4A7WA

Crystal structure of uridylate kinase from helicobacter pylori
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
235
structure length
226
Chain Sequence
b'KNKRVLVKFSGEALAGDNQFGIDIHVLDHIAKEIKSLVENDIEVGIVIGGGNIIIIRRTSGDYMGMLATVINAVAMQEALEHIGLDTRVQSAIEIKEICESYIYRKAIRHLEKGRVVIFGAGTGNPFFTTDTAATLRAIEIGSDLIIKATKVDGIYDKDPNKFKDAKKLDTLSYNDALIGDIEVMDDTAISLAKDNKLPIVVCNMFKKGNLLQVIKHQQGVFSMVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDYLATE KINASE
publication title Structures of Helicobacter Pylori Uridylate Kinase: Insight Into Release of the Product Udp
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transferase
total genus 77
structure length 226
sequence length 235
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4a7wA00
3K4YA 3T7BA 3WWMA 2HMFA 3C1NA 2IJ9A 3S6GA 2VA1A 2E9YA 3QUNA 3ZZFA 4NDRB 2W21A 3LL5A 3D40A 3L86A 1B7BA 2J5TA 2CDQA 2J5VA 4F6TA 4USJA 3LKKA 2BNFA 3S6HA 1Z9DA 4OLCA 3S6KA 2BNEA 2WE4A 1OH9A 2R98A 2RD5A 4NDQA 2JJXA 4NDPA 4A7XA 1YBDA 2JI5A 3EK6A 2AP9A 2J4JA 3C20A 3QVHA 2BNDA 2BMUA 4KZTA 3AB4A 3QVFA 3AB2A 3KZFA 2R8VA 1OHAA 2WXBA 2BUFA 4JZ7A 3WWNA 4F6TB 4A7WA 3C1MA 3AAWA 1OHBA 2A1FA 2JJ4A 2X2WA 3B8GA 3NWYA 1GS5A 4NDQB 4JZ9A 2BRIA 4NDOA 2J4KA 4AB7A 2V4YA 1E19A 3K4OA 2AKOA 2OGXA 3QUOA 3K52A 3U6UA 2V5HA 3D2MA 2BTYA 2J4LA 2BRXA 3QURA 4Q1TA 2WE5A 3TVIA 3ZZHA 3EK5A 3D2PA 3L76A 4NDRA 3ZZGA 2J0XA 4NDOB 4NDPB 3D41A 1GSJA 3LL9A 3K56A 4I49A 2OGXB 3ZZIA 4AXSA 4JZ8A 2J0WA
chains in the Genus database with same CATH superfamily
3K4YA 3T7BA 3WWMA 2HMFA 3C1NA 2IJ9A 3S6GA 2VA1A 2E9YA 3QUNA 3ZZFA 4NDRB 2W21A 3LL5A 3D40A 3L86A 1B7BA 2J5TA 2CDQA 2J5VA 4F6TA 4USJA 3LKKA 2BNFA 3S6HA 1Z9DA 4OLCA 3S6KA 2BNEA 2WE4A 1OH9A 2R98A 2RD5A 4NDQA 2JJXA 4NDPA 4A7XA 1YBDA 2JI5A 3EK6A 2AP9A 2J4JA 3C20A 3QVHA 2BNDA 2BMUA 4KZTA 3AB4A 3QVFA 3AB2A 3KZFA 2R8VA 1OHAA 2WXBA 2BUFA 4JZ7A 3WWNA 4F6TB 4A7WA 3C1MA 3AAWA 1OHBA 2A1FA 2JJ4A 2X2WA 3B8GA 3NWYA 1GS5A 4NDQB 4JZ9A 2BRIA 4NDOA 2J4KA 4AB7A 2V4YA 1E19A 3K4OA 2AKOA 2OGXA 3QUOA 3K52A 3U6UA 2V5HA 3D2MA 2BTYA 2J4LA 2BRXA 3QURA 4Q1TA 2WE5A 3TVIA 3ZZHA 3EK5A 3D2PA 3L76A 4NDRA 3ZZGA 2J0XA 4NDOB 4NDPB 3D41A 1GSJA 3LL9A 3K56A 4I49A 2OGXB 3ZZIA 4AXSA 4JZ8A 2J0WA
chains in the Genus database with same CATH topology
3K4YA 3T7BA 3WWMA 2HMFA 3C1NA 2IJ9A 3S6GA 2VA1A 2E9YA 3QUNA 3ZZFA 4NDRB 2W21A 3LL5A 3D40A 3L86A 1B7BA 2J5TA 2CDQA 2J5VA 4F6TA 4USJA 3LKKA 2BNFA 3S6HA 1Z9DA 4OLCA 3S6KA 2BNEA 2WE4A 1OH9A 2R98A 2RD5A 4NDQA 2JJXA 4NDPA 4A7XA 1YBDA 2JI5A 3EK6A 2AP9A 2J4JA 3C20A 3QVHA 2BNDA 2BMUA 4KZTA 3AB4A 3QVFA 3AB2A 3KZFA 2R8VA 1OHAA 2WXBA 2BUFA 4JZ7A 3WWNA 4F6TB 4A7WA 3C1MA 3AAWA 1OHBA 2A1FA 2JJ4A 2X2WA 3B8GA 3NWYA 1GS5A 4NDQB 4JZ9A 2BRIA 4NDOA 2J4KA 4AB7A 2V4YA 1E19A 3K4OA 2AKOA 2OGXA 3QUOA 3K52A 3U6UA 2V5HA 3D2MA 2BTYA 2J4LA 2BRXA 3QURA 4Q1TA 2WE5A 3TVIA 3ZZHA 3EK5A 3D2PA 3L76A 4NDRA 3ZZGA 2J0XA 4NDOB 4NDPB 3D41A 1GSJA 3LL9A 3K56A 4I49A 2OGXB 3ZZIA 4AXSA 4JZ8A 2J0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K4Y A;  3T7B A;  3WWM A;  2HMF A;  3C1N A;  2IJ9 A;  3S6G A;  2VA1 A;  2E9Y A;  3QUN A;  3ZZF A;  4NDR B;  2W21 A;  3LL5 A;  3D40 A;  3L86 A;  1B7B A;  2J5T A;  2CDQ A;  2J5V A;  4F6T A;  4USJ A;  3LKK A;  2BNF A;  3S6H A;  1Z9D A;  4OLC A;  3S6K A;  2BNE A;  2WE4 A;  1OH9 A;  2R98 A;  2RD5 A;  4NDQ A;  2JJX A;  4NDP A;  4A7X A;  1YBD A;  2JI5 A;  3EK6 A;  2AP9 A;  2J4J A;  3C20 A;  3QVH A;  2BND A;  2BMU A;  4KZT A;  3AB4 A;  3QVF A;  3AB2 A;  3KZF A;  2R8V A;  1OHA A;  2WXB A;  2BUF A;  4JZ7 A;  3WWN A;  4F6T B;  4A7W A;  3C1M A;  3AAW A;  1OHB A;  2A1F A;  2JJ4 A;  2X2W A;  3B8G A;  3NWY A;  1GS5 A;  4NDQ B;  4JZ9 A;  2BRI A;  4NDO A;  2J4K A;  4AB7 A;  2V4Y A;  1E19 A;  3K4O A;  2AKO A;  2OGX A;  3QUO A;  3K52 A;  3U6U A;  2V5H A;  3D2M A;  2BTY A;  2J4L A;  2BRX A;  3QUR A;  4Q1T A;  2WE5 A;  3TVI A;  3ZZH A;  3EK5 A;  3D2P A;  3L76 A;  4NDR A;  3ZZG A;  2J0X A;  4NDO B;  4NDP B;  3D41 A;  1GSJ A;  3LL9 A;  3K56 A;  4I49 A;  2OGX B;  3ZZI A;  4AXS A;  4JZ8 A;  2J0W A; 
#chains in the Genus database with same CATH topology
 3K4Y A;  3T7B A;  3WWM A;  2HMF A;  3C1N A;  2IJ9 A;  3S6G A;  2VA1 A;  2E9Y A;  3QUN A;  3ZZF A;  4NDR B;  2W21 A;  3LL5 A;  3D40 A;  3L86 A;  1B7B A;  2J5T A;  2CDQ A;  2J5V A;  4F6T A;  4USJ A;  3LKK A;  2BNF A;  3S6H A;  1Z9D A;  4OLC A;  3S6K A;  2BNE A;  2WE4 A;  1OH9 A;  2R98 A;  2RD5 A;  4NDQ A;  2JJX A;  4NDP A;  4A7X A;  1YBD A;  2JI5 A;  3EK6 A;  2AP9 A;  2J4J A;  3C20 A;  3QVH A;  2BND A;  2BMU A;  4KZT A;  3AB4 A;  3QVF A;  3AB2 A;  3KZF A;  2R8V A;  1OHA A;  2WXB A;  2BUF A;  4JZ7 A;  3WWN A;  4F6T B;  4A7W A;  3C1M A;  3AAW A;  1OHB A;  2A1F A;  2JJ4 A;  2X2W A;  3B8G A;  3NWY A;  1GS5 A;  4NDQ B;  4JZ9 A;  2BRI A;  4NDO A;  2J4K A;  4AB7 A;  2V4Y A;  1E19 A;  3K4O A;  2AKO A;  2OGX A;  3QUO A;  3K52 A;  3U6U A;  2V5H A;  3D2M A;  2BTY A;  2J4L A;  2BRX A;  3QUR A;  4Q1T A;  2WE5 A;  3TVI A;  3ZZH A;  3EK5 A;  3D2P A;  3L76 A;  4NDR A;  3ZZG A;  2J0X A;  4NDO B;  4NDP B;  3D41 A;  1GSJ A;  3LL9 A;  3K56 A;  4I49 A;  2OGX B;  3ZZI A;  4AXS A;  4JZ8 A;  2J0W A; 
#chains in the Genus database with same CATH homology
 3K4Y A;  3T7B A;  3WWM A;  2HMF A;  3C1N A;  2IJ9 A;  3S6G A;  2VA1 A;  2E9Y A;  3QUN A;  3ZZF A;  4NDR B;  2W21 A;  3LL5 A;  3D40 A;  3L86 A;  1B7B A;  2J5T A;  2CDQ A;  2J5V A;  4F6T A;  4USJ A;  3LKK A;  2BNF A;  3S6H A;  1Z9D A;  4OLC A;  3S6K A;  2BNE A;  2WE4 A;  1OH9 A;  2R98 A;  2RD5 A;  4NDQ A;  2JJX A;  4NDP A;  4A7X A;  1YBD A;  2JI5 A;  3EK6 A;  2AP9 A;  2J4J A;  3C20 A;  3QVH A;  2BND A;  2BMU A;  4KZT A;  3AB4 A;  3QVF A;  3AB2 A;  3KZF A;  2R8V A;  1OHA A;  2WXB A;  2BUF A;  4JZ7 A;  3WWN A;  4F6T B;  4A7W A;  3C1M A;  3AAW A;  1OHB A;  2A1F A;  2JJ4 A;  2X2W A;  3B8G A;  3NWY A;  1GS5 A;  4NDQ B;  4JZ9 A;  2BRI A;  4NDO A;  2J4K A;  4AB7 A;  2V4Y A;  1E19 A;  3K4O A;  2AKO A;  2OGX A;  3QUO A;  3K52 A;  3U6U A;  2V5H A;  3D2M A;  2BTY A;  2J4L A;  2BRX A;  3QUR A;  4Q1T A;  2WE5 A;  3TVI A;  3ZZH A;  3EK5 A;  3D2P A;  3L76 A;  4NDR A;  3ZZG A;  2J0X A;  4NDO B;  4NDP B;  3D41 A;  1GSJ A;  3LL9 A;  3K56 A;  4I49 A;  2OGX B;  3ZZI A;  4AXS A;  4JZ8 A;  2J0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...