4A7QA

Structure of human i113t sod1 mutant complexed with 4-(4-methyl-1,4- diazepan-1-yl)quinazoline in the p21 space group.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCITGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
publication title X-Ray Crystallography and Computational Docking for the Detection and Development of Protein-Ligand Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 40
structure length 153
sequence length 153
chains with identical sequence F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 4a7qA00
1BZOA 1OZUA 1YAZA 2WYZA 1HL4A 1OALA 4MCMA 1AZVA 4B3EA 1PU0A 1BA9A 2Z7YA 1IBBA 2AQSA 1SRDA 3KH3A 3KBFA 1CBJA 2V0AA 4A7GA 2Q2LA 2Z7ZA 2AQNA 2VR6A 4OH2A 2SODB 3LTVA 1FUNA 2WKOA 1Q0EA 1Z9PA 2GBVA 4A7TA 2JLPA 1RK7A 1MFMA 1Z9NA 1SXSA 4U4IA 2LU5A 1DO5A 3MNDA 2VR7A 3QQDA 3KH4A 1IBDA 3MKGA 4BCYA 2AF2A 3CE1A 2GBTA 2Z7UA 2VR8A 1YSOA 1E9OA 2XJKA 1SXNA 3KM2A 1OZTG 3S0PA 1L3NA 2XJLA 1E9QB 3GTVA 4BD4A 1TO4A 1JK9B 1QUPA 1ESOA 3CQQA 5KBKA 1N18A 1E9PB 1YAIA 1COBA 1EQWA 1S4IA 1IBHA 2Z7WA 1PZSA 1PTZA 2C9UA 2AQTA 3ECVA 4OJAA 1HL5A 5KBLA 1IBFA 1F18A 2ZOWA 1DSWA 3PU7A 4L05A 1N19A 4N3TA 2K4WA 3L9YA 2NNXA 1SDYA 1XTLA 5CU9A 3GQFA 3T5WA 2C9VA 2WWNA 4A7UA 3HW7A 1TO5A 4FF9A 3KM1A 4A7GF 1JCVA 1UXLA 1XSOA 1F1GA 2AQPA 5KBMA 3ECUA 1CB4A 1SXCA 2WKOF 1SXZA 1KMGA 1E9QA 1SDAB 2C9SA 2GBUA 1B4LA 1JK9A 1F1AA 2ZKXA 2R27A 3F7KA 3HFFA 4BCZA 1U3NA 2AQQA 1B4TA 3GZQA 1E9PA 2WZ6A 3GZPA 3K91A 4A7VA 3RE0A 1SPDA 2ZKWA 1OAJA 3HOGA 4A7SA 1IB5A 2ZKYA 1UXMA 1XTMA 2WWOA 1P1VA 3SODB 3GTTA 3F7LA 1OEZW 2E47A 2WZ0A 3KBEA 2WZ5A 3QQDB 3GZOA 3L9EA 2AQRA 2JCWA 1E9OB 3CQPA 3H2QA 3H2PA 2AEOA 3ECWA 1F1DA 1SXBA 1SOSA 4N3UA 1EJ8A 2E46A 2APSA 2WYTA 4MCNA 4A7QA 1SXAA
chains in the Genus database with same CATH superfamily
5T3ZD 3ESNA 5C6WH 3LKOB 4KX9A 3RWFB 5I17A 3LZFH 1K8DA 1BDYA 4HBQA 4OLEA 5EO9A 1UA6H 1E4XH 1L9MA 4DO4A 2EP6A 4WEMB 1OGSA 2WSDA 5ENWB 1HHJA 3T04D 4F8OA 3LIZA 3HRZC 3N0PB 5DQJA 2UYLB 2VE6A 3N50A 4Z7UA 5A1AA 3CHRA 3MBWB 3VM7A 1EGJL 1T21B 2CRYA 2FEJA 4MZ3A 5DMGD 5K1NA 2GPZA 4N8VA 5BV7B 4IKIA 3ZVVA 3QQ9C 4L1LA 3S8GB 4NQCB 2NSXA 2OTWA 3NZHL 3PAUA 1SJEB 3QJRB 4DK6A 4Y1AD 3WNPA 3U4EA 1QUPA 4R7NA 3U30C 3UX9B 5FECA 4WJG3 3ZTNL 4G6FD 2YLHA 3C5XA 5I30L 3IGLA 3FCBA 1N18A 2CE6A 2X6UA 3L5WB 1T4WA 4RRPM 3SOBH 1RXLA 4DCQA 1OLLA 2CA3A 1ILUA 1C5BL 1UWYA 4GRWB 3WN6A 1QD0A 4D7BA 5T5NF 2DQEH 1RSYA 1ACYH 1F6LL 4MZ2A 3L3KB 2W0PA 1EEZA 1S7SA 2XTLA 3EDJA 5CEZD 3V6FB 2YPLB 1T0PB 1WK0A 3FF7A 4MXWL 3SDCA 4Q9RH 3FFCA 4CW1A 5C1MB 3RUGA 2VUKA 4OLZH 2B14A 5CHNB 3CDZA 4C8XA 3F7PC 5B8CA 3VU1A 2WWKT 1I7ZB 3IJHB 3X12A 1JVOA 5BJTB 2JKIS 5J4MA 1FFPB 5I8EA 1E6JL 2HVKB 3QDMA 4PWHA 1WBYB 3BN9C 4ZTEA 4WHCA 5JXED 2HTLC 2V2XA 1KCUH 2AK4E 3T6VA 2HA1A 2TSAA 1WFOA 2C3HA 2OJ1A 3PL6D 4JFTA 3DV4A 3EIFA 4GJTB 4AT6B 2R2HB 4NC1E 3EXLA 1SDDB 3TJHC 4CMMA 3BPCA 2F0CA 4KMTH 2F7PA 3QPXL 1JYVA 1IC4H 5B1JC 3WO3B 3WXVL 3FT3B 3WD5L 1XF4B 2ALWA 3AREB 2P28B 2PMZA 1DVQA 4F9PC 2CMRL 3PREA 1KN2L 1HCZA 2ADFH 4KHXH 1UD6A 2F53E 1A6WL 1QSED 1DBBL 2WN2A 2IPKB 4B96A 5IKCA 1NGQL 3S4SA 4O51A 3QXAA 2Z31B 3HB3D 2VZSA 5I9QC 4X8JB 4DTGL 4ZFGH 5JYMA 1EANA 2EXWD 2VAAA 3UTSD 2WJ5A 5IQMA 4IDJL 1ZGLM 4YOKA 3VWJA 1TT6A 1ZLSH 1KEGH 2WLZA 2VXUH 1GGCL 3OKLA 4YDIL 3UEQA 1HFUA 2AAAA 5D7IE 1BJ1H 4FMFA 1U6AL 5FF6B 2WLMA 3OPUA 1TCRB 2Z6FA 3JV6A 2QADC 4TUJA 4LEEA 3S36H 3EAKA 3V4VB 1RZGB 1JVKA 4NT6A 5JHLL 2Z7ZA 1G94A 5DJAB 2CK2A 1TLMA 4MA1C 2HJKA 2Y5TB 2CXKA 2BP8B 4YEEA 5JHDA 2D7TH 4NIKB 3WXWL 3EH2A 2GITB 3KGUA 2DYPA 4DETA 2R0ZH 1EHNA 3BQUB 4UILL 3VMPA 3O2DA 3TBYA 5L0QB 5LWYH 1FC1A 1RIVL 2UX7A 3GMLA 4JKKA 1X5FA 2VLLB 1ADQL 2C4FT 1T0NB 1DQKA 2H1LM 5T3XD 3FQ1A 2VDLH 3O81A 4HCRL 4BZ1A 5MEOA 4RMUA 2MPAL 1GMEA 3MYZA 5DURB 1U0QA 1GY2A 3C6EA 3MACH 1BD2A 2GY7B 1CI5A 2G5BB 1M6OA 2EH8L 4FFYL 2OK0H 3ORJA 3PV7A 2BHYA 1XMEB 1MCDA 1MVYA 2EIDA 2MNUA 4Z7OF 4X6FA 3SKMA 2X6VA 2IV9A 4CVWA 1MDTA 4LLAA 1PZDA 4J6RH 1C8QA 2IQAB 4TNGA 3ZE1B 4JFDB 1OK8A 1AXIB 1XV8A 3MRNA 1HNFA 2P7TB 2J1KA 4QOKD 5CSZA 4OZGB 1WWWX 3RIKA 4A2DA 3B3IA 1YNTB 4MLSA 2JF1A 5TDOB 2NUTA 3GHBH 1KC5H 4GRLA 3HJ0A 3GDBA 3QIUD 3QQ3B 7CGTA 8FABB 1RZJL 3MRQA 4FF9A 4EN3D 1N6QH 2CCLA 1KNOA 3OF6D 2OMUB 4XN1A 1MCJA 3TO4D 4P4KC 3VXMD 2C3VA 2NY6B 1WF5A 4I48B 5AAMC 2HRHA 5JXAL 4AY0A 2R27A 3IFPA 1EGJA 4GAYB 3VQ1C 3TWCH 2BIHA 1XBDA 3AJ7A 3ERXA 3RU8L 1BVKB 4TLSA 3U36A 1G7IA 1T22B 2OFQA 1GKEA 3PWLA 1JZFA 5E1QA 2MJWA 1OL0A 2NW3B 2OYMA 3AZUA 4MD5B 2XN9D 3WJJC 4PCTA 1HXYB 4HPHA 3SODB 3N41B 2OJEA 3NCBB 4HGMA 5C0FA 3UC2A 2C4FU 2CO3A 2A6KA 3OXRA 4KVCL 1PJWA 3CFEA 4Z77A 2UXVA 1F90L 1CLYL 1PZ5B 3CFKB 1G6RH 2RBLA 4XP5L 5TE4L 2A7BA 3H0TB 4Y5VA 3L4XA 4BQCA 4YPGB 5B1BB 4GKSB 4XX1E 5DUPH 4JRYB 1NLDH 4H5SB 4F8TA 4G3YL 3SCMD 4UI2A 1JDAA 1IGCL 3LDBC 3PHOB 4Z7WE 4APQA 2HX9A 4X7DC 2DQCH 2NNAA 3MLRL 4Q74A 4W4OC 3ZE1F 5E6ZA 4PJBA 5HHME 1IFGA 4WW2B 1EO7A 1JTOA 4ZUVB 5D7EA 5JZ7D 2Y1ZA 2OJZH 1MNUH 1TZGH 4EOWH 1D7BA 3KYMA 5IV2A 5D7SH 1DEEB 5I8KH 3ULSB 2ZWYA 3TF4A 2R1XA 4Y19E 4KKLD 1ZTXE 5JPNB 1V7NH 3S5LB 1ZE3C 4L8SB 4IRSC 1PZ3A 3VFGL 3WLBA 4EJ1C 4UIKL 5EZPA 2AJUL 2JKXA 2NMSA 2YEVB 3NRQA 2HWZH 5DS1A 5G5DB 4GUOA 5DHVB 4JBSA 1D5ZB 1JI2A 1KIUB 2VDQL 4NO3A 4G6JH 4WO4A 1J8RA 2YD9A 2J8UA 5JXEC 3JWDC 2X9WA 3UBXB 1PDKB 1GZPA 4MNGB 3G08A 3ROOB 4ANUA 4LCCB 3OSVA 5ALCH 3PL6C 4UOQA 2GJZA 1HL5A 1YEKH 2ATKA 3H9SD 3JWNE 4FEMA 2AABL 4PW4A 5FOBB 5JMOC 4F58H 2GK0B 5DQDH 3IJ9A 1AR1C 2HFFA 4JRXD 3X17A 4XCEA 3VDBA 5B39B 2Q2EB 3Q1EA 3ABGA 1SYSB 1TVBA 4MRCA 1AHKA 4KMLB 1T5XB 4PLOB 1FN4B 4TTGA 3RTQB 4YC2C 2WTPA 1A6UH 2YD8A 4O02H 3STZB 3K2IA 2MCPL 1ECZA 5AUMA 2I7SA 1D3CA 3VFTA 3IVKB 4QPEA 2R7EB 1U95B 5A6LA 2OL3H 4L9DA 2YPVL 3GBNH 4XNDA 3Q9QA 3SPIA 4M62L 3MREA 3GIVB 1M7DA 2ARJB 5HGAB 3OKYA 4OI9A 4CC4C 3MV9B 3VGEA 3B37A 1ADQA 4K7PH 4UTBL 2DEWX 2WWMC 3WTUA 2BC4B 4A38A 3DUHA 2Q3AA 4TQPA 4WNSA 4XPBL 1ES0B 4ZUUA 3GGWB 4U1IB 4Y4FA 2PP9A 4XCNA 4H8WH 2NY4B 2BVYA 3SJVA 1IM3B 3W81A 3V5KB 2EC9T 1AD9B 4A2MA 3K6NA 2GC4C 1GAFH 5A3IC 2XWRA 1U3JA 1BAFH 1L9QA 5DJ2A 3DURA 5B38A 4OVUA 2IBZX 2GFBB 2K7PA 2KHAA 2W91A 2EAEA 4WHYH 4RAVB 7PCYA 1TJMA 1FZKB 1NAKL 3NRPA 1VGEL 5DZVA 4FKEA 4X6DB 4F2MB 4YUEH 1W0WB 2VWEC 1NOFA 3NCFB 4P07A 1BA9A 1O7VA 2A9NH 1YQ2A 3GRWL 5EZLB 3VXRE 4BWWA 3C75A 2R59A 3RB5A 5D7LE 1KENH 4GKLA 3IE9A 1WO2A 5EOCH 2FWOB 1XMWA 4PB9H 3NSCA 2AV1B 5GS0H 5BNXD 3F64A 4XMWA 1ZPUA 2AK1L 2W0LA 5SWSB 4Z3FA 4MAYB 2K1MA 4AQEB 3FTYA 3BH9A 3KPSD 5IIEB 4K3JL 3ARRA 2QJDA 3SKUD 3B7TA 3QIUC 3VH8A 2FH6A 1AXSB 1KB5B 3LQAH 5A2AA 3RWEA 2ZQKA 4YHZH 1LO0L 1ZHBB 5T5FL 1QPPA 3TO4C 5C08D 1UM4L 1Y07A 3DX3A 1PLGL 4GEJA 3CFQA 1JGUH 3K2MC 4WY7H 2EC9U 2AZAA 3KGRA 1DUYB 2WKGA 3QCUH 4PJ5B 1LJMA 1Q9OB 1B2WL 5BPPA 5E1IA 5AVQB 5HDBB 2GT9B 5CU5A 1JS4A 1Y18A 4RMSA 1H15B 1GSMA 3PPEA 2LGNA 1I8MA 1CB4A 4OJYA 1JJUA 1MF2H 3WE6B 1YMMB 2WCGA 1RK1B 4QLWA 5I6KA 1QG3A 4K3EH 5EF1A 4OFDA 5I6LA 5K9QI 4RSYA 2ESVD 3D52A 1OHZA 4A7SA 3SCMC 4FNSA 4XC1H 5ICZA 4K9JA 4H8VA 1M4KA 1P2CA 2Q1EA 4R7DA 4HUCA 2VDPL 2WUBL 2XNAA 2EDOA 5GGRB 4QAWA 4ZFFB 1NDTA 1MCOL 3PHSA 2IANE 4TLKA 3DX1A 2JELL 1RUML 1I7UB 1HT6A 3PJNA 4PJGF 2NXZD 2OZNA 4I89A 2V9RA 2VZ3A 2LQRA 4L8BB 2IPUG 2WAQA 4M6OH 2Q8AL 2ZNXA 2XX0A 4JHVA 1SEQL 1WVZA 4QF1A 1UZ6F 3WFCH 4H2AA 1M05A 1MPAL 4C56B 1RFDH 1MCFA 3DXAD 3Q3GA 4HUVA 3A6CL 1E2VA 3TNNA 3ZHLA 5C0CA 3TBTA 4LCYB 4NKIH 4I9WD 2JMRA 4HV8A 4HS3B 4JM4H 3BVUA 3GMRB 3M88A 4W9CC 4TS6A 1OM3H 3UG3A 3GFUA 4FZ8L 3FPYA 2V6HA 2VN6A 4I1RA 3ATFA 3B2UC 3FTWA 3JVGC 5IK3B 4JFFE 5EEUA 2B39A 2YPVA 1UD2A 3G6DH 3TPUA 3UAFA 4DGIH 4AEIH 5C0EB 3K0YA 3IXAA 5D1XD 4Q8BA 5KN5A 1IGJA 1KPUB 2OMXB 1L3NA 3UGXA 1ZS8A 2OX5B 3B2XA 5J56B 1TO4A 4U3SA 4HH8A 1UVQB 3EOTH 5GGUB 4JQIL 5F3BA 2YPLE 3QO0A 2YD4A 3MLWH 4BZ2H 1YNKL 4J3OH 3DX7B 4AC2A 1SM3H 3NIGF 4IGBB 3OJVC 3MV7D 2DQTL 3MJ9H 4K2UH 4YDLC 1GZHC 4YXLL 1J8HB 1EJ6A 1NC4D 1LQBC 3APDA 2ZYHA 3QJQB 4N24A 4M00A 4XNMB 5E8DH 4F2EA 5FA4B 2OR7A 2PW1A 2A77L 1AOZA 4ZFZB 5TQ0L 2E7MA 3C5ZD 4BEIA 5C07D 1VACA 1NCUA 3GRWA 3NFNB 3IDUA 2HX7A 3U2SA 5CLYA 3MLSH 1Q1JL 1EDHA 1HHKB 2YD0A 4M1DL 1EX0A 2P43B 1MJJA 4GFTB 2F58L 4FFZL 4LMQI 4XI5C 3KYKH 5DZOA 1NBZB 3TIDA 3WL9B 3ZE0B 1XIWD 2QQNH 4DZ8A 1YECH 4G5ZH 1RI8A 3K71A 2B4CL 1T03H 3QR0A 2Z93B 4R9HA 1J11A 5EU5A 4J5VA 3E9UA 3QORA 1FSKB 4UQEA 4YXKL 5ACZB 3KW7A 4XBEL 4ZRGA 5MENE 5KVFH 1R3HB 1A6ZB 4JREC 4MQSB 1TETH 2OR9L 4F24A 2VZOA 4YBLB 3UXFA 4YPJA 1JWSA 2RALA 3RHWF 4P2RB 4I0PD 3GINA 5AYUL 1PQZB 5JR1H 4IEFB 1EFQA 4F5CA 1JPSH 3PGCA 2LU3A 3CAFA 3Q1SH 2XVBA 4J3UA 4P46D 3ROLB 4DAGH 2QZ5A 2R4RL 2ZIDA 5AD0A 4U6VH 3EYUH 3SOTA 2XG5A 4TVPH 3VD3A 2FL5B 1FO0L 3HTLX 2QHRL 4LAQH 1DN0A 1OD7A 4Q6IB 1RHHB 1N12A 3GSVB 1YNLH 4U31A 4WU5A 2H0EA 1J0YA 5CBEA 3RUGF 2CLZB 2KQNA 2NY3B 3B8YA 1AC6A 4XZ4A 4OJEH 1CFSA 3CNKA 1CN4A 3NGBC 1L5GB 1D7FA 1YHPA 2J12B 3IMVA 1W0VA 4GG6A 3QPKA 4AVKA 1SQ2N 4AM0A 5D2LA 5CD5D 5HYJB 2HLAB 1M7UA 2E6PA 4JZNA 2VYRE 3ESOA 3K0WA 3KL3A 4LSVH 5G4OA 3QDGA 4AJVA 2B20A 5HDWA 3ZDXF 2DKSA 3R0MA 1T1XA 5IJKC 5KSVB 4L4TB 1MQ8A 2MSPA 2ODIA 3OKMB 3O45A 4ZDHA 1JYXA 2KZ1B 2VDRB 3ZRFC 4OUUA 2BNRD 1EO8H 5DC4B 4PTTB 2B1AL 3HZMB 5BV7L 4R0LA 3I85A 5ACLA 3ZE1E 1DDHA 2WXGA 1F4XL 3BSZL 4JFDE 4HG4K 3HRZB 3NJFA 1BVNP 5CZVL 3FT9A 3RAJL 4PWJA 2BNQD 5ESQA 2Y24A 1BFTA 1UFGA 3ECVA 1JWUB 2HKFL 4YWGL 4QTHB 1HOEA 3UZEA 5E9DE 3MJ8A 4KTEL 1N7ML 4XCFL 1PCXA 4U1NA 5J89A 2AXFB 3ZYIA 1QFUH 3DSNA 3G5VB 4XHJC 4PV9A 3Q2LA 1QRNB 4OSUH 3CFJB 3U30B 3K8KA 1BG9A 4JO2L 2QKIC 3L3DB 3IAPA 4L3FA 3P4OA 4MHHG 4HVBA 3GBML 5CJXA 4L5FH 2NXZC 2DH3A 4B9FA 5AVSB 3VG9B 1KJ2A 5IQ9A 3D7PA 2BSTA 2L7QA 1S7XB 5FXCH 3T8MA 4P57A 4BGLA 1D6VL 3DMMD 2N4IA 3POCA 3QI9D 4MJIB 4HFWA 3ARGA 3QIWD 4NZTH 3C6SB 1IT9H 5DR5H 4L37A 3FMGH 1EZLA 2WWOA 5FO2A 2YAFA 3IMTA 3WCYA 1ROCA 3H6JA 4M7LH 1FFOB 1Z9LA 5IOPB 1P5VA 1T4KB 2Z3FA 4TSAH 2P42B 3SIKA 4EUPH 1LO5A 3DARA 3WDJA 4QCIA 3LKQB 3BEVB 3P0GB 2Q76B 1HE8A 1IGTB 1Q90A 2Y22A 1PKQB 2XFXB 3LH8A 3MRFB 5DQ9B 3HNSL 2NY2C 4X98A 3HVNA 2EYRA 2OYPA 2FO1A 1WBZB 3O4LD 1RJLA 2NYYD 5JA9A 2Z34A 4BFJA 4G43A 1X5ZA 1FYTE 4AK1A 2CIIB 3M1BB 1E65A 3BUBA 4KPHL 1CG9A 4Y4HA 4WAFA 1DBJH 1BBDH 1GRWA 3SGEH 4HAKA 5DS2A 1QLEH 3PJLA 3GSUB 3CGTA 4FFZA 4PRID 3NPSC 3OKEA 2HVJB 1KFAL 5GRUH 2Y06H 3BAIA 3OHXC 1ZOXA 3I02A 4AC4A 3AG3B 4MQ7B 3V4VL 1U8OB 4QY8A 4XMVA 3MGOA 1F41A 1EO5A 3U1SL 3B9VA 3CC5B 4KGJA 2FNBA 2YD6A 2BM3A 3WO4B 1XWVA 2GSGB 3V4PB 3OXSB 3C5ZC 2FO4B 1OF0A 2FJUB 3HCVA 3W5MA 4Y88A 5F3HA 1NKGA 2Z4QA 2W0FB 2F19L 4MQXD 4MZRA 3SE8H 3CVHA 1IUZA 4QRFA 4LRIC 2F5BL 4PEEA 3LN4B 1P7BA 1XIWC 2DMCA 3RG1C 1VKXA 4ZMAT 4OZ4A 4W9IC 3LVTA 1P5UC 4HGWA 4YGVA 5G55A 1JGLH 2VW7A 3FSAA 4NSKB 2DV6A 3MOBL 1EAOA 1RUQH 1TEGA 4WO0A 2ZUUA 4ELMB 3UACA 5B3JF 5E56A 2C5DC 2DQMA 2D3VA 4LOUC 3BI9X 4LSQH 3ULVF 3VA2C 4ZMXA 1DBAL 2QR0B 3O9WB 5HYQA 1B4JH 1UWEH 3GPEA 3ZR6A 3I6LD 1JZJA 4PJBF 4I0PC 3RFRA 4EI6A 4AV5A 4JFVA 3Q13A 4WEBH 3QIBA 4QD2E 1CIUA 1PF3A 2YEZB 2J4WL 4U6YA 2HN7B 3II2A 1OARH 3HMXA 4IU2B 4MDJB 3RWFA 1H0DA 3PGFL 5LXGL 4ZD3L 4HWUA 4MX7B 2WZ6A 1YEHL 3DOIA 5LN4A 4AG4L 5ENWA 4DN4L 5HYIA 5SX5H 1JV2A 3GBDA 3C60C 2MIZA 2ZKYA 3DVIA 5C0JB 5FYJH 2UVFA 2HKAA 3RIAF 2GI0A 3AY4C 3DJZA 3UAJA 1AYOA 3T3PB 4DZBB 2R0WL 3LS4L 2Q7AA 4ENED 3QH3A 4P4KB 4XMLH 4YXHL 2J8UF 4NQCA 2WLIA 3UOAB 1MCIA 2HT3D 4X6DE 1SJEA 4F2ME 1ZVSB 3IDNB 2ED7A 4TQEL 2ISDA 3CFCL 4HA1A 4EKJA 5L7XL 3K6SB 3UTOA 5HHXL 1ZSDB 4XP9H 2OXHA 4BQBA 4PJ7F 3UH8A 4OV6F 2JCCF 5H4YA 4FQXC 4GW1A 4CU6A 5I15H 3ZQXA 1OALA 3OAZK 2QLVB 3C2SA 2BIPA 1CBJA 2XG4A 3J27A 4PCYA 2VR6A 2P5WB 2DLFL 3RDTD 4UUJA 1C08B 1MI5A 4WZ9A 1KV7A 4PJGE 5CHNA 4WEUD 4XMPH 4Z9KB 4FA8A 5JQHC 3IJHA 3ALPA 2B16A 5C7ZA 3O8XA 2HVKA 3CHQA 4AUUA 3EJPA 1FYHB 1UZ6E 3LDBB 4QT5A 4AENA 4HUWA 3BUYB 4K94L 3CX5K 4FKHA 4Y1AB 3L1OL 3DTXB 4AEHH 4BFFA 2BVUA 4LIQE 1SDDA 2Q86A 4RX4D 4H88H 5CJOL 4G6FB 5DRNB 3APCA 5DZNA 1DLFH 1OGAA 5GRVK 5IEHA 1COBA 1WEJL 3B43A 3JTBA 1K5WA 3QQNA 2J6EL 1XF4A 3PGDA 4UAOB 3FUDA 3ZQWA 2W07A 3LKSB 1FNGB 2YMTA 2X2JA 5GRYA 1J9QA 4FNTA 5E6IC 3Q05A 2XUWA 4B9GA 5EBMB 4ODSL 4WFEE 1WUNT 4M9PA 3LV3B 4NENB 1DQJB 3P9MB 3GJFK 1XGPB 1YN7B 2VLMD 3QI9C 3CFBA 3FQTB 4JUTA 1QR1B 5E1GA 2DB8A 3QIWC 4ZUTB 2Z1PA 3PHQA 1QASA 2G30A 3U0WH 4FZEH 1TQTA 2MMXA 2HT2C 3CFUA 5D9SB 1KCRL 1MRFH 1BCIA 2D4FA 3MQIA 3F12A 5L2KE 1F6AB 3FL7A 1Q4NX 2E56A 2WSKA 1HNGA 1EDYA 2GBUA 1F1AA 2KKQA 3NIGE 2WCPA 3PL6B 1TR7A 1NMBH 1TCRA 1BJ1J 2ROYA 4KQ3H 4LVEA 5IEKA 3NABL 3WHE0 3V4VA 4BFNA 5C8JA 3WFHB 2R8SH 1NIBA 1NKRA 2D2OA 1MCEA 2Y7NA 4UDTB 1G9HA 3UTPD 3BMVA 2DM7A 1A4JB 4NUGH 4IHOA 3CHXA 1Q0XL 3NJKA 4YHIB 2CRMA 4JR9L 3MTRA 4Z1PA 1OE2A 3C5JB 4KJYA 4G8FA 2FNWA 5EC2B 3EYVA 2Y5QA 1KB3A 1QSEB 4HHWA 2IFFL 1I4FB 2IMNA 4BA8A 1DSYA 2VLLA 4L29B 2ZAHA 3HB3B 1XGUA 4XMZA 3I50H 3EGDA 1WZMA 5AZEH 2CO4A 2NR6C 1QZ1A 3QFJD 2LOEA 2YEQA 1QPXA 3PWPD 2FBJL 3F01A 1OAQL 5IB3A 3BDYL 1IAMA 1K3IA 4JZJC 4NN5C 5H37H 2G5BA 3D39D 1HQ4B 3FOMB 3O6ML 4QRRB 5INCA 3DX0A 4TTDC 1F56A 2BP0A 2XA3A 2AXWA 3NJMA 3SE4A 1NCWL 2XX1A 3BLKA 3FRPG 5HHNB 1S3KH 1SZNA 4M8QB 3F3HA 4OCSH 4P9MH 4LQ1A 2VQ4A 4WVRA 4R3SA 4JM2A 1WGOA 4YBHA 4OZGA 4KTGA 1YNTA 5TDOA 2GCYB 3PWJA 4JHAH 3VFPA 2YUXA 3QQ3A 8FABA 2ZAGA 1DJSA 1ZLWH 2H32H 3EGXB 1NCDL 1EFXD 4PBXA 4BUHA 4NZRH 3EGSB 2NY5H 2VR8A 3GSXB 5DVOA 4Z18A 3FFCE 4HPYL 1L9RA 3A67H 4AL8C 4HZ1A 2HRGA 4J3WA 5DJ6B 4BD4A 2YC1A 3SDAA 4RGND 3T2LA 2N01B 3MUGA 1PY9A 1URZA 1WYJA 4FQXA 3PNWB 4UNUA 1PTZA 1A21A 2Y72A 3C9NB 1A3LH 4Z95H 2NW3A 2XACC 4JRFA 3F7VB 4CSTA 3U4KA 2YA0A 4FADA 4Y2DA 3PABB 1FLRH 2DIEA 4RWYH 4L05A 1KB5L 2DBLL 1MIEH 2Q8BH 3ZDXE 1YZZA 3VDCA 4L2LA 1BXAA 4QOKB 1VEMA 4ELDA 2IEPA 1PZ5A 2COVD 3CFKA 1CXFA 1OTUD 1UZ8A 2M26A 3DX8B 2AQ2A 1NC2D 4CKVX 3QIUB 4LIQL 4Z0XA 5AKVA 2R51A 2XC8A 4JRYA 1SHMA 2EECA 4TULH 1QA9A 1CGXA 1T2XA 3P9LB 3TO4B 3VXMB 5IF0A 2J1ZA 2HT3C 1Y0LA 3T6QC 1GJUA 2JJUA 2ZWLT 1OAXH 1TYEB 4LL1A 2XWTB 4EF3A 1KSRA 1NUDA 2WLNA 3VXQA 1OB1B 3S88H 3CZFB 1XXFC 2AQ1A 4ZUVA 4KUZL 3LEYH 2C34A 2WV3A 2K0RA 1U9KA 3L4WA 2ICEA 2NT1A 2XN9B 1JOIA 1XXDC 5LCVA 2BVQB 4WI4A 3FTXA 1TJGH 5DXWA 2CA4A 3BKCH 3BH8A 3T65A 4LQFH 2KT6A 3BD3A 2J5WA 4K5LA 4N90E 2FR4A 2VN3A 3CZNA 5F70A 2F54A 3BP4B 5JQIB 5JHDE 2OP4H 1EPFA 1LO4L 3R8QA 3W5NA 3NPZB 1H3GA 1KIUA 1INQB 1P4BL 4P2QB 1NOLA 1YPZB 4KK8C 5B7MA 1FZJB 3SCMB 4OLWL 3UBXA 4ZMWA 2CGZA 3ROOA 4NO0B 4YNYB 3VM5A 1DVFD 3V4UH 1MW1A 1ZTMA 2RD0A 3HAEB 4TKWA 1HTYA 3Q06A 1VFOA 1BD2E 1GL4B 2B15A 4ORGB 4BSVA 3QZOA 3TZVA 1RLBA 1G1KA 5B39A 5I1GH 3UEZA 3MRJB 4WTXA 3A24A 5ANMB 4UV4L 3OKOA 1J9TA 1T5XA 3D07A 5HYEA 3T2OA 1A3RL 3RTQA 4O5LH 2IOMA 4QLRA 4XZUB 3J07A 4BUGA 1I1YA 2R0KL 4LRNL 3JUYA 4YE4H 3S35H 3BWAB 2R7EA 1R3LA 2DQFA 2F08A 1RUKL 3Q48A 4WHYG 5K39A 3REWB 3U0PA 4M5SA 3I84A 3NJIA 4LF3B 2VAJA 3ZN6A 5HGAA 1Z3GH 2ARJA 5C7XH 5I1EL 5E5MA 3MV9A 1KYOJ 3CU7A 1ID5I 2ZXBA 3LNEA 1GIGH 1ES0A 1I75A 1G7HB 4UZSA 2DLEA 3GGWA 5IWLA 3B1TA 3H9SB 3AMLA 5BO1L 4YO0B 3WN5C 1RAMA 1TQWA 1H5BB 1QRKA 3FBQA 2XQYG 4G7VH 4JRXB 4MWFB 1AD9A 1XCTB 3V0IA 3NFSH 4OJFH 1ZKAA 2YD7A 5EU3B 4RFOH 1EZUA 3HFML 2C9VA 2IMMA 5HYSB 5I66B 2X87A 4RAVA 3SDYH 4FFWD 4OV5B 4U7MA 4PY8I 1BYPA 5D2LF 3VI3F 3SKJH 2ZSVA 3FT2A 1W0WA 3HFFA 3MMEA 4DGWC 5EZLA 2BSDA 4ECNA 1AI1L 1A7QL 5EF2A 3FUIA 4I8DA 3ZGIA 2WO3B 2VSKB 5B3JE 2YSTA 3IRPX 4NP4L 3ULVE 1PKQE 3NOIA 1CXLA 2QQKL 2ZXEB 4FP8L 3QJOA 2LHAA 5EOCJ 3UYOD 2AV1A 4R7LA 2P26A 1A6VH 4HC1H 4Z8FH 4PJ9D 4D3CL 5TPWL 4X6EB 5SWSA 1G0XA 2G5RA 5IB1B 5TF0A 4AQEA 5IIEA 2AANA 2MKLC 1CU4H 5HVGB 4HS8L 5DRXB 1E5AA 4P05A 5FYKD 1PW3A 3K7UA 4TRPH 1AXSA 1TSHA 3INOA 4X7SH 4MB5A 2PPEA 4RIRA 1XB8A 2ENSA 3QUGA 4BH8B 4L18A 4HJGA 4CADA 2FX9L 2EDFA 1IL1B 4DOHE 3IMSA 1XGTA 1PSKH 1OAKL 5B7EA 2OPCA 2EUVA 3QRLA 2DMGA 3IFOB 3O0RL 5CEYB 4CAGA 4Q2ZA 4RGNC 4B97A 3LRSB 1CE1L 4FQ2H 2X10A 2FB4L 5HGGS 4A7GA 1ILSA 1OAYH 1F13A 4PJ5A 4UINH 3KVQA 4FAAB 1NMAL 4ZMNA 1Q9OA 3QXTA 1LYQA 4XCCL 3ES6A 1IGIL 4ICXA 2GT9A 2J88H 1JHLH 1Q9WB 1AVAA 4U4IA 4HBCL 4N8CH 1BQUA 3FQ4A 1CF8H 5D6CB 4D9RE 3T6ZA 4HIJB 2VDKB 2IDTA 3WFBL 1KBGH 2ICCA 3D69B 3KLAB 4PJ7E 3UDWA 1FH5L 2XFGB 3MZTA 3KPSB 4WF7A 5HVFB 2JCCE 1AIFA 4FFVD 1V7ML 2BRQA 1TMCB 3QNZA 1DQLL 2X38A 1YMMA 1OTUC 3QCVH 1XF3B 4R4BA 3ENEA 4LLDA 4R4FL 5L9DL 3RA7L 1R1CA 3NGBB 3MCKA 4DGVH 4C54A 4PY7B 4NAQA 1UURA 5DCCA 3VXTB 4ATWA 1MWOA 1OTSC 5A6IA 1JTTA 4NIYE 1DBKH 5C08B 2VDRL 3QJUB 3UADA 3OPZL 1TPXC 2B3IA 4EIBA 5IJDC 5AB0A 1TNNA 3R7RA 3A6BH 3TA4D 5E23A 3HR5B 3RVVC 5JYLA 4P3CL 4MAUH 2HFGH 4LDEB 2RGSA 1U8NA 5D7JA 4DUVA 4JDZB 5F96H 4X9BA 4HKXB 4FHKA 4L8BA 3TYGL 4IBUA 2AXHA 3CDGA 1A9EB 3V0EA 1PX3A 3K4DA 1QBLL 3H7BB 3L3JB 1FVCB 3JQOB 4ANVA 1NBVL 4QHLB 4ZFOA 1R17A 2XWEA 4C56A 4NBZB 1VJSA 1KYUA 3FUKA 1J0KA 4GEIA 3S7GA 1MAMH 3ZTDC 4OIAA 3OZKA 1MAJA 5DD0L 4HS3A 4J3OG 1R5WA 2ZT9C 3GMRA 5GGQH 4F37K 2ESVB 2OMBA 3RKDC 4FNLH 1LWHA 4I88A 5CIPH 1IQWL 4FQHB 1TZHB 1NGXB 5GSVA 2NNFA 3F5WA 1DVFC 1PD1A 1MJ8L 1S9XA 3LD8B 4GBXD 1SMOA 4P4RB 4RLDA 2CUHA 4GUPA 4JY5H 2NPLX 5CUSL 5C0EA 4UZGA 5C92A 2ZD0A 5KTEH 4GMSL 2G60H 4Y2OB 4PJIA 4WI3A 1JN6B 4MYWB 1I8LC 2NXZB 3MJ7B 2QPUA 3PDOB 4FQPA 1MFCL 1DVTA 1JHKL 1ZD6A 3VNZA 4EI5D 3GXIA 1GKOA 3G6AB 1CD1B 1D5IH 2W5PA 1MHHA 2IH1B 3DPBA 5DZJA 3ZGHA 4DKEL 3OVUB 4X6CB 5AB9A 5BOJA 5HP5A 1DQDL 3ZKXC 2P5WE 4BFOA 2GW5A 2XTJD 3KJ6L 4XXCA 2DJ4A 5EF0A 1ZLVH 3DXAB 4L8DA 2X6CA 1DSFH 3WTSA 2E3VA 3IFNH 5GGTL 1B90A 5IBUB 3QW9A 3RY6C 2IC2A 2ID5A 1KJ3H 2XBZA 4PR5B 2FYYA 5K9QG 3QBTB 3L7FA 1UENA 2FGWH 3FFOA 4ZFZA 1BG1A 1BBJA 2ZUVA 4LSTH 4YAQB 3LPGA 3V0AC 1J5OH 2FRGP 4OQTH 5I75B 4GP5B 4LLQB 1FLTX 3M7OA 4U7SA 3HR6A 2FATH 1HJBC 2NY2B 3H9ZA 3OJ2C 4V1DD 4XAWL 1U8MB 5AEAA 3K72A 5B7FA 5FIEA 1KYDA 2X4UB 3QEQD 5KS9F 5A2FA 4HD9A 4CILA 4L0ZA 5I1DA 5DC2A 3SYOA 1HXMA 1FAKT 5CEZE 5INDB 2X1PA 2Y4SA 4QJ4B 4FFWC 5KVEE 5DK2B 1EQWA 5HSFA 1QX1A 5FGBC 4AIXA 4U1JB 3V4PL 2BO0A 3MV7B 3CCHA 5GIRB 3HE6A 5KYWB 3INUL 3FQNA 1BGXL 4OJAA 4OM0L 1JXJA 1NC4B 4LU5H 1CDBA 4P2RA 1F6FB 2X4SA 2ZOWA 1BMGA 1PQZA 4IEFA 2WVSA 5GJSL 1J87A 3ZLQC 4N3TA 3ZDZB 1QBMH 3BJ91 5A2LH 3RVXC 1NEZA 3C5ZB 5MERA 2VOTA 3B7SA 1X3DA 5ADPH 3VYOA 3BYTA 1LDSA 5FB8B 1RPKA 3ULAB 3ARZA 3GI8L 4JGMA 4JDTL 2P8PA 3OGCA 3LN9A 3GSVA 3IDGA 4PJ9C 1JPGA 4EE2A 1M57B 1XIWB 1J1OH 2D31B 4JCMA 2PWFA 1KLGA 1P5UB 3HC4H 1T0MB 2NSMA 1UD8A 4J1UB 1L5GA 3X1NA 2FQFA 1QSEE 4FG6C 1OD9A 2XPGB 4R96A 3RGVD 2BNUB 4WHTB 5JO5B 1QQDB 2XRAL 1BZ7B 4HJTA 3ZDYF 4GI9A 1KGYE 3VXNB 1T7YA 3RX7A 1V27A 4FTVD 2C26A 1HL8A 2DWSA 2NLJB 4I0PB 3O6FA 4KNUA 3V5DB 3NAAH 3GTTA 4FQCH 3W0WA 4CC1A 5IVXB 4NFBA 4L4TA 5KSVA 1GYUA 3JWOH 3MLYL 4IKLA 1YEDB 4P46B 3OKMA 3QUMB 3AXLB 1H9DA 4H40A 4QRRE 2MKWA 3V9CA 1S9YB 4NCC2 2YAQA 3IDXL 4OF6A 3QUYA 1DHKA 1ROWA 4ZZFA 4NO2A 4NHUA 1V3KA 3AB0B 1HZHL 3NEXA 3LQMA 3CSYB 4WU7B 1D5MA 3P0VL 1INDH 1SYVB 4WUKH 4XN4A 5K9JH 5L4JA 3VD2A 3OX8A 3TCLA 4FFVC 1QI3A 4GKNB 1H3UA 3D2UD 4QTHA 4CMHC 4RSVA 1RZ8A 3QK0A 4NQED 4UB0H 4PRAB 2R1YA 5ISZA 3S37X 3MR9B 3REVB 3CZEA 4AIOA 3LN5B 4PREA 4AQ1A 4Z3IA 2HVBA 3CFJA 1YY9D 3KVPA 4PV8B 4XC3H 1F3JA 1MY5A 3UO8B 1J1PL 1XF5A 3DV6A 4OIBA 3TBBA 4EUPG 3KH4A 4XN5A 1I1AA 1KXTB 5F9DC 1DO6A 2VMDA 1MWAB 2DQDH 3JV4B 2BNRB 5E2UH 4BELD 5BW7C 4HJUA 2YD2A 1ONQB 4XBGB 1TF4A 2CRIA 1YA5A 2P1YA 3OAYH 4MS8D 3WUWB 1MVUB 3KPRD 1S7XA 1E9PB 1U2CA 1UG9A 3RFZA 2PYEA 5A7EA 1T5WB 4NHCH 1E3ZA 4MJIA 2ZOUA 4NWUL 5E7BA 1OCWL 3BRDA 1G7LB 2BNQB 3KXFA 3QZLA 1MG3C 1WICA 2B0SL 2YGPA 4XWGH 5JW3H 3I6KA 4HIXL 4HIEA 4EZKA 4JHUA 1LEIA 5FHAH 4Z78A 1Q1PA 5FM5O 2OZ4L 2WLLA 5IOPA 1RV6X 4XN2A 1T4KA 5CR1A 3VXME 1I3GH 5JUEH 1XAUA 3LKQA 5I0VA 3D12B 3VCLB 1H6TA 3B56A 1KY6A 1AY1H 4KVNH 4Q9BA 4GBXC 5CEZL 3MLXL 5IUSA 2GIXA 1R5IB 3WEAA 1WBZA 4JM2F 1S7WB 1UT1A 5JNYB 3FO1B 5EIIG 4UT9H 3RILA 2A9AA 3FN0H 3KLDA 3OG4B 4X4XB 5JQ6H 4JO1H 4LCWD 1YN6A 1HYRC 1FV1B 2ITFA 2W0KA 1F4YL 3GSUA 3JWDL 4GLRI 2XTJC 3DMMB 3QI9B 2EADA 4QO1B 1NZRA 1CUOA 3GJFB 3QIWB 3WIIH 1FZOB 3CFIC 4MQ7A 4BKLA 3CX5J 2WMPA 4P2QE 2E47A 3BVDB 4NI6A 4R6UA 4X5PA 2WZ5A 3RKPA 5CS7A 4WWID 5I1HH 3I2CH 2FEDC 3JUZA 3V4PA 1I1FB 2FO4A 5D6DA 5F0MB 4ZTPH 3VI3E 4BHUA 1A6AA 1FJ1B 1DQIA 3QHFH 3SDXB 4NQQA 1AHMA 2H26A 3RBSA 1E4WL 1NBYB 3FCSB 4G6KH 5EZIH 4JAMA 2A0LC 3WY2A 3O4LB 1OZUA 2ZCKL 1VHPA 4HDIB 3D09A 3X2QB 2AJVH 1ULVA 5ANME 1KELH 4XPTL 4NSKA 3W39B 4X4YA 4PGBB 3QDJA 3QXDB 4PRIB 5A2JH 1J8KA 3A4AA 5CN2A 4LSPH 1MCKA 4GFXA 2APXA 3O9WA 1P9MC 2HJLA 2L7JA 3WNLA 1GR7A 2BH0A 2YWZA 3CG8A 4BFEA 4YSUA 1WZ1L 4JG1H 1K6QH 2V5YA 1C9SA 2WXIA 4GOSA 5EWIH 1ZA3B 4EI6B 3BAEH 4LDCA 2D7QA 2O5XH 1A7NH 2JKWA 4F91B 4FQJL 2UUDK 4QRPD 3TBWA 5IW6B 2BOBB 1OAZL 3T2QA 3RY4A 3GSRA 4RGOH 3LZNA 4GQZA 2X41A 2X7LB 4GKOA 4M7LT 5T3XL 1TQUA 1E7UA 3N1PC 3MCLL 2WQUA 3QZNA 1CWVA 1JF1B 4YDVA 4PLKC 1REIA 4CVZB 2F7OA 3CLWA 4EQ3A 3QZWA 4RFEB 3MVSA 5HGDB 4L3ED 2H2SC 3ZTEA 4XVJL 2UWEB 4LKXB 4JO3L 1D6EA 1U3HD 2FWUA 2JKLA 4JO4H 2Q3ZA 4OGYL 3N85L 1N70A 5EOQL 2D3LA 3SDXF 3FUMA 5C6TH 4M6NH 3MNVB 3MRHA 4WSJA 5DJZB 2W65A 5K9OB 1ZSDA 2VM9A 4Z7QF 3KLKA 2BCMA 2A9MH 4QXGL 2XA8H 2VMFA 1HE7A 1OGTB 25C8L 3BAWA 3MRBA 1J05A 1MHPH 5E2TL 5EN2A 2C9SA 1KV3A 4LSSL 1B4LA 5EO1B 1WZAA 3MBEC 5DZ9A 1AKPA 4WFHE 5CKGA 5CXPA 1T7VA 2QSVA 1A14L 4MNQB 1OW0A 2VR4A 3UP1A 5HPMB 4X5XB 4HMDA 1FF5A 4ZX3A 5FCUH 4PJAB 4CBZA 5F9WC 4P5MB 3WOVA 1PZBA 4ABUA 2QSCL 2AEPH 1TTAA 3MRKB 1L4IA 1P6WA 4DEUA 1UJ3A 1ZV9A 5E8OB 3BSGA 5ESVB 4PTUA 2GIMA 2GSIB 3DTXA 2P4AB 1DJYA 2JKRM 1YEIH 1YY9C 2I07B 3MRMA 4U2YA 4AKOA 4A55A 3TT1L 1BVNT 1KBPA 3T0EC 1JRHH 2E27H 1BP3B 5DC0A 4WGWB 5EN3A 4ZSOE 3C08L 2VL5B 4JFHE 4MSWB 3I6GB 5ICYB 1AZVA 1FQ9C 1PJ9A 1FHNA 4U1GB 3DVNB 1SJVA 1XB6A 4CVXA 3VD1A 2JB6B 4Z7IA 4Y89A 3PDDA 5EO0B 4PS7A 1DQJA 3P9MA 3QWQB 4ZJ9A 3RDTB 4G8IB 3QFGA 1NGWA 2A2QT 2D7OA 1BQSA 2FT6A 3FQTA 1OSEA 2EYSB 3S96A 4K8RH 5KUKA 5IFAL 1HH9B 2QGEA 2X4NB 2FIKB 4M5YL 4PI0A 4HULB 3W9DB 2VR7A 1A6PA 5GSRB 2XKUA 3TN0A 3AU1A 1MXDA 2NX5D 4WENB 4ZODA 5HVWA 2VC2H 1KXHA 3DHPA 1IAII 4UOW0 2JKTM 5H37G 4DPCX 5EEZA 3VXSA 1I9JL 3QNXB 4WV1A 4UDTA 3TA3D 2IFGA 4JKLA 3MHZA 3IJYB 3L3IB 4I77H 3D2TA 4XVTH 4ZO7A 3HKFA 4YHIA 4LCUB 1RURL 2EDXA 5JOPD 5I8OH 4YL9A 3IDMA 5EC2A 3P02A 1R3IH 2WUCL 1I4FA 2FD6H 4XP1H 1OSYA 2R29L 5F7EH 5KS9E 5LBVA 1ED3B 3GQFA 2E7CA 4P2AA 2AJYL 3UTSA 3DJRA 3F6LA 2VN7A 3BPNC 4A7GF 1NTDA 4M3KB 1CZ8L 1LO3H 5IR1B 3T6WA 3FOMA 1QFOA 1JNHA 3H3KA 1YUKB 4C55A 4Y9GA 3K8LA 1MCCA 1NIEA 1N3NB 5IMKA 5HHNA 1G9NH 4M8QA 5DJYB 1XR9A 4PRBB 3M6DA 5EOTB 2CM6A 3B34A 4KXZH 3V0VB 3MX0A 1UT2A 5L2JA 3QJZA 3UJJL 4RDQG 4OCYH 1RSFA 2O26U 1I82A 2YIHA 2YS4A 3WIFA 2W9DH 2ENJA 2OMVB 5FYJU 4LEOB 4PS4H 1HEZA 4YSSA 3O2DH 3QFJB 1MI5E 4X5WA 2JQZA 2WBWB 3PWPB 4BRVA 5DTFB 2XVKA 4U1SB 3O3EB 3BE1L 4ODUA 3D39B 4BZ1H 1T0OA 4W6WB 1QTYT 1RP8A 2GC7C 3C9NA 3LQAC 3IXTB 1MFUA 5DUML 1ZVYA 1KB9K 2O6FA 5FA3A 3ZDYE 2XN2A 3R8BB 1T6BX 1VIWA 3AM8A 4R8WH 3T0VA 4FULA 2AV7B 3CMOH 3QWRA 3GMNB 4PJEB 1OGAE 3WV0A 1U8CA 4QOKA 1A7RL 2JSFA 3DX8A 4XOBA 5CWSB 3DO7B 3NT0A 3LQZA 4EN3A 2BS8A 1E8ZA 3C2AH 3VGAC 3Q8AA 1KWGA 3BX7C 1EFXB 1U3HC 3VTMA 3OF6A 1Z2KA 2G75A 3P9LA 3BESR 1LE9A 5AZUA 3W82A 4DP6X 2AKRB 5FM5M 1NPUA 3HG1D 1ITBB 2NYKA 4HOXA 2CJUH 2OA9A 4QYOA 4RGNB 1B0RB 4RMWA 3L2LA 4KV5F 2YOAA 4P5KB 1HILB 2VDKL 1B4RA 1NEUA 4MMYB 2X70B 1UB5A 3UZQB 4PJIF 3ZMNA 1FGVH 1EGJH 3ETBJ 5T8IA 5FYLD 2WZPD 2CG9X 1YMHB 4HK3J 4DWHA 5C9JB 2XN9A 5I24A 4PJDF 1FI8C 1RZKL 1G6VK 3HEIB 2CKNA 5BXFB 3VXOA 5I82A 4Z3HA 1GJIA 3NZHH 4XH2B 3SZ6A 2CDEB 1QHQA 3QZBA 3SPJA 4MD4B 3ARVA 5GHWL 4S1RH 3VQMA 5I30H 3ULUF 1NC2B 4OCRL 1CLOL 1KTLB 2B1HH 4FABL 4IRZL 4ZW5A 1I3VA 1F8TL 2YR3A 3NZ8A 2YJQA 4PD4K 1C5BH 1FZJA 3VFRA 4O02A 3CK0L 4D8PA 4MCZA 5FAAA 4P23C 1KCWA 3EZJB 4YNYA 4OZIF 1OP4A 4D9LL 3VACA 3HAEA 2OL3A 3O3AB 4PIRF 3THML 2XWJB 1AMYA 3GXTA 3ULVH 3P77B 1IAIM 4JDVB 5EUKB 1ZT4A 3SB3A 2WP3T 5HGHB 3LH9A 4Y16C 2ZSWB 3RWDA 2G4EA 4QHNB 3HLAB 5DO2D 3VD4A 3VQLA 1K2DB 4OZHB 5AL0A 2KZBA 3IBOA 4GAAA 4XZUA 2NY1C 3MRPB 5KJRL 1BM7A 3BH4A 4XNBA 3WFDH 4DVRL 4NRXA 5F1IB 1OSZB 1HL9A 4PJHB 3FRUA 4URTB 4LF3A 3QPXH 1U41A 1LEGB 2VLKE 2EC8A 3WD5H 5BUGA 3HPJB 1SUHA 2YGQA 1AANA 3B2MA 4HUKB 1DEDA 4WNQA 5IB2B 2WIIA 2CMRH 3WFEL 4X4ZA 1TZOA 1KN2H 5DHEA 3E0GA 4RAUB 1JZ6A 4AYSA 3FO9A 4J3OC 2FDBP 1DVFB 2G0LA 5AKRA 4ZAKA 5C0BA 2JB5L 4HUMB 2IBZY 4QEGA 3BKML 1DBBH 3LSOA 2OS7A 3S2AA 3ARBA 4IIQA 4MWFA 4DTGH 3TA3C 5I1CL 3H9HB 4AE1A 5KBDA 4IDJH 5EU3A 5C0DB 3O3DA 2MCAA 5CGYD 1LQSR 5D5MB 3HJEA 4L23A 4W6YB 2CCWA 3BEWB 1GGCH 4N9GA 5ALBL 4YDIH 1FNEA 4P2OD 1GA2A 3ZKXB 5J6HA 3FUJA 5GGSB 1S7TA 4OV5A 1NM9A 4KK6C 3EYFA 4FLRA 4ZNCD 1U6AH 4HIQA 5HGBB 2PP8A 3EJYD 3MROA 4IRJC 2RFXA 2RH0A 5F7HA 4JFUA 3IM1A 1D5BB 3FHEA 4GMTL 4FXKC 3U1PA 4LHUD 4MJ6B 4X4KA 1VADB 3AS2A 4F7EB 4U1MB 3D0VB 4KO6A 3HA0A 3MRDB 3WXWH 3UJIH 5AG8A 2YRPA 4UILH 5EZOH 1K4CB 4K5PA 1YEFH 4H1LA 1XR8A 3PLYA 1UQSB 5F6HI 1ADQH 2EABA 3LCYA 3CTTA 4FI7A 5IY5B 2AK4D 3CSBA 3HBPA 4ONFL 4M1GL 3NJHA 3GUFA 4R83A 2MPAH 3MFGB 5CU9A 2WQXA 2EKJA 1WT5A 1T66D 3NYKA 1IGYA 4G8GA 3EO0A 5TH2B 2DH2A 2ITDB 2KQMA 3IRZA 3RWCB 3BIAX 3VFNA 2EH8H 1CXEA 2EKSB 1TQVA 1DQQB 2X6BA 4OCMC 3QJXA 4AXWB 5ADOL 3KDMA 1IL1A 5BRQA 1VEPA 1KMGA 2AAVA 4KQ0A 3LEVL 3BVXA 2VH5L 2DM2A 4YDJA 4HKZB 2CBQA 3D4YA 2C9RA 3IFOA 4YSEA 3HZKA 3NDZE 1JMXA 1H9VA 2F53D 4G83A 2H8PA 2OMYB 4QRSB 1YYLH 5AOIA 1FFTB 5JPMB 1KGIA 1LHZA 5D7KE 5J1AB 1EK3A 5HI4D 3SGKA 5MEQB 1RZJH 2W60B 4OW6A 1BZQK 4RNRB 3SDXE 3T08A 3TPKA 4HIPA 4HZLA 4JFWA 3NDYE 4N0CC 2FQEA 3RRQA 3RZCC 4ADJA 2AI0H 4FQLL 4PJ9B 1MLBB 2DAVA 1T1ZB 4Z7QE 3D69A 5I18L 4N0FB 1MEXL 3DBXB 1B0GB 3QB7C 1SBSH 1LE5A 4ZW7A 2LR4A 3KYOA 5DGQA 4ZX6A 1INEH 2AEQL 1QUNB 3RU8H 3VFSB 3COOA 1R3KB 1OOWA 1TIUA 2V5MA 4PY7A 4NZJA 3VXTA 4IBZA 3QUML 4O9HL 4L1SA 3S3CB 2ITCB 5LBSL 3B9KD 2IDCA 3PQYA 4ZPTB 3G6JB 3LXAA 3OMNB 3IKKA 4I1NB 1XF2B 5DFTA 4FXGB 1E6OL 1N5AB 1L3WA 2C7UB 1OT4A 3HR5A 4KVCH 4X7EC 1M1SA 4Z7VB 1CLYH 1LK2A 5J5EA 15C8L 5TE4H 3UAEA 1T7WA 4U1HA 1XH1A 4HKXA 4HUXA 1SVZA 4ZMVA 5ITFB 1A0QL 4NBYB 1X5IA 4KJQC 4ATTA 3H7BA 2NCEA 1IC7L 1FVCA 1IGCH 1WGVA 3W11C 4HKJA 4QHLA 3V9EA 4CNIB 4GW5A 2L04A 5D2NC 1AE6L 3AUWB 5LGJB 2C3GA 3MLRH 3LNHA 2NXYC 4MA3B 1TCMA 1U8PB 3NJNA 2X5PA 1DJHA 1QYGL 1KGCE 2W88A 2F18A 4K15A 4UOJA 3ZSSA 2ESVA 2X4OB 5HYFA 4LBEB 5CNHA 3ZL4L 3VXPA 4Z3TA 1MWAL 3ZO0A 1X5LA 2ALAA 4LEBA 1TZHA 1MREH 1NGXA 1X44A 1G5AA 5D71H 2BHZA 4QYAA 4JRLA 1QLFA 1V5JA 1ZGLB 3X3FH 3P4LA 4LLUB 5KSAD 3VFGH 3F7YA 4UIKH 3MJ7A 1T89A 1PFOA 1PLBA 4JRWA 3ZXAC 4X83A 4KKNA 2VDQH 3Q8EA 3G6AA 1JFQH 2IH1A 1WCQA 1W91A 2VLRA 4X6CA 4MNQE 2R69L 4WI0B 5B4MC 3GF8A 1OANA 3BYYA 4GIAA 4OFYD 4JY4B 3F7KA 3DGDA 2AABH 4OZFB 2QTVA 5IBTL 3BT2L 5E9AA 2Y69B 5AW5B 3GJEB 4MMXC 4PR5A 3CVIH 3MOQA 5GRVL 4L4VE 3ZYZA 3HN5A 3NESA 3FFDA 2P80A 2N7AA 4LLQA 3DX6B 5TFSL 3D18A 4GBXB 1BQ5A 1IFRA 1OPOA 1CO1A 4PJCF 2ZJSL 4FI8A 4JL1A 5F89A 3GLDA 2B7DT 5D1XA 1E3XA 4AV4A 5IROD 3AGWA 1AMXA 4ODHL 4MA8H 4QRQA 2YPVH 4FJYA 2MQ3A 4EI5B 5GRJL 2LAAA 4M62H 2IWFA 1H3VA 4FGMA 4M61B 6PCYA 4W9HC 3QRFM 1BPVA 5IVOA 3FU3A 4XPGH 4N0YH 3NSJA 1A6TB 4G1MB 2XTJB 3BRFA 2AQ3A 3JBG7 1DBML 3MV7A 2KPWA 5KYWA 1QFHA 2A6JA 3EJYC 3FUFA 2GUOA 4B6ZA 2ICWI 1NC4A 2AQSA 5JDSA 3IGAA 3LMJH 3ZTJH 4ZG1A 1I8KB 1HS6A 4DH2A 2XQ0A 3OGOE 2YN3A 3ESPA 1D9KC 1JXFA 3LZOA 2Q5BA 4L8CB 5C07A 1IKFL 3LKNB 1RU9L 3MNMA 2EE3A 2VDLB 4TNVF 4V1DB 1S5HB 1VGEH 4W9JC 3FONA 3QEQB 5F0LB 1U8HB 2B59B 1ZLUK 1Z5YD 3KPLA 3GRWH 4PHZA 2Z91A 2W1NA 4I18B 2IOOA 2EICA 4NXKA 1T66C 4AVJA 1UATA 3GHEL 3TBVA 4NQDB 2X4RB 1S8DA 1WJ3A 4PJXA 3S9DB 3RNQB 1MVFA 4JFSA 4KXAA 3SBRA 1QQDA 1BZ7A 1PZCA 1PBYA 4IBTA 5CCGE 1K5NB 1LD9B 5CLWA 4KI1A 4QTFA 2VKXA 3FUNA 4ZO9A 1YDPB 4ZXBD 3X13B 1M71B 2QVKA 3CFDA 2AK1H 4NQVB 2NLJA 5IG7B 5C9KA 1UUNA 1GPOH 3CPUA 4OLYL 2XWCA 3R4DA 3VG0H 4ZTOL 3VGFA 4P46A 3MC0A 3LRMA 3P0YH 1JERA 3AXLA 3QUMA 4K3JH 2X4PB 4NQXB 4OJDH 5E4EC 2PXYC 3U7WH 1BIIB 1YQVL 2NY0D 2XZAL 4LXFA 2CLRA 5HI4C 4R26L 4IOIB 2Q87A 5AVXB 3BO8B 4KVPA 2QSQA 3ZMRA 1CFNA 2Y6SD 1LO0H 1M7XA 1ASPA 1O7DC 1U21A 1YJDC 1UM4H 3BVVA 4TL5A 5HHOE 4KV5E 3CSYA 1PLGH 4I5BA 4N0UB 3CSGA 4WU7A 3DDFA 5LDUA 1SYVA 4N2CA 1O0VA 2YARA 3FRPB 4AL8L 1S7UA 4PJIE 4NI3A 2C1OB 2JI3A 2E59A 5ID0B 1CPUA 4UIMA 4X8XA 4OI7A 3BP5B 1OF2A 3FB8B 3L3HA 4PJDE 4XO9A 5IMLB 3KVDD 1B2WH 4JN1L 3RGVB 2ZCLL 3MR9A 4S1QL 4A2HA 1EHKB 3LN5A 2WXLA 1P4IL 4DW2H 3B9KC 4FTVB 3Q8CA 4GXFA 2E7LA 3HBGA 4V2BA 5K1VA 1UASA 1XDTT 5IT2L 2ZCHH 1ZXQA 4QAMB 2ADGA 3V4LA 3D39E 5J7CC 3BAKA 3EBGA 4MNHB 4EUPA 2YKKA 4DT2A 4M6MH 2OW7A 3F62A 2WBJC 3VXRD 2ZE0A 1YRKA 3WUWA 1VA9A 5AAWC 4OZIE 5D7LD 4JKPH 2JI1A 1NCIA 3NH7L 4R84A 4HJSA 2BSBA 4ONGL 3O41B 1W16A 2CO6B 1NCBL 2WUBH 1KTDA 5F9WB 3TVMD 1MCOH 4MBOA 3DO4A 3D2UB 5KYXA 5ERWA 1RUMH 1E5BA 1HAWA 2Q2LA 4NQEB 4P5TD 3RL1B 5LNDA 3CFTA 4ZYKB 3VCLA 5H2BA 4NPKA 4GKZB 3KWWB 1JNJA 1N64L 3MLUH 3S3PA 3V8OA 4TSBL 3QEHB 5FO9B 2V2TB 3AADB 4ETQB 3US1A 1DL7L 4TM9A 5FW7A 1OV8A 1TG8A 1CQYA 1X9LA 4QDGA 2NY7H 1QACA 4XBPB 1CD0A 4KKRA 3BKYL 1NL0H 1KBVA 3KM2A 3A6CH 4GG8A 2YUZA 3B2VH 5J1TC 2JFCA 2O5YL 1ZT7A 2EEAA 4RQQB 5IFJA 2GIYA 1G9EA 4MCYA 5EIIA 1BQRA 4N2OA 4G8EA 1AQ8A 1CGVA 3S6CA 4P49A 5D4IA 4F2FA 3I9GL 5HI3D 4UZUA 3ZW3A 4Q97A 1KG0B 4JCWA 1KJ2H 1XO8A 2JIXD 3DMMA 4KDWA 5BUPA 3GJFA 2EDHA 3OKNA 2ADJB 4N25A 4WNJA 3ALWA 2OTPA 5J3HD 3V52L 1DUZB 2W59A 4HUUB 1WTGT 2Z8RA 2WNKA 5IMOB 5I6OA 3ZKNC 1CT8B 2H6PB 3DUUA 3FSWA 4ZNEA 3FNKA 1I1FA 3NP3A 1FJ1A 3CPLB 4QGTA 4JQIH 3NJGA 2CUAA 4OGAD 3N43B 1V3MA 1NBYA 1ND0A 4JM0A 1ETJA 3W0WE 2WQAA 5E1HB 1KUMA 1WBXB 3O4LA 1IEBA 4YXLH 2WOBA 2YMOA 2JJSA 3KEDA 4LCWB 1E40A 2IAND 2J44A 3D4GA 3A5VA 1JFHA 4YHOL 3DWTA 4HX1A 1SPDA 2KMWA 2ZKWA 4PGBA 5TQ0H 3P54A 3QXVA 4PRIA 4GO9A 4JVUA 3T0WA 4S2SB 3ML8A 1Q1JH 4U4BA 3DOHA 4M1DH 4FFZH 5LAPA 1I9RH 2WTRB 2CDGB 1CDCA 3GDCA 4NDMB 1UXWB 1KWKA 1ZA3A 5ISZE 2XWBA 1IE5A 4OF5A 2NY5C 4C59B 3HI1A 4QXTB 3BP7B 4ANKA 3WKML 4U0QB 2BOBA 4ZPVB 3R06B 3ZK0A 1QI5A 2RCSL 5F1OB 1TZIB 2AITA 2OR9H 1EJOL 2F7IA 3HHMA 4L1BA 3SPCA 2F9BT 4JFFD 1JF1A 4TVSa 2OSWA 3CVHH 3L9RB 1Q9KB 3VWKC 2ORBH 1R24B 2EXYD 3MLVL 2YAMA 1RJZA 2DQIH 2IBGA 2Z35A 1I7TA 3FQRB 2PYEE 3EJTA 3UFIA 5HDLA 2X53A 3VXUE 1RZIA 2OMWA 1FO0H 5LNGA 1NKOA 2OBGA 5LLIC 1WP6A 3MNVA 3I75A 3QRGL 2YPLD 1CR9L 2B5IC 4GT7A 3QQDA 3PIQA 4XNXL 2R15A 1CDUA 1KJVA 3Q2NA 5GQBA 5I71B 2EILB 4LLVB 4N8VG 3EJZD 4UQ2A 2F7QA 3B9AA 3LKRB 4JFYB 2YRBA 5AAWA 2J21A 4HLEA 5DHMC 5F7KC 3S8FB 2HT4D 4QRPB 4O2FB 4A63A 4PG2C 2GAZB 3ILDA 2ZPKH 2WXHA 3DX9A 1J0HA 4KNQA 1HH6B 2XKNB 1NDMB 4PJAA 4MYPA 3WLWD 1JGEA 2BRRH 1G7MB 4P5MA 3RWIB 1CFTB 1O5PA 4L1HA 3ZSTA 4CADB 1IBFA 4L3EB 5G4MA 1U3HB 4DK3A 2K78A 2IPTL 3PAVA 3GTNA 4LPUA 1MHCA 2R2CA 4K3GA 4PRHD 4YHNA 5LGHH 2K4WA 3N55A 4ZK8A 1EZVX 5E8OA 3NTCL 3QG6B 2N0MA 1ECYA 3ECQA 5BV7H 1I9EA 2I07A 5IQLA 1G7JB 3CVCA 3QO1B 5CZVH 2MHAB 4HWEH 5MEND 3C09C 4DEPC 4X2UA 1KLUA 2VL5A 3VSUA 4S1DC 3SYQA 4YWGH 2R9HD 3MBXL 5ICYA 5AOLA 2XYCA 5DT1H 1JHTA 1FGNL 3DVNA 1N7MH 2OMZB 2R23B 4XCFH 4GRWH 5D8JL 2O30A 3NCJL 5ESAB 4BFBD 3RDTA 1NDGB 2DDQH 2YKLL 4G8IA 4WUUE 4RZCB 1Z1WA 3N9GL 3DK2A 1HH9A 3L3GB 3FB5A 2DMKA 4PQXA 3L5XL 4WWKA 3W9DA 1AXTL 3OLIA 5D1QA 4NO5A 3GBMH 4J3SA 4OY9A 3BD5A 1HN1A 4K3HA 3P2DA 3QDJE 4PBVC 3S3SA 2E4FA 3S5ZA 3BQUD 3S4SG 2HSIA 4RX4A 3QUXC 4LLYB 2CR0A 4P3DA 1AS7A 2VXVL 4J2QA 3BVNA 2UXGA 2R2EB 3ZHKA 3L3IA 1KGJA 4NNYB 5DSCB 3IFLL 2PPFA 1U8IB 5DURD 3D3VA 4Q0XH 1SRDA 4KMQA 5FK9B 1NGZB 1T20A 2NW2A 4PJCE 4UYPA 4PJ8A 1Z9PA 3HG0A 1ED3A 2VQTA 3HNSH 5EUOF 2ADIA 3OJDB 2CO7B 1I3RB 2F74B 3W57A 5IVZB 1SY6L 4GQRA 4MB4A 3V0GA 4XN7A 3NJLA 5J3HC 1SMAA 3T1FB 4PV1C 2FX7L 2Z8VC 5GZNA 2NX5B 3G5ZB 3WEMA 2H5UA 4PYGA 3TYFA 4KPHH 3CQQA 2WO4A 3IPBA 5E9DD 4LESA 4OGAC 2ZF8A 4R5VA 3HHRB 1KDJA 4PRBA 2UZXA 3ZT5A 1G1CA 4LNRB 4YHPB 2QELA 3TA3B 5EOTA 1KIPB 3VFMB 3V0VA 4NZFA 5DVKA 3R1GH 3V4VH 4PWIA 2YFOA 6CGTA 3GS7A 1FFNB 2P52A 3M46A 2XV0A 1F86A 1JAEA 1WC7A 5BVPL 3ARFC 3SGJA 3SYAA 2FK9A 2OXGB 1ZANH 3H54A 4ONHA 4JNXA 5AVVB 5E08L 1OP9A 2ZUSA 4JPIB 4LEOA 4LSUH 3WEXA 2BS9A 4H26B 5FEBA 3TO2A 4XPHH 1TO5A 1Q9LB 5DTFA 3ZHDA 4F33A 2F5BH 2EVIA 1NFKA 4JFQB 2DI7A 2XXMB 2VZTA 2XXGA 4A39A 4OF7A 4BSWB 3ARDA 1F4WL 4WI7A 4Q9QL 2KUTA 1KEML 1UKTA 2DTMH 2WB1A 3EO9L 3MOBH 4HPOL 4KRPD 4DQAA 1BMZA 2J72A 2LLNA 1ZA6A 4JVWA 4HFUL 3G7TA 1F58L 4K3DL 2AV7A 3JSSA 4RMVA 5I0ZA 1BQLH 1UA3A 1DBAH 4PJEA 2P46B 4M5ZL 4F8PA 4ETYA 2XIDA 1NFIB 2VR5A 3APMA 3KJ4C 1DTUA 3RBGA 1RK0B 5ACMA 1M9SA 2MPVA 3WFZA 1FVDA 5BQ7B 2A6IB 4XP6L 3EJRA 2XTJE 3HLKA 4J3OF 3KG5A 5T1LD 2LTQC 1FYTD 3MLPA 1CICD 3PGFH 4JANB 2ZOKB 3ZIYA 4RISL 4ZD3H 4KTDL 1ORSA 4AG4H 3EFDL 4OLXL 3HUJA 3LXUX 4UTAL 5DWUL 1HILA 2IGFL 3EHBD 1HHIA 4P3WA 3IU3A 2AXGB 2IBBA 2BMKB 3H1ZA 1E8YA 4L9LC 4ELKB 1OTTD 5B1KA 3MV01 2BLFA 4TUOB 1TOXA 3L1EA 4LVNC 4XCYA 5JIIA 5FYKL 4PRPB 3D85D 5DD1L 3Q6GL 2HT4C 3GS4A 3RZCB 4YXHH 3QXWA 4YJZL 4KTYA 3MNWB 3QEQE 4LARH 3VXSE 1NIFA 2OKMA 1GCYA 3CFCH 5E8EB 3RIFK 4N6RB 1BXUA 2F8VA 2OI9B 3WLWC 5HHXH 5L7XH 1NC2A 1L0YA 3MAWA 3KCWA 3JTTA 4HJIA 3QUZD 3V5HA 4NQDE 2YD3A 5C09B 4C83B 2OQJB 2G9HB 2ZG2A 3VB8A 4PVNA 1ZHLB 4LVHB 4UANA 1KIQB 3TBSB 3HG1B 2VLJA 1AHWC 1VPOL 1ZV2A 5DWPA 5I1IL 4DPAX 2YA2A 2I5YL 3QPQD 1YUHA 3BJLA 4ODVH 1OQXA 1XZWA 4TPRH 2DLFH 4FL4C 5H94A 3P77A 4KKBD 4XX5A 2PF6A 3FYIB 3SOBL 1FVEB 1KTCA 3BSHA 3IK2A 2R9HC 4BFGA 3PP3H 5ID1A 3QGVA 3NIDF 4IOSD 1JZ4A 1EBAA 3HLAA 2R4SH 2Y36H 5C3IA 1VDGA 4N0UE 1VLXA 1CFVH 3L1OH 4J3VA 3S97C 4JFOB 1CQKA 3K6IA 2NXYB 3RL2A 3TL5A 4Q9RL 4NKDB 1Y6MR 3SHSA 5CJOH 5FF6A 1OAUH 3NIFB 1PG7X 3BWUC 1IM3D 3NMEA 4PRNA 2J6EH 3HPJA 2UXTA 3K2UL 4PGEB 4UU9B 4ANWA 4GI6A 2F8XC 1KTKE 1KXQE 2BSRA 4WK2B 3E8VA 1X7QB 2V7HB 3TV3L 3BVWA 1KTJA 4HK0B 4IBQA 4ODSH 2YOCA 1UH2A 4TQIA 3K6OA 3VO0A 2QFPA 1W0YT 3WBDA 3QQ4A 1WAAF 4AX3A 4OQ1A 3H9HA 1QFWI 3ZL2A 3FT4A 4AYGA 3BD4A 4QXVA 1HYSD 3P73B 5CD3A 2FJHA 4Y5XC 4DFIA 1AGCA 2IGTA 1WD9A 5JHAA 3KPQB 3H55A 4FQ1H 1ETZA 1FZMA 4X4ME 5E00B 2Q0ZX 1ZCRA 3PWVB 3N5AA 5IHZB 3HBZA 3NK4A 1GGUA 2CCVA 1G7QA 1QTSA 2GJJA 3HBQA 4UQ9A 4LLMA 4MMXB 1PD0A 4F7EA 2GUYA 5B38G 5I19H 3PNRB 2K9UA 4U1MA 4XO8A 2XIIA 1Q0XH 2I24N 2WC7A 1WPCA 3E8UL 3SBWA 4JR9H 4NM4H 3TOPA 2CR6A 4CSPA 1BVOA 1S9VB 4PG9A 4K7FA 1FE8L 5F21B 2IFFH 3B6SB 1AO7A 3H7LA 1J7VR 2IADB 3T0EE 1SVCP 5MEPA 1XCQB 4GINA 5E5LA 3GUTB 5L4MA 1BQHG 5FCSH 3UBHA 1JGDA 1OAQH 3BDYH 4OGZA 4NZUL 4BSJA 4AQAA 3ASNB 1HOCA 3O6MH 2BCKA 1SN5A 4D0BB 4WTZA 2R0ZL 4AXWA 1KT2A 2XJKA 3BWSA 1UXSA 1E4KC 3PF2A 4HKZA 4AM0Q 4FEIA 5DRWA 4EXPX 2VDLL 4XO5A 2OMYA 4QRSA 4WFED 5EZJA 5JPMA 3SQBA 4A6YA 4S11A 1D9KB 3CZUB 4KKCD 5GGVY 3VH8G 5F6IB 4KXBA 1PAZA 1ZIAA 3L3OC 4G80B 4IJTA 2OK0L 1NCDH 4KRPC 3VE0B 1OK0A 5BMFH 1EAPB 3N42F 3SDDA 5C2BH 5L2KD 2DWEB 2J20A 1MLBA 4LL4A 1SJMA 2AK4B 5F7BA 4N0FA 2BK8A 3A4DA 5L8LB 2XWZA 3PP3K 5I2IB 3U9UA 4R90L 4LCWE 3VFSA 4V33A 1J1XH 2WXPA 3GHBL 1PZAA 4MXQD 3KPOA 2E74C 1N6QL 2J57A 3OJMB 5EU6D 4JGJA 5CFAA 1CICC 3G6JA 3SQOL 1MCLA 4MQTB 4WW1B 4JPQA 5B1CA 4M93C 2F53B 3BPLC 1T1YB 1CE6B 3MYJB 4FXGA 5H35B 3TWCL 4E5XG 4Z7VA 2Y7QB 1FRGH 1X4ZA 4RDBA 3FU7A 1Q8MA 5E4EB 2PXYB 2VTFA 2H0PA 1AIZA 4HSCX 1RJYB 4JG0L 4JMXA 1KCSH 1QFWH 4XVUC 3U9PL 4D0DA 1JVLA 3Q0HA 3WJMA 4FNQA 1UEYA 2WLYA 5D7IB 1SJHA 5LGJA 3U6XS 4TQ8A 5C0IB 2V33A 1CCZA 1CDJA 3IMRA 4I3SL 3WHE1 4F7TB 3QUZC 5I0XA 4KUZH 5F1SA 1LILA 1W9XA 1UC6A 2EO7A 2X4OA 2HJFB 2J2ZA 4LBEA 1MNNA 1NLDL 3OKDA 4N2KA 5HY9B 2CGYA 2EE9A 3MV8B 4MCMA 3B9KB 3BISA 4BFRA 1PU0A 4I0CC 4QKXB 1IBBA 5D96C 1AD0B 2EIJB 3KBFA 4DUXA 5BVJB 2DQCL 1ZWIA 1V54B 3SDCD 4PWEA 4KKBC 1HVXA 3S34L 3FFCD 2CIKB 4Q58C 4QKTA 2DWTA 3OZLA 4F7MB 2WBJB 2YK1L 2C8NA 3BCFA 1XT5A 1P4BH 4TOYL 3WY4A 2E7HA 1QFWM 1TZGL 3RWGB 4BQ6A 3NZUA 1CXHA 1JP5A 4UM9A 4QRBA 5EC1A 3DIFB 4OLWH 4MZIA 1UHVA 3QDMD 5JLZB 3QG7H 3GB7A 4J4PC 1LWJA 1YG9A 1EXHA 5DJDB 3CSFA 1V7NL 4LCIL 4M43L 4HK3N 4L3EE 3T4AB 2Y2WA 3GJEA 4G8GE 1RKRA 1YEEL 2IO5A 5LG1A 4CBPA 2HWZL 3ZRSA 1R5VA 3QWOA 1V3LA 2GJ6A 2W95A 5SX4I 5BZDB 3UPCA 4G6JL 1FWXA 2VRKA 3BDXA 3WTVA 1K8IA 3C6LC 4KXCA 3CHOA 3WJLA 3ZTJG 2WHVA 4MKMA 3VD5A 1A3RH 5EUOE 1U92B 3QR1A 3EOAA 1I85C 1V05A 3HN8A 2DWDB 2R0KH 1UB6B 2PYFB 4L3CA 4LRNH 3ARUA 5DQDL 1AGDA 1ZJBA 3FH8A 3E6FB 1AGBA 3UGEA 1A3ZA 5I1EH 5F7AA 1AG0A 4NWTL 4KY1L 3VWJD 5M7QA 1AH1A 2IDSA 1A6TA 4G1MA 1M2VB 3FKUS 5LHDA 3N44F 5DMIH 3IMBA 1IVTA 3L95A 2ZKXA 5BO1H 3RVWC 43CAB 1CL7I 4N8PA 1HAUA 4K5NA 3UTZA 4MJ4A 5DD6B 2WKLA 3KPPB 1S6NA 4N90D 2MWCA 5GRZA 4XO4A 5EFIB 2YXVA 4BV1A 1C12A 3ULUH 4L8CA 3HFMH 2J1YA 2NY3D 5JHDD 4JFEA 2WQ8A 1A1NB 4K7PL 1M1XB 5A2IH 5JW4R 1HNYA 2OMTB 4IW4C 1KBWA 4FG0A 4ZMOA 2VW4A 3GSNB 1OCZB 1E27B 2PCFB 3MUY1 2Z9TA 5F8QC 3EG9B 1IMHC 1AI1H 4I18A 1A7QH 2ATPB 5F0JB 2F61A 1YEJH 1PGRB 2PR4L 1XSIA 2X4RA 1BD2D 3PWNB 5F9JA 3U79A 1Q0YL 4MHHI 4RBPK 43C9B 5IHHA 4QRUA 3HMWL 4NP4H 5IB5A 3VFWB 4FP8H 1A9BA 3UBFA 2X3BA 1U8JA 3S3DB 4U6XB 4WIQA 4D9QE 1J0ZA 1BF5A 3FCTA 2DYRB 2UV3A 4JFXA 2MNWA 4D3CH 3BZ4A 3V6BR 1A66A 5AB1A 4W9FC 2A9NL 1HCFX 1NJ9A 2DS4A 2G2NA 3RPBA 3TTYA 2ED8A 2H32B 4NQXA 2X4PA 1KENL 2V9TA 4YR6B 5EBGA 2N3JA 1P1ZA 2EYTB 4GRLD 1O6SA 3BO8A 3WS6C 1HINL 1BQKA 2Z64C 3KWUA 5J12C 2FX9H 4FLHA 2UY7B 1R3JB 1HKLL 4F7CB 2PO6C 4AVHA 2AC0A 1PKOA 3O0RH 1O75A 5KVDL 1SFHA 1CE1H 4ZW8A 1JK8A 5T1JA 3BVTA 3VWKB 1SBBA 4OVVA 5JOPE 3FB8A 2KLRA 1NMAH 2HP4A 4S1SL 4MXQC 2VLRE 4GQ9H 1IGIH 3RGVA 3E6HB 3SGDI 3EADA 4BH7B 1WLHA 3LQAL 5IQ7L 1N68A 4YHZL 5J0BA 4LP5A 5LAXA 5T1KA 4XMKL 4FTVA 4GAJL 4ZXBB 5J6SA 3OD3A 3DC0A 3O2VH 1NA8A 4CA4A 4NNXB 3N1GC 5K5YA 1FH5H 4WY7L 3M1OA 4BUQA 4MMZA 1GCFA 1DQLH 3L1FA 4OD2B 2NY0B 2OW6A 5L9DH 3RA7H 1ICTA 4IMKA 4PAZA 5C97A 2NT0A 2XBDA 4X50A 5KVFE 4EDXB 2GTZB 1HZKA 4YL4A 3BN9D 4AIZA 2VDRH 4J3XA 3WTXA 3A0OA 3ZDWA 3T0AA 1WG3A 3ULVD 4KDTA 1RD6A 3LNIA 4J8RA 4UT9A 1R0AL 4WI5A 4APQD 4F7PB 5F7FA 2D7NA 3D2UA 4N1HB 2VZ1A 4P3CH 4R5XA 4ABWA 4ZUSB 3O3BA 3NIDE 1CL7H 4TVPE 4YMPA 4NQEA 5HDRA 4K3EL 3RL1A 1HHHB 1AQKH 3TYGH 5JORB 1E4XI 2ZOLB 4GKZA 1M42A 4XC1L 1QBLH 1ORQA 3TXAA 1NBVH 3MFFB 4K8RC 4XB3A 4DSYA 3C09B 4DEPB 5E4IA 5DMKA 1TTGA 3SDCC 1KJMB 5C0GA 4HS6B 4Y4KA 3MSPA 5DD0H 3VXRB 4CJ0A 4RQQA 5F7DA 2JJWA 4H25B 1X5YA 5B8CC 4PRPE 5DJ8A 3KPRA 5D7LB 2FEEI 4M6OL 4LAJH 4KOCA 4NLHA 2H9GA 3EKCA 1TVHA 1KG0A 2XSKA 2WPGA 4RDQF 4E2OA 2J25A 1AQDB 2J43A 3BUQA 1TU2B 1MJ8H 2YN5A 4LK4A 1WAAE 3IKCB 3TVMB 2QADD 3VMNA 1ZDSA 5CUSH 2DIAA 1H3XA 4D9RD 2F6AA 4F3FA 3FAXA 4ODWB 1FFQA 5C09E 5IMOA 2K3HA 4P5TB 1FUNA 1CT8A 2H6PA 1MFCH 3U46B 1JHKH 1JV5B 2E9WA 1ZEAL 3ZZSA 3OKKB 1OM3L 3LB6D 3A6OA 4FCHA 3CPLA 3GBEA 1HSAB 3EDDA 1AJ7L 1IRAY 3STBA 5LVEA 3IS1X 3CIAA 4DKAA 1NGPL 3KJ6H 1OPGH 2VXTL 3G6DL 3ETBF 1WBXA 4NPYA 4AEIL 2JKNA 4MJJA 1Q72L 5C0AA 5GGTH 4EIZC 3CDFA 5FO7B 2FBRA 3IETB 4GYBA 5KAQG 4M8RA 3EOTL 5E6YA 3TNMA 4LLWB 2BW4A 5D2NE 1G9NC 1MLCB 2YGOA 1FG2B 1RUAL 5LG6A 1ADWA 4BZ2L 1JNNL 3SGDH 5BRZB 4XAWH 1SM3L 2L7UA 4L5FE 4LMQE 1WISA 2I60H 3MJ9L 3Q6FA 4K2UL 4Y4FD 3HUJF 3S5YA 1X9UA 3P3YA 3SJVD 3H56A 2QVFB 4JQVA 4JPSA 5E8DL 1QNIA 4ZS7L 2F1EA 2I32A 2ZXDA 3OZ9H 4JG9A 5K9KB 2CHNA 5I76B 3MRGB 1GZQA 1MCNA 4GQQA 3X14B 3OR6B 3T5WA 3A23A 4R7VA 2EIZB 4OGQC 1PS3A 3EFOB 1DVXA 3E7JA 3R06A 5EBWA 3V4PH 1GVIA 3LZPA 3MLSL 3F2LA 3BQVA 3INUH 3Q8FA 4BQ9A 5F71A 2Y5EA 5FWRA 3SO3C 1WTLA 2VQ1A 3ATAA 2ZX9A 2X4QA 3RY5A 1I7RB 2C9XA 3N1MC 2HTKD 2QQNL 4KFMA 1LVEA 5IJVA 1YECL 4G5ZL 3V0HA 5IM7B 1R24A 5IMMB 1T03L 1AFVH 1GH7A 4JZOA 1NCTA 1A4BA 3BLBA 2WM0A 1B2YA 3AQZA 2P45B 3GI8H 3V6OA 2AGJL 4JDTH 4E9LA 3KYNB 2YMXH 4HZAA 5SWQB 2P5WD 2LE9A 1IGML 4NN6B 1JZ3A 4NN7C 4J3BA 2CR3A 2QZQA 5JR1L 1T83A 1JPSL 2KPNA 3BAJA 4NEHB 3HI5L 5DI8A 2CKBA 4YS4A 1A4CA 1F1DA 4DIXA 1CGTA 3CDCA 4GRLC 4TNFA 4U6VL 4Z3JA 4XGZA 4MGXA 5FO8B 1P7HL 1DFBL 2E7DA 4X5QA 1EEQA 2VABB 1CTMA 1CJYA 2OTUB 2Y7OA 2Q7NA 4Y9FA 3KJ4B 4JFFB 4XOAA 1G7MA 1IIKA 3ISYA 5IVNA 1HSBA 4L4JA 4YSPA 2ROXA 4GSRA 5TK4A 1XH0A 3VD0A 2Y3AA 4HKBB 1C5DA 3CVBA 2P24B 1CYWA 2LTQB 4DEWA 3AT8A 3IDXH 2KL6A 1NAMA 3STLB 1N0LB 1Y1DA 3VSVA 1HZHH 3GMPA 1M7IA 1IZJA 4KHTL 1DO5A 5HHPB 1TJHL 3P0VH 3A47A 3G5YB 5IHUL 3CN3A 4NYLA 8CGTA 4ZOBA 4IRSD 4YFDB 4HJ0C 5GS2H 4U3HA 1WIOA 4KJPC 4LVNB 5KG9A 2OMZA 2R23A 3HZVA 1I8IA 4DGUA 4Y5VC 5T1MB 4O2CB 3QC6X 5T3ZH 4KH9A 1KLFB 2XZQH 4HJJL 1ZHKB 3DX4A 5B3NA 3P3RA 4RZCA 3ULVC 4PJFA 3BIKA 3HS0A 4DK5A 5IW1B 3FF8A 2G2RA 3IN2A 3U2IA 4APQC 3L3GA 3EYQC 3VW3L 1AR1D 4MDRA 5J9PB 2CDFA 3V6ZB 2X9YA 3FN9A 3NA9L 1IAKA 1MCRA 4HGKC 4PRHB 2MTPA 5CMAB 2ERJC 3JT0A 4TNWK 5FYLL 1MCQA 3S37L 2CQVA 4Z7OB 5FYJE 4LLYA 4OFQA 1IQDB 4NWUH 1W80A 5MENB 3KYAA 3SYCA 2WIMA 4JFPA 2R2EA 5DHYB 2B0SH 1KPRB 4AJYV 2PW2B 1TQCC 3RIAK 4B7LA 1CFMA 3FU6A 4OGXH 4AZ8B 4JDEA 1U8IA 3B7UX 5C0CD 2OZ4H 1E8WA 3DRTA 5FK9A 5T1DH 1J5HA 1T7ZA 1O7DE 2VMJA 2BVOB 2RQEA 3G04B 3FJTA 1CK0L 1OAJA 4QRRD 4WO4C 2WWMD 4D0CA 3WIAA 5F2FA 4B95C 3IS0X 2SEBB 2YD5A 1U91A 4L1TA 3VSTA 2DL2A 2CO7A 4WLCA 3MLXH 4XNQB 4JKNA 5DO8A 1A25A 1RHFA 1TTRA 3GIZL 3HC0B 4NZTL 1S46A 3BGFB 3IJSB 2YD1A 5DR5L 2QPFA 1S9WB 3T1FA 2FT8A 3O11B 4PRDA 5A3ID 3G5ZA 3BZDA 2CBPA 4BK5A 3H2QA 3MV8E 4TSAL 1W72A 2V4LA 4NQSB 3LB6C 4HAGA 4AWJC 1GTNA 1ZDQA 6TAAA 1F4YH 2FHFA 1UEMA 1Z5LA 4M56A 4GAFB 3AAZB 2FJGA 1KIPA 1NFDF 2CBTA 1U8QB 1BVLA 1J18A 3KS0J