4A8XC

Structure of the core asap complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
125
Chain Sequence
PEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFMDLKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-BINDING PROTEIN WITH SERINE-RICH DOMAIN 1
publication title The Structure of the Asap Core Complex Reveals the Existence of a Pinin-Containing Psap Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 29
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2011-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06487 SAP18 Sin3 associated polypeptide p18 (SAP18)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.550 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4a8xC00
4A6QA 2HDEA 4A8XC 4A90A
chains in the Genus database with same CATH superfamily
2HJ8A 3NS8A 1VZ8A 4ICVA 2MEKA 1OFFA 1ZW7A 1WX7A 3ZDMC 1HZ6A 1ZXHA 3WAMA 2X38A 4FJZA 2N1VA 2G9HD 1KRHA 2A4ZA 2LMCA 3RD2A 1TS5A 2KQSA 3EECA 3RNAC 3ZYYX 3DVGY 1P1AA 2UYZB 2IDYA 3AMZA 1F2RC 3PLUA 5CHWA 2M8SA 1I42A 1GC7A 2N9LA 3DWGC 1XLNA 3QK0A 2L52A 1WI0A 3KVFB 3TMPB 4W9EA 3VRBB 1TGZB 3A4RA 3DDCB 4D2KA 2DYMA 2D3AA 1IUEA 1J7CA 1OQYA 2FNJB 2L32A 2Z59B 2ASQA 4GDLB 4QAYA 2JQRB 3BYYB 3A4SC 1K50A 3AU4A 3HK0A 3PGEA 5AZFA 3Q3OC 3NRZA 1OQRA 4RF1A 2K22A 1AWDA 1IGDA 1F52A 2JRHA 4W9JA 2WXHA 4TQ0A 4N9F4 5LXIB 4JL9A 4KSLC 1I4PA 2BYVE 1EM7A 3ZJTA 3MJWA 3RPFC 3N1XC 2W3SA 2YLMA 4ZHOA 2JF5A 3DBSA 2OJRA 1FPYA 2QHOA 3L54A 3W1SA 3AEAB 1YN5A 2W54A 3M95A 2LXCA 2WQYB 1GB4A 1IBXB 1GAQB 5EE0A 2XN9C 5D3IB 2INPE 2GBMA 1BUIC 4ANWA 2J0KA 1V49A 4IDIA 1NYQA 1WXVA 1D5MC 4FULA 2XBBC 2IGGA 3P42A 5J18A 2WXNA 3ZIMA 4FHJA 2MJEA 4LNIA 4YWGG 1I4XA 1VR9A 2PLPA 2NPTB 5BMHA 1V1OA 2WDVB 3N20C 2KO3A 3MHZA 4NAWB 3VQIA 1QLBB 1SF0A 5FK9C 3H7PA 4E3CA 4M0WB 2BS4B 2O6VB 4UDUC 2JYTA 3JYUA 3ML8A 1PGXA 2JZPA 3U30A 4P6VF 3A9KB 3AECB 3P4QB 3BYTB 3OJ4B 4H2AA 3L13A 2R2QA 1WE6A 4W9CA 4LDTD 4C7YA 4IWOA 3D32A 1N6ZA 3ONSA 3CSFA 2KX0A 3U7DA 4HRSA 3GZNB 1F9JA 2BYFA 1CK1A 2N9EB 3JSVA 3V05A 4CO7A 3RMKC 1ACCA 4KGSA 4KVGB 3TCAA 4TMAB 4E71A 4EZKA 1WR1A 2RDGA 2Y3AA 2JWZA 2D2QA 1WZ3A 1T5XD 2NVUI 4IWPA 1FIQA 3Q8FA 3VUXA 2N7JA 3RN9C 2PPHA 3L16A 2PKOA 3RI7C 3NVZA 4W9HA 1SE9A 3L17A 1FNWA 4HLEA 2CHZA 1CZPA 4MDKE 4P1BC 1S1QB 1SIJA 4C7ZA 4PYUA 3PSEB 3SFDB 4MM3B 1HTQA 4EUTA 1B9RA 1PDXA 4K3BA 5GMVA 1GC6A 1LFDA 5CX3A 1Q5WB 4A3OA 3W1SC 1FXIA 3RZFA 4IUMB 1JW9D 1WGKA 4PS8A 3AE6B 3FC4A 1C79A 1DOXA 3CWIA 4BOZB 2BGFA 3ZXVA 1WMHB 4WJPA 4I6NB 3BK1A 3L4PA 1LXDA 2J4XA 1GOZA 2ZW1A 4GSWA 4FBJB 2K9XA 2PMVA 5IKCM 3AEFB 4PS7A 3QCAA 5CHFA 3I5JC 3NG0A 3UINB 3Q3MC 1IYFA 3I9V1 4KSKC 2WXFA 4ANVA 2MBOA 1C4AA 3R7RA 3MC9A 1UF0A 2RR9A 4PS3A 4HPMB 2J42A 1KM7A 2AL3A 4XWWA 2KNBA 4NJ7A 2KTRB 3DBHI 4KIKA 1SJHD 4NY0A 3B1LX 5EE3A 3DWMA 2W55A 4DK5A 3ZJUA 3H1UA 2I1JA 5AZGA 2BKRB 2MA9B 1RYJA 1OQQA 1SSNA 1E8WA 3TSSA 2KACA 2C7NB 4HPPA 2DYOA 5D7GA 1WR6E 4AP4C 2KQ7A 2HJ1A 2C9WB 4B0MA 2L3ZA 3B0AA 1YQ3B 3UGBB 2K25A 2DAJA 4RM9A 5LLIA 2G3QB 2LRWA 1WGDA 3BY4B 1FO4A 2RGFA 3NJTA 3SDLC 3ZRFA 4ANXA 5BO4B 5HG2A 1P98A 3U7ZA 1FXTB 5AEKB 4HDOA 1D6EC 3RNCC 3TIXA 5FR6A 4BZAA 4DQOC 3P4RB 4HPLB 2NBVB 5I4DA 4E74A 2RDHA 2MH7A 1YNTE 2DZIA 2QJLA 3PHWB 2N9PC 4YSXB 1E5WA 4GU2A 1NEKB 2Z0EB 5JHAA 2CS4A 3I63C 1EO6A 3NHEB 3WCQA 2JZZA 2RPQA 2IY1B 3KUDB 2KMAA 3EFUA 2WXKA 3W2DA 4P16A 2CJNA 4US8A 1FCCC 1P0RA 4GDLA 4G0NB 4BAXA 1I4GA 4GXBA 2IO3B 4AUQC 2K5PA 2GMIC 5FR3A 2OJWA 3L08A 5G5GA 1JALA 3H7PB 3CIRB 4A55A 2JY6A 4YSYB 1GNUA 1YOVB 2PE9A 2MQJA 1V86A 5AUKA 4EZJA 1GPXA 1P7EA 3C0RB 4DDGD 2REXA 3Q3FA 3QARA 4ZOHC 4ZRJA 1C77A 2WS3B 3MHSD 4KKIA 4A9AA 1WZ0A 1YQ4B 3IT6B 4ZRPA 2FE8A 3VFKA 2KLGA 1IBXA 1K53A 4ZHPA 2KDBA 4W9GA 2QEJC 4I6LB 2MBBB 2MRPA 2LVPA 3X23A 1XLOA 1LM8B 2FCQA 1STEA 1D5ZC 1WYGA 2BPSA 1WXMA 2L05A 1SIFA 4MH0E 5C1ZA 2NBUA 1TKGA 3N1ZC 2L7RA 2H89B 2BS3B 2NPTA 5DPWA 4HROA 2IO2B 4ARIA 4NAWA 3VXWA 1D5XC 2FIDA 4M0WA 2JX5A 2O6VA 3GP7A 5E6NA 3UI3A 4K7SA 3FAHA 4RNAA 4OVUA 2Y5BB 1E90A 3BVGA 3B9JA 3WANA 3RULA 1F1HA 2WXQA 1FXAA 3A9KA 1J7AA 3UQAA 4G11A 4YT0B 3KLSX 4USAA 2WXIA 3MTNB 4S17A 2VZKD 1FCLA 3AEDB 5HI1A 4OVZA 1E0ZA 1C1YB 1VLBA 2G45B 3NVVA 3R2IA 2L83A 2Z0DB 2M19A 2IO1B 2MLBA 3DVNU 2O2VB 3LDZE 2N0SB 3APCA 1C9FA 2WHIA 2L0FA 1NENB 5TR5A 1DGJA 3B2GA 3JVZX 2K8BA 3QA8A 2BKFA 4GLSC 1FM0D 3VR9B 2L8JA 1TZOA 2JU6X 4FADA 1UBQA 4RFBA 1E9MA 4BKSA 3VDZA 3W9CB 4MM3A 2DENB 2V9HA 1ZE3D 1R4NI 1EWCA 2V4IB 4MJSB 3MJ5A 3ENEA 3WAPA 4DHJD 2DX5B 5G55A 1V2YA 4AJYB 3ZKJC 5DPTA 2KTFA 4JQWC 3GOEA 4WIPA 2LUMA 3LJ3A 4MEMA 1U4AA 3U8ZA 1WXQA 1I7HA 2WXOA 2IGDA 2N4FA 5C3JB 4MGYE 2KD0A 4HJGE 3PO0A 2ZW0A 1RFAA 2N9KA 5GXGB 2YEPF 2WXLA 4JWUC 1Z2MA 3VH4B 3N32A 1IGCA 4AQ7A 4XX5A 1ZGUB 3C19A 4N6EB 2EELA 2Y5CA 1SGHA 2K6DB 2AEHA 4IC7B 3Q8CA 4WWMA 1V81A 2KTRA 3IHPC 2I38A 1DOYA 2J7QB 3P4SB 1NYRA 1Y8RC 2PIAA 1N61A 2EMSA 2BYTA 4LNOA 3OG5A 5EE9A 2GOWA 2DZKA 4OW0A 3PRMB 2SEBD 4NZLB 4RF0A 1YMHE 3K9PB 3WIMA 1TBEA 4O1NA 5JH5C 2WX0A 1FNVA 3SU8X 2MSED 5H8YE 3DBRI 3OLMD 2WU5B 3TBLD 1SEBD 3IFWB 2BYEA 4GIVA 3NVWA 1UGJA 1X1MA 1WJ6A 1EF5A 1IPGA 3TJPA 2JT4B 4LNKA 5HHDG 2JWUA 4YSZB 1AN8A 4EKUA 3ZJVA 2KWCA 2MBHA 3BWUD 3Q3JA 2IZVB 2L00B 1FFUA 2N9XA 1L4ZB 2KJHB 3ZW3A 4RGMA 2PJHA 2WDRB 2QILA 3PRZA 4FJVB 5HFYA 1MI0A 1YN4A 2DLBA 4M8NA 2MX2A 4YTNB 2VRRB 4IOIE 2V0GA 2INCC 4W9FA 5D3DA 3S2AA 1NI3A 4KX6B 5E6JA 3C8YA 4DDID 1JMLA 1HZ5A 2WXJA 1WXSA 3IAS1 1R7SA 2MHJA 2AYOB 4DHZB 1L7YA 1QOAA 1SXTA 3VVWB 1WRDB 1GB1A 4IM2A 3ZXRA 1I35A 3A1QB 3HIZA 4TQ1A 3DCGA 3R7QA 2XK5A 1WJNA 2BBCA 3UF8A 3J9CA 4KZ0A 4LDTB 3LXFA 4RGNA 2ACZB 2BQQA 3DHIC 4OHJA 2MJ3A 1YJIA 5LXHA 4WJOA 4ZRKA 1BT0A 2GBRA 4C00A 1TKYA 4BBNF 4S0RA 1E8ZA 1HXYD 5IN7A 4B9KA 2R2OA 3KUCB 4LNFA 3ZTCA 2UU7A 2NR2A 2DAFA 1XCQL 4AS1A 2AWTA 1KLUD 1WX8A 3QQ8B 3X0WA 2LVOA 1WGRA 5DPRA 3Q69A 1JWMD 2K3UA 3Q3NC 2WU2B 3QC8B 1WGYA 1CJEA 3ETRA 1WRIA 5D6JB 2ZZPB 3V62A 4B95A 4JX1C 2A5UA 4KV2A 4AJWA 2Y5PA 3K9OB 1CQVA 3KYDD 4F7ZA 2D11A 3H9DA 1FEHA 3R3MA 5E6OA 2KVZA 2WXRA 3RFZB 1F2RI 2M1MA 1HEZE 1YD8U 2N7EA 1WJUA 1F0ZA 4JLCA 2QC8A 5G5HA 1KOTA 3BK2A 1SE3A 1VZ7A 4URKA 2HTHA 2W9NA 3ZO5B 1UELA 3EGRA 4P7IA 2LGIA 2MP2B 4GDKB 2AQ1B 3ZRCA 4MH8A 4L2YA 4LLGM 2JPHA 3DBHB 1UZXB 3VAWA 4DBGA 3CF6E 1ZUD2 2GB1A 4Q2JA 2KVRA 2KANA 5EDSA 2AL6A 3PS6A 4WAAA 2GBJA 2O2VA 2KAJA 3N30A 4JPSA 2KZRA 1UWXA 4ZYNA 3APFA 2ZPYA 5G2NA 1WY8A 2BS2B 2LRUA 2WGSA 5J17A 4HKQA 4JGHB 3NVYA 1TTNA 3NZUA 2QSDA 4HXDA 2MJDA 2HDEA 3QHTA 3SD5A 4ZDVA 3A9JB 3W5UB 2IO0B 1FRDA 1HE8A 1ET9A 4ICUA 4RM8A 2HE7A 1EU3A 3UIPB 1JROA 4PT5A 4DHZE 3M62B 1WX9A 1KH0A 2UWQA 4MJSA 4II2B 1N62A 1WJ4A 1V97A 4K7WA 1P7FA 3BIID 3ZUNA 4NQLB 1RM6C 4BFRA 2VH2A 1EUVB 1E7VA 4G3XB 2LASA 1DOIA 1N60A 3TEXA 1MVKA 1PGAA 2XNAC 4N58A 5T8IA 2ONQA 2HTME 1A5RA 1RWSA 3AEEB 4HCNB 2V3NA 2LXAA 5DPSA 4LCDE 2QIEB 4NNJB 1AW7A 2MCNB 3AULA 1BMLC 2RDBC 3KWLA 1QQRA 3VHTC 3MC0B 3E56A 3N9YC 4CYEA 1J7BA 3V61A 3PLVA 2L1AA 1ENFA 2BW2A 2YEPB 3Q2AC 2CU1A 4IM3A 4WAFA 2GBKA 2KLCA 3ZNZB 5IAAC 3IBEA 2JVCA 1XD3B 1PYWD 1WGGA 1YJ1A 2PW9A 1V5OA 1TY2A 4J3OD 3H7SA 4FN2A 3DOWA 3JW0X 3VUWA 4LJOB 4B0EA 2XK5B 3R2TA 2KFJA 3B2FA 2I2YA 3WAOA 2CKHB 2E3TA 1L5PA 3B08A 4YTPB 4EE2A 4WQOB 4KZCA 4NAMA 4NPNA 3TL5A 2FUHB 3OWEB 5JZEB 2DZJA 1VCBA 3IXSA 1M4VA 2LUEA 4YXDB 1PGBA 1E7UA 1QOGA 2KMCA 2I1KA 4ACFA 1ZKHA 1MG4A 4BKGA 1I4QA 3IVFA 2RSUA 1YX6B 4HVBA 2ON8A 5MPOA 2ZPNA 1HQRD 1ROEA 3DBLB 5HKHA 2ICIA 5EE1A 3MP9A 3V60A 3L10B 1WIAA 3AXCA 3PZ7A 1SB3C 4EEWA 2VH1A 4FJYA 4WH4A 2W82A 1E10A 3TUOA 3PVLA 2KDIA 3A1QA 2LFIA 3ZNHB 4GN1A 4G50A 1L4DB 4A3PA 3AE3B 2ZJDA 1OGWA 3VUYA 4W9DA 4C80A 4M02A 2VZKB 2IBIB 3NOBA 4WWOA 3ZNGC 2OOBB 1KLVA 1L6UA 2GI9A 3V6CB 2D5GA 3SR6A 3ZGZA 1Z5SB 3AI5A 2KXJA 3DHGC 2FIFA 1T3QA 1R4NB 3ML9A 3WA0A 4FA6A 1WF9A 2ZNVB 4XWTA 1XEEA 3QWZB 4KKJA 2V3SA 2K8HA 1YX5B 1KF6B 2H88B 3ZQ4A 3AN1A 1ZDXA 1GG3A 3RNBC 2LGDA 2R61A 4US9A 2LGXA 2KC1A 2OHFA 2K39A 4M00A 4EZLA 4L23A 1ZOYB 2LWPA 1PUTA 1MFWA 1HA5A 4RGOS 4DWFA 2GRIA 1F77A 4M01A 4MSQB 2EKIA 2NMQA 4DHJB 1V8CA 1L0XB 2KX3A 1TZ1A 5TSSA 3AE7B 1JWAD 4RCOA 1V6EA 4NJCA 2SAKA 3P2BA 2WLBA 4HEA1 2MP2A 4GDKA 1UBIA 1WFYA 5J2RA 1LGRA 4ASWC 2FCMA 1RFKA 2KC2A 2NTSA 1E6EB 4II3B 3EFCA 2IYDB 3NZ3A 3FILA 4TKNA 3DVGX 2BT6A 1R4MI 1LO5D 1Q10A 2LVQA 3AEGB 4WWPA 3EHVA 1ZDVA 1XT9B 3AE4B 3I57A 2KYWA 3HRDD 3MFGA 1H8CA 1ZPSA 3DBRB 2RMMA 2Z8LA 4MELA 3GE8C 1T0YA 3AE9B 1D4BA 3DVNV 4GOCA 2TSSA 4DXFA 2LHDA 3A9JA 4XDDA 4K7UA 2KJ6A 3OAWA 1UGMA 2PE6B 3LYYA 1T0SC 2MBQA 2FAZA 1WH3A 2WDQB 2KDFB 1UUPA 3N1YC 3AE2B 3VRAB 3KW5B 3Q8EA 3Q14C 1H4RA 1WXAA 1QOFA 2M0AA 4LJPB 1FD6A 1ISNA 3AV8A 4FXCA 2JXXA 3U4EG 3IAM1 3TEYA 2DYBA 5IA7A 3ABVB 5L95C 1N5XA 3R66C 2J0MA 2ZCCA 2D07B 3H6NA 4NJ6A 2GLSA 3AE8B 2RPVA 3GS2A 1IP9A 1EU4A 2G4DB 4ANUA 1L2NA 1CMXB 1TJEA 1V9JA 1XQQA 2KK8A 5CHVC 4XGAB 1T0QC 1QOBA 4KGRA 2JZ3B 3SHQA 1VRAB 1FNUA 4ARCA 1TT5B 2PEAA 5LNK1 3ZVVA 4BVUC 3CMMB 2E6XA 3BVZA 1JRPA 4J6IA 1SJED 2PVGC 1TS2A 1NBFC 2PTLA 3HM6X 2WNMA 5JXVA 4BOSC 1SE2A 2CHXA 1T6BX 5AZHA 4DXGA 2WX1A 3ECIA 1MG8A 4R3DA 4HKZE 2GBNA 3KYCD 2FCNA 1J0GA 4F1SA 3FKYA 1OEYA 3NZSA 1AYFA 1UH6A 5H92C 3RT3B 4A90A 3GE3C 4B6WA 3BINA 3PRPB 4NQKE 2LGSA 3VR8B 4ZRQA 2K1FA 1ZXIA 2X8XX 4K1RB 2CR5A 3EUB2 2N7DA 4YL8A 3H8HA 2J52A 4TV3A 2D3CA 1C4PA 2DHZA 3HVDA 4HCPB 4LTUA 4HWIB 4HDQA 4OZCA 2O6VD 3KQ4A 2M17A 1ET6A 2EKEC 1P9DU 2G1EA 2WDTB 1J8CA 3EC8A 3RYTA 3QAQA 4IG7B 2WWZA 3LB8C 3NY5A 1VZ6A 3PZ8A 1RRBA 1N63A 2AQ2B 1JRUA 2J53A 5BMGA 1QF6A 5D2MB 1WM3A 4LNNA 3RUIB 1V1PB 2KHWB 4A6QA 2W3RA 4JE3B 1OTRB 4W9LA 3QX1A 5L83A 1GUAB 2Q5WD 2K6QA 1M94A 1YJJA 1NDDA 1J19A 2MBEA 2YVCA 1E8YA 3TEZA 4TSSA 3R8BA 5KHQA 4ZRIA 4DXAB 1TYGB 2IPKD 2BTEA 3E9SA 3VTVA 4IKGA 5IOIA 2EMTA 3GZNI 3U52E 2KDEB 2AQ3B 2KWVB 3I3TB 1T0RC 4ZYSA 2KFKB 4BKSD 1WE7A 4K81A 4WQMA 2V3PA 3FILB 4C4VB 2KKCA 1UD7A 2NS5A 2D3BA 4WURA 1JWSD 3T3NA 1TS3A 2BWFA 1TS4A 1L0YB 2JYEA 5KHOA 1KLGD 1TY0A 4CHKA 1K51A 2BB5A 4RMAA 1XLQA 2V1YA 1FFVA 5IP4D 2ZVOA 2WXPA 2G4SA 3O65B 1EF1A 2IGHA 4N59A 3PPAA 2NTTA 2CHWA 5CTRC 2MW5A 4WWNA 4HJKA 3O13A 2JUOA 4FLHA 4OZBA 3UQBA 1V5TA 5FKAC 3PTFC 4RGTA 3AE5B 3ZLZA 2M56B 1C78A 3GB1A 2LEKA 4MSMB 1NI2A 2DWQA 3NUHB 4KGTA 4YTMB 2C7MB 4XE0A 4TUUA 1OEYJ 2CU3A 3BVMA 2BF8B 4K3CA 3PREA 3TEWA 1KJTA 3IG3A 1TIFA 4P1CC 3BZDB 1UWMA 3SFEB 1XLPA 4MACA 2D10A 4GB9A 1ZP0B 5IO9A 4IW0A 3ZNID 1EWYC 3HHMA 1KFYB 2CJOA 3KWVA 3L0WB 4MGKE 1XF5L 1GJZA 2LZ6A 2NCNA 2KOXA 1C3TA 1L0VB 2FBWB 4MGZE 2BWES 4GGQA 3T3OA 2C5LC 4HK2A 2KDMA 1C76A 3DHHC 3W5VB 4X57B 1XXGA 1Y56A 3OJ3A 1DYQA 3VTUA 1P3QU 3AE1B 4XYCA 2WP9B 2DNFA 1NVID 4A8XC 3AU5A 2ZNVC 3DQVA 3UIOB 1QILA 1E7PB 2V4LA 4IWQA 2KJRA 1FMAD 3P4PB 1MHXA 4KDIC 5DCNA 3WALA 1JQ4A 3VH3B 1Q0WB 3VTWA 2C7HA 4BBNC 4XC2A 2ZEQA 4AWJA 2ZVNA 3DPDA 3ZTDA 5C2TB 5AUIA 4L1BA 2XEWA 3HM3A 3PHXB 3AB5A 2HD5B 1LQBA 2ZCBA 4MGIE 3HVZA 4IM0A 2B3AA 2LI5A 4XDCA 3PZDA 3RNEC 2KWUB 2INNE 1XO3A 2KQ4X 3AEBB 3P1MA 1JWUD 3IT4B 1K8RB 1ESFA 1WM2A 2NBWB 1VJKA 1I4RA 3M63B 3RZWC 2QMTA 1YQBA 2JRIB 1WGHA 4OVVA 3JSVB 3P63A 3T9LA 4WJNA 4WJQA 4JWSC 3RNFC 2INDC 4REZA 3ALBA 1L6VA 3PV1A 3QIJA 1MPEA 2LHEA 1QZEA 3NS1A 3RNGC 1TKEA 2FCSA 1E8XA 2PVOD 1RLFA 2KN4A 3APDA 3KUZA 1KTKA 1YN3A 2FUG1 1RAXA 2KN5A 3Q6BA 1K52A 2MWSB 3U2SC 2IY0B 1WSPA 3N3KB 4KDLB 2IJ0A 3URYA 1V80A 2LGYA 5C23A 2D3GA 3M3JA 2OEDA 1HTOA 4MT5A 4EOYA 1N5WA 3EA6A 3CSTA 4EFOA 3A33B 4PK1A 2B76B 4F8CB 2K8CA 2BB6A 2KWDA 1Q1OA 2N1WA 3DBLI 4PYZA 5BYRA 2WYQA 1SBBB 4W9IA 2WXGA 1WYWB 2AX5A 3RCZA 4AOFA 4W9KA 2L76A 1QKZA 3KH0A 1V1PA 2K0PA 2WXMA 3MC8A 3PT2B 4FHKA 4JIOU 1B1ZA 3V3XA 2L0TA 1R4MB 4GMVA 1MHHE 4ITKA 4C56C 3SEBA 3W1YA 1C4CA 1D3ZA 1PQSA 3Q8AA 1SE4A 3V6EB 3AM9A 1VDVA 3ZDTA 1YIWA 3HUIA 1XCTL 2JXTA 4I6PA 2QCZA 1QT9A 5BMIA 2RD0A 4RH6A 2LJ5A 4XZ4A 4KIKB 2BVCA 2LD9A 3QJZA 2JSVX 1JCKB 3T8MA 1WWTA 1VD2A 2KFKA 5E6PA 2C60A 1I4HA 5BYQA 1G6JA 1BXTA 2LJIA 4C4VA 5JHBA 4OZAA 1PFDA 5BYSA 3AH7A 2J0JA 1JWBD 2DBYA 4A20A 3Q8BA 1UNSA 4LK0M 2KT7A 2M4NA 1S3SG 5D94A 4M8MA 4BKTA 4CQNA 1WMHA 2DZMA 1A70A 1MJDA 2KMMA 2M0XA 1AARA 1FRRA 2QDFA
chains in the Genus database with same CATH topology
1V97A 3HVDA 1P7FA 3BIID 4LTUA 1VZ8A 2MEKA 1OFFA 1RM6C 4OZCA 1HZ6A 1ZXHA 2X38A 3KQ4A 1TKGA 1ET6A 2G9HD 1KRHA 2G1EA 2H89B 2BS3B 2LMCA 1TS5A 4HROA 1DOIA 3ZYYX 1N60A 4ARIA 3TEXA 1D5XC 1MVKA 1PGAA 2XNAC 3LB8C 4N58A 2IDYA 1VZ6A 3PZ8A 3AMZA 4M0WA 1F2RC 2JX5A 1N63A 2AQ2B 5T8IA 3GP7A 2ONQA 2N9LA 3UI3A 2J53A 2HTME 3DWGC 3FAHA 1XLNA 1RWSA 4RNAA 5BMGA 2L52A 3AEEB 3BVGA 3B9JA 1QF6A 2V3NA 3VRBB 2WXQA 1FXAA 1V1PB 1J7AA 4YT0B 3KLSX 4A6QA 4USAA 4D2KA 2DYMA 2W3RA 4JE3B 2WXIA 1IUEA 1J7CA 2VZKD 2QIEB 1AW7A 2L32A 2Q5WD 1YJJA 4GDLB 1FCLA 3AEDB 5HI1A 2JQRB 1BMLC 3KWLA 3BYYB 1QQRA 4OVZA 1E0ZA 3MC0B 3TEZA 1K50A 1VLBA 3E56A 3N9YC 4TSSA 3R8BA 3NRZA 3NVVA 1J7BA 3R2IA 2L83A 1OQRA 4RF1A 2K22A 2M19A 1AWDA 1TYGB 1IGDA 2L1AA 2IPKD 2BTEA 1ENFA 2BW2A 3E9SA 2YEPB 2N0SB 2WXHA 4IKGA 4TQ0A 4WAFA 1C9FA 1I4PA 3U52E 1NENB 2AQ3B 1DGJA 1EM7A 3ZJTA 3B2GA 3RPFC 4ZYSA 1PYWD 2W3SA 4ZHOA 2PW9A 1TY2A 4WQMA 2V3PA 3FILB 4GLSC 4J3OD 1FM0D 3VR9B 3W1SA 3AEAB 1YN5A 2W54A 1TZOA 2JU6X 4B0EA 2WQYB 1GB4A 1IBXB 4WURA 3R2TA 1GAQB 3B2FA 4RFBA 1JWSD 2XN9C 5D3IB 5EE0A 1E9MA 2INPE 3T3NA 2I2YA 1TS3A 3W9CB 2E3TA 1BUIC 1L5PA 1TS4A 1L0YB 2JYEA 1ZE3D 1KLGD 4IDIA 1NYQA 1EWCA 2V4IB 1TY0A 4YTPB 4EE2A 3MJ5A 1K51A 2BB5A 1D5MC 4NAMA 1XLQA 1FFVA 2IGGA 3P42A 4WIPA 3OWEB 2LUMA 2WXPA 3IXSA 1M4VA 2WXNA 4YXDB 1PGBA 1WXQA 1QOGA 2IGHA 2MJEA 4N59A 4YWGG 1I7HA 1I4XA 2NTTA 1VR9A 2PLPA 2WXOA 2IGDA 1I4QA 5BMHA 1V1OA 2WDVB 5C3JB 3MHZA 4NAWB 3VQIA 1QLBB 1SF0A 2ON8A 3O13A 5FK9C 5MPOA 4HJGE 3PO0A 2ZW0A 1HQRD 1ROEA 2BS4B 2ICIA 4UDUC 5EE1A 3MP9A 4OZBA 2N9KA 2JYTA 5FKAC 4RGTA 3AE5B 2M56B 1C78A 3GB1A 1PGXA 5GXGB 2LEKA 2JZPA 2YEPF 3PZ7A 1SB3C 4P6VF 2DWQA 2WXLA 3AECB 3P4QB 3NUHB 4KGTA 4JWUC 3BYTB 4YTMB 4XE0A 4H2AA 1IGCA 4WH4A 4AQ7A 2W82A 2CU3A 1E10A 3TUOA 4N6EB 2EELA 3BVMA 4C7YA 2Y5CA 2LFIA 3TEWA 1L4DB 4HRSA 3Q8CA 4WWMA 1CK1A 3AE3B 2I38A 3V05A 1DOYA 3P4SB 1ACCA 1NYRA 4KGSA 4C80A 3BZDB 2VZKB 1UWMA 3SFEB 1XLPA 2PIAA 4MACA 1N61A 4TMAB 2BYTA 1ZP0B 2RDGA 1L6UA 2GI9A 5EE9A 1EWYC 2Y3AA 1KFYB 2CJOA 3KWVA 1XF5L 4OW0A 1T5XD 2SEBD 2D5GA 4NZLB 4RF0A 1YMHE 3SR6A 3ZGZA 1FIQA 4O1NA 3Q8FA 1L0VB 2N7JA 2FBWB 1FNVA 1T3QA 5H8YE 2PKOA 3T3OA 2WU5B 3NVZA 1SEBD 4XWTA 1FNWA 1XEEA 2KDMA 4KKJA 1C76A 3NVWA 3W5VB 1UGJA 1XXGA 1CZPA 1Y56A 1KF6B 2H88B 1DYQA 3ZQ4A 3AN1A 1ZDXA 2R61A 1SIJA 4US9A 4C7ZA 3SFDB 4MM3B 5HHDG 2JWUA 4YSZB 3AE1B 1AN8A 3ZJVA 3BWUD 2OHFA 1PDXA 1B9RA 2WP9B 1NVID 4A8XC 1QILA 4L23A 1FXIA 1ZOYB 1E7PB 1PUTA 1FFUA 1FMAD 1L4ZB 3P4PB 1MHXA 1JW9D 1WGKA 4RGMA 2WDRB 1JQ4A 1HA5A 2QILA 4RGOS 5HFYA 2GRIA 1F77A 3AE6B 2EKIA 2NMQA 3FC4A 1MI0A 1YN4A 1C79A 1V8CA 1L0XB 2DLBA 1DOXA 3CWIA 4YTNB 4IOIE 5C2TB 2V0GA 5TSSA 3AE7B 1JWAD 4RCOA 5D3DA 4NJCA 2SAKA 5AUIA 3BK1A 4L1BA 1NI3A 3L4PA 4KX6B 2J4XA 1GOZA 2ZW1A 3C8YA 5E6JA 2WLBA 2K9XA 2PMVA 3AB5A 4HEA1 3AEFB 1JMLA 3HVZA 1HZ5A 2WXJA 1RFKA 2NTSA 4XDCA 1E6EB 3IAS1 2INNE 1XO3A 1R7SA 3I9V1 2KQ4X 2WXFA 3AEBB 1C4AA 1JWUD 3P1MA 3IT4B 1QOAA 1SXTA 1GB1A 3NZ3A 1ESFA 3FILA 1VJKA 1I4RA 2J42A 2BT6A 1LO5D 2QMTA 1Q10A 4TQ1A 4XWWA 3AEGB 1ZDVA 2BBCA 1SJHD 5EE3A 3P63A 3DWMA 3AE4B 2W55A 3J9CA 3I57A 3HRDD 3MFGA 3LXFA 1ZPSA 4JWSC 4RGNA 2ACZB 3ZJUA 2RMMA 2Z8LA 4OHJA 2MJ3A 4REZA 1YJIA 1L6VA 3AE9B 1MPEA 1RYJA 1D4BA 1OQQA 1TKYA 2LHEA 3NS1A 1SSNA 1TKEA 1HXYD 3TSSA 2TSSA 4DXFA 2KACA 2LHDA 2PVOD 2KN4A 2DYOA 5D7GA 4XDDA 1KTKA 1YN3A 2FUG1 3LYYA 4B0MA 1K52A 2WDQB 1XCQL 3U2SC 4AS1A 1UUPA 3AE2B 1KLUD 3VRAB 1WSPA 3Q8EA 1YQ3B 2IJ0A 3URYA 3Q69A 1FO4A 1JWMD 2K3UA 1QOFA 2M0AA 1FD6A 3AV8A 4FXCA 3U4EG 2WU2B 2OEDA 5HG2A 1CJEA 3ETRA 1WRIA 4MT5A 3IAM1 3U7ZA 1N5WA 3TEYA 1D6EC 3EA6A 4JX1C 4DQOC 3P4RB 2B76B 3ABVB 1N5XA 5I4DA 2Y5PA 2RDHA 2MH7A 1CQVA 1YNTE 2BB6A 2KWDA 2QJLA 1FEHA 4YSXB 5BYRA 1SBBB 2WXGA 1NEKB 2WXRA 3AE8B 3RFZB 1F2RI 2RPVA 3GS2A 2AX5A 1HEZE 3WCQA 1EU4A 1F0ZA 1QKZA 5G5HA 1TJEA 3BK2A 1V1PA 1SE3A 1VZ7A 2K0PA 2WXKA 2WXMA 3W2DA 4P16A 1QOBA 1B1ZA 1C4PA 2CJNA 3EGRA 3V3XA 2LGIA 4GDKB 2AQ1B 1MHHE 4US8A 1FCCC 4MH8A 4L2YA 4ITKA 4LLGM 4C56C 3SEBA 4KGRA 1I4GA 1VRAB 1C4CA 1FNUA 4ARCA 1ZUD2 3Q8AA 2GB1A 2K5PA 4Q2JA 5FR3A 1SE4A 5LNK1 3AM9A 1VDVA 2E6XA 3BVZA 3HUIA 1XCTL 5G5GA 1JALA 1JRPA 2JXTA 3CIRB 4A55A 4YSYB 1QT9A 5BMIA 1SJED 4RH6A 2PVGC 1TS2A 2PTLA 2KAJA 2WNMA 5JXVA 4JPSA 5AUKA 1GPXA 1UWXA 1SE2A 1P7EA 4DXGA 1T6BX 2JSVX 1JCKB 1WWTA 2BS2B 4R3DA 4ZOHC 1C77A 4HKQA 1I4HA 4HKZE 2WS3B 5BYQA 1BXTA 2LJIA 3NVYA 2QSDA 4KKIA 4A9AA 4OZAA 1YQ4B 2MJDA 3IT6B 1PFDA 2HDEA 4ZRPA 5BYSA 3AH7A 2FE8A 1JWBD 3W5UB 2DBYA 1IBXA 1AYFA 1FRDA 1ET9A 1K53A 5H92C 4ZHPA 3Q8BA 1UNSA 2QEJC 4LK0M 4A90A 1EU3A 1JROA 3VR8B 4ZRQA 4PT5A 1ZXIA 4CQNA 2KMMA 1A70A 1KH0A 3EUB2 1FRRA 1XLOA 3H8HA 1STEA 2J52A 1D5ZC 1N62A 1WYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A6Q A;  2HDE A;  4A8X C;  4A90 A; 
#chains in the Genus database with same CATH topology
 2HJ8 A;  3NS8 A;  1VZ8 A;  4ICV A;  2MEK A;  1OFF A;  1ZW7 A;  1WX7 A;  3ZDM C;  1HZ6 A;  1ZXH A;  3WAM A;  2X38 A;  4FJZ A;  2N1V A;  2G9H D;  1KRH A;  2A4Z A;  2LMC A;  3RD2 A;  1TS5 A;  2KQS A;  3EEC A;  3RNA C;  3ZYY X;  3DVG Y;  1P1A A;  2UYZ B;  2IDY A;  3AMZ A;  1F2R C;  3PLU A;  5CHW A;  2M8S A;  1I42 A;  1GC7 A;  2N9L A;  3DWG C;  1XLN A;  3QK0 A;  2L52 A;  1WI0 A;  3KVF B;  3TMP B;  4W9E A;  3VRB B;  1TGZ B;  3A4R A;  3DDC B;  4D2K A;  2DYM A;  2D3A A;  1IUE A;  1J7C A;  1OQY A;  2FNJ B;  2L32 A;  2Z59 B;  2ASQ A;  4GDL B;  4QAY A;  2JQR B;  3BYY B;  3A4S C;  1K50 A;  3AU4 A;  3HK0 A;  3PGE A;  5AZF A;  3Q3O C;  3NRZ A;  1OQR A;  4RF1 A;  2K22 A;  1AWD A;  1IGD A;  1F52 A;  2JRH A;  4W9J A;  2WXH A;  4TQ0 A;  4N9F 4;  5LXI B;  4JL9 A;  4KSL C;  1I4P A;  2BYV E;  1EM7 A;  3ZJT A;  3MJW A;  3RPF C;  3N1X C;  2W3S A;  2YLM A;  4ZHO A;  2JF5 A;  3DBS A;  2OJR A;  1FPY A;  2QHO A;  3L54 A;  3W1S A;  3AEA B;  1YN5 A;  2W54 A;  3M95 A;  2LXC A;  2WQY B;  1GB4 A;  1IBX B;  1GAQ B;  5EE0 A;  2XN9 C;  5D3I B;  2INP E;  2GBM A;  1BUI C;  4ANW A;  2J0K A;  1V49 A;  4IDI A;  1NYQ A;  1WXV A;  1D5M C;  4FUL A;  2XBB C;  2IGG A;  3P42 A;  5J18 A;  2WXN A;  3ZIM A;  4FHJ A;  2MJE A;  4LNI A;  4YWG G;  1I4X A;  1VR9 A;  2PLP A;  2NPT B;  5BMH A;  1V1O A;  2WDV B;  3N20 C;  2KO3 A;  3MHZ A;  4NAW B;  3VQI A;  1QLB B;  1SF0 A;  5FK9 C;  3H7P A;  4E3C A;  4M0W B;  2BS4 B;  2O6V B;  4UDU C;  2JYT A;  3JYU A;  3ML8 A;  1PGX A;  2JZP A;  3U30 A;  4P6V F;  3A9K B;  3AEC B;  3P4Q B;  3BYT B;  3OJ4 B;  4H2A A;  3L13 A;  2R2Q A;  1WE6 A;  4W9C A;  4LDT D;  4C7Y A;  4IWO A;  3D32 A;  1N6Z A;  3ONS A;  3CSF A;  2KX0 A;  3U7D A;  4HRS A;  3GZN B;  1F9J A;  2BYF A;  1CK1 A;  2N9E B;  3JSV A;  3V05 A;  4CO7 A;  3RMK C;  1ACC A;  4KGS A;  4KVG B;  3TCA A;  4TMA B;  4E71 A;  4EZK A;  1WR1 A;  2RDG A;  2Y3A A;  2JWZ A;  2D2Q A;  1WZ3 A;  1T5X D;  2NVU I;  4IWP A;  1FIQ A;  3Q8F A;  3VUX A;  2N7J A;  3RN9 C;  2PPH A;  3L16 A;  2PKO A;  3RI7 C;  3NVZ A;  4W9H A;  1SE9 A;  3L17 A;  1FNW A;  4HLE A;  2CHZ A;  1CZP A;  4MDK E;  4P1B C;  1S1Q B;  1SIJ A;  4C7Z A;  4PYU A;  3PSE B;  3SFD B;  4MM3 B;  1HTQ A;  4EUT A;  1B9R A;  1PDX A;  4K3B A;  5GMV A;  1GC6 A;  1LFD A;  5CX3 A;  1Q5W B;  4A3O A;  3W1S C;  1FXI A;  3RZF A;  4IUM B;  1JW9 D;  1WGK A;  4PS8 A;  3AE6 B;  3FC4 A;  1C79 A;  1DOX A;  3CWI A;  4BOZ B;  2BGF A;  3ZXV A;  1WMH B;  4WJP A;  4I6N B;  3BK1 A;  3L4P A;  1LXD A;  2J4X A;  1GOZ A;  2ZW1 A;  4GSW A;  4FBJ B;  2K9X A;  2PMV A;  5IKC M;  3AEF B;  4PS7 A;  3QCA A;  5CHF A;  3I5J C;  3NG0 A;  3UIN B;  3Q3M C;  1IYF A;  3I9V 1;  4KSK C;  2WXF A;  4ANV A;  2MBO A;  1C4A A;  3R7R A;  3MC9 A;  1UF0 A;  2RR9 A;  4PS3 A;  4HPM B;  2J42 A;  1KM7 A;  2AL3 A;  4XWW A;  2KNB A;  4NJ7 A;  2KTR B;  3DBH I;  4KIK A;  1SJH D;  4NY0 A;  3B1L X;  5EE3 A;  3DWM A;  2W55 A;  4DK5 A;  3ZJU A;  3H1U A;  2I1J A;  5AZG A;  2BKR B;  2MA9 B;  1RYJ A;  1OQQ A;  1SSN A;  1E8W A;  3TSS A;  2KAC A;  2C7N B;  4HPP A;  2DYO A;  5D7G A;  1WR6 E;  4AP4 C;  2KQ7 A;  2HJ1 A;  2C9W B;  4B0M A;  2L3Z A;  3B0A A;  1YQ3 B;  3UGB B;  2K25 A;  2DAJ A;  4RM9 A;  5LLI A;  2G3Q B;  2LRW A;  1WGD A;  3BY4 B;  1FO4 A;  2RGF A;  3NJT A;  3SDL C;  3ZRF A;  4ANX A;  5BO4 B;  5HG2 A;  1P98 A;  3U7Z A;  1FXT B;  5AEK B;  4HDO A;  1D6E C;  3RNC C;  3TIX A;  5FR6 A;  4BZA A;  4DQO C;  3P4R B;  4HPL B;  2NBV B;  5I4D A;  4E74 A;  2RDH A;  2MH7 A;  1YNT E;  2DZI A;  2QJL A;  3PHW B;  2N9P C;  4YSX B;  1E5W A;  4GU2 A;  1NEK B;  2Z0E B;  5JHA A;  2CS4 A;  3I63 C;  1EO6 A;  3NHE B;  3WCQ A;  2JZZ A;  2RPQ A;  2IY1 B;  3KUD B;  2KMA A;  3EFU A;  2WXK A;  3W2D A;  4P16 A;  2CJN A;  4US8 A;  1FCC C;  1P0R A;  4GDL A;  4G0N B;  4BAX A;  1I4G A;  4GXB A;  2IO3 B;  4AUQ C;  2K5P A;  2GMI C;  5FR3 A;  2OJW A;  3L08 A;  5G5G A;  1JAL A;  3H7P B;  3CIR B;  4A55 A;  2JY6 A;  4YSY B;  1GNU A;  1YOV B;  2PE9 A;  2MQJ A;  1V86 A;  5AUK A;  4EZJ A;  1GPX A;  1P7E A;  3C0R B;  4DDG D;  2REX A;  3Q3F A;  3QAR A;  4ZOH C;  4ZRJ A;  1C77 A;  2WS3 B;  3MHS D;  4KKI A;  4A9A A;  1WZ0 A;  1YQ4 B;  3IT6 B;  4ZRP A;  2FE8 A;  3VFK A;  2KLG A;  1IBX A;  1K53 A;  4ZHP A;  2KDB A;  4W9G A;  2QEJ C;  4I6L B;  2MBB B;  2MRP A;  2LVP A;  3X23 A;  1XLO A;  1LM8 B;  2FCQ A;  1STE A;  1D5Z C;  1WYG A;  2BPS A;  1WXM A;  2L05 A;  1SIF A;  4MH0 E;  5C1Z A;  2NBU A;  1TKG A;  3N1Z C;  2L7R A;  2H89 B;  2BS3 B;  2NPT A;  5DPW A;  4HRO A;  2IO2 B;  4ARI A;  4NAW A;  3VXW A;  1D5X C;  2FID A;  4M0W A;  2JX5 A;  2O6V A;  3GP7 A;  5E6N A;  3UI3 A;  4K7S A;  3FAH A;  4RNA A;  4OVU A;  2Y5B B;  1E90 A;  3BVG A;  3B9J A;  3WAN A;  3RUL A;  1F1H A;  2WXQ A;  1FXA A;  3A9K A;  1J7A A;  3UQA A;  4G11 A;  4YT0 B;  3KLS X;  4USA A;  2WXI A;  3MTN B;  4S17 A;  2VZK D;  1FCL A;  3AED B;  5HI1 A;  4OVZ A;  1E0Z A;  1C1Y B;  1VLB A;  2G45 B;  3NVV A;  3R2I A;  2L83 A;  2Z0D B;  2M19 A;  2IO1 B;  2MLB A;  3DVN U;  2O2V B;  3LDZ E;  2N0S B;  3APC A;  1C9F A;  2WHI A;  2L0F A;  1NEN B;  5TR5 A;  1DGJ A;  3B2G A;  3JVZ X;  2K8B A;  3QA8 A;  2BKF A;  4GLS C;  1FM0 D;  3VR9 B;  2L8J A;  1TZO A;  2JU6 X;  4FAD A;  1UBQ A;  4RFB A;  1E9M A;  4BKS A;  3VDZ A;  3W9C B;  4MM3 A;  2DEN B;  2V9H A;  1ZE3 D;  1R4N I;  1EWC A;  2V4I B;  4MJS B;  3MJ5 A;  3ENE A;  3WAP A;  4DHJ D;  2DX5 B;  5G55 A;  1V2Y A;  4AJY B;  3ZKJ C;  5DPT A;  2KTF A;  4JQW C;  3GOE A;  4WIP A;  2LUM A;  3LJ3 A;  4MEM A;  1U4A A;  3U8Z A;  1WXQ A;  1I7H A;  2WXO A;  2IGD A;  2N4F A;  5C3J B;  4MGY E;  2KD0 A;  4HJG E;  3PO0 A;  2ZW0 A;  1RFA A;  2N9K A;  5GXG B;  2YEP F;  2WXL A;  4JWU C;  1Z2M A;  3VH4 B;  3N32 A;  1IGC A;  4AQ7 A;  4XX5 A;  1ZGU B;  3C19 A;  4N6E B;  2EEL A;  2Y5C A;  1SGH A;  2K6D B;  2AEH A;  4IC7 B;  3Q8C A;  4WWM A;  1V81 A;  2KTR A;  3IHP C;  2I38 A;  1DOY A;  2J7Q B;  3P4S B;  1NYR A;  1Y8R C;  2PIA A;  1N61 A;  2EMS A;  2BYT A;  4LNO A;  3OG5 A;  5EE9 A;  2GOW A;  2DZK A;  4OW0 A;  3PRM B;  2SEB D;  4NZL B;  4RF0 A;  1YMH E;  3K9P B;  3WIM A;  1TBE A;  4O1N A;  5JH5 C;  2WX0 A;  1FNV A;  3SU8 X;  2MSE D;  5H8Y E;  3DBR I;  3OLM D;  2WU5 B;  3TBL D;  1SEB D;  3IFW B;  2BYE A;  4GIV A;  3NVW A;  1UGJ A;  1X1M A;  1WJ6 A;  1EF5 A;  1IPG A;  3TJP A;  2JT4 B;  4LNK A;  5HHD G;  2JWU A;  4YSZ B;  1AN8 A;  4EKU A;  3ZJV A;  2KWC A;  2MBH A;  3BWU D;  3Q3J A;  2IZV B;  2L00 B;  1FFU A;  2N9X A;  1L4Z B;  2KJH B;  3ZW3 A;  4RGM A;  2PJH A;  2WDR B;  2QIL A;  3PRZ A;  4FJV B;  5HFY A;  1MI0 A;  1YN4 A;  2DLB A;  4M8N A;  2MX2 A;  4YTN B;  2VRR B;  4IOI E;  2V0G A;  2INC C;  4W9F A;  5D3D A;  3S2A A;  1NI3 A;  4KX6 B;  5E6J A;  3C8Y A;  4DDI D;  1JML A;  1HZ5 A;  2WXJ A;  1WXS A;  3IAS 1;  1R7S A;  2MHJ A;  2AYO B;  4DHZ B;  1L7Y A;  1QOA A;  1SXT A;  3VVW B;  1WRD B;  1GB1 A;  4IM2 A;  3ZXR A;  1I35 A;  3A1Q B;  3HIZ A;  4TQ1 A;  3DCG A;  3R7Q A;  2XK5 A;  1WJN A;  2BBC A;  3UF8 A;  3J9C A;  4KZ0 A;  4LDT B;  3LXF A;  4RGN A;  2ACZ B;  2BQQ A;  3DHI C;  4OHJ A;  2MJ3 A;  1YJI A;  5LXH A;  4WJO A;  4ZRK A;  1BT0 A;  2GBR A;  4C00 A;  1TKY A;  4BBN F;  4S0R A;  1E8Z A;  1HXY D;  5IN7 A;  4B9K A;  2R2O A;  3KUC B;  4LNF A;  3ZTC A;  2UU7 A;  2NR2 A;  2DAF A;  1XCQ L;  4AS1 A;  2AWT A;  1KLU D;  1WX8 A;  3QQ8 B;  3X0W A;  2LVO A;  1WGR A;  5DPR A;  3Q69 A;  1JWM D;  2K3U A;  3Q3N C;  2WU2 B;  3QC8 B;  1WGY A;  1CJE A;  3ETR A;  1WRI A;  5D6J B;  2ZZP B;  3V62 A;  4B95 A;  4JX1 C;  2A5U A;  4KV2 A;  4AJW A;  2Y5P A;  3K9O B;  1CQV A;  3KYD D;  4F7Z A;  2D11 A;  3H9D A;  1FEH A;  3R3M A;  5E6O A;  2KVZ A;  2WXR A;  3RFZ B;  1F2R I;  2M1M A;  1HEZ E;  1YD8 U;  2N7E A;  1WJU A;  1F0Z A;  4JLC A;  2QC8 A;  5G5H A;  1KOT A;  3BK2 A;  1SE3 A;  1VZ7 A;  4URK A;  2HTH A;  2W9N A;  3ZO5 B;  1UEL A;  3EGR A;  4P7I A;  2LGI A;  2MP2 B;  4GDK B;  2AQ1 B;  3ZRC A;  4MH8 A;  4L2Y A;  4LLG M;  2JPH A;  3DBH B;  1UZX B;  3VAW A;  4DBG A;  3CF6 E;  1ZUD 2;  2GB1 A;  4Q2J A;  2KVR A;  2KAN A;  5EDS A;  2AL6 A;  3PS6 A;  4WAA A;  2GBJ A;  2O2V A;  2KAJ A;  3N30 A;  4JPS A;  2KZR A;  1UWX A;  4ZYN A;  3APF A;  2ZPY A;  5G2N A;  1WY8 A;  2BS2 B;  2LRU A;  2WGS A;  5J17 A;  4HKQ A;  4JGH B;  3NVY A;  1TTN A;  3NZU A;  2QSD A;  4HXD A;  2MJD A;  2HDE A;  3QHT A;  3SD5 A;  4ZDV A;  3A9J B;  3W5U B;  2IO0 B;  1FRD A;  1HE8 A;  1ET9 A;  4ICU A;  4RM8 A;  2HE7 A;  1EU3 A;  3UIP B;  1JRO A;  4PT5 A;  4DHZ E;  3M62 B;  1WX9 A;  1KH0 A;  2UWQ A;  4MJS A;  4II2 B;  1N62 A;  1WJ4 A;  1V97 A;  4K7W A;  1P7F A;  3BII D;  3ZUN A;  4NQL B;  1RM6 C;  4BFR A;  2VH2 A;  1EUV B;  1E7V A;  4G3X B;  2LAS A;  1DOI A;  1N60 A;  3TEX A;  1MVK A;  1PGA A;  2XNA C;  4N58 A;  5T8I A;  2ONQ A;  2HTM E;  1A5R A;  1RWS A;  3AEE B;  4HCN B;  2V3N A;  2LXA A;  5DPS A;  4LCD E;  2QIE B;  4NNJ B;  1AW7 A;  2MCN B;  3AUL A;  1BML C;  2RDB C;  3KWL A;  1QQR A;  3VHT C;  3MC0 B;  3E56 A;  3N9Y C;  4CYE A;  1J7B A;  3V61 A;  3PLV A;  2L1A A;  1ENF A;  2BW2 A;  2YEP B;  3Q2A C;  2CU1 A;  4IM3 A;  4WAF A;  2GBK A;  2KLC A;  3ZNZ B;  5IAA C;  3IBE A;  2JVC A;  1XD3 B;  1PYW D;  1WGG A;  1YJ1 A;  2PW9 A;  1V5O A;  1TY2 A;  4J3O D;  3H7S A;  4FN2 A;  3DOW A;  3JW0 X;  3VUW A;  4LJO B;  4B0E A;  2XK5 B;  3R2T A;  2KFJ A;  3B2F A;  2I2Y A;  3WAO A;  2CKH B;  2E3T A;  1L5P A;  3B08 A;  4YTP B;  4EE2 A;  4WQO B;  4KZC A;  4NAM A;  4NPN A;  3TL5 A;  2FUH B;  3OWE B;  5JZE B;  2DZJ A;  1VCB A;  3IXS A;  1M4V A;  2LUE A;  4YXD B;  1PGB A;  1E7U A;  1QOG A;  2KMC A;  2I1K A;  4ACF A;  1ZKH A;  1MG4 A;  4BKG A;  1I4Q A;  3IVF A;  2RSU A;  1YX6 B;  4HVB A;  2ON8 A;  5MPO A;  2ZPN A;  1HQR D;  1ROE A;  3DBL B;  5HKH A;  2ICI A;  5EE1 A;  3MP9 A;  3V60 A;  3L10 B;  1WIA A;  3AXC A;  3PZ7 A;  1SB3 C;  4EEW A;  2VH1 A;  4FJY A;  4WH4 A;  2W82 A;  1E10 A;  3TUO A;  3PVL A;  2KDI A;  3A1Q A;  2LFI A;  3ZNH B;  4GN1 A;  4G50 A;  1L4D B;  4A3P A;  3AE3 B;  2ZJD A;  1OGW A;  3VUY A;  4W9D A;  4C80 A;  4M02 A;  2VZK B;  2IBI B;  3NOB A;  4WWO A;  3ZNG C;  2OOB B;  1KLV A;  1L6U A;  2GI9 A;  3V6C B;  2D5G A;  3SR6 A;  3ZGZ A;  1Z5S B;  3AI5 A;  2KXJ A;  3DHG C;  2FIF A;  1T3Q A;  1R4N B;  3ML9 A;  3WA0 A;  4FA6 A;  1WF9 A;  2ZNV B;  4XWT A;  1XEE A;  3QWZ B;  4KKJ A;  2V3S A;  2K8H A;  1YX5 B;  1KF6 B;  2H88 B;  3ZQ4 A;  3AN1 A;  1ZDX A;  1GG3 A;  3RNB C;  2LGD A;  2R61 A;  4US9 A;  2LGX A;  2KC1 A;  2OHF A;  2K39 A;  4M00 A;  4EZL A;  4L23 A;  1ZOY B;  2LWP A;  1PUT A;  1MFW A;  1HA5 A;  4RGO S;  4DWF A;  2GRI A;  1F77 A;  4M01 A;  4MSQ B;  2EKI A;  2NMQ A;  4DHJ B;  1V8C A;  1L0X B;  2KX3 A;  1TZ1 A;  5TSS A;  3AE7 B;  1JWA D;  4RCO A;  1V6E A;  4NJC A;  2SAK A;  3P2B A;  2WLB A;  4HEA 1;  2MP2 A;  4GDK A;  1UBI A;  1WFY A;  5J2R A;  1LGR A;  4ASW C;  2FCM A;  1RFK A;  2KC2 A;  2NTS A;  1E6E B;  4II3 B;  3EFC A;  2IYD B;  3NZ3 A;  3FIL A;  4TKN A;  3DVG X;  2BT6 A;  1R4M I;  1LO5 D;  1Q10 A;  2LVQ A;  3AEG B;  4WWP A;  3EHV A;  1ZDV A;  1XT9 B;  3AE4 B;  3I57 A;  2KYW A;  3HRD D;  3MFG A;  1H8C A;  1ZPS A;  3DBR B;  2RMM A;  2Z8L A;  4MEL A;  3GE8 C;  1T0Y A;  3AE9 B;  1D4B A;  3DVN V;  4GOC A;  2TSS A;  4DXF A;  2LHD A;  3A9J A;  4XDD A;  4K7U A;  2KJ6 A;  3OAW A;  1UGM A;  2PE6 B;  3LYY A;  1T0S C;  2MBQ A;  2FAZ A;  1WH3 A;  2WDQ B;  2KDF B;  1UUP A;  3N1Y C;  3AE2 B;  3VRA B;  3KW5 B;  3Q8E A;  3Q14 C;  1H4R A;  1WXA A;  1QOF A;  2M0A A;  4LJP B;  1FD6 A;  1ISN A;  3AV8 A;  4FXC A;  2JXX A;  3U4E G;  3IAM 1;  3TEY A;  2DYB A;  5IA7 A;  3ABV B;  5L95 C;  1N5X A;  3R66 C;  2J0M A;  2ZCC A;  2D07 B;  3H6N A;  4NJ6 A;  2GLS A;  3AE8 B;  2RPV A;  3GS2 A;  1IP9 A;  1EU4 A;  2G4D B;  4ANU A;  1L2N A;  1CMX B;  1TJE A;  1V9J A;  1XQQ A;  2KK8 A;  5CHV C;  4XGA B;  1T0Q C;  1QOB A;  4KGR A;  2JZ3 B;  3SHQ A;  1VRA B;  1FNU A;  4ARC A;  1TT5 B;  2PEA A;  5LNK 1;  3ZVV A;  4BVU C;  3CMM B;  2E6X A;  3BVZ A;  1JRP A;  4J6I A;  1SJE D;  2PVG C;  1TS2 A;  1NBF C;  2PTL A;  3HM6 X;  2WNM A;  5JXV A;  4BOS C;  1SE2 A;  2CHX A;  1T6B X;  5AZH A;  4DXG A;  2WX1 A;  3ECI A;  1MG8 A;  4R3D A;  4HKZ E;  2GBN A;  3KYC D;  2FCN A;  1J0G A;  4F1S A;  3FKY A;  1OEY A;  3NZS A;  1AYF A;  1UH6 A;  5H92 C;  3RT3 B;  4A90 A;  3GE3 C;  4B6W A;  3BIN A;  3PRP B;  4NQK E;  2LGS A;  3VR8 B;  4ZRQ A;  2K1F A;  1ZXI A;  2X8X X;  4K1R B;  2CR5 A;  3EUB 2;  2N7D A;  4YL8 A;  3H8H A;  2J52 A;  4TV3 A;  2D3C A;  1C4P A;  2DHZ A;  3HVD A;  4HCP B;  4LTU A;  4HWI B;  4HDQ A;  4OZC A;  2O6V D;  3KQ4 A;  2M17 A;  1ET6 A;  2EKE C;  1P9D U;  2G1E A;  2WDT B;  1J8C A;  3EC8 A;  3RYT A;  3QAQ A;  4IG7 B;  2WWZ A;  3LB8 C;  3NY5 A;  1VZ6 A;  3PZ8 A;  1RRB A;  1N63 A;  2AQ2 B;  1JRU A;  2J53 A;  5BMG A;  1QF6 A;  5D2M B;  1WM3 A;  4LNN A;  3RUI B;  1V1P B;  2KHW B;  4A6Q A;  2W3R A;  4JE3 B;  1OTR B;  4W9L A;  3QX1 A;  5L83 A;  1GUA B;  2Q5W D;  2K6Q A;  1M94 A;  1YJJ A;  1NDD A;  1J19 A;  2MBE A;  2YVC A;  1E8Y A;  3TEZ A;  4TSS A;  3R8B A;  5KHQ A;  4ZRI A;  4DXA B;  1TYG B;  2IPK D;  2BTE A;  3E9S A;  3VTV A;  4IKG A;  5IOI A;  2EMT A;  3GZN I;  3U52 E;  2KDE B;  2AQ3 B;  2KWV B;  3I3T B;  1T0R C;  4ZYS A;  2KFK B;  4BKS D;  1WE7 A;  4K81 A;  4WQM A;  2V3P A;  3FIL B;  4C4V B;  2KKC A;  1UD7 A;  2NS5 A;  2D3B A;  4WUR A;  1JWS D;  3T3N A;  1TS3 A;  2BWF A;  1TS4 A;  1L0Y B;  2JYE A;  5KHO A;  1KLG D;  1TY0 A;  4CHK A;  1K51 A;  2BB5 A;  4RMA A;  1XLQ A;  2V1Y A;  1FFV A;  5IP4 D;  2ZVO A;  2WXP A;  2G4S A;  3O65 B;  1EF1 A;  2IGH A;  4N59 A;  3PPA A;  2NTT A;  2CHW A;  5CTR C;  2MW5 A;  4WWN A;  4HJK A;  3O13 A;  2JUO A;  4FLH A;  4OZB A;  3UQB A;  1V5T A;  5FKA C;  3PTF C;  4RGT A;  3AE5 B;  3ZLZ A;  2M56 B;  1C78 A;  3GB1 A;  2LEK A;  4MSM B;  1NI2 A;  2DWQ A;  3NUH B;  4KGT A;  4YTM B;  2C7M B;  4XE0 A;  4TUU A;  1OEY J;  2CU3 A;  3BVM A;  2BF8 B;  4K3C A;  3PRE A;  3TEW A;  1KJT A;  3IG3 A;  1TIF A;  4P1C C;  3BZD B;  1UWM A;  3SFE B;  1XLP A;  4MAC A;  2D10 A;  4GB9 A;  1ZP0 B;  5IO9 A;  4IW0 A;  3ZNI D;  1EWY C;  3HHM A;  1KFY B;  2CJO A;  3KWV A;  3L0W B;  4MGK E;  1XF5 L;  1GJZ A;  2LZ6 A;  2NCN A;  2KOX A;  1C3T A;  1L0V B;  2FBW B;  4MGZ E;  2BWE S;  4GGQ A;  3T3O A;  2C5L C;  4HK2 A;  2KDM A;  1C76 A;  3DHH C;  3W5V B;  4X57 B;  1XXG A;  1Y56 A;  3OJ3 A;  1DYQ A;  3VTU A;  1P3Q U;  3AE1 B;  4XYC A;  2WP9 B;  2DNF A;  1NVI D;  4A8X C;  3AU5 A;  2ZNV C;  3DQV A;  3UIO B;  1QIL A;  1E7P B;  2V4L A;  4IWQ A;  2KJR A;  1FMA D;  3P4P B;  1MHX A;  4KDI C;  5DCN A;  3WAL A;  1JQ4 A;  3VH3 B;  1Q0W B;  3VTW A;  2C7H A;  4BBN C;  4XC2 A;  2ZEQ A;  4AWJ A;  2ZVN A;  3DPD A;  3ZTD A;  5C2T B;  5AUI A;  4L1B A;  2XEW A;  3HM3 A;  3PHX B;  3AB5 A;  2HD5 B;  1LQB A;  2ZCB A;  4MGI E;  3HVZ A;  4IM0 A;  2B3A A;  2LI5 A;  4XDC A;  3PZD A;  3RNE C;  2KWU B;  2INN E;  1XO3 A;  2KQ4 X;  3AEB B;  3P1M A;  1JWU D;  3IT4 B;  1K8R B;  1ESF A;  1WM2 A;  2NBW B;  1VJK A;  1I4R A;  3M63 B;  3RZW C;  2QMT A;  1YQB A;  2JRI B;  1WGH A;  4OVV A;  3JSV B;  3P63 A;  3T9L A;  4WJN A;  4WJQ A;  4JWS C;  3RNF C;  2IND C;  4REZ A;  3ALB A;  1L6V A;  3PV1 A;  3QIJ A;  1MPE A;  2LHE A;  1QZE A;  3NS1 A;  3RNG C;  1TKE A;  2FCS A;  1E8X A;  2PVO D;  1RLF A;  2KN4 A;  3APD A;  3KUZ A;  1KTK A;  1YN3 A;  2FUG 1;  1RAX A;  2KN5 A;  3Q6B A;  1K52 A;  2MWS B;  3U2S C;  2IY0 B;  1WSP A;  3N3K B;  4KDL B;  2IJ0 A;  3URY A;  1V80 A;  2LGY A;  5C23 A;  2D3G A;  3M3J A;  2OED A;  1HTO A;  4MT5 A;  4EOY A;  1N5W A;  3EA6 A;  3CST A;  4EFO A;  3A33 B;  4PK1 A;  2B76 B;  4F8C B;  2K8C A;  2BB6 A;  2KWD A;  1Q1O A;  2N1W A;  3DBL I;  4PYZ A;  5BYR A;  2WYQ A;  1SBB B;  4W9I A;  2WXG A;  1WYW B;  2AX5 A;  3RCZ A;  4AOF A;  4W9K A;  2L76 A;  1QKZ A;  3KH0 A;  1V1P A;  2K0P A;  2WXM A;  3MC8 A;  3PT2 B;  4FHK A;  4JIO U;  1B1Z A;  3V3X A;  2L0T A;  1R4M B;  4GMV A;  1MHH E;  4ITK A;  4C56 C;  3SEB A;  3W1Y A;  1C4C A;  1D3Z A;  1PQS A;  3Q8A A;  1SE4 A;  3V6E B;  3AM9 A;  1VDV A;  3ZDT A;  1YIW A;  3HUI A;  1XCT L;  2JXT A;  4I6P A;  2QCZ A;  1QT9 A;  5BMI A;  2RD0 A;  4RH6 A;  2LJ5 A;  4XZ4 A;  4KIK B;  2BVC A;  2LD9 A;  3QJZ A;  2JSV X;  1JCK B;  3T8M A;  1WWT A;  1VD2 A;  2KFK A;  5E6P A;  2C60 A;  1I4H A;  5BYQ A;  1G6J A;  1BXT A;  2LJI A;  4C4V A;  5JHB A;  4OZA A;  1PFD A;  5BYS A;  3AH7 A;  2J0J A;  1JWB D;  2DBY A;  4A20 A;  3Q8B A;  1UNS A;  4LK0 M;  2KT7 A;  2M4N A;  1S3S G;  5D94 A;  4M8M A;  4BKT A;  4CQN A;  1WMH A;  2DZM A;  1A70 A;  1MJD A;  2KMM A;  2M0X A;  1AAR A;  1FRR A;  2QDF A; 
#chains in the Genus database with same CATH homology
 1V97 A;  3HVD A;  1P7F A;  3BII D;  4LTU A;  1VZ8 A;  2MEK A;  1OFF A;  1RM6 C;  4OZC A;  1HZ6 A;  1ZXH A;  2X38 A;  3KQ4 A;  1TKG A;  1ET6 A;  2G9H D;  1KRH A;  2G1E A;  2H89 B;  2BS3 B;  2LMC A;  1TS5 A;  4HRO A;  1DOI A;  3ZYY X;  1N60 A;  4ARI A;  3TEX A;  1D5X C;  1MVK A;  1PGA A;  2XNA C;  3LB8 C;  4N58 A;  2IDY A;  1VZ6 A;  3PZ8 A;  3AMZ A;  4M0W A;  1F2R C;  2JX5 A;  1N63 A;  2AQ2 B;  5T8I A;  3GP7 A;  2ONQ A;  2N9L A;  3UI3 A;  2J53 A;  2HTM E;  3DWG C;  3FAH A;  1XLN A;  1RWS A;  4RNA A;  5BMG A;  2L52 A;  3AEE B;  3BVG A;  3B9J A;  1QF6 A;  2V3N A;  3VRB B;  2WXQ A;  1FXA A;  1V1P B;  1J7A A;  4YT0 B;  3KLS X;  4A6Q A;  4USA A;  4D2K A;  2DYM A;  2W3R A;  4JE3 B;  2WXI A;  1IUE A;  1J7C A;  2VZK D;  2QIE B;  1AW7 A;  2L32 A;  2Q5W D;  1YJJ A;  4GDL B;  1FCL A;  3AED B;  5HI1 A;  2JQR B;  1BML C;  3KWL A;  3BYY B;  1QQR A;  4OVZ A;  1E0Z A;  3MC0 B;  3TEZ A;  1K50 A;  1VLB A;  3E56 A;  3N9Y C;  4TSS A;  3R8B A;  3NRZ A;  3NVV A;  1J7B A;  3R2I A;  2L83 A;  1OQR A;  4RF1 A;  2K22 A;  2M19 A;  1AWD A;  1TYG B;  1IGD A;  2L1A A;  2IPK D;  2BTE A;  1ENF A;  2BW2 A;  3E9S A;  2YEP B;  2N0S B;  2WXH A;  4IKG A;  4TQ0 A;  4WAF A;  1C9F A;  1I4P A;  3U52 E;  1NEN B;  2AQ3 B;  1DGJ A;  1EM7 A;  3ZJT A;  3B2G A;  3RPF C;  4ZYS A;  1PYW D;  2W3S A;  4ZHO A;  2PW9 A;  1TY2 A;  4WQM A;  2V3P A;  3FIL B;  4GLS C;  4J3O D;  1FM0 D;  3VR9 B;  3W1S A;  3AEA B;  1YN5 A;  2W54 A;  1TZO A;  2JU6 X;  4B0E A;  2WQY B;  1GB4 A;  1IBX B;  4WUR A;  3R2T A;  1GAQ B;  3B2F A;  4RFB A;  1JWS D;  2XN9 C;  5D3I B;  5EE0 A;  1E9M A;  2INP E;  3T3N A;  2I2Y A;  1TS3 A;  3W9C B;  2E3T A;  1BUI C;  1L5P A;  1TS4 A;  1L0Y B;  2JYE A;  1ZE3 D;  1KLG D;  4IDI A;  1NYQ A;  1EWC A;  2V4I B;  1TY0 A;  4YTP B;  4EE2 A;  3MJ5 A;  1K51 A;  2BB5 A;  1D5M C;  4NAM A;  1XLQ A;  1FFV A;  2IGG A;  3P42 A;  4WIP A;  3OWE B;  2LUM A;  2WXP A;  3IXS A;  1M4V A;  2WXN A;  4YXD B;  1PGB A;  1WXQ A;  1QOG A;  2IGH A;  2MJE A;  4N59 A;  4YWG G;  1I7H A;  1I4X A;  2NTT A;  1VR9 A;  2PLP A;  2WXO A;  2IGD A;  1I4Q A;  5BMH A;  1V1O A;  2WDV B;  5C3J B;  3MHZ A;  4NAW B;  3VQI A;  1QLB B;  1SF0 A;  2ON8 A;  3O13 A;  5FK9 C;  5MPO A;  4HJG E;  3PO0 A;  2ZW0 A;  1HQR D;  1ROE A;  2BS4 B;  2ICI A;  4UDU C;  5EE1 A;  3MP9 A;  4OZB A;  2N9K A;  2JYT A;  5FKA C;  4RGT A;  3AE5 B;  2M56 B;  1C78 A;  3GB1 A;  1PGX A;  5GXG B;  2LEK A;  2JZP A;  2YEP F;  3PZ7 A;  1SB3 C;  4P6V F;  2DWQ A;  2WXL A;  3AEC B;  3P4Q B;  3NUH B;  4KGT A;  4JWU C;  3BYT B;  4YTM B;  4XE0 A;  4H2A A;  1IGC A;  4WH4 A;  4AQ7 A;  2W82 A;  2CU3 A;  1E10 A;  3TUO A;  4N6E B;  2EEL A;  3BVM A;  4C7Y A;  2Y5C A;  2LFI A;  3TEW A;  1L4D B;  4HRS A;  3Q8C A;  4WWM A;  1CK1 A;  3AE3 B;  2I38 A;  3V05 A;  1DOY A;  3P4S B;  1ACC A;  1NYR A;  4KGS A;  4C80 A;  3BZD B;  2VZK B;  1UWM A;  3SFE B;  1XLP A;  2PIA A;  4MAC A;  1N61 A;  4TMA B;  2BYT A;  1ZP0 B;  2RDG A;  1L6U A;  2GI9 A;  5EE9 A;  1EWY C;  2Y3A A;  1KFY B;  2CJO A;  3KWV A;  1XF5 L;  4OW0 A;  1T5X D;  2SEB D;  2D5G A;  4NZL B;  4RF0 A;  1YMH E;  3SR6 A;  3ZGZ A;  1FIQ A;  4O1N A;  3Q8F A;  1L0V B;  2N7J A;  2FBW B;  1FNV A;  1T3Q A;  5H8Y E;  2PKO A;  3T3O A;  2WU5 B;  3NVZ A;  1SEB D;  4XWT A;  1FNW A;  1XEE A;  2KDM A;  4KKJ A;  1C76 A;  3NVW A;  3W5V B;  1UGJ A;  1XXG A;  1CZP A;  1Y56 A;  1KF6 B;  2H88 B;  1DYQ A;  3ZQ4 A;  3AN1 A;  1ZDX A;  2R61 A;  1SIJ A;  4US9 A;  4C7Z A;  3SFD B;  4MM3 B;  5HHD G;  2JWU A;  4YSZ B;  3AE1 B;  1AN8 A;  3ZJV A;  3BWU D;  2OHF A;  1PDX A;  1B9R A;  2WP9 B;  1NVI D;  4A8X C;  1QIL A;  4L23 A;  1FXI A;  1ZOY B;  1E7P B;  1PUT A;  1FFU A;  1FMA D;  1L4Z B;  3P4P B;  1MHX A;  1JW9 D;  1WGK A;  4RGM A;  2WDR B;  1JQ4 A;  1HA5 A;  2QIL A;  4RGO S;  5HFY A;  2GRI A;  1F77 A;  3AE6 B;  2EKI A;  2NMQ A;  3FC4 A;  1MI0 A;  1YN4 A;  1C79 A;  1V8C A;  1L0X B;  2DLB A;  1DOX A;  3CWI A;  4YTN B;  4IOI E;  5C2T B;  2V0G A;  5TSS A;  3AE7 B;  1JWA D;  4RCO A;  5D3D A;  4NJC A;  2SAK A;  5AUI A;  3BK1 A;  4L1B A;  1NI3 A;  3L4P A;  4KX6 B;  2J4X A;  1GOZ A;  2ZW1 A;  3C8Y A;  5E6J A;  2WLB A;  2K9X A;  2PMV A;  3AB5 A;  4HEA 1;  3AEF B;  1JML A;  3HVZ A;  1HZ5 A;  2WXJ A;  1RFK A;  2NTS A;  4XDC A;  1E6E B;  3IAS 1;  2INN E;  1XO3 A;  1R7S A;  3I9V 1;  2KQ4 X;  2WXF A;  3AEB B;  1C4A A;  1JWU D;  3P1M A;  3IT4 B;  1QOA A;  1SXT A;  1GB1 A;  3NZ3 A;  1ESF A;  3FIL A;  1VJK A;  1I4R A;  2J42 A;  2BT6 A;  1LO5 D;  2QMT A;  1Q10 A;  4TQ1 A;  4XWW A;  3AEG B;  1ZDV A;  2BBC A;  1SJH D;  5EE3 A;  3P63 A;  3DWM A;  3AE4 B;  2W55 A;  3J9C A;  3I57 A;  3HRD D;  3MFG A;  3LXF A;  1ZPS A;  4JWS C;  4RGN A;  2ACZ B;  3ZJU A;  2RMM A;  2Z8L A;  4OHJ A;  2MJ3 A;  4REZ A;  1YJI A;  1L6V A;  3AE9 B;  1MPE A;  1RYJ A;  1D4B A;  1OQQ A;  1TKY A;  2LHE A;  3NS1 A;  1SSN A;  1TKE A;  1HXY D;  3TSS A;  2TSS A;  4DXF A;  2KAC A;  2LHD A;  2PVO D;  2KN4 A;  2DYO A;  5D7G A;  4XDD A;  1KTK A;  1YN3 A;  2FUG 1;  3LYY A;  4B0M A;  1K52 A;  2WDQ B;  1XCQ L;  3U2S C;  4AS1 A;  1UUP A;  3AE2 B;  1KLU D;  3VRA B;  1WSP A;  3Q8E A;  1YQ3 B;  2IJ0 A;  3URY A;  3Q69 A;  1FO4 A;  1JWM D;  2K3U A;  1QOF A;  2M0A A;  1FD6 A;  3AV8 A;  4FXC A;  3U4E G;  2WU2 B;  2OED A;  5HG2 A;  1CJE A;  3ETR A;  1WRI A;  4MT5 A;  3IAM 1;  3U7Z A;  1N5W A;  3TEY A;  1D6E C;  3EA6 A;  4JX1 C;  4DQO C;  3P4R B;  2B76 B;  3ABV B;  1N5X A;  5I4D A;  2Y5P A;  2RDH A;  2MH7 A;  1CQV A;  1YNT E;  2BB6 A;  2KWD A;  2QJL A;  1FEH A;  4YSX B;  5BYR A;  1SBB B;  2WXG A;  1NEK B;  2WXR A;  3AE8 B;  3RFZ B;  1F2R I;  2RPV A;  3GS2 A;  2AX5 A;  1HEZ E;  3WCQ A;  1EU4 A;  1F0Z A;  1QKZ A;  5G5H A;  1TJE A;  3BK2 A;  1V1P A;  1SE3 A;  1VZ7 A;  2K0P A;  2WXK A;  2WXM A;  3W2D A;  4P16 A;  1QOB A;  1B1Z A;  1C4P A;  2CJN A;  3EGR A;  3V3X A;  2LGI A;  4GDK B;  2AQ1 B;  1MHH E;  4US8 A;  1FCC C;  4MH8 A;  4L2Y A;  4ITK A;  4LLG M;  4C56 C;  3SEB A;  4KGR A;  1I4G A;  1VRA B;  1C4C A;  1FNU A;  4ARC A;  1ZUD 2;  3Q8A A;  2GB1 A;  2K5P A;  4Q2J A;  5FR3 A;  1SE4 A;  5LNK 1;  3AM9 A;  1VDV A;  2E6X A;  3BVZ A;  3HUI A;  1XCT L;  5G5G A;  1JAL A;  1JRP A;  2JXT A;  3CIR B;  4A55 A;  4YSY B;  1QT9 A;  5BMI A;  1SJE D;  4RH6 A;  2PVG C;  1TS2 A;  2PTL A;  2KAJ A;  2WNM A;  5JXV A;  4JPS A;  5AUK A;  1GPX A;  1UWX A;  1SE2 A;  1P7E A;  4DXG A;  1T6B X;  2JSV X;  1JCK B;  1WWT A;  2BS2 B;  4R3D A;  4ZOH C;  1C77 A;  4HKQ A;  1I4H A;  4HKZ E;  2WS3 B;  5BYQ A;  1BXT A;  2LJI A;  3NVY A;  2QSD A;  4KKI A;  4A9A A;  4OZA A;  1YQ4 B;  2MJD A;  3IT6 B;  1PFD A;  2HDE A;  4ZRP A;  5BYS A;  3AH7 A;  2FE8 A;  1JWB D;  3W5U B;  2DBY A;  1IBX A;  1AYF A;  1FRD A;  1ET9 A;  1K53 A;  5H92 C;  4ZHP A;  3Q8B A;  1UNS A;  2QEJ C;  4LK0 M;  4A90 A;  1EU3 A;  1JRO A;  3VR8 B;  4ZRQ A;  4PT5 A;  1ZXI A;  4CQN A;  2KMM A;  1A70 A;  1KH0 A;  3EUB 2;  1FRR A;  1XLO A;  3H8H A;  1STE A;  2J52 A;  1D5Z C;  1N62 A;  1WYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...