4A7QA

Structure of human i113t sod1 mutant complexed with 4-(4-methyl-1,4- diazepan-1-yl)quinazoline in the p21 space group.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCITGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Crystallography and Computational Docking for the Detection and Development of Protein-Ligand Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
total genus 40
structure length 153
sequence length 153
chains with identical sequence F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 4a7qA00
4FF9A 1E9QA 2GBUA 1SXZA 1BZOA 2WKOA 2Z7UA 1OAJA 4MCMA 1N19A 5KBKA 1SPDA 3F7KA 2WYTA 2C9SA 1DSWA 3GZOA 1IB5A 1SXBA 3ECWA 3KBFA 4BCZA 1JCVA 1YAIA 4L05A 4U4IA 1OZUA 4A7TA 3H2PA 2Z7ZA 3KM1A 3ECVA 3H2QA 3K91A 1E9PB 2ZKWA 1SXSA 5KBMA 1BA9A 3QQDB 3L9EA 1PTZA 1QUPA 2LU5A 1F1DA 1SOSA 2ZKXA 3CQQA 1FUNA 2GBVA 1HL4A 3ECUA 3LTVA 2WZ0A 3KH4A 4N3UA 4A7GA 2NNXA 1B4LA 2AQNA 2VR8A 1JK9B 1JK9A 1OEZW 1CBJA 4A7UA 1Q0EA 2Q2LA 2WKOF 1DO5A 1YAZA 3MKGA 4OJAA 1COBA 1XTLA 1UXMA 1F1AA 2AEOA 4A7GF 1CB4A 1P1VA 3QQDA 4B3EA 1F1GA 3HW7A 1SXNA 2WWNA 2R27A 5KBLA 2XJLA 2AQSA 3T5WA 1KMGA 3CE1A 3SODB 4N3TA 1SDYA 1PZSA 4BD4A 1E9PA 2APSA 2C9UA 1EJ8A 1XSOA 3GQFA 1TO5A 2AQQA 5CU9A 2V0AA 2ZKYA 2AQTA 1B4TA 1HL5A 1TO4A 3L9YA 3RE0A 2E46A 4A7QA 1N18A 1E9OB 1E9OA 3HOGA 1RK7A 2VR6A 1E9QB 1EQWA 3S0PA 3GTTA 4OH2A 3F7LA 2E47A 2VR7A 3HFFA 3KH3A 1ESOA 2JLPA 1U3NA 4MCNA 2WZ5A 4A7SA 2GBTA 1IBDA 2C9VA 1S4IA 2SODB 3KBEA 1Z9NA 2K4WA 1UXLA 2Z7WA 3GZPA 2WWOA 2WYZA 1F18A 1PU0A 1SXAA 1YSOA 2AQRA 2WZ6A 1SXCA 2Z7YA 1AZVA 2AQPA 1SDAB 2XJKA 1MFMA 1XTMA 2AF2A 1OZTG 3CQPA 2JCWA 3KM2A 4A7VA 3GTVA 2ZOWA 1SRDA 1IBHA 1OALA 3MNDA 3PU7A 1Z9PA 4BCYA 1IBFA 3GZQA 1IBBA 1L3NA
chains in the Genus database with same CATH superfamily
1SUJA 3KGUA 5BS0A 4JY6A 3KJ4B 3O11A 4Q6YA 4LKXA 2YN5A 2NR6A 3MJWA 1H0DA 3GXFA 5D1QB 5EC1A 1H3TA 3IGKA 4Q0XH 1KUMA 1V8HA 5DU7A 2CJ3A 3K72B 3FAWA 1SHXA 4GT7A 3JQOB 3K91A 3HPJB 2OJZH 3J7HA 4RBPK 4HALA 8CGTA 4WENB 3W1ZA 4JRXA 5BXFB 4IQHA 4ZPTB 4MYWB 1QMUA 1BG9A 4ZG1A 2YAHA 1QLFA 2XBTA 2FSDA 2K6ZA 3TH3T 4OFPA 4W9KC 3EOTH 5KBDA 2WTOA 5SWSD 2F5AH 2PTUA 3EJZD 3IDMB 3CX2A 3VMNA 4BHUA 1MY5A 3GHBH 3VFPA 1IZJA 3ULVC 5LN4A 2CK0H 4ZXBC 2QVMA 4PRHB 1WF5A 2R29H 2EABA 1HFUA 2XKUA 3Q43A 4XPTL 1FL5B 4U3XA 4R7LA 5DD5H 5HI5D 2IBZY 2WWNA 1U6AH 3ARDA 4GAGL 4PTUA 4UQDA 4I0CC 2J8HA 3U1PA 4PEEA 4D0CB 1G4MA 4OUOA 3WXWH 3BT0A 4IKJA 3TLRA 2XXGA 1G0DA 5FA3A 3ZRSA 5KSUB 5E95B 4P2OA 4ZD3H 4KZCA 4BH7B 2VUKA 1ID5I 3RTQD 4U6YA 3AC0A 1AI1L 2VDQH 2A6DB 2WQUA 2P5EB 3D2UD 1F41A 4X99B 1G9NH 4PYHA 4EIGB 2JXMB 3K1KC 5DK2B 4UT6A 5AYTA 3MA7A 2E7MA 1A3LH 2H3NA 4IBVA 2OAAA 1ACYL 2DQFB 4MA3B 4GKZB 5DD0L 4FG0A 4JRYE 3H54A 3ULSA 3QUKA 3L3JA 5E24E 1A64A 2AXFB 3WEMA 3FH7A 2AKRB 2YUZA 5DHDA 5CD3A 4AXWB 4P46C 2OMYA 4AKQA 4LRIC 3CLEH 1A6AA 3BAKA 1ES0A 3BT2H 2H8PA 1X7QB 5I8OH 1NFKA 1RURL 1X4ZA 5AVRB 4D2NA 3MFGB 3ZRFC 1UXLA 3GSNH 5K9KA 3OZ9H 4JJOA 1GYVA 4AEIH 3P4OA 4IBUA 4OJCA 3HEIB 3DNKA 4XE5B 3HMXA 4FQXD 1KPRB 1Q9WA 3WCYA 2WVTA 4H25B 2F7OA 1CGTA 4CAGA 3OMZA 2OXGA 4Q9QH 5EEXA 3ASNB 2IOMA 4X5RA 1B9ZA 2JI3A 1U8OB 5GS0H 3VMPA 4QRPE 3TJEL 4UZSA 4WFFE 4LSQH 5IVXA 3B9KC 2K6WA 5D6DC 5CCHE 1ASOA 1L6PA 4H4NA 1ILSA 2FHBA 3BPOB 3DX6B 4OKVA 4TSBL 3U0TA 2X4PA 1BZOA 2YBGA 3NUKA 2ISDA 1IVTA 3LIUA 4BK4A 3FU8A 2Z0BA 3A4FA 3V55A 1CLZL 3BSZL 4WNSA 1INQB 3AB0B 5BW7C 1AIFB 2ITCB 4PWHA 1DSWA 2F7IA 1OOAA 1PEZA 2IADA 3RWCB 1KLGB 3N1GC 2R0LL 3APDA 2CMRL 3DX9A 1OM9A 1MEXH 3O11B 2XLLA 5IVZA 1H8LA 2Q76B 1E27B 3IGUA 4DKEL 5F21B 35C8H 3IDYC 3B9EA 4L9LB 4A55A 3NZ8A 4KQ4H 2E6JA 4PJHA 4XPAL 2HPOA 4L4TE 1OKEA 1F11B 2FL5B 3HVNA 1EANA 2YXVA 3H2WA 3HNSH 4KMLB 3UDWC 4AQEA 5ADOH 1W0WB 3AMLA 4FJ6A 4WEBH 4XBPB 5CILL 1EMTL 4XMPL 4F8PA 1N8ZB 4J6RL 1OPGL 1KBWA 2APVA 1EFQA 3RWFB 3ZR5A 1A8JH 1ZLWH 2BSSA 3T2QA 4DGYH 4OLYL 3ATEA 3ZE2F 4ZFQA 4MJ5A 2OZ4H 3RY5A 3JUYA 5T1LB 2JELH 4QRBA 3ARFC 3KPSB 4KNSA 1WEJL 4Y5YA 3CZUB 4HF5L 2VQ1B 4JFDE 3DROB 4OF7A 4PV9B 3QZLA 2FWLB 4EQ2A 4UZUA 1WZMA 4ZQKA 2CNYA 2NQCA 2CBOA 2HFTA 5EU3B 5KSAC 3S3BB 1JK8B 3Q6FB 2C4FT 5IROC 2C7UB 2V17H 1NOFA 1MHCB 5DMYA 4OF0A 2W91A 1MG3C 3G6JF 2V7NA 1XGRA 2HVJB 4IDLA 1JERA 2XN0A 3EHBD 2A9ML 1BSIA 4KY2A 1FV1A 3IJ7A 3LZFH 4F58H 4WUUA 1GR7A 2WUBH 1GJIA 3BZFB 4KKZA 4M3HA 1JPFA 3H1ZA 4XNUL 2BFGA 3SDDB 3VM7A 2O72A 4U4BA 5BRZB 5KVEH 3BUYB 4AXWA 1ZHLB 1BFTA 1I4FB 2EIEA 1ZDQA 4GAFB 4WNQB 3HCVA 4NZTH 1ECZA 2PCFA 3V10A 1CDHA 1AQMA 1TEGA 1WWWX 1ZOXA 4M56A 4PW4A 1KCWA 3F62A 4Y19D 3RUGE 4GXUM 4ZFGH 3RZCA 3MXVL 5DFAA 4IGBA 2IPKA 3IDYB 2B1HH 2C9RA 4Y1AA 1ETB1 1RZJL 3KVQA 4HIPA 3QORC 2DS4A 2XG4A 1R24A 1U91B 3ZKSD 4Y2DB 3GBNL 4NKMB 1BPLB 1JHLL 4ISVB 2WANA 3WD5H 5HJ3A 1HCYA 4ZRGA 5MHSE 2EH7L 1IT9L 4PMFA 5JW3H 1QZNA 1OAYH 1DEDA 2EIMB 3PHAA 3ULSB 4R97B 2B16A 4PLJC 4KVCH 2Q2EB 4KVNH 1OAYL 5T1KB 4PGCA 2XA8H 4WCYH 2F5BH 3WUWA 1BJ1J 2XZAL 2AEIT 4XP9L 1PZ3A 5BRPA 3ASOB 4WSJA 1FUNA 1A3RH 4NC1C 2XN9D 1NSNL 3BQUD 1ZSDB 3PWUA 4W4NA 1AD0A 4N8UA 5EOCH 1JGUH 4GBXB 3TS8A 1T2XA 2YAEA 2CUHA 5C6WH 5JXEC 1R3LB 5KYYA 2HLAA 3NSFA 2IQ9H 4BDVB 3MRFB 1JV2B 3N04A 2GC7C 1IEAA 1WAAE 5D7JD 1F13A 2FZ3A 4KO9A 3VDBA 1V55B 3LIZH 2ZJSL 1XZWA 2AEOA 4BK5A 5KVEL 3MRGA 5D7JB 5GSRA 5KYWA 3L3IA 2I60H 4WI2A 1H5BA 1BAGA 2B1AH 5LN8A 2A5UA 2JJTA 3MROA 4FTVD 2W95A 3WFDL 3RGBA 3I02B 4F92B 5HY9B 2KDYA 1KB5A 4FI6A 3WXVH 5AW6B 2EXSA 1MNNA 3CVHA 3GO1H 4FQJL 3TO4D 1MCNA 3MYZA 1L5GA 1S9XA 3IDGB 1EAOA 2XIBA 2CLVA 1Q9OB 2JKLA 4LEOB 3MV01 3P73B 5SWZE 4R83A 3GI8L 4Z7WF 5D6CA 2E46A 2XRAH 4YDVA 4XMKL 4ZT1A 1YMHA 4YHZL 2N59A 3CDGA 3LKPA 1E9QB 1HOCB 4KTYA 4KMQA 3LH9A 2MCMA 5J12B 1NC4B 4O58L 3STZB 3CPUA 5IF0A 3MOAL 1NGWB 3OWRA 4G7VH 1M6OB 3VSVA 3LH2H 2G30A 1AVAA 3BVXA 4XBGA 3LRSA 4K71C 5CGYC 4XB8A 1P2CB 4XXWC 3ZE1E 1HSBB 1R3HA 4M4RB 4BK5C 1CU4H 2ZXGA 1KULA 4Z7OB 1WBYB 1KJMB 1BBDL 1A4AA 3T4AC 1MWAL 2DYPB 3GSUB 1EO7A 1SN2A 3MRMA 3R06A 3ZRCC 5I0WA 2WLMA 2J1XA 2WLYA 5F89B 2GTQA 3DECA 3TWYA 5A2AA 2Q7NA 4K9EC 4ONGL 1ZLUH 1U4FA 1F0LA 4HKBB 5C0AA 2HLEB 2FGWH 3L1EA 3B2UD 1QKZL 4UUJB 3ELAT 3ERXA 3U6RA 3N85H 4AL8H 1FJ1A 2A9BA 4R4BB 4OZHA 5BV7H 3OJVC 3QUML 1HSAA 4J3UA 4DVBA 1WC7B 4AIOA 3MRIA 4FFZH 4TXVB 5D2NE 1JZJA 3DDFA 3TJPA 3LZNA 1JUFB 5I1AA 2HJFB 3L3GB 4WTWA 1FVDB 5IW6A 4EDWL 4F9PA 3UBGA 4K3EH 4FHBD 3VCLA 3CHPA 2F18A 5FGSA 4LCCB 4QEGA 4UILL 3VFUB 4LGRB 2MOGA 4I0KA 4BXVA 2EUZA 5T1LA 2LGNA 3P73A 3D69A 5K9QI 1JZ8A 4U6TA 4QWWC 2ODHA 3SOBL 4GUOA 1NGPL 3S7GA 3WIHH 1AGDB 3D33A 4C56E 1FLRH 1YN7A 2GSGB 3PJSA 2YRLA 1OAZL 5I19H 4ZDHB 1JFQL 3AREC 5ITBL 3DGGB 4YDJB 3QUYA 1UWYA 3K2IA 2EO7A 3MNZA 5C07A 4AT6A 3ULVH 1KTDB 4HGMA 3RVWD 2TRHA 4WGWB 1JTTA 3J2PA 1V3JA 4M6OL 1I7ZA 2J6EH 1U8IA 5D1ZC 1ONQA 2WIIB 4IOIA 5DHYA 5T3XE 2YMXH 4FNRA 4I3SH 2UWEA 5AEAA 2FSEB 3IDNA 5AW8B 1MFAL 2K8QA 1BXXA 5DVNA 1INEH 1DDTA 1USQA 1W72A 2YPVL 5I66A 1QW9A 3EDKA 4BQCA 1KB9J 4JHZA 2FCBA 3M86A 2JJVA 1H8SA 3UO8B 4K15A 2ZXQA 3QUXA 5L9DL 5HI3C 3EDEA 2QGEA 1LDSA 3WFHA 3X11A 4NUJA 5I16B 5L6YL 2XZCL 3A4DA 1T2QH 3CFQA 2V0AA 4UMSA 4ZUVB 3WN5C 1FGVH 3FUFA 2AS5M 4PRAB 5DZPA 4Z7QB 3LKRA 1KV7A 3K6OA 3RE0A 4FQCL 1F3DJ 4FZEL 3OSVA 1DQMH 1TUPA 1U91A 4E9TA 4CGTA 5HDOA 4X5WA 4QLWA 3RX5A 4MDJA 5LGHL 5MEQB 5F7KC 1IMHC 1HHIB 1LMIA 3BIKA 3DK2A 1OAXL 1T0MB 2EC9U 4PY7B 1QRNA 4XTRD 4YSTA 2LTQC 2KUTA 3NCYS 1F4YH 1SVCP 4GSQA 1DLHA 4AEHH 5DHMC 4JRYB 4IRJD 1G7IB 3L9RB 4GS7B 5KVDL 3IS0X 3V8OA 5KZCD 3CFJB 1BVKB 5CGTA 4YFLI 3ZL2A 4F7EA 3BN9D 2E6QA 4RWYL 1BQ5A 5T3XH 1UC6A 1OWRM 1LDPH 2Q8BL 4MB4A 2G0LA 4JMNA 1H15A 3QUKB 2ARWA 1NCDH 4N6RA 2X1XR 5B1CA 3ZE0B 1I8KA 1ETZB 1URZA 4UQEA 4MZRA 3TF4A 2XTLA 2FDBP 4BCYA 5BO0D 2Z34A 4JQVA 4HJ1A 1GS7A 3D0LA 4OLZH 3UYPB 4B60A 3MLVH 2SEBB 1F45A 3ALXA 5H37G 3T0XA 5L4MA 1JNHB 4EDXB 3L17A 1E3FA 1VFAB 1JK8A 2WWMD 1LO4H 3O3UN 2KI6A 2X7LA 2UXFA 1KEGL 1BF5A 1JXDA 4ZUVA 4OR1A 3IMVA 5CIPB 4Z7UF 3VCLB 3VDAA 4XP6L 1MZYA 5B1KA 4FHJA 1RZIA 1M7UA 1CDJA 3JWDH 2A74B 1D5BB 3RRQA 1R5IA 1ZDSA 2BCKB 3BKCH 5KVGL 5KVMC 4UI2A 2UZYA 2Y3AA 1DVFB 1FG2B 1GZHA 4DHLA 2ZP9A 3CG8A 2X1PA 3WENA 2QHLA 1OEZW 3U4BH 5F7NC 4X5LA 5KVFH 1CYGA 1HNYA 2COVD 4DW2H 2WKOF 4NNXA 1DO5A 4DF9A 3NVQA 1NL0H 4XBEL 4BBWA 1FHGA 2BOBB 2BDNH 2DQJL 1KLUA 4MA1C 5EU6E 4U1JB 4ELDA 4FABH 5C07B 1FBIL 2XN1A 3LSOA 3JVGC 1AJ7H 1PZ5B 1R3HB 3C60B 3Q1EA 5HGBB 5TQ0L 4PB9L 3HE7C 4ECNA 1AKJD 5C0JB 4M5ZH 3RIFK 5JYMA 2Z0UA 2DF3A 5IJVA 1LJMA 1KIUA 1XCTB 3CN1A 4DEPC 3QDJA 5CWSA 4NUPA 3CDGB 3LKPB 3BSHA 1K4CB 4OCMC 4DPBX 4B5ZA 3Q06A 5AAWA 3D69B 1CDUA 3CVHH 3U7WL 1OT4A 3BHBB 4KK9D 2VZOA 2FO8A 1IZKA 3BZEB 2YZ8A 4N2EA 1OTTD 2QEJA 3U0PA 1LE5A 5IR1A 1MPAL 4UIKH 4DETA 1PD6A 4S10A 1HEZA 3VRJA 3FQ2A 3MA9H 4KITB 2BVOA 3KL0A 2XZZA 5LXVA 3CFCH 2BNUA 3CX5K 4JM4H 2G3ZA 4LOEA 4UOW1 5E56A 4FNUA 2JCCE 4QYOA 1KYUA 4Z7VF 3JV4A 1OP5K 4JO8A 3DYPA 3KPRB 1HI6B 3CCHA 5CP3H 4P5MB 3RDTB 1JXJA 1BP3B 4DW2L 3QB7C 1S8DA 2EIJB 3M8OL 4R26H 5F70A 3CXHK 3D51A 4MMYB 3E6HB 2XBZA 2ID5A 1AC0A 1X44A 2VAAB 3VXRD 2NY0D 5KVFE 1YEFH 2VH5H 4OD2A 3RWJA 3WL9A 5A7EA 5D1ZA 5DJ6A 4UT9H 1YNTA 2EXYC 5KVGH 5EUOF 1IVLA 3B3IB 4LGSB 4LIQE 1NL0L 4XBEH 5ESQB 3ZK0A 3MCLL 3DHUA 4MCYB 4EMZA 4Z3FA 5F7UA 4LSPH 1IKFL 2OMYB 3JXAA 4WLCA 4FA7B 2ZKHH 2TRYA 1PG7H 2QKIB 5F7AA 3DETD 3VH8B 4PJCF 4PBVC 5JMOC 3U30C 2YSTA 2B4CH 1TMCB 5JIKA 5EPMB 5E4OA 2VO8A 3VXOB 3D9AH 1R75A 2I5YL 3IFOA 3A23A 3FYIB 3B7SA 3L3HB 2VE6A 3SKJH 2DQFA 3IU4H 4MA3A 5E8DL 5IFAL 3CBJB 3MYJA 3BUIA 4MHHI 4M9PA 5TE6H 4LBEA 3A3YB 2BHZA 1VFAA 2ZUTA 1F97A 1S9XB 3IDGA 3PWPD 1L5GB 3O4LE 4Y4HB 2OSLA 1P53A 5INDB 3U30B 1J48A 2WWKT 4OI7A 3MA9L 5AVYB 2NY7H 2J55A 3NIDF 4N86A 2OR7A 1PIGA 3APFA 2EIZA 4NJ9L 1BLNB 3DHMA 3JYBA 2XTJC 4YK4C 3EO0B 3EYFB 3HMXH 1WFTA 3DOSA 1JFQH 5ITBH 1HX0A 2VDKH 2XC8A 3V4LA 3IFPA 1QPPA 3QJQB 4FFZA 1B2WH 3CFUA 2ZYRA 4AKPA 2Y9RT 4BYHA 4PRHA 4MD4A 2ED7A 3HNVL 3PL6A 4HX1A 1RQ5A 3F04A 4UOQA 5IY5B 1QX1A 1LD9B 1T1ZB 3C2AH 4LLVB 3VFMB 3GGWB 3I9PA 2NXYB 3TBVA 1MCQA 4GKNB 7CGTA 1DQML 4K3EL 5DRNB 3S3DB 5ABDE 1ZWIB 2X4QB 3GBEA 3LNHA 3VFVB 3SDXF 1FGVL 3QEUA 5FO2A 2PYEE 4W6XB 3ZYJA 4KK6C 2DLIA 4MHHG 4KX7A 3ZVVA 1Q0YH 4FMKA 4JQIH 4YSOA 1ML0A 4CC0A 3DXAD 5HJGA 1JVLA 5BZWB 4JM4L 1QEWA 5D7LB 3ABZA 3N50A 4LKXB 3FFCD 5E1HB 3V0IA 5IEKA 1THAA 5AWNH 5C08A 1RVFL 5DSCB 4DO6A 3QXTA 1I8LA 1S7SA 5ALBL 2VZVA 1KXVA 3CXDH 4XP5H 5ESVA 4I1PA 5J3HC 3QS2A 1TFPA 3FFOA 3F01A 5F8QC 4G7VL 5HYFA 4NNPH 5KSBE 3DOSB 3G9VA 3IRZA 4HG4J 5B38G 2X09A 2EACA 2QV4A 3S3PA 2ICEB 4NM4H 2WQXA 4MRBA 3GM0A 3I6GB 4NS0A 3FU7B 5EOTA 1CGUA 4XOEA 5GGRA 2YAMA 3LXAA 1SQ2N 2XKNA 4X6FB 4ZFZB 2PR4H 3WTWA 3BGMB 2ZWZA 3W57A 2Y2TA 3BXNB 3QNZA 3DI3B 2R0ZL 4FQXC 3M46A 1VPOH 2DYRB 3O3EA 2I85A 4P2OD 5FAAA 4FF9A 4M8RA 5DZVA 4G6AC 4H0GA 4Z76B 3QSKB 2B15A 1OAJA 1XF5B 5ERWB 4F33A 4WV1B 1BQHB 4AJWA 1RMFL 2HRLA 5FF6A 1SQMA 4J4PD 5IIEA 1IB5A 3ENEA 3TIDA 2E7LA 3MBXH 4M7KH 4APXA 5C0GA 2H47C 3ZT6A 3QR2A 2VXVL 4RAVB 3B2UC 4M03A 1AZUA 1UZGA 1RZGB 2CBQA 5DI8A 1VGEH 3DX7B 3BOVA 1UATA 4UDTB 5ACZB 5LO7A 2NOYA 3KWTA 3I3DA 4PGDB 4MS6A 2ADGB 4PJXA 4BKLA 4A7UA 4F1SA 2WQRA 2Y25A 2CRMA 4XBPA 5DK0A 2XWTA 4LOFA 4QR7A 3UZVB 4EBQL 3VXNB 3X12B 4PRPB 3MLZH 5EIIB 1I3GH 2YGNA 4HCRA 5F7HA 4OFIA 4M1GH 4QXVA 2AJVH 1MFAH 3BCFA 3UO1H 1QBLH 3INUH 1NAMA 4TS6A 2P47B 2VNCA 5AOIA 3OKKB 5I5MA 4NQDE 1EEZB 1LO0H 2DBLH 3HC2A 2R7EA 4OGXH 5E4IA 4F80A 3FB6B 1XSOA 3C8KB 5CFAA 3FMGH 1HYRC 3MNWB 1CIDA 5FECA 5EB9A 3IJ8A 5F72S 1NAMH 2CJUL 4KTEL 4YXKH 3V0GA 2MPAH 3O81A 3MV8B 3QFJE 4KJQD 3MLSH 3HC3H 1MXDA 1CE1H 4FXKC 3BE1H 5DJCB 1YEWA 1SUHA 4HWZB 4XCEB 5B1BB 1AGCA 3T0EA 4N1HB 2VDMB 3LZRA 3U48A 4FFYL 2IGFH 5HJ3B 3BH8A 4LQFL 1BYOA 4M6MH 2V2TA 1KT2A 1FYTB 4IM8A 4U1MB 4FXKB 1YA5A 2I7OA 1RV6X 1YMME 2QT6A 1HAWA 4NQDD 5H2BA 2OQJB 3TNNB 3VXSD 4H0IA 4MJ4A 5BOJA 1A47A 2UZXB 1URLA 3GGWA 2HKHH 1NCIA 1DUYB 5FXCH 1R1CA 3LZPA 4P2AA 3QDJD 2CRYA 2XQYG 3UDWA 2D31A 2BW4A 3MNDA 2BZCA 4U49A 3S5LA 4PJ5B 1UT2A 1D5XB 4IIQB 3ROOA 2AEWA 2CD0A 5ID0B 4HD9A 3P0YL 2X9XA 3BJLA 3VD4A 2IBZX 4HF5H 4MFHA 3ZDXF 3G5WA 4GAYB 5DVLA 3RTQC 1WEJH 3L3OB 3GSXA 5GQBA 2JELL 2V5YA 4F7TB 3X1GA 1DZ0A 4XP9H 3FCBA 4WKZA 3CLWA 1L4IA 1CFSB 4E36A 1CGWA 3UG5A 4TVPH 5IJDC 5C0DB 3RDTD 1N70A 3F5WB 2B1HL 3AG4B 2E8YA 3FT2A 5IESL 5KSUA 2EDNA 1GYWA 4HKZA 4KPHL 5L2KA 1E4KA 1NOAA 3EYSL 3LJ3A 3NJHA 4B9IA 2LTQB 1TCRB 4KJYA 4OD3H 4Y1AB 2G3XA 3OKLA 1EVTC 2AABH 2YGVA 4MQSB 1LO5A 3VSUA 5EPMA 2YMTA 3FRUB 3GMPB 4LSUL 1PLGH 3QEQE 4B50A 3M7FB 1E6OH 1FNEB 1BJ8A 5ABZA 3IB4A 2HTLC 3U2IA 1PSKL 2X4SA 1W2KT 1CL7L 5GPRA 1LTXA 2CDGA 4Y16D 3WXVL 2ADGA 4ZS6C 1O6VA 4HWUA 4PJAA 2VKXA 3PPSA 3QZWB 4C56A 4JDZB 4Y4KB 3ZHNA 2FO4A 4RFEA 2X4TA 4WW1A 3MRBB 3RNKA 2CHWA 1JF1A 3WNNA 2ZX5A 5CN3A 1DQDH 2UYLB 3DVNB 4TRPL 4Y16B 3WL9B 1GYAA 2H1XA 2V2WB 2WXOA 4S1RH 1NAML 2CJUH 4RH4A 4YXKL 4BSWA 3PUCA 4KROC 4ZXBA 1W0WA 4ZAKC 2XHNA 3C5ZC 4LP8A 2GK0B 2NUTB 2E7LC 1S7WA 3KCPA 1M57B 1T5KA 2A9MH 5GGSB 2QQQA 3GRWA 3WIHA 2H2PD 1EK3A 1TTCA 1BPVA 4JPQA 5K39B 3OMIB 1LO3H 1WC7A 1GRWA 1MQ8A 2BPBA 5FCUH 5ISZB 3US1A 3QEQA 4DZ8B 1BQKA 1L9TA 1O9VA 3BWSA 4LFHG 2A6IA 3K4ZA 2H1PL 2F5BL 1U95B 4UIMA 4OCNC 3PHSA 2CUAA 2LLLA 5LQBH 4PJGA 5CEZD 1AIFA 2ITCA 3HFFA 3SSGA 1AGEB 2NNFA 3MQIA 3TV3H 1RURH 3FK3A 4UM9D 5F3BB 3QBTB 4G8GD 4GQPH 3P77B 2ZX7A 3PNWA 2EXWD 4R6UA 2WXNA 5BRZD 1U8IB 1IL1B 1EVUA 5T5NF 5F9DC 4X80H 4ZFZA 5LGJB 1KIPA 5KSBA 2EAEA 2PP8A 4M4RA 1BVLA 4X7TA 3LKQB 3VQLA 3QHTC 1NEZB 4KI5E 4YLCA 1RUAH 2YA2A 1T21A 1F4XH 4NLAA 4CDHA 5GS1B 4JM2B 2OXGB 2BJMH 3U7YH 3CQPA 1AR1C 4WO0A 4X5QA 3EXLA 1IJ9A 2DMGA 2X0UA 3PWPE 3IAQA 2D0HA 5F2FA 5FOJA 5KYXB 3C6LA 4PS4L 5D6CB 3D34A 5CZXC 2NXYC 4LZKA 2VABB 2E75C 4DKAA 3OX8B 2ZNXA 4LSVL 1BDYA 1M2VA 1CLZH 4LEXL 2NCEA 2I07B 2NRDA 4HZAA 4KQ4L 2XOTA 2AKRA 5CZRA 5CD3B 3CSTA 2VXTH 4XNZC 3UADA 4F91B 2X6BA 3CFMA 3IVKB 3AAZA 4K3HA 5B39A 3L3OA 4HFWA 1EO8L 5IROD 3WS6A 3KJ6H 3ZTEA 1T3FB 1CYWA 4GMSH 3VFSA 1S7QB 3I74A 4YDIH 4DCQB 1NIDA 4H8WH 2EE6A 3T08A 2YSSB 1JG9A 2Z93A 2ADIA 5T1LD 1GSKA 3X17A 5DT1L 1NCTA 1T6BX 5E6ID 4DGVL 4W4OC 4PBWD 1JPTH 4FFWC 4I89A 3SD5A 1FAKT 3TT1H 1OGTB 1QBMH 4OIBA 3RVUC 5EDSA 4LLYA 2W9EH 2DQIL 2BSCA 2IMNA 4M93B 1ETJA 3B8YA 3KPMB 3L3JB 2R83A 3QUXC 2ZT9C 4KKPA 1J8HB 4X8JB 5JPMA 2BC4B 2CCVA 2C8NA 2VITA 2YXMA 5DJCA 4JS7A 3M17B 3TWCH 5CJQL 4PY8I 2OJEA 3L4TA 1Z3RA 4Q9BA 4P48A 4D9RD 5L2KD 2KC0A 3EO9H 3MU3A 4IOFC 2MFNA 3A6BL 4Y88A 4R2GB 2A9NL 2EDEA 3GKZA 1SMAA 4XPFH 5E9DB 4UZGA 2X4OA 4O2FB 3VFWA 4PMEA 5FDWA 1T1XA 4MAYA 4HGWB 3ZKMC 4JHAL 4L8SC 3ECQA 1IAKA 2PYEB 3B5GA 3MUZ1 1MF2L 5KTEH 2BWDA 3IPEA 4AGPA 1QNZH 4AG4H 1FVEB 3UEQA 2GUYA 3FONB 3HN3A 3VGEA 2K4WA 3QQNA 1X5LA 1G7PA 2OZNA 3LNIA 2AJSL 2WWOA 2CIKB 1PLBA 4HSQA 3UEZA 1KV3A 3OGCA 5AOJA 3QH3B 4XX1E 2GY7B 1CFBA 2V7NB 2HT2D 4LB8A 1MLBB 2Z92A 2COQA 5ANME 4R4FH 5ACLA 1A6TB 3KPRA 4J6RH 1YYCA 4JBSA 4WO4B 4NB7A 1SY6A 2WAQA 3V6OA 2B1OA 4LRNH 1LK2A 5JW4M 4OGAC 3SE8L 1FZJB 2EADA 3X1BA 4KNTA 3SKJL 2GBUA 5KBPA 3SJVB 4PJDB 2DI7A 1D7DA 3VG0L 3QUZB 2NZ1A 5LGKA 1M3JA 3LN5B 3VFTB 1NDMA 1OK0A 1GZQB 4DKEH 2P8MA 3HR5B 2NDGA 3TFBA 1MCPH 4IU2A 5E99H 1HOEA 3LPWA 5B7FA 2GT9A 4PJ7B 1OAQH 3IU3A 1BIIA 4LCWD 5HGAA 3WEOA 3DPBA 2EKSA 3KPPA 1S7RB 3IYLW 3QQ4A 2A74C 4M02A 1MW3A 2VW6A 2L7UA 3S8FB 2EDOA 2X9WA 4AQ1A 1MFCH 3BCDA 2E86A 3JZYA 5DYOB 1G9NL 1MJUL 4TQHA 2QHRH 4JFUA 4Z5RA 3MLYH 4R26L 5HGGS 5KSVA 1U92A 4JG9A 5CGYD 2BMKA 1WGOA 2DMCA 4LVOB 3RPBA 5E03A 1UXMA 3GJEA 1KCKA 4NFDA 4KTDH 1AXTL 2N7BA 3A22A 1F56A 4G43A 5CFHA 1WAAA 3FT4A 2G9KA 4PJCE 1CCZA 1EO5A 1U6AL 4GAGH 5I8EB 3RBSA 3K0WA 3RWGA 4P46B 1F4WH 1BJMA 2P28B 3BX7C 3FH5A 4QHKJ 4N0RA 3VXPB 3EF4A 3REWA 6PCYA 2IDCA 2R29L 4XPTH 1XF1A 4KXAA 4OTXL 1N0XH 2DD8H 2H2PC 3POHA 4ZUTA 3S36L 3TESA 4WWKD 1FCCA 3MOBL 2ENSA 5FHAH 4BHUI 3SPHA 1MRCH 4L4VB 3V6ZA 2NXZB 2QZ5A 1K5NA 1OM3H 4PLNC 5CF3A 2HUHA 3QI9A 3SY0A 5HYQB 2A6JA 3PJLA 2VR5A 3WJLA 1JXKA 1CDGA 5A43C 2PN5A 5GS0D 2SEBA 3CWGA 1D6VH 4HUKB 4WKXA 4BKTC 4R8WL 1IM9D 1E3XA 3HE6D 4B97A 1TZHA 2CKBB 1GZPA 2ZICA 4HHWA 4P2YA 1TZOA 1ETZA 1I9EA 1VFMA 5EBGA 4PG2C 2YPLE 4LSSH 3UBXB 5JOPD 1Z66A 2QLVB 5HHMB 1BD2B 2H6UA 3N9GH 2F54A 2C34A 1E5BA 4J3WA 4BZ1L 1IE4A 2C9VA 1TJHH 4PLOB 2HA1A 5ITFB 1QVOA 4M1DL 5JW5B 5C0NC 5DYOA 1UXSA 1QLRB 4G80B 3PWLA 2WZ6A 5CZXD 1BD2D 4N5ED 4Z18A 5BZZA 1QSVA 4AW7A 1X3DA 4D9QE 1P7BA 4KKBC 4U7KA 3SDAB 5TDNB 4X0NA 4EQ3A 4GRLC 3SJVE 3TT1L 5I0VA 4N0YH 4NM8L 1UD8A 4I3RH 5EU6B 4F57L 1S9WA 4YN3A 3QNYA 4OCWH 5CLTA 5EULV 4JR9H 5CEXB 5BMFH 5JOFB 3WAKA 4NLHA 4YX2L 5IBTL 4BJLA 2EXTA 4K7PH 2GUOA 1CJYA 3CN2A 1T3FA 3BVTA 5LLIC 3DTXA 4KV5E 4MQTB 3P9MB 2VQ4A 4WO4A 4PGCB 4MCZA 1AD9B 3STLA 5TGBB 1EO8H 3MCYA 2D03L 5FPIA 1RUML 2CIIB 2CLRB 4QRRA 5EZOL 4OLUH 3DV4A 3QULA 2I9TA 3ZO9A 2EC8A 2FT7A 2P8PA 1T0NB 4ZUUA 2KZ1B 1LM8V 3FXIC 4HJJH 4CBPA 1NGYB 4KVPA 3O2VH 1NMAL 1T1YA 4MA7L 4MB1A 2NNXA 3Q3GA 5HHNB 3CFEB 4PGEA 3QPXL 5ESQA 5G4OA 4Y19B 4JPIA 1TITA 1CBVH 1UYWH 4TNVK 4H20H 4W81A 5DEFB 4I18A 3BUTA 2PW2B 3QGVA 3N9GL 1QSFB 5CUSL 4GRMA 1JD9A 4NCC2 5D72H 3UBHA 3KVPA 3T4YB 3KLKA 3DJTA 5FX3A 5LBSL 5E8OA 2VDQB 1AYOA 3EH2A 4CSPA 2ATKA 2CH8A 3NCYP 2FYYA 4Z7IA 4FA6A 5KSAA 2CKBL 2Z31D 5LKNA 5C0FA 4OF5A 1GKEA 1WT5C 4AYDC 5JIQA 4NJAH 3L8QA 5ANMB 4URKA 3I85A 3IE4A 3EADA 4HMDA 4JQXC 2NLJA 9PCYA 1OM3L 2APXA 4MXWH 3ZHFA 1EZSA 2VL4A 1VB9A 3NDYE 2AITA 4UTBH 3L2MA 3TPKA 4JCMA 3NACH 5FKAB 2CRZA 3RL1B 2L7JA 5I23A 1MXGA 5FO9A 4G6ML 3P02A 5I1JL 3TA4D 4GW1A 4JLRA 1AHWC 1X9UA 2BWQA 2H1PH 2XWRA 2FHFA 5LNEA 4L8SB 4O51A 3OAZH 4YIQA 1K3IA 4APQB 1K8DA 1I7UA 2AXGB 4FKEA 3U6RB 3LPOA 2XBDA 4IHOB 2Z93B 5CGBA 1KY7A 3W0WE 5J6GB 3PY9A 1BZEA 4WI0B 3ARFD 3MLYL 3SN6N 1BD2A 3CSBA 1ORSB 1Z3GH 4E0RA 5K93A 4IS6B 3HZMA 5T1JA 4P2RA 3BWUF 2WXGA 3ZZ1A 4M7LT 2L3BA 4WK0B 2F7QA 2P1YA 2EDTA 1ZXQA 4XBGB 2DTSA 3NPSC 4NO0D 3HE7A 4PJEA 3W2DH 2OYMA 4H26A 3OAWA 4PP1C 3V9EA 5C9KA 2F7PA 3ELQA 3H3BC 3HI1B 2P24A 5E08L 1DQKA 5F1OB 3BWAA 4TULH 1P1ZB 4E9VA 2X6AA 4MGXA 4LHUG 1YMHB 4WHYG 1O7VA 3QUXD 5L7XL 1T20A 1DJZA 1NCOA 5TK2A 2VDRH 3TYGH 3NTCL 3HFML 1UADC 4K2UL 1FL3A 1PGRB 1QBML 2HT3C 4OLXL 1XBRA 1KEML 4GI9A 4G3YH 3QDAA 3N85L 1FO0L 4XPGL 4KPHH 5DLLA 4YSQA 2JVUA 3M88A 4XMTA 3CVIH 4W6WB 4Z3GA 2BHYA 4A04A 5D1ZD 5CLZA 1MFUA 1NFDE 3CIQA 1BZ7A 3PDOB 1P5UA 5DFVC 3SKUD 1TYEB 4XWGL 3VQMA 4A7GA 2ZCHH 1XGTA 2NY6B 5AKTA 4NCC1 1TEYA 3G5YB 3F58L 4L48A 4KTGA 1G6RH 3DRQB 4QPEA 4FHKA 4U6XA 1NEPA 2DM7A 1CMOA 4YHLH 3ZTCC 4I18B 3CFJA 2WTRA 4LIQH 3H9SA 1I85C 3VH8G 5CEZL 1BMGA 4EIBA 5DJYA 3NP4A 3F6JA 4BGLA 1T66C 5KOVC 1VGKA 2EDXA 2EYTA 2YQ3A 4JVUA 3J8F7 3EO9L 5E4EB 3UTSA 3U36B 4BGDA 1T83C 3X1NA 3EYOA 3WV0A 4PS4H 4B27A 3TWCL 1AD9A 3STLB 4F8LA 3P30L 4XODA 3QWQB 1VJSA 3HR6A 3NQIA 4M6ML 5B38A 1S7TB 1EJOL 1LL1A 4GKNA 4TRPH 4EDXA 3FBQA 4I0PD 4F7PA 4YDLB 4DQOL 2DQEL 1FNAA 3ESPA 4GKSA 3DA0A 4HEMA 5T3ZE 3LIZL 3TN0A 1JPTL 3JWOH 1CL7H 3UPRB 4TTGA 1UA6H 5FA3B 4DOHB 4BZ1A 1RHHB 3QISA 1UJ3B 5B1JA 3US9A 4YQXL 3SE3C 1NDGB 1VADA 4FI7A 5EOCL 3FCTB 5I5JA 3NT0A 3MJ6A 4GFTB 2CGRH 1B4JH 2A83B 1ZJAA 1QBLL 15C8L 3MUY1 2VXQH 4MAYB 1USZA 2JQAA 1ZVSA 3FTYA 3OR7B 4OFYA 4J3SA 5E6UB 4Q4IA 1DLHB 3DGGA 2NXZD 2DTMH 3QPQD 4YDJA 3OB8A 3G5ZB 2Q86B 2FX9H 4MAYD 3HVDA 2VR4A 2CLZB 3FZUC 3K81A 2G2RA 4IMKC 4ODWA 3BRGC 3G9AB 3ULUD 2CIIA 4GXVL 2JB5H 3MXWL 5DJDB 2XIDA 3FQ1A 3IFOB 3PYCA 4MTMA 5ABAA 1DEEA 4OZIF 3B9KD 2DLHA 3N42B 5FWQA 1DL7L 5D7KE 3U2JA 1HXMA 2DJ4A 2WXHA 3ZMRA 1JWSA 3W5MA 4O5LL 5IQ9B 3B2PA 2ZXDA 2NZIA 4LLAA 2EDRA 4MD0B 1XF2B 2WXRA 3QQDB 4ETYA 4B9YA 1MCOH 5ESAB 5DJ6B 1XIWB 4IGBC 3RWDB 1MJ8L 4GXFA 4WV1A 1DJGA 3PREA 3WI9A 4NI6A 4CKQA 2OI9C 1GSMA 1T2JA 2FECI 3WUZA 4ZX3A 4FYQA 3RDJA 3SQBB 3JWOL 1R46A 1A7OH 1U41A 1VLXA 3LPFA 3EYSH 4U2ZA 4X9IA 1QWHA 3RDTA 3EG9A 2BSEA 3QJHB 2EIKB 1YQVL 3MOQA 4C54A 1OP9A 3H9SD 3T3PF 2J72A 3BISA 4PUBH 3ZZSA 5FA4A 5EU4B 2FEDC 1UVQB 4L2LA 2JLLA 5EBWA 2R8SH 1NFDF 1RIUH 4JO2H 4BIKA 3N43F 1T04B 1KGXA 4QRUB 5SV3A 1KC5L 2Z1KA 3QZWG 4BFOA 1XGUB 5JIPA 1E27A 5TE4H 4HS6A 3K8KA 3N43B 1WA1X 2O30A 4RVBA 3VGHA 1JGVH 5EF0A 2W65A 3CSPA 3EO1B 3EUDA 3CJJA 3WS3A 4NN7B 1EV2E 3S2AA 3WLWD 1WHOA 1LLAA 4OB5L 3P3RA 4NYLB 5AQ0A 3OAZK 1EHXA 5DJXB 4HIQA 1A7PH 4HV8A 3ZGIA 3ZX1A 1FNLA 3SJVA 1FYTD 32C2B 5G5DA 3GKWH 3O2WL 5KJ4A 3REWB 2QQKL 1G1KA 2WBJD 2D8KA 1KYFA 4E41D 4O2CB 3V6FA 1HSAB 2Y6SD 4KJWC 1YNTF 2WW8A 2ZE0A 3HIZA 4I2XB 4S2SB 2BM3A 4DT2A 2JIXD 3L7EA 3VU2A 1DVSA 4P05A 4I48B 2ZCHL 3VFRA 4EXPX 4WTZA 1FI8C 2E9BA 2YLKA 1UGNA 2HN7A 4IU3B 4Y8DC 5E9NA 1BM3H 4JFDB 4POUB 2V5SA 5CSBA 3UAJC 1IC5H 4PJCA 1D5BA 5IFJB 1CE6B 4JQIA 1GHFH 1H3VA 3BZ4A 4TNFA 3D05A 3Q8EA 2LVCA 4FD0A 2AJ3B 4ZFOB 2D3JA 2JJWA 4UM9A 1I7UB 4ZOBA 4YLBA 1EAJA 2MQ3A 2NMSA 1SMOA 4NQEB 4D0DB 2DWDA 1DVZA 4KKAD 3C09B 3T0BA 3BSZH 4L4TA 1E9QA 1HOCA 2PWDA 4PN6A 3GS7A 1Z9SB 4F33B 2VGLM 1U58A 4I18C 3BZ5A 4I0PA 4J4PA 3V0FA 3HMXL 2H26B 5E94A 3QYMA 3UO1L 5E9DD 4JEGB 3O6KL 4UQ3A 4ZXBB 4J28A 1F58L 3BW9A 3RPIB 2D73A 3ILDA 4CVUA 3BXNA 1TTGA 4NSKA 1BAFL 2FBJL 7PAZA 4WW1B 1FHNA 1JNNH 2VITB 1CK0L 1U3JA 3ULVF 4NP4L 2IXQB 1DQVA 2WVSA 4WZ9A 3QVAA 4HG4K 3U6XS 1HILB 1JXGA 2NW2B 4KXBA 4OZFB 2JKTM 4HAFA 1AMYA 5E8DH 1G1YA 3QJTB 5GSVB 3U9WA 5C0IB 4KFMA 1R4XA 1EBPA 3FFCB 3MRNB 1QFWL 43CAB 1IFHH 4ZX5A 4LEEA 3PHOA 4XVJH 4XCCH 12E8L 1Y07A 2VDPB 4JPSA 2XWEA 4N25A 3TN0B 3LKSB 4OFDA 4ELMA 1XTLA 5ACMA 3DO7B 3JWNC 3K6NA 2H41A 4FFYH 4OLVL 4TKWA 3K71B 3S8WA 2BXYA 1DFBL 1J87A 2QMKA 5EBLA 3RVVD 2HRPH 2Z8RA 3BZFA 3UG4A 2ED6A 2JTYA 1NH6A 2LQRA 4K8RH 3VFSB 1CGVA 4QXWA 3ZTNH 2VAAA 4X8CA 3CFBA 2BSBA 4AKOA 4Y4HD 1S8DB 4QOKD 3O3AB 4XP1H 2H7WA 2AQQA 2XFXB 3ZN6A 4AK2A 4L4TB 5GRWA 5HPMB 5E2WH 3QG6B 2PYFA 1N10A 3O6MH 4PFEA 4MKTA 3RQ3A 4R4NC 2EYRB 2VDLL 3GJFB 2VR6A 1MCWW 4JAMB 4X8JA 4LVNC 1BVNP 5K1JA 5GZOD 2VL5B 1S7XA 2ICES 4Y5VC 3L4YA 3REVB 2VLRE 4GO8A 5BVPL 3PUUA 4RISL 1PYWB 5DQ9B 3L4UA 1JZ7A 1YEJH 4HIJA 5DYFA 3KWUA 3G5YA 4NO0A 3CXDL 4XP5L 2P5EE 1IBDA 3FF7A 3RU8H 2AJUL 3QIBB 2ZOUA 2H9GA 3GMQB 3E3QE 3O2VL 3O4LB 4MMXC 3ME0B 3HAEB 1DQQA 4ZPVB 3KYKH 2LT9A 8FABA 3V7AE 4NO2B 1OW0C 1BZ7B 4LXFA 5D2LF 5IHHA 4U0RC 5E5LA 5JW5A 3L81A 3GBLA 4MVBC 1UXSB 4QUOA 4BFRA 2NY7L 5AYQA 2YSSA 3QJSB 2X4NB 3SPVA 4GG8B 4P99A 5EV7A 4CDGC 2AEQL 4PJ8B 5B39G 1AFVH 1AO7D 5LBSA 3BJ91 3FUNA 4GB9A 5CIPH 3QS3A 1I8MA 4P2QD 3FW6A 3PP4L 1SXZA 4MA1B 2QQNL 3EF7A 1NLDH 3OKOA 4Y1AD 4ALAL 2WGNB 5HVHC 4DN4L 2K7QA 4ENED 1ZGLP 1E4WL 5D1QC 2ZKHL 1JCVA 4YL9A 5C71A 2OS7A 4F2EA 1G84A 2DI9A 3WMQA 2W38A 3KCPB 4ZUTB 4G70B 4QXUL 4AL8C 1XSIA 4HK0A 2AJYL 3NCFB 2FLRT 4AYFA 5JTWA 1LYQA 4P4KB 1FZOA 3HHRB 6FABL 3MRQB 3U25A 4NJ9H 1LVEA 4X6CF 1UEYA 3OBAA 2J8UE 3SDAD 5HHME 3F7RA 3MV7D 4QRAA 4MAZA 2BMKB 1N8ZA 2AXGA 2VM4A 3KYAA 3HAEA 2CGZA 1ZXKA 4JZOB 4PS7A 4ZNEE 1OCOB 1KIPB 5J6GA 5IJKC 3JYCA 4JPKL 3LEXA 3SZKC 1QLEL 4ZUSB 1CR9L 1OGAE 3SGDI 2IF7A 4U7MA 5J13B 4HHAB 5C1MB 4DGWC 3WNKA 4U3HA 5HP5A 2OFQA 4AM0Q 5T1MA 4MXVE 1YEIH 4E5XG 1Q0YL 3MRLA 1TO5A 4HCGA 1DYZA 3LV3A 5GGUB 4K8RC 2ED9A 2IAMB 3MRHA 1OGSA 2Y6SC 2Y1ZA 3KXFB 5HGHB 4NFCA 2GIMA 1QABA 4UT6H 3BLKA 4P49A 4G8EB 1JJUA 4DQAA 5DMIH 2EDWA 3O3DA 1ZA3A 1O7SA 4PJIA 1LK3L 4P9HL 4FN0A 4OJFH 4XMZA 3MJ8B 3VE0B 1CI5A 3QJUB 4OIAA 4TF4A 4WHTA 2YEVB 1JOIA 2W9DH 4MJIE 4NHUA 2G75B 1PLCA 4AGLA 2NNAB 1QTSA 4XNYH 1MFCL 1X4YA 3KBEA 3UTQA 5GGRY 2OK0L 2FX7H 3B7RL 1XSJA 3DX8A 2DEXX 5HD8D 2NW3B 3TBWA 4KY1H 1ZLSH 3OPZH 1FNEA 4WUKL 4M61A 3EFFB 4WO4D 3TCTA 3VXRB 4JZNB 1INEL 2YPVH 1WA2X 3CFEA 4PGEB 4NWUH 1DN2A 1HT6A 3HI5H 3KLDA 3C75A 1CGSL 5BQ7A 3UC2A 1ZEAH 2CE6A 1DCLA 2VAJA 1CDYA 3WJJA 4E9SA 1AGCB 3D7PA 4ZW3A 4KK8C 3SE8H 5IFAH 3FTXA 4NKMA 5CM1A 1Y6KR 3WKYA 2CK2A 3PV6B 2H3NB 3L13A 3QIUB 3V79C 1CFNB 1G9MH 4QHNA 3ECWA 5E2VL 3HZ3A 2RMNA 1GOGA 5EU6A 2QLYA 4EZJA 1BFOA 3TP4A 3M17A 3TBYB 2ZKWA 3VXSB 4QTIL 2Y06H 5F1NA 1CG9B 1H15B 1HNFA 2NY2D 1HZHH 3K5SA 5E1IA 4YDNA 3TA3B 3MACL 1NAMB 2BERA 4G7QB 4QRSA 5KVDE 3EYUH 1UA3A 1ZA6B 3P3UA 2FE0A 3QR0A 5HI3D 4PWJA 3N41F 3Q48A 1UB5A 3SDAA 5IVXF 4ZMXA 3L4VA 4JFOB 4U1KB 4L9DA 2ZSWA 3V5KB 2N01B 3FZUD 2VDML 4NQED 3R8QA 2D4DA 1P7QA 4DK6A 4KAQH 2DMHA 2F19L 2P46B 1AQKH 2F58H 4LARL 4H1LG 2R1XB 3ECBB 1TQBC 1QSED 1KT2B 3UX9B 3RVXC 5GGVH 2AFNA 5J9PA 3B83A 1MPAH 4UIKL 5I9QB 4JQXA 2R0KH 3W9EA 3TNMA 1BMZA 5DJ2B 4PJHF 1OLLA 3CHSA 3PNRB 1PMYA 4F20A 4B41A 3SE3A 3BAWA 1GL4B 1YEJL 1DDHA 2FWOB 3BWAB 4HUMB 2NY5H 3RKDD 3T4AB 3X3FL 2X6MA 5DXWA 4XAKD 2K1MA 4Z3HA 3QA3A 5D1QA 4QWWD 4G5ZH 3BIAX 3P3SA 4QY8A 3LNDA 1WPCA 1X5AA 4DGVH 2OW6A 2VDLH 3QHFL 3T8XA 2EUWA 3DXAB 4QRTA 5C0RL 3AQDA 3TVMB 5HVGB 5BJTA 5FYLL 4EF3A 5KVDH 3T65B 3ESMA 1KLFB 2Y1VA 3B8SA 1RK1A 2IGTA 2X4NA 5AALA 5TE7H 4TSCH 4G59C 4ZTEA 4M48L 3KBHE 1D9KD 4EI5B 3U4BL 3CH1B 4ZMQA 2DQGL 4BFGA 3GZPA 1GC1L 2EVGA 1DSFL 1F11A 2WXMA 3NBNA 3SDXB 4U6HB 5KYWB 1VFBB 3POCA 4K8RL 4XC3L 5D2LE 4G9FA 3VD7A 5LCVL 3KM2A 2QJDA 4Z5RB 2BVOB 3NIFE 4HHGA 5AG9A 4L37A 3QWNA 4L3AA 1F3RB 2DLFL 2ZJSH 5FWRA 2PNDA 4K7FA 4KFZC 4PCYA 5A16A 5B1JC 2A6IB 2BIOA 3P2DA 4Y1TA 2UY7A 1F90H 3P3YA 3PWUB 4WI9A 2J12B 1YECL 3U0WL 4UQAA 1IQWH 1WFUA 3NFPB 3GZOA 4CVZB 4XVSL 4AQOA 5FUOH 2HPTA 2UVEA 4KQ0A 4I1RA 5F8RC 4UV7L 2Q7YB 4DKTA 4S0TD 2J71A 3WY3A 2AK1H 2HP4A 2KT6A 2WQSA 3NJVA 4KKRA 3HRZB 4LU5H 3S96B 5GS0C 2V2WA 3E8UH 4BSWB 3TZVB 2E7BA 1UHVA 1ICTA 3ULVL 2IAAC 1N26A 3WLBB 3O4OB 2IFGA 4PP2B 5I2IB 1HTYA 4PS8A 1RZ8B 4QRQA 5DMGD 2VDLB 3EDFA 4KO7A 4X98B 2ORBH 1TJXA 1FLRL 3PXJA 2QR0B 3AT0A 1XO8A 2WVUA 4QGYA 2X40A 3V9CA 1MN4A 3FO1B 1MCCA 3SYOA 2CHXA 5AW7B 4OJAA 5SWZB 3BPCA 4L1HA 2P8PB 3Q13A 1OB1A 2A3TA 4B3EA 4NN7C 2PUQT 4JFXA 1I1AA 3FRPB 2XXMB 5DZOA 4PVLA 3BEWB 5EO9A 4IRSD 4CVXA 4YDVB 3UC0L 2FJFA 2LE9A 1KF9B 4Q6IB 1ZIBA 2W94A 3SY6A 1VADB 1ROWA 2EIZB 4OY9A 4HIEB 4EN3D 4LOUC 4JPIB 1P5UC 3CQFA 3AS3A 5DS2A 1UASA 3QXWA 4F24A 1FP5A 1BREA 4BH7A 5AVXB 3QUMH 1QEWB 4J3BA 1E40A 4G7YL 3MN8A 1GXEA 3UBXG 1GCYA 4FDWA 2FWUA 3MRHB 4AGNA 2JNZA 3MJ7B 5D70H 5I1KH 5HPOA 2B1AL 3WHXA 1DBAL 3ZKXB 4W9FC 2RIKA 5KJRL 1Z9SA 1M1XB 3MRGB 5JZ7C 5DRWB 3FB5B 4AV4A 4ZI8A 3TBSA 1KELH 2CCLA 1FVCA 3FJTA 1VGKB 4OLWH 4PWGA 1EWHA 2NX5A 4HHAA 1R3JA 3HB3B 5DMJB 3S5LB 4AYID 5D7IE 3NAAL 4JGJA 4PJ5A 2VJ8A 3FU0A 3EYOB 4F7MB 1OAUH 3H9SB 3LH2L 2OYKA 4KZDH 5ITFA 3MRRB 4I4WA 3L5XL 5C8JA 3LVEA 4K5PA 2DKSA 4EUPB 1AZVA 3GMRB 3VI3A 4D3CL 4Y1AE 3EGDA 2E7DA 2VC2B 1NFIA 3GXMA 3PLYA 4PS3A 4Z7WA 1W8OA 5D71L 3QZBA 4I2XA 2XFGB 4EIUA 1EEYA 4AX3A 5CLWA 3BUBA 4M7ZB 3GO1L 4HLZG 2P3YA 1S5IL 5FO7A 4GRWE 3WTUA 3P4NA 1XGTB 5FLUA 2P45B 3O8XB 4L23A 2VDNH 4HBCL 2CO7B 2EEBA 3EHBC 5EEVA 2W0LA 2WZAA 4QIRA 4P46D 2N0MA 2WO2B 1BOGA 4KNUA 1FFNB 1TG8A 2VMJA 2Z91A 4LPCA 3L9BA 3PWJB 5IHZA 2R2EB 1G9EA 5F96L 2QADB 2YD7A 2A6JB 3SCMD 2CMRH 2NY6D 2FSEA 1F1DA 1KCLA 4A68A 4OCLC 2WZ0A 3JTSB 1OGAD 5IZ7A 1QSEA 2HFFA 5L0QC 1KCSH 3CPLA 3IDIB 2LHAA 4TNWK 1D7CA 2WLLA 5K9QG 2IALA 3X12A 3TCXA 3VSTA 2WUBL 4WCYL 1L6ZA 2Y72A 2M2DA 3Q5TA 5I1GH 4PJBF 4XVUC 3G6JE 4XB7A 5D71H 2CRIA 3D2TA 2EKSB 3CVCA 4KKNA 5HYJB 2D7PA 2F08A 3HW7A 4K71B 1ZHKB 4PJBB 4M6AA 1OCRB 2XJLA 4IJTA 2P80A 4YAQB 2KZBA 2Z8SA 3FSVA 4ZW5A 4YIQB 5CBAB 1U92B 1NDMB 1AGEA 1NCJA 4OZGB 4YHNB 4ELMF 3MV8E 4HWEH 1GYUA 4OZFH 3IMRA 1QOKA 4PV9A 5I30L 1NQBA 3KNBA 1EZVX 4A6YB 4APXB 2OA9A 3DPBB 3RL1A 3OLGA 3INUL 4B53A 1KELL 5LVEA 3N0AA 3H6JA 5MP6L 5DJDA 1N67A 1S2EA 1UA7A 4N90D 2AMGA 1QO3B 1MLBA 1XMEB 2Z92B 4GO6B 5F1SA 1C5DA 3GTTA 1DHKA 2E47A 1B3JA 2ZXCA 4NT6A 3G5ZA 5F89A 1ZK5A 3DOHA 4MWFB 5F7DA 2FQGA 4F2FA 1U2YA 2B3IA 4JY4A 1DUZB 1XDTT 2VYRE 3MRJB 4XCFH 1N8OE 3ARVA 4N6RB 1F18A 4NO2A 1K4DA 4KMTH 1FO0A 1HYSC 4HKXB 3RPKA 4PR5B 4DVRL 1GMEA 3MBXL 1W80A 4YNYB 4BSJA 1DCEA 5B3JE 4JO3H 3PU7A 4NDMA 5KSAD 43C9B 5CCKH 3LRLA 2Z8VC 3TF7C 2VDNL 2ZOLB 4N5UA 4AI7A 3HC0B 4G72B 2WOBA 5D5MB 2IPTH 4G6JH 3QCTH 5D7LA 5DLML 3TX4A 5F9WB 3PPEA 1SLWA 5CXPA 1CN4A 5J11B 3DSNB 4GLRI 3D3VA 5C9JA 2XVLA 3R4DA 1RPUA 1EEYB 1XV8A 5C0BB 3IWUA 3OQRA 4QHPA 2YD2A 3QZNA 3FSZA 3O0RL 4N2FA 4WW2F 5E2VH 1JL8A 5KBMA 4YHOL 1G9ML 3CN3A 1I7TA 2GVYA 2Z4QA 5BOZG 2IAMA 4D0DA 3MNVA 5ADOL 5GHWL 4KDVA 1JIBA 1QPKA 3TYFA 3DUSA 3BLPX 1ORQB 4EZLA 1SOQA 4MS8D 3L5HA 1J1XH 3BZ4B 2F74B 2HLAB 4HSCX 4OGYL 4BDVA 3ZKXC 4XNUH 3S3JA 1OQOA 5KYUA 4U6XB 3BFQG 5K1VA 4B0MB 3DYMA 2PXYC 3SPJA 5A2BA 1U33A 1D6EB 2VT0A 1DQJA 3I9GH 1OSPH 1A6UL 2IVFC 2G4EA 4HUWB 4KKBD 3K8MA 4JZOA 3GSQA 1K6QL 3GK8H 2J20A 3Q6GH 4X6CA 3NIDE 1P5UB 1AQKL 4FQXB 2YKLL 4G8FB 4Q9CA 5IT2L 1YMMD 2NY1C 2HMID 1JV5B 3AREA 3IS1X 4RQQB 2FNWA 1TQCB 4Q6KA 3CXFA 4NSKB 3MLUL 3C6SB 1J1PH 3HBZA 3UTTE 3ATBA 2VRAA 3GSWB 1G87A 4EXKA 3JVFC 1RL1A 3WXWL 1G1CA 1NC4D 5FYKL 5I71B 4HJIA 4YPGB 4S1SL 5IJCC 5KJ7E 25C8H 2VXUH 4KO5A 2WB7A 1V7NH 2NY3B 3QRLA 4NZ8A 4HS6B 3HCVB 3T2NL 2YR3A 3HE6A 4ZMYA 5IEHA 4KX9A 3LMJH 4H26B 4UYQA 4MCYA 5GRVL 4FYTA 5KANG 4L8DB 4UTBL 4AJVA 1IILE 5HJDA 1S4IA 1I8MB 3E6FB 1EHNA 4CGUB 3HZMB 4PJIF 5EIIA 1MHEA 2DYPA 5TH2B 2R2HB 3CDZA 1GC1C 4NHCH 1Q72L 2A1WH 3MVSA 3GUTA 1J10A 3Q7JA 4MZIA 4FADA 1DZBA 4PGJA 2NYYD 1KBVA 4N24A 5GZND 2JTDA 2E56A 3HUJE 5IJBC 4IHOA 4S2SA 5FDYA 4BFJA 5CS7A 4ZO7A 2WMPB 1E5CA 3KPOA 5D7LE 1IQWL 2WC7A 3O4LA 2E8ZA 1FE8H 3AY4C 5E8PB 4Q0XL 1NC2B 1Q0XL 2WVVA 2XQBL 4GIPD 4L8SA 4O51B 4QD2E 3VXRE 4WJ5A 4M5TA 5ERWA 1HHKB 5G55A 5HBBA 4A66A 3MUHL 4LCCA 3FU9A 3VFUA 5A3ID 1HXMB 2H0EA 1L9MA 4MQXC 1E8ZA 3F7VB 3QUHA 2CLVB 3ECVA 2KMWA 5FOBA 3PRZA 1SHSA 3MV9E 4OLUL 4LSDA 4UM8A 1LK3H 4JKWA 5IOPA 4QOKA 4ZFFA 5JQHC 3I3EA 4UT6L 2ZKXA 3K80A 1L9NA 4BKSC 3V7AG 5GGSA 4TLSA 3LKNA 1RAMA 3C60A 5C0JA 5D7LD 1ZVNA 2APFA 4MNGA 1IBGL 1JK9A 4YE4L 4TVPD 4Y9GA 2UXVA 4IOSA 5GGRB 1AZNA 1MVUA 5AAMC 1QASA 4FTVB 4YGAB 3EG9B 3W82A 1J5CA 3NZUA 3ZO0A 4WVRA 3MTXA 5CLXA 1MHEB 2VC2L 2EDYA 2N1KA 1PLAA 3OL2A 1BVNT 1HHHA 1IGTB 3EBAA 4IKKA 5CEZE 4JFEB 2WSKA 4WUKH 3WKML 4G1EA 1O7DE 2GCYA 4GBXA 4W9ZA 1ZLSL 2IO5A 3ZOAA 2XDHA 5CCGE 4LLMB 1KJ3H 4MAUH 5EIIG 3VD9A 1I7RB 1HINL 4N3TA 3CZKA 4JRWA 4M7JL 4PJ7F 4DFHA 1U0QA 5DSCA 4GOSA 1D5RA 5J8OA 3MLXL 4XWOD 1BV8A 3FBKA 3IJHB 5DJZB 5E1GA 1LE9A 1AI1H 2VDQL 5CIPA 5EZPA 3P0VH 2FJUB 3VD2A 3TNMB 3KWXA 5JOEA 3FSOA 4TVPE 5EFIA 1B6DA 1ZTXE 4JFEE 5E9DA 1JNHA 5EORL 4ZX4A 1KZQA 1PCSA 4PY8J 2P9RA 4FQIH 5F7EL 4GEJA 1T1ZA 4LLVA 3VACA 5JO5B 3D09A 3RDTC 2O6EA 4XN1A 4TVSa 3VQ1C 1NGQH 1MIMH 3NRQA 1MFEL 1S9WB 4ODSH 1NJ9A 4DAGH 2CAKA 5DJYB 2CO4A 4FTVE 3V6BR 1AE6H 1BZ8A 4LPVA 3EYUL 3T77B 2DDQL 2EE0A 2A0LC 5FV2A 1LHZA 3B37A 5TFSL 1ZHLA 3EOTL 3QHZH 4ZAKD 1Z0NA 4Y4FA 3TA3A 1JF5A 4IBLT 1HH6A 1PS3A 1R3LA 2IDTA 3A5VA 1GY2A 3SGDH 3PHQB 4G8IA 3X13B 2APTA 1BFOB 3MV9B 5EDXA 4NENA 5F7DB 3VFNA 3WFZA 3UH8A 3DIFB 1NIBA 1OW0A 3U7AA 1J18A 2Y6TE 4QRFA 1MREH 3VFRB 5BS0E 4IMKA 2C1OA 4FNSA 4NWTH 5INDA 4K94L 2YAOA 3GSOA 4PJ9C 4QJ3B 4Z6AT 2X12A 1CPUA 4O2CA 2OTWB 2VN3A 3TH2T 3DSNA 4PV8A 4BCZA 3GHEH 4HC1H 5A6MA 1EFXD 5DGQA 3X11B 4DKFH 1R24B 3L7FB 4XCYB 3NCJL 1ZT1A 4PH8A 2Y7NA 5D1XD 2XV0A 3H0TB 5C07E 4NZRL 1BGXL 1HHGA 2EXYD 1K85A 3QQXA 4XH2B 3ARZA 5JUEH 4XO3A 2C1PB 2VSKB 4K9JA 3HZKA 2FLBT 3LN9A 1ZHNB 1F4YL 1LILA 2XTJE 4FXGB 4O2EA 5IG7B 3LN4B 4HJGB 4AW4A 2W9DL 3ZW3A 1K4DB 2F68X 1WWAX 4UTAL 3ARED 1T7VA 2IOOA 5LGHH 1UWEH 1ODUA 2I32A 1WZAA 4R7DA 4YO0A 1VZGA 3MUUA 4ONHA 1P4BL 2B2XH 4ZOAA 4CNIB 1XAKA 2MTPA 4ZSOA 3QG7L 1U8JB 1P7HL 2VOTA 3QUYB 3M1BB 3LQAC 3J07A 1UEMA 1EPFA 5EZIL 3ARRA 3QQ4B 2DWYA 4L1SA 1SOXA 4APQA 4Z7QE 5C07D 3BSZA 2AJXL 1INDH 3GPSA 4JPVL 2AV1A 4HIJB 1K4CA 3NH7H 1KCVL 1H8NA 1GZQA 3HG4A 3HG1E 2XTJD 5DFTA 1AS6A 4OF8A 2RGSA 1FIGH 4RMUA 4WY7H 1PCXA 1JS4A 2WGXA 2JJSC 4Q14A 3SJVD 3VDCA 4OV5A 2BOLA 3T6ZA 4ZUSA 3U4EA 1OARL 3NIDB 4NOBA 2P42B 3CV5A 1ZLEA 4GG6E 5J7CC 3AW5A 5IIEB 1RP9A 5EOTB 2EEDA 2WLZA 1Z5LB 3MRCA 3V0WL 3G5XA 2P5WB 5GGQL 4G6AD 4L18A 2DQUL 3LQZA 6FABH 4L3CA 1XAUA 2BOBA 4YHKH 1V10A 5D55A 5DK3A 4IRZL 5I1LB 1RIUL 3MRMB 4M9OA 3WIFB 2OMTA 1WBZA 2W88A 3AU1A 2AF2A 3FL7A 4KHTL 4NN5B 4X8XA 3EFDL 2ZUQB 1A6AB 4HT1H 3KLHC 3WNLA 1MAMH 1M53A 3II3A 2F1AA 2MCG1 1NLBL 3AXHA 4JDEB 3RFZA 3KCWA 4QHLB 2E5EA 3WJJC 5ADPH 2J2ZA 4NQCB 4HWBL 2GEEA 1H3GA 4NQTA 3RVWC 3MJ7A 2Q7AA 2WBJB 2ZX8A 2W60A 4JJ5B 3ZKMD 2WYTA 4H8VA 2ZUYA 4HGKC 4NP4H 1VESA 4X99A 1KPVB 2H1LM 3IJSB 3QQ3B 4PJ8A 4N8VG 4M1CD 4POZC 4ODUA 3D07A 5BZWA 4GQ9H 1UZ8B 1W0VA 3B1UA 4KUCD 3VXME 1I1AD 4KZ0A 2E0PA 1JN6A 4B9PA 1SOSA 1KTKE 1X5HA 3G6JB 4NGHL 3IJ9A 3B2MA 3SBRA 4HP5A 2KBGA 1MRDL 3U36A 4MDRA 3MGOB 5GRJL 5A2JH 3MI6A 4MAYC 4E68A 1RHFA 1BYNA 3ZE1B 3N6YA 4HMEA 3UTTD 1QRNB 5FC9A 1LO2H 1TIUA 5AB2A 5K9KB 1C8PA 1JRHI 3CFTA 4L3EB 1WG3A 3WNMA 2MTAA 3L9RA 5FGBC 3IDMA 3D4YA 5I2IA 5KBLA 2P26A 2DLTA 5PAZA 2EJ1A 3C5ZB 3LS4H 2UZXA 1HE7A 2NW3A 4PUBL 2AXFA 3BIKB 4K7PY 5EFIB 4GH7B 3QULB 3S6CA 3PP3K 1TZHB 4WFGD 2XY1A 4DTGH 1A1MA 4GAJL 4NUJB 1CICC 2PO6B 1LEKA 5HGDA 4P3DB 5DJZA 3IMBA 3PCYA 3ZTNL 3FUHA 3WFDH 4HUVB 2KS0A 4QMEA 3WSQL 2X1WL 3VH8A 2PXYB 3ZYZA 1RU9L 4ZW8A 1KBPA 2O1AA 1EA9C 2ZYIA 2BY0A 2H3XC 3IT8D 3B6SA 2PO6C 4GXUN 4AY0A 3ZTJG 2X4RA 1IRAY 4IMLB 1M42A 1R3IL 4JZJC 5MP6H 2X42A 1QHOA 2L0DA 4HUUB 4PJAF 4O5LH 3RL2A 5EU7E 2Z35A 3RX8A 1ADQA 3BO8A 1UCBH 3FTZA 3ZDWA 2FB4H 2WINA 4X9HA 1AOHA 3O45B 4NQVA 4N8VA 4RMVA 5AL8A 4C83A 4EVNB 4FNLH 1PY0A 5AUMB 5B21A 1NEZA 2R8SL 1CK0H 3FULA 4S1RL 1J8KA 3JV4B 2XZQL 1XMWA 5F9WC 2X4UB 5M7QA 3DOIA 4PGZA 2QKSA 3AU0A 4HPYH 5MENE 1SFHA 4JDTH 1DN0A 4QJ5B 4U1HB 3NJFA 1HC1A 1NDTA 1O0VA 5EA0L 2H45A 5D1QD 2B7DT 4ALAH 3BZEA 4PJ9D 3HOGA 3SQOH 2ZWLT 3GBNH 3M45A 3VGDA 3GDCA 5EF3A 2Z3FA 4QCIB 4L0YA 1HZLA 2OMUA 2VISA 2YARA 3QDJB 1OCWH 3R4RA 4ETQA 1HHGB 2Z4TA 2ZUXA 3VFTA 5IB2B 1N3NA 1YAIA 3Q5OA 4G2AA 4DOHE 2X70B 3FTGB 1TJGH 3EHBB 1S7WB 2VERN 2CO1A 3O8XC 3QIBD 4TUKH 4AIEA 4QYAA 3X1EA 1NBYB 5JW4R 2CA4A 3PAVA 5KUMA 2PLTA 1JF1B 4N3UA 3AG3B 4FNLL 4WW2A 3AQXA 4NN5C 1T22A 1SEBA 3L4CA 4I9WD 3EJUA 5D96B 5GGSY 3ZJAA 2FB4L 3F8UB 4OQTA 1IEBA 2C3VB 3V4VL 5I8CB 3GNMH 4G1MB 1TQVA 3VWJC 3VW3H 4ZSOE 1WBYA 3SDYH 5IBUB 4JO4L 2PMZA 2L7EA 4ORGB 3JBG7 4D3CH 5F1KC 3SDYL 3OKYA 5DDHB 3GXPA 4RNRB 5GJSH 3SODB 2MOVA 3TVMA 1IGCH 5BJTB 3O6LH 3VVWA 1T4KB 3TN0D 1T1XB 3LRKA 4UYPA 1WBXB 5H4ZA 3TBYA 1LP9B 2ICWI 4GRWF 3VXSA 1SNRA 1XQ4A 3D08A 1Z2KA 1MAML 5C92A 3CD4A 3D0LB 3MCG1 3UYPA 5KS9A 2BNQA 4HJSA 2N7AA 3HPLB 1LP9F 2AK4A 4H8HA 3HS0A 1A6VL 3THML 4F7TA 1ZT1B 4P9HC 4CMHC 1JDCA 4KI5D 4A7QA 1XGYL 5ECJE 1A1MB 1EX0A 5E1AA 3DX6A 4FQHB 5IB4A 3U0TB 3KPSE 4RX4D 2JKIS 4TUKL 3ROLB 2VM9A 3KPNA 4NQDB 2G2NA 1X5FA 4Q58C 3HZVB 1CD1A 2CPUA 3SDXE 3ZDYE 1A3ZA 1BVOA 1H5BB 5KYUB 1I9IL 5HHQB 2WYIA 4PLKC 3PL6B 1F6AB 1G7IA 1AKJB 4L3EA 2FECL 5JXED 3AG1B 1DVXA 5JHDA 1D2PA 1MRDH 4HS8L 4IDJL 1CO1A 2CIKA 3HBPA 1QR1B 3SQOL 3MNVB 1YY8B 4WI4A 2F15A 2QSTA 3NEXA 3DXAE 2DMKA 1B6UA 3CHXA 1N4XL 3JTTA 4NHUB 5EF2A 1AZRA 1IBHA 4A2FA 4H20L 3LOWA 2J5LB 3LQAL 1BCIA 2ORBL 2BP0B 1ZA3B 2DN7A 4OCYL 1L3NA 4MS8C 5DURD 2J56A 3ILEA 3PGDB 3NPSB 4DGUA 2V3FA 4LNRB 3HRPA 3LZLA 4NWTL 1P84K 2NX5E 3ZZLA 2EXWC 4GP4B 5DJ0B 3C87A 3TZVD 1JZEA 4LU5L 3B9AA 3TTSA 1VGEL 2WAHA 3BD3A 5B1AB 4NDMB 4HUCA 5ALCH 1A3QA 2OSLB 4W93A 4UV7H 4UV4L 3RVUD 1PFCA 3OX8A 2WKGA 3S4SA 3L1FA 3MYJB 4KRPD 3CLFH 3VXQB 3OD3A 1HXYB 3JWNE 3L3HA 1U42A 1ROCA 3NACL 4JRXE 4NKIL 4YXHH 2AXWA 1XZ0A 4YHML 4TNVF 4C47A 2QSQA 3HLKA 3HG0A 4YSPA 2I69A 4DTGL 3IXAA 3P9LA 4HT1L 3PWVB 4MQ7B 4YSEA 1MHPL 4XT1C 3ULUL 3EZ8A 4X7EC 2ESVA 3MKGA 3U9PL 1NTDA 3FU5A 3OR6A 3RVXD 1HHHB 5ID1A 4JY5L 3PP3H 2YOAA 2HT2C 5TH2A 1D9KB 1TPXC 4YC2C 3SOTA 4AM0A 4WHTB 1UQSB 3DLQR 1XGPB 3D2UA 3OXRB 1T89C 5E6IB 3KMDA 4Z78B 4O00A 3VGFA 5IR1B 3P0VL 1R47A 2JWYA 5IQLA 4OJYA 3ZQWA 3LRGA 3AT8A 5CMAB 2VLJB 3NH7L 3L3GA 4IW4C 4AQ8C 1JGLL 4LLDA 1MSPA 1Q9KA 4HZ1A 3TA3D 3H85A 1FFRA 1G5AA 5G4NA 5HGAB 4QOKB 4P06A 2GT9B 4PJ7A 3ZE0F 1FJ1B 2YZ1A 3IN2A 3OHXC 5L88H 3WY2A 3ZIMA 3LDBB 1YYLH 4PBDA 4Z7UB 3V0VA 4KOCA 4HKJA 3A6CH 3DUUA 5JHLL 1ZV5A 2AVGA 1XHHA 3H4FA 4O02L 2BZ7A 4HLJA 4PBXA 2NY3C 3D8MA 2KQMA 3PGFH 2HJFA 3HZYB 2BLFA 2DH2A 1JHTB 3O3BA 5KAQF 4XMUA 1XGUA 4G1MA 4W9CC 4W9HC 1SBBA 5CZVL 4JHBA 2IDFA 3Q8FA 1HIMH 4EVNA 1RLWA 1UM6H 1UVQA 1YJDH 2W81C 2ZF9A 5EBWB 2V8MA 4YHPB 4C58B 3IGLA 3WIAA 1FFPB 1C5CL 5HHXH 1TQCC 2A6KB 4IBWA 1RK1B 4NNXB 4NUGH 4LASH 1RJZA 3FFDA 4XCNB 3V0VB 1P69B 2B9AA 2Z35B 3DIVA 5JOPE 1SDDB 2GAZB 3CBRA 1MOEA 3VFGH 1B3IA 3EBGA 4CU6A 5SV4A 3A67H 3UIYA 1BQUA 2VLKE 3EZJB 3CHQA 3DXAA 1B2WL 1JI2A 2ZAIA 1NUGA 1H19A 4JAMA 4ORZC 4QRTB 5DD1H 3H42H 3O8XA 3N40P 1RPQA 1BXUA 1N2RB 1VAHA 1XIWA 3HN5A 4NQSB 4Z8FL 5E08H 2O5ZL 2DQUH 2Z8WC 3HE6B 1B0GA 4HJTA 4KKQA 4ETQB 5FUCC 5GISH 1OZUA 1OGAB 2I7SA 4NRZB 4TL5A 1O6TA 4WTZG 5HGDB 5TGBA 3UZEA 3WEXA 1WIOA 1CLYL 1A4KB 1BVZA 4BINA 1I1RA 4H8QA 4LNVA 5IBTH 4YX2H 4Z7VB 4OLEA 1CUOA 1IM9A 4D7PA 1ZY9A 5FO8B 5JOFA 2J44A 4NZUL 3WTSA 2WOYA 3LKSA 2YA1A 4NFBA 2OMBA 3SO5A 3ARXA 1L7TL 1BVKA 3CFDB 4NWUL 2P49B 4NKDB 1P1VA 5H8DA 1U3HC 1LO5B 2HWZH 4K3JH 2OL3A 4DKDC 2JMRA 2AW2A 5E8EA 4KTDL 1KGWA 4PWFA 1P4BH 2B2XL 4MB5A 1S46A 3SEPA 3H42L 3TT3H 3KGSA 1CQKA 3JWOC 5F7MC 5IHUL 1FE8L 4NOFA 2YPLD 4WRLA 2XACC 4XMXA 1NGQL 2P43B 4WU5B 1SYSB 3MLXH 2JCCB 4OSUH 2QPFA 4L8BA 3UROR 4WKZB 4I13B 2RALA 3QI9D 5SX5H 4AJYV 3BN3B 3AY4A 1BD2E 4NZRH 4K5NA 1RK7A 3PGDA 5FIEA 1OGAA 4XI5D 4DN3H 2DWDB 5CZVH 3NCJH 2J4WL 2FGZA 4P2QE 4PJ7E 1FNGA 1KN2L 3IN0A 4GRMB 4D7BA 3U7WH 3LDBC 1Y18B 1IGTA 4JVPA 4JRLA 3QRFM 2YEQA 3OHXB 4BQ8A 4Y7MA 2VABA 2IFFH 1ACZA 4NZUH 1RIVH 4HEPA 2K7PA 2V2XA 1LEIA 2ATPB 3S37X 1QLEH 1V54B 4JPKH 1FNFA 4QKXB 4BKLB 1PZDA 1P9MA 4MNGB 5HDWA 4JM2A 4ZO8A 1JZIA 1KB5H 3FUMA 4AITA 1LQBC 2BFVH 1G7HA 1U4EA 2BDNL 1HHJA 4TNEA 3VX1A 1FAIL 1MFDH 2X1OA 4PQXA 2V3DA 4G5AA 2GITB 1J8RA 5I6XB 4X7SL 3FTUA 5F88B 1PDKA 2BHFA 2BVYA 1T6VN 3BP4B 3JTSA 4R7VA 5CINH 2NY1D 1G7QA 9CGTA 1N19A 4HIIB 5CBEA 3KJ6L 1RULH 3UAAA 4HETA 5I1EH 1N59A 3QPQC 3FTVA 3WDIA 1E5AA 3TEWA 1KGCD 1MCFA 1OAQL 3BHBA 4A7TA 1RUPL 5LCVA 1MIML 4IU2B 2E9JA 4WFED 3H2QA 3IXTA 4P5RA 1MHPH 3C09C 3FPYA 4JDEA 3SGEI 4DP8X 1OCZB 2CO7A 2EO1A 5BUGA 4RIRA 3PWLB 2AXHA 1U8QB 1I31A 2VZSA 1RJLB 2VIRA 3QEHB 4ABQA 2GK0A 2GJZA 3ES6B 5C0CA 1KDIA 4BFEA 3DBXA 2VLRB 4RMWA 2OZ4A 5I73B 4OCRL 4PCTA 4B96A 2VLJE 1A6TA 3LMJL 1RZFL 4L3CB 1FQ9C 2OW7A 4N9GB 1Q72H 3T71A 1E3ZA 1WYJA 2P48B 2YWYA 3O6FD 3SDDD 3K2MC 3N0PB 4E0RB 4XBMA 5F97E 1I8LC 2AJSH 2I25N 3HUJA 1QFHA 4S1SH 4LAQH 2GW5A 4I4WB 5SWSE 2J1WA 4HEPG 5FHAL 4HK0B 4P3CH 2JJUA 2ADFH 4XCYA 1S6NA 5I0DA 2CALA 2PYEA 3LEVH 4NO3B 2E76C 1FZMB 3GC3A 4FA8A 4ODTH 4XNDA 4FG6C 5E8PA 2WCGA 1DBKL 5IVXB 3RHWF 3DSFL 4XOAA 3TC9A 3S88L 4OZ4A 5FCUL 1H9VA 1I8AA 5C0DA 5I76A 2DKUA 5DJ0A 3P2BA 2YN3A 4Z3EA 3PIQA 5FYKD 1JRHL 3D2UB 2KQNA 2PCXA 3DIFA 1UM5L 3RWHB 4G7SB 5I1GL 3L3IB 1OE3A 4YSUA 3TBVB 4FG4A 5CKGA 3US0A 3P4NB 1ASPA 3PWNA 2XX0A 5I1DB 4IEFB 1XGQB 1OF2A 1E6JH 1YZZA 1X5ZA 3S36X 3TN0C 4FP8H 4YZFF 5GS2D 1FRGL 3ISRA 2YUXA 5EZLA 4ZYKB 3TO4A 4WEEA 4NQVB 4CILA 4KHXH 3OKEB 4FXGA 4O2EB 2QGBA 4B9GA 3D30A 1XZ0B 4URTB 4AVKA 4LCYB 1EUTA 1AD0B 1X7SA 5I1CL 1XIWC 4U2YA 5LXGL 1T0MA 4XVJL 1LQSR 3VG0H 1E6OL 1VIWA 3AZUA 1JV2A 3PF2A 1IFHL 5ENWA 4BRJA 1SYSA 2H8PB 2IBGA 2AI0H 4JG0H 1JNLH 4FQ2L 4DK5A 3MV7E 5GHWH 5F9JB 5MEOB 1W6WA 1KGIA 2JE8A 3QUMA 1AGFB 2GHWB 1OAZH 2H2SC 4YHOH 3UTSD 3ZE2B 5I19L 2K4AA 4XX5A 4P3DA 3FF8A 1BAFH 2FBJH 3NCXA 4F2MA 1ZSHA 4FQ1H 3VXOA 3ZDYB 1V7NL 2WQ8A 3ILQC 1FL5A 4M61B 2X3CA 2J5LC 2Q86A 5DRNA 1KCUL 2PCPA 4WU5A 3ULUE 4N5EC 3BKML 3C5ZA 3OGCB 4RWHA 1UD3A 3RJOA 1D2OA 1D5MB 4MZ2A 3L5XH 4HKXA 1QNZL 2E27L 1TQSA 1E5UI 4JHAH 4J3OH 3IMUA 1I9IH 1IAKB 2CM6A 4DP4X 3MJ8A 1UJ3C 4XMWA 3RP1A 1RHHA 1F6AA 5FGBA 2HXAA 4YUEL 5JMRA 4FL4C 3PDOA 2X10A 3CHRA 3LKNB 3NSXA 1FA4A 4GIOA 4G6FB 3PJSB 4X4KA 4PJXB 1TKWA 4HAGA 4LCWE 3VMOA 4AQ1C 5AVUB 5CJQH 1QFUL 2JFCA 3L54A 3DJSA 3FQTA 4WUUB 3GQFA 4QTHA 3MO1A 5CN2A 4LHUD 1PLGL 4L2YA 4QT5B 1AYRA 1N6QL 1JAEA 5HHMD 4O58H 5ETUB 2Q3ZA 3C5XA 4LLYB 3UC0H 3GXDA 4HBQA 1FVDA 1A6WH 1NKRA 4CU8A 4ELME 5IW6B 1C1EH 5I0ZA 2KHAA 4F7KA 4YHZH 2YIHA 4JFHD 1SGKA 3BKJL 3CDCA 1QI4A 3IPFA 3LXUX 3Q8AA 3OJMB 4Y5XC 4XPHH 1UD6A 6TAAA 1N0LA 3SGJA 4Z95H 3FN0H 3RHWK 3V4VH 3AXLB 5DJ2A 4WHYH 5F0MB 1L3WA 1G0YR 3P11L 3ZTDC 2GSIA 2SODB 4Y2OA 1TTRA 3JSSA 1RH8A 4OZGF 1KCRH 2R59A 4RBPH 1XCXA 2AJVL 2MEJB 3TEZA 1FH2A 5JR1H 1YVLA 3WUWG 4KRNA 4L37B 1KJMA 2RH0A 1I3GL 2O61B 3TTYA 1DE4A 1I9JH 2VIRB 3MODL 5DJAB 3I6GA 5L0QB 4NQCD 3G5XB 4TYUA 1NGZA 3WSQH 4DVRH 2HFGH 3MTRA 1CLOL 4OAWA 3EYQD 4FNPA 4N8VB 4GAJH 1IC4H 1M2OA 1UENA 4M00A 4X50A 1ZTMA 3NQKA 1L0YA 3F7YB 4YR6B 5DVKA 2IWGA 4NP9A 4PJXE 4QRSB 3F7QA 4UT7L 1EDYA 3G6DL 3B34A 4AQZA 1XGPA 1HQ4B 4QTHB 4W70A 4MMZB 3CK0H 2UXTA 2ZNWA 2K9UA 3RX7A 4UQCA 1LO2L 1M05B 1WGVA 4KDWA 1F4XL 1T7XA 3C12A 4RQQA 3HC3L 2PXYA 2IBBA 1LEGB 2LU5A 5DHVH 3ZUNC 1B88A 4PHXA 4E9LA 2G5RA 4BFBD 1J86A 5K1NA 3BVUA 3WNOA 3RUGB 1WFMA 2R2BB 4PRNB 3ZKQD 4DEWA 2JK5A 5D5MF 4KZDL 5J3HD 1OAUL 2WUCL 3UAJA 2MQCA 2PW2A 3CAFA 4UQ2A 5DVMA 5TDOA 3QE5A 5ID1B 2Y5EA 4GBXD 4JRYA 1FCGA 3BH9A 4XI5C 1OO2A 1B4JL 4YJZL 2GJRA 3S3SA 2FO1A 4AZ8B 4PSPA 3ZL4H 1S5HB 4ESKA 1Z9LA 4G5ZL 2ATPA 3ZDZE 1BIHA 5IEHB 5D70L 2OQJA 2CBPA 4CL7A 3CNKA 4KO6A 2XWBA 1EHLH 5T1KA 3AXIA 2KH2B 5CSZA 1G43A 4OLWL 4APQD 3FQXA 5D1XA 2VM3A 4N8CH 4PRPE