4A7WA

Crystal structure of uridylate kinase from helicobacter pylori
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
235
structure length
226
Chain Sequence
KNKRVLVKFSGEALAGDNQFGIDIHVLDHIAKEIKSLVENDIEVGIVIGGGNIIIIRRTSGDYMGMLATVINAVAMQEALEHIGLDTRVQSAIEIKEICESYIYRKAIRHLEKGRVVIFGAGTGNPFFTTDTAATLRAIEIGSDLIIKATKVDGIYDKDPNKFKDAKKLDTLSYNDALIGDIEVMDDTAISLAKDNKLPIVVCNMFKKGNLLQVIKHQQGVFSMVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDYLATE KINASE
publication title Structures of Helicobacter Pylori Uridylate Kinase: Insight Into Release of the Product Udp
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transferase
total genus 77
structure length 226
sequence length 235
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4a7wA00
2X2WA 2JJ4A 3B8GA 3S6KA 4NDPA 3D41A 3TVIA 1GS5A 1GSJA 3K56A 3K4OA 1B7BA 3AB4A 4JZ8A 4NDQA 4KZTA 2J5VA 3AB2A 4AB7A 2W21A 2R98A 3EK6A 3QVHA 2J0XA 1OHBA 2R8VA 2J4JA 2BMUA 4F6TA 3D40A 4JZ7A 2BRXA 4Q1TA 2AKOA 2OGXB 2J4LA 2HMFA 2J4KA 4NDOB 3D2MA 4AXSA 2WE5A 4NDRB 4USJA 2BNDA 2CDQA 3C1MA 2BNEA 2E9YA 1Z9DA 1E19A 3LL5A 3L86A 3U6UA 2BNFA 3C20A 4A7WA 3ZZGA 4NDPB 2J0WA 3ZZHA 2IJ9A 3WWNA 2BUFA 2VA1A 2AP9A 3D2PA 1YBDA 4JZ9A 4NDQB 3C1NA 3EK5A 2WE4A 2WXBA 3WWMA 2A1FA 3NWYA 4OLCA 3ZZFA 3AAWA 2JI5A 2OGXA 4NDOA 3LL9A 3LKKA 3QUNA 3K4YA 3QVFA 4NDRA 2BRIA 2BTYA 3S6HA 2J5TA 3S6GA 2JJXA 3KZFA 3QURA 3K52A 1OH9A 3ZZIA 1OHAA 4I49A 2RD5A 3QUOA 4A7XA 4F6TB 2V5HA 3T7BA 3L76A 2V4YA
chains in the Genus database with same CATH superfamily
2X2WA 2JJ4A 3B8GA 3S6KA 4NDPA 3D41A 3TVIA 1GS5A 1GSJA 3K56A 3K4OA 1B7BA 3AB4A 4JZ8A 4NDQA 4KZTA 2J5VA 3AB2A 4AB7A 2W21A 2R98A 3EK6A 3QVHA 2J0XA 1OHBA 2R8VA 2J4JA 2BMUA 4F6TA 3D40A 4JZ7A 2BRXA 4Q1TA 2AKOA 2OGXB 2J4LA 2HMFA 2J4KA 4NDOB 3D2MA 4AXSA 2WE5A 4NDRB 4USJA 2BNDA 2CDQA 3C1MA 2BNEA 2E9YA 1Z9DA 1E19A 3LL5A 3L86A 3U6UA 2BNFA 3C20A 4A7WA 3ZZGA 4NDPB 2J0WA 3ZZHA 2IJ9A 3WWNA 2BUFA 2VA1A 2AP9A 3D2PA 1YBDA 4JZ9A 4NDQB 3C1NA 3EK5A 2WE4A 2WXBA 3WWMA 2A1FA 3NWYA 4OLCA 3ZZFA 3AAWA 2JI5A 2OGXA 4NDOA 3LL9A 3LKKA 3QUNA 3K4YA 3QVFA 4NDRA 2BRIA 2BTYA 3S6HA 2J5TA 3S6GA 2JJXA 3KZFA 3QURA 3K52A 1OH9A 3ZZIA 1OHAA 4I49A 2RD5A 3QUOA 4A7XA 4F6TB 2V5HA 3T7BA 3L76A 2V4YA
chains in the Genus database with same CATH topology
2X2WA 2JJ4A 3B8GA 3S6KA 4NDPA 3D41A 3TVIA 1GS5A 1GSJA 3K56A 3K4OA 1B7BA 3AB4A 4JZ8A 4NDQA 4KZTA 2J5VA 3AB2A 4AB7A 2W21A 2R98A 3EK6A 3QVHA 2J0XA 1OHBA 2R8VA 2J4JA 2BMUA 4F6TA 3D40A 4JZ7A 2BRXA 4Q1TA 2AKOA 2OGXB 2J4LA 2HMFA 2J4KA 4NDOB 3D2MA 4AXSA 2WE5A 4NDRB 4USJA 2BNDA 2CDQA 3C1MA 2BNEA 2E9YA 1Z9DA 1E19A 3LL5A 3L86A 3U6UA 2BNFA 3C20A 4A7WA 3ZZGA 4NDPB 2J0WA 3ZZHA 2IJ9A 3WWNA 2BUFA 2VA1A 2AP9A 3D2PA 1YBDA 4JZ9A 4NDQB 3C1NA 3EK5A 2WE4A 2WXBA 3WWMA 2A1FA 3NWYA 4OLCA 3ZZFA 3AAWA 2JI5A 2OGXA 4NDOA 3LL9A 3LKKA 3QUNA 3K4YA 3QVFA 4NDRA 2BRIA 2BTYA 3S6HA 2J5TA 3S6GA 2JJXA 3KZFA 3QURA 3K52A 1OH9A 3ZZIA 1OHAA 4I49A 2RD5A 3QUOA 4A7XA 4F6TB 2V5HA 3T7BA 3L76A 2V4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X2W A;  2JJ4 A;  3B8G A;  3S6K A;  4NDP A;  3D41 A;  3TVI A;  1GS5 A;  1GSJ A;  3K56 A;  3K4O A;  1B7B A;  3AB4 A;  4JZ8 A;  4NDQ A;  4KZT A;  2J5V A;  3AB2 A;  4AB7 A;  2W21 A;  2R98 A;  3EK6 A;  3QVH A;  2J0X A;  1OHB A;  2R8V A;  2J4J A;  2BMU A;  4F6T A;  3D40 A;  4JZ7 A;  2BRX A;  4Q1T A;  2AKO A;  2OGX B;  2J4L A;  2HMF A;  2J4K A;  4NDO B;  3D2M A;  4AXS A;  2WE5 A;  4NDR B;  4USJ A;  2BND A;  2CDQ A;  3C1M A;  2BNE A;  2E9Y A;  1Z9D A;  1E19 A;  3LL5 A;  3L86 A;  3U6U A;  2BNF A;  3C20 A;  4A7W A;  3ZZG A;  4NDP B;  2J0W A;  3ZZH A;  2IJ9 A;  3WWN A;  2BUF A;  2VA1 A;  2AP9 A;  3D2P A;  1YBD A;  4JZ9 A;  4NDQ B;  3C1N A;  3EK5 A;  2WE4 A;  2WXB A;  3WWM A;  2A1F A;  3NWY A;  4OLC A;  3ZZF A;  3AAW A;  2JI5 A;  2OGX A;  4NDO A;  3LL9 A;  3LKK A;  3QUN A;  3K4Y A;  3QVF A;  4NDR A;  2BRI A;  2BTY A;  3S6H A;  2J5T A;  3S6G A;  2JJX A;  3KZF A;  3QUR A;  3K52 A;  1OH9 A;  3ZZI A;  1OHA A;  4I49 A;  2RD5 A;  3QUO A;  4A7X A;  4F6T B;  2V5H A;  3T7B A;  3L76 A;  2V4Y A; 
#chains in the Genus database with same CATH topology
 2X2W A;  2JJ4 A;  3B8G A;  3S6K A;  4NDP A;  3D41 A;  3TVI A;  1GS5 A;  1GSJ A;  3K56 A;  3K4O A;  1B7B A;  3AB4 A;  4JZ8 A;  4NDQ A;  4KZT A;  2J5V A;  3AB2 A;  4AB7 A;  2W21 A;  2R98 A;  3EK6 A;  3QVH A;  2J0X A;  1OHB A;  2R8V A;  2J4J A;  2BMU A;  4F6T A;  3D40 A;  4JZ7 A;  2BRX A;  4Q1T A;  2AKO A;  2OGX B;  2J4L A;  2HMF A;  2J4K A;  4NDO B;  3D2M A;  4AXS A;  2WE5 A;  4NDR B;  4USJ A;  2BND A;  2CDQ A;  3C1M A;  2BNE A;  2E9Y A;  1Z9D A;  1E19 A;  3LL5 A;  3L86 A;  3U6U A;  2BNF A;  3C20 A;  4A7W A;  3ZZG A;  4NDP B;  2J0W A;  3ZZH A;  2IJ9 A;  3WWN A;  2BUF A;  2VA1 A;  2AP9 A;  3D2P A;  1YBD A;  4JZ9 A;  4NDQ B;  3C1N A;  3EK5 A;  2WE4 A;  2WXB A;  3WWM A;  2A1F A;  3NWY A;  4OLC A;  3ZZF A;  3AAW A;  2JI5 A;  2OGX A;  4NDO A;  3LL9 A;  3LKK A;  3QUN A;  3K4Y A;  3QVF A;  4NDR A;  2BRI A;  2BTY A;  3S6H A;  2J5T A;  3S6G A;  2JJX A;  3KZF A;  3QUR A;  3K52 A;  1OH9 A;  3ZZI A;  1OHA A;  4I49 A;  2RD5 A;  3QUO A;  4A7X A;  4F6T B;  2V5H A;  3T7B A;  3L76 A;  2V4Y A; 
#chains in the Genus database with same CATH homology
 2X2W A;  2JJ4 A;  3B8G A;  3S6K A;  4NDP A;  3D41 A;  3TVI A;  1GS5 A;  1GSJ A;  3K56 A;  3K4O A;  1B7B A;  3AB4 A;  4JZ8 A;  4NDQ A;  4KZT A;  2J5V A;  3AB2 A;  4AB7 A;  2W21 A;  2R98 A;  3EK6 A;  3QVH A;  2J0X A;  1OHB A;  2R8V A;  2J4J A;  2BMU A;  4F6T A;  3D40 A;  4JZ7 A;  2BRX A;  4Q1T A;  2AKO A;  2OGX B;  2J4L A;  2HMF A;  2J4K A;  4NDO B;  3D2M A;  4AXS A;  2WE5 A;  4NDR B;  4USJ A;  2BND A;  2CDQ A;  3C1M A;  2BNE A;  2E9Y A;  1Z9D A;  1E19 A;  3LL5 A;  3L86 A;  3U6U A;  2BNF A;  3C20 A;  4A7W A;  3ZZG A;  4NDP B;  2J0W A;  3ZZH A;  2IJ9 A;  3WWN A;  2BUF A;  2VA1 A;  2AP9 A;  3D2P A;  1YBD A;  4JZ9 A;  4NDQ B;  3C1N A;  3EK5 A;  2WE4 A;  2WXB A;  3WWM A;  2A1F A;  3NWY A;  4OLC A;  3ZZF A;  3AAW A;  2JI5 A;  2OGX A;  4NDO A;  3LL9 A;  3LKK A;  3QUN A;  3K4Y A;  3QVF A;  4NDR A;  2BRI A;  2BTY A;  3S6H A;  2J5T A;  3S6G A;  2JJX A;  3KZF A;  3QUR A;  3K52 A;  1OH9 A;  3ZZI A;  1OHA A;  4I49 A;  2RD5 A;  3QUO A;  4A7X A;  4F6T B;  2V5H A;  3T7B A;  3L76 A;  2V4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...