4A7WA

Crystal structure of uridylate kinase from helicobacter pylori
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
235
structure length
226
Chain Sequence
KNKRVLVKFSGEALAGDNQFGIDIHVLDHIAKEIKSLVENDIEVGIVIGGGNIIIIRRTSGDYMGMLATVINAVAMQEALEHIGLDTRVQSAIEIKEICESYIYRKAIRHLEKGRVVIFGAGTGNPFFTTDTAATLRAIEIGSDLIIKATKVDGIYDKDPNKFKDAKKLDTLSYNDALIGDIEVMDDTAISLAKDNKLPIVVCNMFKKGNLLQVIKHQQGVFSMVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Helicobacter Pylori Uridylate Kinase: Insight Into Release of the Product Udp
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transferase
molecule keywords URIDYLATE KINASE
total genus 77
structure length 226
sequence length 235
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4a7wA00
2OGXA 2V5HA 2BNFA 2V4YA 4NDRA 2JJXA 2J5TA 3C1MA 2OGXB 4AXSA 1GS5A 3EK6A 3ZZHA 2J0WA 4A7WA 3QVHA 2BRIA 2HMFA 4AB7A 2R98A 4F6TA 2BRXA 2W21A 3WWNA 3D41A 4I49A 4F6TB 3S6HA 2J4JA 3D2PA 3S6GA 1GSJA 2WE4A 2VA1A 2BTYA 3KZFA 3L86A 2R8VA 4JZ8A 3C1NA 2CDQA 3K56A 1OH9A 1E19A 3ZZIA 3K52A 3AB4A 3EK5A 2AKOA 4NDQB 3LL5A 2BUFA 2X2WA 2WE5A 1YBDA 3AB2A 3QVFA 2WXBA 1OHAA 4A7XA 3C20A 4NDPA 3QURA 2BNEA 3D2MA 3K4OA 2J4KA 4OLCA 2E9YA 3ZZFA 2JJ4A 4JZ9A 4KZTA 4NDPB 4Q1TA 4NDOB 3AAWA 3L76A 1OHBA 4JZ7A 4USJA 1B7BA 2RD5A 3TVIA 3WWMA 3S6KA 3QUNA 2J4LA 2J5VA 3ZZGA 3B8GA 2A1FA 4NDOA 3LKKA 1Z9DA 3D40A 2IJ9A 3QUOA 2BMUA 2JI5A 2AP9A 4NDQA 3U6UA 2J0XA 3NWYA 3LL9A 3K4YA 2BNDA 4NDRB 3T7BA
chains in the Genus database with same CATH superfamily
2OGXA 2V5HA 2BNFA 2V4YA 4NDRA 2JJXA 2J5TA 3C1MA 2OGXB 4AXSA 1GS5A 3EK6A 3ZZHA 2J0WA 4A7WA 3QVHA 2BRIA 2HMFA 4AB7A 2R98A 4F6TA 2BRXA 2W21A 3WWNA 3D41A 4I49A 4F6TB 3S6HA 2J4JA 3D2PA 3S6GA 1GSJA 2WE4A 2VA1A 2BTYA 3KZFA 3L86A 2R8VA 4JZ8A 3C1NA 2CDQA 3K56A 1OH9A 1E19A 3ZZIA 3K52A 3AB4A 3EK5A 2AKOA 4NDQB 3LL5A 2BUFA 2X2WA 2WE5A 1YBDA 3AB2A 3QVFA 2WXBA 1OHAA 4A7XA 3C20A 4NDPA 3QURA 2BNEA 3D2MA 3K4OA 2J4KA 4OLCA 2E9YA 3ZZFA 2JJ4A 4JZ9A 4KZTA 4NDPB 4Q1TA 4NDOB 3AAWA 3L76A 1OHBA 4JZ7A 4USJA 1B7BA 2RD5A 3TVIA 3WWMA 3S6KA 3QUNA 2J4LA 2J5VA 3ZZGA 3B8GA 2A1FA 4NDOA 3LKKA 1Z9DA 3D40A 2IJ9A 3QUOA 2BMUA 2JI5A 2AP9A 4NDQA 3U6UA 2J0XA 3NWYA 3LL9A 3K4YA 2BNDA 4NDRB 3T7BA
chains in the Genus database with same CATH topology
2OGXA 2V5HA 2BNFA 2V4YA 4NDRA 2JJXA 2J5TA 3C1MA 2OGXB 4AXSA 1GS5A 3EK6A 3ZZHA 2J0WA 4A7WA 3QVHA 2BRIA 2HMFA 4AB7A 2R98A 4F6TA 2BRXA 2W21A 3WWNA 3D41A 4I49A 4F6TB 3S6HA 2J4JA 3D2PA 3S6GA 1GSJA 2WE4A 2VA1A 2BTYA 3KZFA 3L86A 2R8VA 4JZ8A 3C1NA 2CDQA 3K56A 1OH9A 1E19A 3ZZIA 3K52A 3AB4A 3EK5A 2AKOA 4NDQB 3LL5A 2BUFA 2X2WA 2WE5A 1YBDA 3AB2A 3QVFA 2WXBA 1OHAA 4A7XA 3C20A 4NDPA 3QURA 2BNEA 3D2MA 3K4OA 2J4KA 4OLCA 2E9YA 3ZZFA 2JJ4A 4JZ9A 4KZTA 4NDPB 4Q1TA 4NDOB 3AAWA 3L76A 1OHBA 4JZ7A 4USJA 1B7BA 2RD5A 3TVIA 3WWMA 3S6KA 3QUNA 2J4LA 2J5VA 3ZZGA 3B8GA 2A1FA 4NDOA 3LKKA 1Z9DA 3D40A 2IJ9A 3QUOA 2BMUA 2JI5A 2AP9A 4NDQA 3U6UA 2J0XA 3NWYA 3LL9A 3K4YA 2BNDA 4NDRB 3T7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OGX A;  2V5H A;  2BNF A;  2V4Y A;  4NDR A;  2JJX A;  2J5T A;  3C1M A;  2OGX B;  4AXS A;  1GS5 A;  3EK6 A;  3ZZH A;  2J0W A;  4A7W A;  3QVH A;  2BRI A;  2HMF A;  4AB7 A;  2R98 A;  4F6T A;  2BRX A;  2W21 A;  3WWN A;  3D41 A;  4I49 A;  4F6T B;  3S6H A;  2J4J A;  3D2P A;  3S6G A;  1GSJ A;  2WE4 A;  2VA1 A;  2BTY A;  3KZF A;  3L86 A;  2R8V A;  4JZ8 A;  3C1N A;  2CDQ A;  3K56 A;  1OH9 A;  1E19 A;  3ZZI A;  3K52 A;  3AB4 A;  3EK5 A;  2AKO A;  4NDQ B;  3LL5 A;  2BUF A;  2X2W A;  2WE5 A;  1YBD A;  3AB2 A;  3QVF A;  2WXB A;  1OHA A;  4A7X A;  3C20 A;  4NDP A;  3QUR A;  2BNE A;  3D2M A;  3K4O A;  2J4K A;  4OLC A;  2E9Y A;  3ZZF A;  2JJ4 A;  4JZ9 A;  4KZT A;  4NDP B;  4Q1T A;  4NDO B;  3AAW A;  3L76 A;  1OHB A;  4JZ7 A;  4USJ A;  1B7B A;  2RD5 A;  3TVI A;  3WWM A;  3S6K A;  3QUN A;  2J4L A;  2J5V A;  3ZZG A;  3B8G A;  2A1F A;  4NDO A;  3LKK A;  1Z9D A;  3D40 A;  2IJ9 A;  3QUO A;  2BMU A;  2JI5 A;  2AP9 A;  4NDQ A;  3U6U A;  2J0X A;  3NWY A;  3LL9 A;  3K4Y A;  2BND A;  4NDR B;  3T7B A; 
#chains in the Genus database with same CATH topology
 2OGX A;  2V5H A;  2BNF A;  2V4Y A;  4NDR A;  2JJX A;  2J5T A;  3C1M A;  2OGX B;  4AXS A;  1GS5 A;  3EK6 A;  3ZZH A;  2J0W A;  4A7W A;  3QVH A;  2BRI A;  2HMF A;  4AB7 A;  2R98 A;  4F6T A;  2BRX A;  2W21 A;  3WWN A;  3D41 A;  4I49 A;  4F6T B;  3S6H A;  2J4J A;  3D2P A;  3S6G A;  1GSJ A;  2WE4 A;  2VA1 A;  2BTY A;  3KZF A;  3L86 A;  2R8V A;  4JZ8 A;  3C1N A;  2CDQ A;  3K56 A;  1OH9 A;  1E19 A;  3ZZI A;  3K52 A;  3AB4 A;  3EK5 A;  2AKO A;  4NDQ B;  3LL5 A;  2BUF A;  2X2W A;  2WE5 A;  1YBD A;  3AB2 A;  3QVF A;  2WXB A;  1OHA A;  4A7X A;  3C20 A;  4NDP A;  3QUR A;  2BNE A;  3D2M A;  3K4O A;  2J4K A;  4OLC A;  2E9Y A;  3ZZF A;  2JJ4 A;  4JZ9 A;  4KZT A;  4NDP B;  4Q1T A;  4NDO B;  3AAW A;  3L76 A;  1OHB A;  4JZ7 A;  4USJ A;  1B7B A;  2RD5 A;  3TVI A;  3WWM A;  3S6K A;  3QUN A;  2J4L A;  2J5V A;  3ZZG A;  3B8G A;  2A1F A;  4NDO A;  3LKK A;  1Z9D A;  3D40 A;  2IJ9 A;  3QUO A;  2BMU A;  2JI5 A;  2AP9 A;  4NDQ A;  3U6U A;  2J0X A;  3NWY A;  3LL9 A;  3K4Y A;  2BND A;  4NDR B;  3T7B A; 
#chains in the Genus database with same CATH homology
 2OGX A;  2V5H A;  2BNF A;  2V4Y A;  4NDR A;  2JJX A;  2J5T A;  3C1M A;  2OGX B;  4AXS A;  1GS5 A;  3EK6 A;  3ZZH A;  2J0W A;  4A7W A;  3QVH A;  2BRI A;  2HMF A;  4AB7 A;  2R98 A;  4F6T A;  2BRX A;  2W21 A;  3WWN A;  3D41 A;  4I49 A;  4F6T B;  3S6H A;  2J4J A;  3D2P A;  3S6G A;  1GSJ A;  2WE4 A;  2VA1 A;  2BTY A;  3KZF A;  3L86 A;  2R8V A;  4JZ8 A;  3C1N A;  2CDQ A;  3K56 A;  1OH9 A;  1E19 A;  3ZZI A;  3K52 A;  3AB4 A;  3EK5 A;  2AKO A;  4NDQ B;  3LL5 A;  2BUF A;  2X2W A;  2WE5 A;  1YBD A;  3AB2 A;  3QVF A;  2WXB A;  1OHA A;  4A7X A;  3C20 A;  4NDP A;  3QUR A;  2BNE A;  3D2M A;  3K4O A;  2J4K A;  4OLC A;  2E9Y A;  3ZZF A;  2JJ4 A;  4JZ9 A;  4KZT A;  4NDP B;  4Q1T A;  4NDO B;  3AAW A;  3L76 A;  1OHB A;  4JZ7 A;  4USJ A;  1B7B A;  2RD5 A;  3TVI A;  3WWM A;  3S6K A;  3QUN A;  2J4L A;  2J5V A;  3ZZG A;  3B8G A;  2A1F A;  4NDO A;  3LKK A;  1Z9D A;  3D40 A;  2IJ9 A;  3QUO A;  2BMU A;  2JI5 A;  2AP9 A;  4NDQ A;  3U6U A;  2J0X A;  3NWY A;  3LL9 A;  3K4Y A;  2BND A;  4NDR B;  3T7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...