4A7WA

Crystal structure of uridylate kinase from helicobacter pylori
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
235
structure length
226
Chain Sequence
KNKRVLVKFSGEALAGDNQFGIDIHVLDHIAKEIKSLVENDIEVGIVIGGGNIIIIRRTSGDYMGMLATVINAVAMQEALEHIGLDTRVQSAIEIKEICESYIYRKAIRHLEKGRVVIFGAGTGNPFFTTDTAATLRAIEIGSDLIIKATKVDGIYDKDPNKFKDAKKLDTLSYNDALIGDIEVMDDTAISLAKDNKLPIVVCNMFKKGNLLQVIKHQQGVFSMVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDYLATE KINASE
publication title Structures of Helicobacter Pylori Uridylate Kinase: Insight Into Release of the Product Udp
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transferase
total genus 77
structure length 226
sequence length 235
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4a7wA00
2WE4A 1B7BA 3L76A 2R8VA 2W21A 3TVIA 2JJ4A 3QUOA 3WWNA 3C20A 2BMUA 3AAWA 2WXBA 3ZZGA 4USJA 4A7XA 2BNEA 2J5VA 4I49A 2J0XA 2JI5A 2BTYA 2A1FA 3QVHA 3L86A 2V4YA 1E19A 3D2MA 4NDPA 3D41A 1GS5A 4AXSA 1OHAA 4NDPB 3D2PA 2CDQA 2J5TA 3WWMA 2X2WA 4KZTA 3QUNA 2BNDA 4NDOA 3KZFA 4Q1TA 3AB4A 3S6HA 4NDOB 3LL9A 3ZZIA 2WE5A 4F6TA 3EK5A 2BRXA 2AP9A 3AB2A 1GSJA 4F6TB 1OHBA 3S6KA 2J4JA 3D40A 4AB7A 3ZZFA 4JZ9A 3QURA 3EK6A 1Z9DA 3K4YA 3K52A 2BRIA 2BUFA 2E9YA 3QVFA 3ZZHA 4JZ7A 2J0WA 3C1NA 2IJ9A 3C1MA 3U6UA 4NDRA 2BNFA 4OLCA 4NDQA 3K56A 2V5HA 4NDRB 2J4KA 4NDQB 1YBDA 1OH9A 2JJXA 2VA1A 3LL5A 2AKOA 2OGXA 2RD5A 3T7BA 4A7WA 3LKKA 3K4OA 2OGXB 4JZ8A 3B8GA 3S6GA 2HMFA 2R98A 2J4LA 3NWYA
chains in the Genus database with same CATH superfamily
2WE4A 1B7BA 3L76A 2R8VA 2W21A 3TVIA 2JJ4A 3QUOA 3WWNA 3C20A 2BMUA 3AAWA 2WXBA 3ZZGA 4USJA 4A7XA 2BNEA 2J5VA 4I49A 2J0XA 2JI5A 2BTYA 2A1FA 3QVHA 3L86A 2V4YA 1E19A 3D2MA 4NDPA 3D41A 1GS5A 4AXSA 1OHAA 4NDPB 3D2PA 2CDQA 2J5TA 3WWMA 2X2WA 4KZTA 3QUNA 2BNDA 4NDOA 3KZFA 4Q1TA 3AB4A 3S6HA 4NDOB 3LL9A 3ZZIA 2WE5A 4F6TA 3EK5A 2BRXA 2AP9A 3AB2A 1GSJA 4F6TB 1OHBA 3S6KA 2J4JA 3D40A 4AB7A 3ZZFA 4JZ9A 3QURA 3EK6A 1Z9DA 3K4YA 3K52A 2BRIA 2BUFA 2E9YA 3QVFA 3ZZHA 4JZ7A 2J0WA 3C1NA 2IJ9A 3C1MA 3U6UA 4NDRA 2BNFA 4OLCA 4NDQA 3K56A 2V5HA 4NDRB 2J4KA 4NDQB 1YBDA 1OH9A 2JJXA 2VA1A 3LL5A 2AKOA 2OGXA 2RD5A 3T7BA 4A7WA 3LKKA 3K4OA 2OGXB 4JZ8A 3B8GA 3S6GA 2HMFA 2R98A 2J4LA 3NWYA
chains in the Genus database with same CATH topology
2WE4A 1B7BA 3L76A 2R8VA 2W21A 3TVIA 2JJ4A 3QUOA 3WWNA 3C20A 2BMUA 3AAWA 2WXBA 3ZZGA 4USJA 4A7XA 2BNEA 2J5VA 4I49A 2J0XA 2JI5A 2BTYA 2A1FA 3QVHA 3L86A 2V4YA 1E19A 3D2MA 4NDPA 3D41A 1GS5A 4AXSA 1OHAA 4NDPB 3D2PA 2CDQA 2J5TA 3WWMA 2X2WA 4KZTA 3QUNA 2BNDA 4NDOA 3KZFA 4Q1TA 3AB4A 3S6HA 4NDOB 3LL9A 3ZZIA 2WE5A 4F6TA 3EK5A 2BRXA 2AP9A 3AB2A 1GSJA 4F6TB 1OHBA 3S6KA 2J4JA 3D40A 4AB7A 3ZZFA 4JZ9A 3QURA 3EK6A 1Z9DA 3K4YA 3K52A 2BRIA 2BUFA 2E9YA 3QVFA 3ZZHA 4JZ7A 2J0WA 3C1NA 2IJ9A 3C1MA 3U6UA 4NDRA 2BNFA 4OLCA 4NDQA 3K56A 2V5HA 4NDRB 2J4KA 4NDQB 1YBDA 1OH9A 2JJXA 2VA1A 3LL5A 2AKOA 2OGXA 2RD5A 3T7BA 4A7WA 3LKKA 3K4OA 2OGXB 4JZ8A 3B8GA 3S6GA 2HMFA 2R98A 2J4LA 3NWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WE4 A;  1B7B A;  3L76 A;  2R8V A;  2W21 A;  3TVI A;  2JJ4 A;  3QUO A;  3WWN A;  3C20 A;  2BMU A;  3AAW A;  2WXB A;  3ZZG A;  4USJ A;  4A7X A;  2BNE A;  2J5V A;  4I49 A;  2J0X A;  2JI5 A;  2BTY A;  2A1F A;  3QVH A;  3L86 A;  2V4Y A;  1E19 A;  3D2M A;  4NDP A;  3D41 A;  1GS5 A;  4AXS A;  1OHA A;  4NDP B;  3D2P A;  2CDQ A;  2J5T A;  3WWM A;  2X2W A;  4KZT A;  3QUN A;  2BND A;  4NDO A;  3KZF A;  4Q1T A;  3AB4 A;  3S6H A;  4NDO B;  3LL9 A;  3ZZI A;  2WE5 A;  4F6T A;  3EK5 A;  2BRX A;  2AP9 A;  3AB2 A;  1GSJ A;  4F6T B;  1OHB A;  3S6K A;  2J4J A;  3D40 A;  4AB7 A;  3ZZF A;  4JZ9 A;  3QUR A;  3EK6 A;  1Z9D A;  3K4Y A;  3K52 A;  2BRI A;  2BUF A;  2E9Y A;  3QVF A;  3ZZH A;  4JZ7 A;  2J0W A;  3C1N A;  2IJ9 A;  3C1M A;  3U6U A;  4NDR A;  2BNF A;  4OLC A;  4NDQ A;  3K56 A;  2V5H A;  4NDR B;  2J4K A;  4NDQ B;  1YBD A;  1OH9 A;  2JJX A;  2VA1 A;  3LL5 A;  2AKO A;  2OGX A;  2RD5 A;  3T7B A;  4A7W A;  3LKK A;  3K4O A;  2OGX B;  4JZ8 A;  3B8G A;  3S6G A;  2HMF A;  2R98 A;  2J4L A;  3NWY A; 
#chains in the Genus database with same CATH topology
 2WE4 A;  1B7B A;  3L76 A;  2R8V A;  2W21 A;  3TVI A;  2JJ4 A;  3QUO A;  3WWN A;  3C20 A;  2BMU A;  3AAW A;  2WXB A;  3ZZG A;  4USJ A;  4A7X A;  2BNE A;  2J5V A;  4I49 A;  2J0X A;  2JI5 A;  2BTY A;  2A1F A;  3QVH A;  3L86 A;  2V4Y A;  1E19 A;  3D2M A;  4NDP A;  3D41 A;  1GS5 A;  4AXS A;  1OHA A;  4NDP B;  3D2P A;  2CDQ A;  2J5T A;  3WWM A;  2X2W A;  4KZT A;  3QUN A;  2BND A;  4NDO A;  3KZF A;  4Q1T A;  3AB4 A;  3S6H A;  4NDO B;  3LL9 A;  3ZZI A;  2WE5 A;  4F6T A;  3EK5 A;  2BRX A;  2AP9 A;  3AB2 A;  1GSJ A;  4F6T B;  1OHB A;  3S6K A;  2J4J A;  3D40 A;  4AB7 A;  3ZZF A;  4JZ9 A;  3QUR A;  3EK6 A;  1Z9D A;  3K4Y A;  3K52 A;  2BRI A;  2BUF A;  2E9Y A;  3QVF A;  3ZZH A;  4JZ7 A;  2J0W A;  3C1N A;  2IJ9 A;  3C1M A;  3U6U A;  4NDR A;  2BNF A;  4OLC A;  4NDQ A;  3K56 A;  2V5H A;  4NDR B;  2J4K A;  4NDQ B;  1YBD A;  1OH9 A;  2JJX A;  2VA1 A;  3LL5 A;  2AKO A;  2OGX A;  2RD5 A;  3T7B A;  4A7W A;  3LKK A;  3K4O A;  2OGX B;  4JZ8 A;  3B8G A;  3S6G A;  2HMF A;  2R98 A;  2J4L A;  3NWY A; 
#chains in the Genus database with same CATH homology
 2WE4 A;  1B7B A;  3L76 A;  2R8V A;  2W21 A;  3TVI A;  2JJ4 A;  3QUO A;  3WWN A;  3C20 A;  2BMU A;  3AAW A;  2WXB A;  3ZZG A;  4USJ A;  4A7X A;  2BNE A;  2J5V A;  4I49 A;  2J0X A;  2JI5 A;  2BTY A;  2A1F A;  3QVH A;  3L86 A;  2V4Y A;  1E19 A;  3D2M A;  4NDP A;  3D41 A;  1GS5 A;  4AXS A;  1OHA A;  4NDP B;  3D2P A;  2CDQ A;  2J5T A;  3WWM A;  2X2W A;  4KZT A;  3QUN A;  2BND A;  4NDO A;  3KZF A;  4Q1T A;  3AB4 A;  3S6H A;  4NDO B;  3LL9 A;  3ZZI A;  2WE5 A;  4F6T A;  3EK5 A;  2BRX A;  2AP9 A;  3AB2 A;  1GSJ A;  4F6T B;  1OHB A;  3S6K A;  2J4J A;  3D40 A;  4AB7 A;  3ZZF A;  4JZ9 A;  3QUR A;  3EK6 A;  1Z9D A;  3K4Y A;  3K52 A;  2BRI A;  2BUF A;  2E9Y A;  3QVF A;  3ZZH A;  4JZ7 A;  2J0W A;  3C1N A;  2IJ9 A;  3C1M A;  3U6U A;  4NDR A;  2BNF A;  4OLC A;  4NDQ A;  3K56 A;  2V5H A;  4NDR B;  2J4K A;  4NDQ B;  1YBD A;  1OH9 A;  2JJX A;  2VA1 A;  3LL5 A;  2AKO A;  2OGX A;  2RD5 A;  3T7B A;  4A7W A;  3LKK A;  3K4O A;  2OGX B;  4JZ8 A;  3B8G A;  3S6G A;  2HMF A;  2R98 A;  2J4L A;  3NWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...