 4O2CA 5I9QB 3K6OA 3HG3A 3I85A 3BUQA 4FYQA 4G1MA 3LRSB 2AGJL 2XYCA 2ZWSA 1TVDA 4PR5A 1I7UA 3MU3A 4HCRH 4XMLL 3U4BH 1OARL 1MCOL 5E4EB 3QDJE 3TCLB 2E5EA 4LMQI 1N70A 2QPFA 2VKWA 4LAQH 4YC2C 5GRXG 5ACZB 1KJVA 2X9XA 1IBHA 3UFIA 3EHBD 2GT9A 3FT2A 3X3GH 1I1CA 4ZW6A 5C0FB 1E9OA 2AXFA 2V5TA 5AW2B 3MRNA 3VFUA 1OXYA 2MQ3A 4X5XA 3ISRA 4KQ4L 4OZFH 1IRAY 3D0AA 3GMNA 1OT2A 2NQ3A 5FA3B 1UWEL 4PV9A 2DI9A 4YDIH 2GYSA 4IW4C 3F6IA 2ESVA 1EJ8A 4QCIA 1ZA3B 3HAEB 1MFAL 2Y7MA 3ZL4L 4WZ9A 3NABL 3FRUB 4LLYB 4XXDA 4H8PA 4PRBA 5C0AD 3ABGA 2R56L 3BKML 4JO1L 3OQRA 4QNPF 1S7XB 3CDGA 3FTZA 1VIWA 4F80A 1P1ZA 3RVVC 1BP3B 2XWTB 1LYQA 1N6UA 1V7NH 3G6DL 3H42H 2ZCHL 4LLQB 5KSBF 3D51A 2AS5M 1AD9A 1KBVA 3RL2A 4HCGA 2ZSWA 2X7LB 4TKWA 3V5HB 5CGTA 2LGNA 3MUGB 4PJAF 3ULUH 1QWUA 2HLFC 3FT4A 3QDME 5CD5D 4O00A 1KIQB 1X7QA 3PWLA 1DUYA 3QIWA 4KRMB 3UBXG 4UT9L 3OXSB 5GRZA 1G9MC 3GSNH 4KKZA 3MI6A 4IIQA 3N50A 1ASOA 1KCLA 1T1ZB 4UAHA 1H6EA 3ZKMC 1QPPA 4FI8A 4IBYA 4J2QA 4N0YL 3UIYA 2BSEA 1GZHC 2ARJQ 1F58L 1MHEB 2MQ0A 3B4NA 3OKOB 3PWNA 4JM2F 3WL9B 5EOCH 4ALAL 4GMTL 1HC1A 3SY6A 2CKBH 4FZEL 3RPIA 5JW3L 1F18A 1KB5A 1X9QA 1UXWB 4IRJB 3SYQA 5G4MA 2NY5C 2V37A 4TUJA 4MS8D 1U3YA 2LVEA 5B7EA 3BP6A 2R23A 5T1JA 4L4JA 3O2VL 4R96A 2ED9A 4GSRA 3ULAB 3WXVH 3NZ8A 2QMJA 1YEGL 3HVDA 5DWUH 4P2QE 3VFSB 5AAWA 2IO5A 4N0FA 1MRFL 4NO0A 3QC6X 2Y1YA 1HHGA 3LCYA 4J3UA 4YVNA 1WDAA 2J8HA 3B2MA 1B90A 3DSFL 2AV7A 3T0ED 2NY2D 2NXZB 1IB5A 2XRAL 5IOPA 2Z7YA 2HVKA 3LDBB 3NIFF 5HHNA 4TOYL 1NOFA 1UZ8A 4X7TA 4M7LT 2R69L 3TFKD 4GG8B 2D7MA 1INDL 1EZVX 4YZFE 3KNBB 5DRXB 3WFZA 4G8AC 1NDTA 3GJEB 2RQ8A 5FLVA 2LW3A 3GUTB 4A7UA 4BZ1A 1I9IH 5E00B 5KANI 4RGMC 1CXLA 5D1QE 5C0CA 1G9NH 5I8KH 1OAXL 4BUQA 3G04A 1HTYA 3PL6B 3X13A 1B2YA 3O6FB 4OM1H 5IHUH 1YMMD 2ZG2A 3M1BA 2XV6B 3FTGB 5GGQL 3OJDA 3GPSA 3QHTC 4A7TA 1HIMH 4S1RH 3M88A 1T4KB 3HKZA 1CXFA 3IMRA 3MRMA 5ACMA 3CLEL 3N9GH 1F4YH 4OKVB 4ZPVB 3L1EA 4APQD 1CF8L 2FECI 4HS8H 4BH7A 1BQRA 4CVXA 5DJXA 2Q8AL 1PVHA 3HG2A 1F1AA 2Y72A 1UJTA 3GSWB 5HHXH 2XWBB 1RUQL 3DK2A 5F7LB 2HFEB 4G7YH 3S36H 3T4AA 4K55A 2CD0A 4H40A 3V6FB 2D31A 2QQNL 3KYKH 2ADIB 2OR8A 4QHNA 1I1AA 3NSCA 5IT2H 1XF1A 3DV6A 4BZ1L 4GEJA 2MQGA 4XP1H 1NBCA 1NANI 4NKDB 5B21A 4S1QL 5I0VA 4FXKC 1CN4A 2DWDB 5CLWA 3GXFA 3IKCB 5TDPB 1EVTC 2P42B 5DVNA 4AT6A 1UM6H 5I8EB 2V2WA 1QW9A 4HPHA 1DQKA 4F58H 3LRMA 2DQIH 4N0UB 3RWEA 4F7TA 4L8DA 2VABA 4KXBA 4NP4L 4Q14A 1LEGB 4XOAA 1C5BH 1CDHA 1NLDH 1OVZA 1JP5A 3KAAA 4DUXA 1A7OH 1KXQA 3T2NH 4Q0XH 3MR9A 1RK1B 4PJEB 1JFQH 5E1GA 4BQ6A 4ONOA 4P46D 1G9EA 3ZMRA 4NQED 4H8WL 3WFHA 4QWWC 1MF2H 1YEJH 2HZHA 2X4OA 2NY1D 1RUKH 3HOGA 2Q9OA 5F3FA 3SPVB 5GZOA 3W37A 3BZEB 4X6DE 1MFVA 1W16A 3D07A 4JLRB 5F6HI 2PCYA 1RUAL 3DX8A 3PP3K 4BSWB 4ZMYA 1WPCA 3B34A 5KSUA 4XNAA 1KIUA 3WUWB 3WELA 1JWSA 1K5NA 4HWBH 4AEFA 5DJ2A 3FT1A 4XZUA 1P4IH 5AB1A 2KHAA 3G08A 4WO0A 3HNVL 4MD4B 3RVWC 3JVGA 3CZFB 4WHTB 2VM3A 5AVXB 2YLHA 3P4MA 4GRWB 4EJ1C 5EOCJ 5CJ5A 2EIKB 1J11A 2YPLE 4YHIA 3HE6A 4TQ8A 5HHQB 1KWKA 3PQYA 3B6SB 2CLRB 3HE6C 1DN2A 4XPBH 5D9SA 4XVJL 4J3OG 1K3IA 1TQBB 2ENSA 3Q01A 2JKJA 5F9DC 4AEIH 2UV3A 3KVPA 2ICES 2E47A 4FFVD 1H19A 4N86A 3G5ZB 3P11L 3EYUH 2FQFA 4H20H 2ZYSA 1NWPA 4XP4L 3FT3B 3OHXB 5BV7L 1A6PA 1ZSHA 4CADB 4DN3H 5CJOH 1NFKA 2K8MA 3VO0A 3G5YA 3VJ6B 3N44F 1ETZA 2D0GA 5IWLA 1WEJL 4M5YH 4JRFA 2OR7A 4FZ8H 4DCQB 5JPNC 2W92A 5AKTA 2BP0B 2NX5D 1KCUL 3ARBB 1OSYA 3MLSH 2AK4B 1NMBL 3MV7A 3CIQA 4LF3A 4NZJA 3RB7A 2P24B 3MRKA 5GZND 2I60L 5EO1B 5ANME 4MAYA 3NCEB 2B4CL 4J1UB 1H0DA 4U49A 4S11A 3VWKD 1IT9H 3JSSA 3U0WL 2WXLA 4JZOA 4BFJA 3SPGA 3ORJA 1GAFL 1E6JH 2DYPD 3QG7H 1ACZA 4LPWA 4GFTB 5D1ZI 5F9OH 2PN5A 3FN3A 5HDBB 5J13B 5GS2H 5GGRA 3G9AB 1HZKA 2LV4A 1X6LA 5EU6D 3ZTJH 4U6TA 4ZMPA 2GSGA 5I71B 1AQKH 4DSYA 4LKXA 1G43A 3FCTB 1U58A 1UJ3B 4QLRA 4WU7A 5DUPH 3VRLF 4EI5D 2CCLA 2G0KA 4W68A 2VLJD 3ZDYE 4EI5B 5IFJA 3RDTC 1BYNA 3HZ3A 1CDIA 1D6VL 2PTVA 3HLAA 4UT9H 4IJ3C 5M94B 4ZYKB 1W0WA 3L3IA 4J8RA 4W9IC 1IAII 3WDHA 4FFTA 5TE7L 3TTSA 2DKMA 4X5QA 1FNSL 1OPGH 3US0A 2VJ0A 3KDMB 2X38A 3FB7B 4L3EB 1MIML 2V8LA 3LEYL 3KLKA 4DW2L 5F93C 1V5JA 4NN7B 3VDCA 1YEKH 3TWCH 3VVWA 1BREA 1KXVC 2I7OA 1KB9K 2WMPB 4YHMH 2WLNA 1AZNA 1FVEB 3MFGB 3N1GC 1RHHA 4F33B 1JPFA 1ACCA 1L0XA 1QVOA 4KV5E 3OMIB 4LDLB 2QSVA 1EPFA 4K3JH 3KJ4B 3TL5A 4GG6A 4GNKB 1A2YB 5C0RL 1L9TA 2JF1A 1N18A 3T6XA 2Q6WA 4EIZC 2YQGA 1A3RH 1GGIL 4YFLI 4RDBA 5JIKA 5C3IA 1V27A 5C6PB 2V2TA 4DAGH 1U8IA 1NJ9B 4AX3A 2F8VA 1R5VB 3BQVA 2P8LB 2J6EL 3FSZA 3MNZB 4X9HA 4Y2OA 1HH6A 1BQSA 3BAKA 4QOKE 1LP9B 1XMEB 2OTUB 3HRZA 3QJOA 4YJZL 5DO2D 3D52A 2HWZH 4NQSA 1FI8C 3LZLA 3SDXA 3R0NA 4YBHA 2OYLA 2F8IA 4I13B 1DLFH 3V0WL 5E08L 1T7XA 3ZDZF 1VKXB 1D7DA 2BVYA 2PW1B 3EO0B 5I6PA 4XMKH 1CDUA 3QI9A 3SY0B 2CO3A 4YZFF 5JPMA 5DUML 4QHMB 4CN1A 1U8PB 4PJFB 3V0JA 2XV3A 5JORA 3Q8FA 4HUWB 3RWJA 3E38A 2AK1H 5ABDE 3FU3A 4QLWA 3QPKA 1DQQA 5FUZL 2OX5B 1DVFD 1OTUD 2B15A 3T0XA 2WCPA 3QUZA 2JCCE 5BRZE 4TSCH 3S35L 1CBJA 2HRPL 5HYSG 2FEJA 3HR6A 3D2TA 1CF8H 5DK2B 2ATAA 4RFEA 1NLBL 1GS6X 5HVFB 1U92B 1ZGLB 1AI1H 3NA4A 5DS1A 2IPTH 3CSPA 4XPAH 4EI5C 5IEHB 2W07B 1G7QA 1F1DA 2X6AA 3C5XA 2RJMA 1T04B 4NKMA 2YC1A 3MA7A 4ODWA 1HX0A 5DJAB 1SY6H 3CLFL 3OKEB 1G84A 4Z9KB 1OE3A 1S7RA 1QWNA 5ALCH 4C56B 1BV8A 1U93A 1Z66A 2PXYB 2ATKA 5FFGA 4ZAKD 1U2YA 3ZZ1A 3MNDA 3IJ7A 4RGND 2XA8L 4RAHA 1S7TA 1BWWA 2DQIL 2BMKA 1PZUB 4F15C 1RULH 4UBDC 4NQCE 3LN5A 3SN6N 1E5CA 1J05B 3ILQC 4L8BB 3VMNA 4R4ND 4HBCH 5D4HA 4X7SL 5BCAA 4WCYL 3RY6A 2I9TA 2AJYH 2OSXA 4MAYD 5IBLD 3CVHB 1UG9A 4DGUA 4YSTA 3O9WC 3QUYC 4ZNEA 3CFMA 3DO7B 1CLZL 2JTYA 4IMKA 4AIOA 3GZQA 4KK6D 4N1CA 3Q9QA 3W9DA 3KYAA 4FJZA 3AY4A 1YY9C 1G0XA 3F8UB 2P1YA 2YA1A 4LL4A 5TQ0H 4NN5C 1M7IB 5HHVL 4G43B 5J9PB 4APQA 4EPSA 1MAJA 1N67A 3CN3A 5JOPD 3F12A 4ZG1A 5ID0B 3MGAA 2PNDA 2Y2TA 3UTTB 2DWXA 5F7HA 2GJ6A 3RU8L 1BF8A 2R1YA 3DX6A 4FCHA 1UXSA 2A6JA 2OP4L 4NZTL 1E4JA 4JPIB 3ZDYF 4JO3L 4E2OA 4AGMA 1Z5LB 3PGDB 1ETJA 2R7EB 4HWEL 4NZUH 3TURA 1GC1L 1R24B 2B3IA 4JFYB 3V0EA 2FJSA 4OLUH 4CKVX 4ZS6D 5IIEB 4LBAA 4FTVA 5DO2C 3FCBA 3GSRB 3GLAA 4LLAA 3KWVA 1FL3A 4HISA 4NZDA 4AYGA 3MSPA 3WFBH 1EHXA 3D34A 3O3AA 4E9QA 1EDYA 3OAUL 4I4WB 1I85C 4JM2A 3GHPA 1D2PA 4I77H 2D0FA 4JFXA 4A2GA 4XNMB 2VMDA 4G6JL 4J27A 4P8QA 2B5IB 1UH3A 4BSVB 3TH2T 1AQMA 1Q94A 2E7HA 2W59A 4B9IA 2WSDA 1AAJA 3P0GB 2WLMA 2EYRA 3T2QA 3VXTA 3D25B 2DWYA 2IADB 4UQ2A 5IEKA 4Y4FC 4M5YL 2Y3AA 4EZMA 5J1AA 1B9KA 4S2SA 4ZQKB 2JK5B 3MLSL 3BZ4A 4I9WD 1C12B 1LNUB 4LCUA 2M2DA 1XTMA 4TPRH 4R7NA 3GSVA 4NQDA 3NEEA 4HOWA 1CCZA 1DCEA 4UT7H 5L2KD 3V4PH 4R0LA 1PKOA 4ZXBB 4AGOA 3SJVE 1UACH 4PS4L 3I6KB 4WEBL 4ZQTA 2Y1VA 2DBJA 1R3LB 2ZUUA 2EAEA 4Y5XA 4FYRA 1DLHB 1CS6A 2KT6A 3F85A 2V9TA 2H9GA 1ZTXL 2CRZA 4PR5B 4P4RA 4WI9A 3U9WA 3U1SH 3CC5B 3I9GH 3MROB 4AVJA 3UZVB 1JK9A 1ZLWK 1AHMA 3LRHA 5HDBF 1NAML 2EO9A 4EN3A 3MV01 3JWNG 1H3GA 4KZEH 4B95C 1LD9B 3QWOB 2K3HA 3BDXA 3GHEH 4A6YL 1QHPA 4AWJC 5C8JB 1SF5A 1QUPA 3K2IA 4XC1H 1NDMB 3GMNB 1C08B 4U1NA 1J9SA 3LS5L 4IRSB 1TU2A 5IQ9A 3TO4B 3BYTA 4WO4B 1VZIA 5GRJH 1K4DB 3D7PA 3BLKA 3VWKC 3AADB 4LPCA 4OR1A 1IV8A 5DS8B 1E7VA 1PKQE 4RA0C 4XCCH 4G9DB 3RTQA 2XBDA 2XTJE 4HJUA 4PREB 4R97B 4U1HA 2NSXA 2KL6A 4X6CF 4NQEB 2E7BA 3PGCA 5KOVC 1CF1A 4A1RA 1QLEL 2YKLL 3H2WA 3HFML 4GBXD 4RGOL 4TLKA 3RL2B 4GY4A 3M17B 4MA1C 1BW8A 2EDEA 1A9EA 2QKIA 1WG3A 4KH9A 4AIEA 3UMTA 1DJYA 3GBEA 2QKIC 2YXVA 1KIRB 4P5TA 5DD5L 4FULA 43C9A 4U3HA 2FJGB 2V9UA 5INDA 1OLZA 3B2UD 2VLKD 3F7LA 2AJUH 3U30C 5GGRB 2X10A 4ISVA 5AW7B 3VSVA 4LSSL 4RSVA 1A4AA 5HI5D 4DFHA 4EBQL 1SDDA 2KZBA 2NOYA 1TZAA 4OCYH 5T3ZH 3JT0A 4G5ZH 4ODBD 4YSUA 2HH0H 3QEGL 3QISA 4HEPG 5AEAA 1C5DA 1E5YA 2JMRA 1HQ4B 2X0WA 5LVEA 1OANA 2XQBL 4A7QA 4HAFA 3L3HA 4YDMA 3RVWD 3FFOA 4XE5B 3GI8H 4EMZA 3K91A 3KH4A 2LVCA 3LS4L 4LCYB 5AW9B 2ZKHL 4H0IA 3BRFA 2K9UA 2H2PC 3CHXA 4N1HB 3B5TA 8FABB 3ZX1A 3MHZA 5BVPL 4N2LA 2HLAB 2OR9H 4JCMA 4GO9A 1BECA 2M8XA 2X2YA 1XGZA 4U6YA 5D96B 5IY5B 9CGTA 2V17L 2NX5E 2AJXL 4Z3IA 4AL8C 1THCA 3AG4B 2Z35B 2YD9A 3MCG1 4KHTL 5EBLB 1NTDA 1H9VA 4JM2D 3WTXA 1V3MA 5E51A 2K45A 3WEXB 4HALA 5HHMB 2EDHA 5EF3A 3M6DA 4WWKD 3O4LA 2PCPA 5C70A 3S2AA 1HINL 5DQJB 2V3EA 5D93B 3B37A 2ZCLL 3F7VA 2TAAA 3K74B 4G82A 3CSYA 3FB5A 2R0KL 2F7QA 5AFAA 1KTBA 2WYZA 4KKAC 1YEWA 1WIOA 3RTQD 4MBRA 4X6BA 2NXZD 5GHWL 1KACB 4AE1A 1TVHA 1EHKB 5LXVA 1FZOA 1TQSA 2WXIA 1SXZA 1BVKB 3SDAA 2XA8H 2HT2D 2FSDA 5GGUA 1FORH 4NNXB 1BJ1H 3BP7A 2LE9A 1BJMA 3E6HB 1S7UB 3IFLL 2XPGA 2X12A 4U2YA 2AJ3A 5CZXD 5IVNA 2MTAA 1GMIA 2XIDA 3B2XA 3FYIB 3PP4H 2CR6A 3U4KA 5JXAH 5BRZA 2V2XB 1IC7L 1IGJB 2NNAB 5BV7B 3OKDB 3GSWA 2G5BA 3S3SA 5J6SA 3VGHA 2VERN 2HVJB 1Q9WA 4LPUA 3SKMA 5I1JH 4I48A 2ZWNA 5FECB 3GXTA 1OF2A 1MUJA 3OZ9H 3AGVA 4I18C 2ITDA 4Y8AA 2V3DA 1P5UA 2A4ZA 4PM1A 4XMPH 1BZ7A 5JPMC 1J5CA 5CGMA 2OI9B 4XWOD 1TQTA 5HGAB 4N0UA 3RWEB 1IAMA 3NRFA 5G4NA 4J4PC 2H0EA 5GS1B 4FFWD 3DHMA 4LCVA 1CT8B 1FHGA 3D0LB 1Z0NA 2IQAA 1E2VA 4Y4KB 1UOVA 2HJFB 4AYFB 3NJVA 4LASL 4HWEH 3X2QB 4NQVA 4PB0L 2Q76B 1BQKA 1GGYA 3BWAB 4MJID 4QHKI 4NQCA 3ZE1F 1BLNA 3OQ3B 2NNCA 3FO1B 2G2NA 2V9QA 3K0YA 4IRZA 4JRYE 4MD5A 4XB8A 4KK5C 2E0PA 3ARED 2FJUB 5I75B 5E6RB 4Z7NE 4BFEA 3KLAB 2CJUH 12E8H 3KWTA 4OZHF 3AWGA 1H3WM 2NT1A 1TVBB 1N5YH 1DE4B 3MAWA 3TIEA 2QR0B 3UMNA 2IH9A 3O6LL 1WZLA 1YN6B 3C2AL 2BJML 1LO0H 4ZX5A 3HC4L 3HI5L 3ZU8A 2H1XA 2QZQA 2OZ4H 1MFEL 3HC2A 2XWRA 1RZ7L 2QSQA 3KYOA 4Q6KA 5D7JB 2YR3A 2B9BA 4JY4B 1CFNB 1HXMA 2WSPA 3LV3B 1O7DE 3FSAA 1RK0A 3T08A 3LIZA 2R0ZH 4D9RE 4Y16D 1UQSA 1NGYA 3G5XB 4CW1B 5I1DB 4LLWB 1W0VA 1U2HA 2J1KA 4YHYB 1QBMH 2YFOA 5E2VH 3P3YA 3OWRA 4PRIE 3SE4C 4CBPA 3DETD 2Q8BL 1MJ7H 4G8GA 2MIZA 1FNGA 3FQNB 3VI3A 3MOBH 3CZSA 1KJVB 2UUDK 1UACL 4PS4H 1M2VA 3JTTB 1VHPA 3QXDA 4O9HL 2FO4B 5KYWB 5C07B 4GSUA 3F7QA 1JIBA 1ETZB 1QSFA 1KYOJ 3VWJC 1GZQB 1A14H 3GSOA 4CUCA 2BHYA 3TA3C 4BA8A 4ZMLA 5KVDL 2VDQL 3QJXA 2AJZB 1U95B 2Y7NA 3F84A 3QXAB 5E6ZA 2P7TB 3QCUH 4NNYA 3N1MC 3T0EB 4LOFA 4XVUC 3FQ4A 3SCMB 3VG0H 3WOVA 2WTOA 5E8DL 3INUL 3QGVA 4PP1C 1H0DB 3LXCA 1I7UB 4C55A 4U1JA 5H2BA 3OSVA 3D6GA 1P0SE 5GRJL 1KT2A 2YK1H 1BYPA 1MW1A 2A9NH 3E8UH 1TNMA 4N68A 4JAMB 4YXHH 4WWKB 3KPSB 5EULV 4ADGA 1YYCA 2JIXD 2GT9B 4O2FB 2CLVB 4ZRGA 3FN0H 4MQ7A 5DF0A 3WS6A 1L5GA 1IFHH 4N24A 1QASA 4KJPC 2B9AA 3L3JB 3E7JA 4GINA 1OCRB 1MW0A 5LCVH 1I75A 1USZA 4RZCA 1ZE3H 1E5AA 1IU1A 2G3MA 4LOUD 1EAOA 5HYQB 2BDNH 2MSPA 3GHBH 3PWVA 3N1QC 2KLRA 5EZPA 1F3RB 4AMKL 4LXFA 3AREC 2YSSB 4QYOB 4R4NC 4AKOA 5DFVD 4B97A 4JVPA 3W2DL 1T5WA 4BEIA 1NCDL 3LRLA 2A6DB 3KPRE 3VW3L 5IM7A 2QTVA 3RWIA 5DD1H 2BW4A 3KDMA 1ET8A 3WXWH 5HHPA 3QG6B 4TL5A 2XSKA 3T2PA 1I8UA 1SDAB 2P46B 4ELKB 4HZLB 1BAWA 3BKYL 2WXPA 3C6SA 4YPGB 4D3CL 2E6PA 2Z64C 4EZKA 2AQ2A 3KGSA 3QDAA 1FRGH 4GSDL 1G6RA 2QSTA 5E99L 4OCMC 2RACA 4BFFA 3D09A 1LM8V 1PAMA 1SHMA 4KKLC 3CUPA 3HC3L 1M1XB 3WN5A 5GJTL 3HS0C 5IOPB 1CR9H 1DQDH 4D7PA 3IPEA 5TH2B 2W9EL 3OKOA 4NUGH 3T77B 5HHNB 3RWFA 2X4NB 3H85A 3QHFL 3D0VB 2XG5B 5JHDD 1AH1A 5F9JA 5LNGA 1IO4C 2CAKA 2X6MA 2ZXEB 3GZPA 4WI0B 4ENEC 4OCWL 4Z6AT 2Z8VC 2Z91B 1WUNT 1PCSA 3C60B 4OU3A 1WZKA 3DHUA 3JXAA 4UQCA 4OLXH 5TD4A 2DIBA 4K7PX 5I75C 1MHPH 5F7MC 5SWSE 5IROD 5F44A 3EO9H 4MQSB 5CCJA 2QQKH 3IDGB 4FERA 4WU5B 3SKJH 4FXGA 4NM4L 4HPOH 3FTGA 4KMLB 4KQ0A 4XPGH 3QJUB 3RTQC 2FGWL 1RU9H 3TPUB 3FC8A 4YDVB 3OZLA 1T4KA 4OB5H 3SO3C 4NM8H 4LLDB 1H6UA 4EI6B 3ESMA 1RZKH 1VAHA 3AT0A 2IOMA 3MREA 4JG5A 1HCVA 1GH7A 4ODVH 1D5RA 2DKSA 4J3VA 2R69A 3WEMA 4LBEB 3VD3A 3LIZH 1JZJA 3BP5B 4M7ZB 5J13C 5DRXA 4TQEL 4YSOA 1DQQB 4JQIL 3V7AE 1KV7A 3QUMB 2XPZA 4QHNB 3SD5A 2PYEB 4UOW1 4PJGA 2NXYD 5AW0B 3BQUC 4FN0A 3RHWK 1IM9B 3PV6B 2QSCL 5EZOH 3UZEC 3NABH 2RAMA 3GBMH 4P2OB 1ZK5A 3D08A 4A68A 1GJIA 1KWGA 3H3PH 3OVUB 1JHKL 1AG6A 1IILE 4U3XA 3D87B 5AW3B 4ZNCD 3S36L 4JG0H 2YD6A 1ZHKB 2JKXA 3UC0H 2GEEA 2VABB 1NCBH 2JQAA 2C7UA 3UGUA 1AQDB 4PBVC 2H41A 1M57B 1WIPA 3P30H 4H0GA 2A99A 4N20A 3EUDA 3BDYL 1IKFL 2OTPA 3ELQA 1KMGA 2ATKB 4MMYA 4F7KA 4AW4A 3KHQA 1LJMA 2XXGA 3PWPB 2WCSA 5EA0L 4OQTL 2BMKB 4BUGA 3L81A 3S88L 3NFNA 1WA0X 2NY0D 4L8BA 4X4YB 4D9RD 1PW3A 1MQ8A 2FD6L 1D7CA 5D7EA 5C1MB 2FWUA 2Z4QB 4OAWB 4RAUB 2X4UA 3EAKA 4HUXB 1UM5H 3KJ4C 4KK5D 4WUKH 2I26N 4MB1A 4YNYB 1SVZA 4ATWA 4AQEB 4JFOB 1TNNA 1MF2L 1YEJL 2HKHL 2W95A 4J4PA 5KZCD 1IQWL 2VXQA 4F7TB 4TF4A 3VH8B 1L6PA 3DGDA 1S46A 1XX9C 1TKWB 3LXUX 4QHLB 5F6IC 4LVNB 5K1VA 4ZS7H 1WHOA 3VXOB 4PP2A 2VLRB 3MLWL 4OJYA 5ICUA 5T8IA 4LCWB 3VI4B 1BWMA 3CSTA 3QW9A 5CEXA 1RK1A 5ID0A 3JBG7 4Z76A 4IRZH 4F57H 2IANE 1KBGH 3QULA 4TSBH 5A2IH 4MSWB 4LU5H 2APVA 2FTAA 5T1MB 4JFQA 3U9PH 1RVFH 1FGVL 1R24A 2D7PA 2XACC 4UM9D 1CFSB 3UC2A 2C3GA 3AMLA 4QGTA 5ITBL 3GSRA 2XN9B 2IDUA 4P5TD 2G2RB 5AYQA 3LQZA 5IG7B 1RFDH 5J6GA 2QADB 5HYEA 3UEQA 1K5NB 5DJ2B 1Q0XL 2YJLA 3VWJB 1QKZH 1YUHB 2RFXB 3TONA 1KYOK 2KLTA 4ZFZA 5SX4H 1Z2KA 2N7SA 1KN2L 2XTJB 5BV7H 4JM4L 3IJYA 1VFAA 2GABA 1NMCB 1CDJA 3P4MB 1YEHH 4ETQA 1FBIL 3SDAD 4X6FA 3QEQD 3UJIL 1KGCE 1WZMA 1DVZA 1HE8A 4W1TA 3D25A 1RURH 4MNQD 4XODA 2IADA 4E41B 5BZDA 2P80D 1TTCA 3K5RA 1P7QB 4NHCL 1KCUH 3JYCA 1LEKA 3LIUA 3TTYA 1AKJB 5J1AB 2ZCKH 4S10A 5EPMB 3DJRA 3MO1A 1A7PH 3VDAA 4L3CA 2BS8A 4JPSA 3CXHJ 4XR8C 4Z7WB 5I26A 4LEBA 2FB4H 1C5CL 3HMXL 4UU9A 5EZJB 3UADA 2ESVE 5FKAB 4MWFB 3GNML 2BM3A 4Y9GA 1VACA 5AVZB 1JMXA 5T5FH 2HYMA 4K94L 4H1LH 4HJGA 5KANG 2JKWA 2GBAA 2WXGA 1IBGL 4ZO7A 5CEYA 5IJVB 2XPYA 3PNWB 1LXMA 3O2WL 3QSKB 2OZNA 3MBXL 1RP9A 1UEYA 4AL8H 3OX8A 4AG4H 2C5DC 4QOKA 2DQGL 2QQLH 4XXCC 2A4EA 4W9GC 1TTAA 4I18B 1IGYB 5JHAA 1WQVT 3JYBA 2FRGP 4NKOB 2CDFA 3FAWA 1HESA 4NP4H 4UZGA 1CLVA 2GTQA 1FYTB 3WKYA 1WAAF 4Z7WF 2DN7A 3B83A 3RVTC 2GPZA 2HSIA 4KU1A 4XRCA 4N0CD 1CI5A 2WMPA 8PAZA 4HGMA 1C08A 3DDGA 3FUJA 2Z34A 1JXGA 4ZTEA 4Z3FA 4KGJA 3BWUC 4HKJB 5HVGB 3U2IA 1K4DA 4JN1H 4Q97A 1R9FA 1RD6A 4ZFOB 2OK0H 2QMKA 3HNTH 1R4XA 3SCMD 3FCTA 4LE8A 5FYJH 1MIEH 4L4TA 4M1GL 1U58B 2KZKA 2VXVH 4PCSA 3NZUA 3ZL1A 2DQDH 1TZIB 1MPAL 2ZAIA 4HHAA 1ZVSB 3EYVA 3DX4A 4YDKL 3NACH 3NT0A 1GKOA 3ALPA 4GQRA 1T0MA 4ZX3A 4NZFA 1U8HA 4KY2A 1OAKL 3B5HA 4DKTA 3SYCA 3CLWA 4K5NA 4NRZB 1KGYE 3L3IB 2DMHA 3L1OH 3QUGA 2JELL 1AXSB 3CMGA 4FQLL 3WUWG 5I6XB 3FB7A 2X0VA 5C0RH 5BQ7A 4L3EA 3WXVL 5C08E 4R5VA 2VDKH 4WWNA 3OKKB 3EKCA 3IN0A 4TXVB 5JIMA 2RR3A 4ANXA 1EGJA 4DKEH 1LEIB 2X28A 4M7KH 5D96C 4MXWL 2E7LA 1JRHL 3QIBC 4UUJB 1FLRL 1X6NA 4M61A 3QNXB 5EN2A 5D70H 4JG1H 1WLHA 2MOVA 2X87A 4B7LA 4KO5A 1KYFA 3HUJB 3NZSA 4FNUA 3CVHL 1D5BB 5IOKA 1SM3H 2HWZL 4GUOA 4XXWA 4XMZA 4TVUA 3FO2B 1INDH 1LMKA 4FEIA 2NX5B 1AHWB 3I75B 5EB9A 2W94A 5HI4C 1XGUB 3V0VA 1AO7B 1CE1L 1KZYA 3BVNA 4PJCE 4OB5L 4QXUL 3D3VE 4AVHA 3CXDH 3GRWL 3B2DC 3MNZA 1QAWA 1X9UA 2WXRA 1ZGLM 4Z8FL 1DBAL 1JG9A 1U8OB 2DTSA 2BSSA 4RFEB 4UM9A 1NMAH 5CJQH 4UTAA 1EJFA 3QJVB 4F37K 4RMWA 1G7QB 4JPKH 2OMYB 3KM1A 1TCRB 3EGXB 3NIGE 4JW3A 2L7EA 3UZQA 3HAEH 4G71B 4I0KA 1CFTA 3RKPA 3U0TB 2Z35A 3FMGH 1DN0A 4Y5VA 4R3SB 4Y4KD 3RKDD 4BXSV 2PPCA 3RX5A 5JHLA 5C0IB 2JQMA 4TN9A 3DYMA 2UUDH 1XR8A 4PFEA 4R90L 4JQVC 3K7UA 4DK3A 4NCC1 1KJ3L 1NGZB 1JWUB 3F83A 4ZMXA 3MV8D 4EOWH 2AABH 5EU5B 3IDNB 1QNZL 1ZIBA 3R06A 2YZ8A 4LLVA 4BFOA 1TXKA 1ZVYA 4OIAA 4X6BB 1LWRA 4ZMWA 5MEOA 1IIIA 1XH3B 5MERA 2H8PB 4PGDB 4FQ1L 3PPSA 1RULL 4I3SL 3MYJB 4PTUB 4RX4A 2OULB 4X6EB 5HI3C 2QGDA 2OW6A 1JAEA 1TQVA 2WBJD 4OT1L 4MCZB 4NKMB 3THMH 1LMIA 5CSZA 2CIIA 4U33A 3N42F 1T6BX 4C56A 5HI3D 1PNDA 3QRBA 5CEZD 1CFMA 1R33A 2HCZX 5FYLE 1F45A 3UTTA 3QI9D 4AYDC 1Q9WB 4WRLA 2J6EA 4H8WH 5GZOC 4EO5A 1AGEB 4EXPX 5IVOA 4OLVH 1Z5LA 4GUQA 2VSDA 1KDJA 2ORBL 3NIDF 1DQLL 1BPLB 4HH9A 4JFYA 4BKTC 2X3CA 2GBVA 4OD2A 1FO0A 4HMEA 1KCSH 3ARQA 3PXJA 1YEEH 4J8QA 1J5OL 2FEDD 1PZDA 1HL8A 3C6EA 4XCEA 4GOSA 3DRQA 3F2LA 1A1NB 3HN5A 3BGFC 1E6OH 1QFOA 4KPHL 1BFTA 5FGBA 1N12A 1P2CA 5DZJA 5KUKA 1QUNB 2EVHA 1BLNB 4I3GA 3WSQH 4CDHA 1IAKB 5T1KD 3ENEA 3P77B 3SQRA 3BQUA 1TJMA 3ET9F 1EDQA 3RDTD 4UQ2B 4KKLD 2GJ6B 4N9GB 2GITB 4BELD 2ENQA 3DBXA 1QKZL 5EZLB 2PPFA 3QORB 3K6SA 1P84K 3L16A 4MNHB 2JK5A 2W60A 3GM8A 3ILQD 4JPVL 2D3NA 4YDIL 5D2LF 1EZSA 1CLYL 1UA6L 2YIHA 4F93B 4N2OA 3V4UH 5EDXA 1YEIH 3NMEA 1FVDA 1I1YA 1K8IB 1LO4H 3LH2H 4K2UL 4BINA 1SZNA 1OM3L 3MFFA 1I3UA 1WRFA 3ULVF 5IBUB 3VB8A 1OM9A 2J5LB 1FFPA 1ZS8A 1YEFL 1DJXA 3GLZA 4UILL 1HXMB 2WYTA 1I1AC 3ROLA 1V7NL 2R4RH 5EH1A 4B3VA 5IFHH 5DRNA 1WWAX 3O6ML 2XN1A 2DDQH 4YH6A 3AGWA 3BT2H 3UCQA 1ADQL 3MLXH 4QAMB 3ES6A 1KULA 1TFHA 3AZUA 2V9RA 3MRJB 3GSUB 1F42A 4FG6D 3R8QA 3W1ZA 1AKPA 2NY7H 2EH7L 2Y07H 3VRIB 3WFEH 3ZTNH 3K2UH 5IEKB 5F1KC 4BRJA 4FQXA 5HHOB 3U46A 1OALA 1ORQA 1S7VB 5LXGH 1LNUA 5I6MA 3RPBA 1KELL 3L3OA 4KTYA 4EAEA 3PHQB 1B2WL 1RV6X 1CGSL 1N9PA 2WY3B 2Y6SD 4NOFA 3QS2A 3PUCA 2RIKA 4R0LB 5KG9A 2QJDA 1RZQA 4FQJL 5FC9A 3DURB 4Z5RA 4CVWA 3MGTA 4BJLA 1TJGL 3CZLA 5F9WB 4DETA 1RZKC 5DTFB 3FO0L 4F1ZA 5K5YA 3ZYZA 4WUUA 4WQOA 1YEGH 3SBWA 5IVXA 1U3HA 1XCQA 4IRSD 1OAZL 3U25A 1F8TH 4JREB 2VDOB 2XQYA 3FQ1A 3FU0A 4K23L 3CC5A 1BD2D 4XO3A 4ELMA 4UT6L 2WZ0A 1KT2B 4AVIA 4M7LL 4YHLH 2J21A 4J3OF 1OGTA 1JF1B 2EXWC 3V79C 1YEKL 3TWCL 2P47B 5DSCB 3H9SE 5I9QC 5C8JA 1YYMH 4OSUH 4XC3L 1JXDA 3HA0A 5I1HL 3C5ZB 5FO9B 1OHZA 3PP3H 4RMBA 3GUFA 4JJ5B 5DT1L 3RX7A 1P7QD 2WBXA 1EHAA 4CSPA 1HT6A 1LO3H 3NIFB 5TK4A 4DQAA 1MJ8H 4HCFA 3OLIA 1Z32X 4KOCA 2AAVA 2J73A 4JRWA 3SE4A 1HK6A 3BJLA 1TTFA 1T5WB 1XXFC 4WKZA 2VDNL 2IH3A 4ZMVA 5C0FA 4NFCA 2MPAL 4JQIA 3UACA 3UO1H 2GSMB 1ICTA 2P26A 3PXLA 1T1WA 1P7BA 5KEZA 3JWDH 4JEGB 4UB0H 4NYLB 5KN5A 3MRFB 1HSAB 1AS6A 2DLHA 4HZLA 4NCDA 1VSCA 4S1RL 1TSRA 4DTGH 2XWDA 1X5MA 4N85A 4Z3TA 2PCFA 3CMOL 2EDYA 1OE1A 3K8LA 2W88A 3FB8A 2NY1B 4R4BB 1ONQA 5DEFB 3FB6A 3MCLL 5B3NA 3CUPB 5D1XD 5DRWA 3M07A 3OD3A 7CGTA 5FDWB 1DJSA 1YJDC 3LS4H 4N5EC 4DPAX 4QXUH 6FABH 3DRTB 4PJDB 3C5ZD 1AGBB 3VXMD 3N06B 1SHXA 2I24N 2BVOA 3GRWH 2ERJC 3K4AA 4N8CL 4K73A 3VXPA 4CSSA 3Q13A 3AW5A 4NX0A 1T1YB 4HWZA 2VUOA 1NEUA 4XAWL 1PEZA 3OXSA 3ESUF 4KY1L 5T3XD 4JR9H 4KVCL 2PCPB 2DQEL 3C60A 3MV7E 5C97A 1MAML 4WI3A 4BRVA 5I8CB 5CP3H 2XVKA 3MGOA 3KLHC 4GXVH 4X7CC 3EYFA 1A6VH 5E6YA 2PR9A 1NWOA 4PVBA 2E76C 4G9FD 4FADA 1M71B 2R0WL 4JGUA 1UHVA 4UT9A 2X6BA 4PJHF 2CXGA 4CBZA 3UBHA 4Z0BH 3SDYH 4C83B 2FEEI 2RA1A 5F9WC 4EDXA 4XMVA 2NY6D 5F89A 4KKBD 1YYLL 2R23B 2GTWB 3J2PA 1YNKH 2CE6A 4EUPH 3CZGA 3BKJH 1JZEA 2N7AA 4H88L 1M3JA 5SWQA 3VFNA 5JO5A 1TQCC 4R2GB 3BPOB 2HJLB 4O58H 4W9HC 1UB6A 3I02A 4HCIA 1IFGA 3DJSA 3LKNA 3Q5YA 3GMQB 2BVPB 2EE9A 3SKMB 1FH2A 4X4MA 2WLKA 2BCKB 1QTYT 3L3GA 1M05A 2HVKB 4KZ0A 5D7IA 5EBWB 4AUUA 4G59C 1AANA 4JHWL 4QO1A 2W0LA 5FHAL 1RZPA 4ELMF 4ZZKA 1BZ7B 4GG8A 3Q6GL 1FAIL 1IM9D 4KI5D 5JQ6L 35C8L 2EH8L 1OT4A 2YARA 1NAKL 1ITBB 4KK8D 5FKPB 3AY4C 1IMHC