4A94C

Structure of the carboxypeptidase inhibitor from nerita versicolor in complex with human cpa4
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
51
structure length
51
Chain Sequence
VPDDRPCINPGRCPLVPDATCTFVCKAADNDFGYECQHVWTFEGQRVGCYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Novel Metallo-Carboxypeptidase Inhibitor from the Marine Mollusk Nerita Versicolor in Complex with Human Carboxypeptidase A4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CARBOXYPEPTIDASE A4
total genus 2
structure length 51
sequence length 51
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.90 Mainly Beta Ribbon Laminin Laminin 4a94C00
4A94C
chains in the Genus database with same CATH superfamily
1V1HA 3MDLA 4MMZB 2VH6B 1NFUB 1IP0A 1J9CL 3LC3B 2W2ME 1NFXB 4M11A 4OTYA 5COXA 2UWPB 5JVYA 4Z0KB 4D0EA 2W2PE 3LC5B 1EPJA 1FAKL 3KL6B 2XC5L 2F9BL 3LAQA 4TGFA 2P94L 4X8VL 2J94B 4ZH8B 2Y82B 2W2QE 1NZIA 4BTUA 4CUFA 2OYUP 1A3PA 1IQIL 4RS0A 1PXXA 5IKQA 3R05A 4Y76B 4NGAL 1L3YA 4ISHL 1U67A 4Y79B 1HZ8A 4RRZA 1N1IA 1ATDA 2WG4B 2J95B 1U8CB 3KQDL 2K2SB 2FLBL 1KLIL 2K2TA 4Y7BB 1F7EA 1EPHA 2PUQL 2VWNL 1G1SA 3S6XA 1BF9A 5EGMB 2BQ6A 5JBAE 1XFEA 3QCWA 5IKTA 4Y7AB 3SOBB 1MOXC 2BSFA 4O02B 1URKA 4NG9L 1C5MF 1YUFA 1P9JA 2GD4A 3FFGL 2P3FL 5CKQA 5KIRA 3N8WA 3NTBA 1KLOA 2WPJE 4LMFA 1KLJL 1HT5A 4OTJA 3TK5B 2WYJB 2NPRA 1IQEL 1TOZA 2P16L 1ZAQA 1HCGB 2J38B 3FCSB 4Z6AL 3KRKA 1K36A 3ZYJB 1CCVA 5IKRA 1DIYA 2XBYL 3GISX 2VJ3A 1IQML 1X7AL 2MGPA 1ATAA 4Y71B 4ZAEB 3LTFB 1I0UA 2W2NE 1XKBA 3FBYA 4CUDA 1G1RA 2BZ6L 3TK6B 1O5DL 5CKNA 4ZXYL 1XDTR 2P26A 3HO3A 2KL7A 2W86A 1G2LB 2P93L 1NT0A 2UWLB 3N8VA 3KQBL 1YUKB 1W8BL 1IGXA 2FZZL 5F19A 3CS7L 1K37A 4O1ZA 4PH9A 1HJ7A 1HREA 2TGFA 3HS5A 3TBDA 3BT1A 1G2MB 2XBXL 4A7IA 1IQGL 3IJEB 5L2ZL 1IQHL 1TLEA 2WPIE 4YZUB 3N8ZA 1TPGA 3N8YA 4X8UL 1IVOC 4BTIA 1IQNL 2VWLL 5JB8E 4BXWA 3KCGL 2YGPA 2EI8B 1W7XL 2Y7XB 2XC4L 1ATBA 1L5GB 3CENL 1V3XB 3LTGD 2PR3B 3EGFA 3K9XA 2MGRA 4ZXXL 2W2OE 2PHBB 3M37L 5JW1A 4MMXB 5JVZA 2WFXB 2WFTA 5CISA 1DX5I 2Y80B 2KNIA 3HO5A 4G1MB 5KN5C 2JKHL 4X8TL 1IOXA 2UWOB 3F6UL 3POYA 3KQEL 3GCXE 5JBCE 3U73A 2MHPA 3QH0A 3H5CB 2Y81B 1HT8A 4BDWA 1COUA 2XC0L 3IITB 1CCFA 2EI6B 1LPGA 1FFMA 3HPTA 3KK6A 1SZBA 2HORA 3NT1A 2VVVL 4FM5A 3U7UG 4Y6DB 4D0FA 2RA0L 4JYUL 2CJIB 2FD6A 2J34B 3TGFA 1UZPA 1QIUA 1JV2B 1G1TA 1EMNA 1EMOA 2BO2A 3Q7DA 4YT7L 2BT7A 1IGZA 4ZHAB 1EAIC 2VVUL 1LMJA 1UZJA 3LN0A 2Y5HL 2WPKE 2HOXA 3NTGA 4RRXA 1KIGL 1G1QA 3LIWB 2YGQA 1FF7A 1PGEA 5I46L 3SOVA 2P28B 1MQ6L 1UZQA 2VH0B 3F1SB 1DQBA 2J2UB 1XKAL 1FJSL 3BT2A 3ZYIB 1CX2A 2BOKL 3MQEA 2M74A 1NFWB 1WHFA 3M36L 2WPLE 2P3FN 3KQCL 1V1IA 2WPHE 4CUEA 2Q1JB 1PTHA 3ENSA 1WHEA 1LK9A 3PGHA 4CSYA 2EI7B 3HS6A 4BXSA 1YUGA 1EZQB 4XLWA 2VWMK 5E8DA 4BDXA 1APOA 1EPIA 3P5BL 2DDUA 2RNLA 1F0RB 2I9AA 4Z0LA 4A94C 1CVUA 6COXA 1JL9A 3V65B 2WPME 3GCWE 1IQLL 1Z6CA 1F7MA 5L30L 1IJQA 2J4IB 2P95L 4BTTA 3Q3KB 2P3TA 1DDXA 1B9WA 1N7DA 3N8XA 2RHPA 4JYVL 1P0SL 4XBMA 4M10A 5JBBE 2BQWA 1F0SB 2Y5GL 3N8WB 4RRWA 2BQ7A 3NJPC 4ISIL 2B7DL 1HAFA 1APQA 1IQJL 1LPZA 1CEJA 2XBVL 1QFKL 1KKEA 1AUTL 3OLUA 1YO8A 1NPEB 4D90A 2W26B 1FAXL 2VVCK 4E1GA 3SW2A 2WYGB 1CQEA 2XBWL 4RUTA 1EQGA 1IQFL 3TZIA 3ASIA 2BOUA 5CKMA 1LQDA 1GK5A 1IOEL 2H9EC 3RR3A 5K0HB 2D1JB 4COXA 1LMMA 3CA7A 5JB9E 1HRFA 3ZYGA 4LORA 1EPGA 3SOQA 1M1XB 2H9EL 3OLTA 3TH3L 3V64C 5F1AA 3HS7A 1Q4GA 1FSBA 4YT6L 1FE2A 4GU3A 1HX2A 1CVWL 1DVAL 2AYLA 2FLGA 1EQHA 2Y38A 2P3UA 2FLRL 5IKVA 1EGFA 2I9BA 1PFXL 4JZEL 1HAEA 1KSNB 1NQLB 2VRSA 2BOXA 4AQTA 2W3KB 3ELAL 1YGCL 2BT8A 2YGOA 4MMYB 4X8SL 3CFWA 1UZKA 2W3IB 4JZDL 4NA9L 2JJLA 2KV4A 3DEMA 2ADXA 2WG3C 2BOHA 3N8YB 3QMOA 3LN1A 4C16A 5L2YL 1IQKL 1RFNB 5FDQA 2OYEP 3HO4A 1Z6EL 3BPSE 1OB1C 1LPKA 2BMGA 1JBUL 1EBVA 4JZFL 1ATEA 2VWOL 4RRYA 2G00L 1PRHA 4XL1A 1NFYB 2KB9A 3C9AC 4GU4A 1ADXA 2Y5FL 1WU1B 1MQ5L 2Y7ZB 2WZPP
chains in the Genus database with same CATH topology
3MDLA 4MMZB 2VH6B 1NFUB 1IP0A 1J9CL 3LC3B 2W2ME 1NFXB 4M11A 4OTYA 5COXA 2UWPB 5JVYA 4Z0KB 4D0EA 2W2PE 3LC5B 1EPJA 1FAKL 3KL6B 2XC5L 2F9BL 3LAQA 4TGFA 2P94L 4X8VL 2J94B 4ZH8B 2Y82B 2W2QE 1NZIA 4BTUA 4CUFA 2OYUP 1A3PA 1IQIL 4RS0A 1PXXA 5IKQA 3R05A 4Y76B 4NGAL 1L3YA 4ISHL 1U67A 4Y79B 1HZ8A 4RRZA 1N1IA 1ATDA 2WG4B 2J95B 1U8CB 3KQDL 2K2SB 2FLBL 1KLIL 2K2TA 4Y7BB 1F7EA 1EPHA 2PUQL 2VWNL 1G1SA 3S6XA 1BF9A 5EGMB 2BQ6A 5JBAE 1XFEA 3QCWA 5IKTA 4Y7AB 3SOBB 1MOXC 4O02B 1URKA 4NG9L 1C5MF 1YUFA 1P9JA 2GD4A 3FFGL 2P3FL 5CKQA 5KIRA 3N8WA 3NTBA 1KLOA 2WPJE 4LMFA 1KLJL 1HT5A 4OTJA 3TK5B 2WYJB 2NPRA 1IQEL 1TOZA 2P16L 1ZAQA 1HCGB 2J38B 3FCSB 4Z6AL 3KRKA 1K36A 3ZYJB 1CCVA 5IKRA 1DIYA 2XBYL 3GISX 2VJ3A 1IQML 1X7AL 2MGPA 1ATAA 4Y71B 4ZAEB 3LTFB 1I0UA 2W2NE 1XKBA 3FBYA 4CUDA 1G1RA 2BZ6L 3TK6B 1O5DL 5CKNA 4ZXYL 1XDTR 2P26A 3HO3A 2KL7A 2W86A 1G2LB 2P93L 1NT0A 2UWLB 3N8VA 3KQBL 1YUKB 1W8BL 1IGXA 2FZZL 5F19A 3CS7L 1K37A 4O1ZA 4PH9A 1HJ7A 1HREA 2TGFA 3HS5A 3TBDA 3BT1A 1G2MB 2XBXL 4A7IA 1IQGL 3IJEB 5L2ZL 1IQHL 1TLEA 2WPIE 4YZUB 3N8ZA 1TPGA 3N8YA 4X8UL 1IVOC 4BTIA 1IQNL 2VWLL 5JB8E 4BXWA 3KCGL 2YGPA 2EI8B 1W7XL 2Y7XB 2XC4L 1ATBA 1L5GB 3CENL 1V3XB 3LTGD 2PR3B 3EGFA 3K9XA 2MGRA 4ZXXL 2W2OE 2PHBB 3M37L 5JW1A 4MMXB 5JVZA 2WFXB 2WFTA 5CISA 1DX5I 2Y80B 2KNIA 3HO5A 4G1MB 5KN5C 2JKHL 4X8TL 1IOXA 2UWOB 3F6UL 3POYA 3KQEL 3GCXE 5JBCE 3U73A 2MHPA 3QH0A 3H5CB 2Y81B 1HT8A 4BDWA 1COUA 2XC0L 3IITB 1CCFA 2EI6B 1LPGA 1FFMA 3HPTA 3KK6A 1SZBA 3NT1A 2VVVL 4FM5A 3U7UG 4Y6DB 4D0FA 2RA0L 4JYUL 2CJIB 2FD6A 2J34B 3TGFA 1UZPA 1JV2B 1G1TA 1EMNA 1EMOA 2BO2A 3Q7DA 4YT7L 1IGZA 4ZHAB 1EAIC 2VVUL 1LMJA 1UZJA 3LN0A 2Y5HL 2WPKE 3NTGA 4RRXA 1KIGL 1G1QA 3LIWB 2YGQA 1FF7A 1PGEA 5I46L 3SOVA 2P28B 1MQ6L 1UZQA 2VH0B 3F1SB 1DQBA 2J2UB 1XKAL 1FJSL 3BT2A 3ZYIB 1CX2A 2BOKL 3MQEA 2M74A 1NFWB 1WHFA 3M36L 2WPLE 2P3FN 3KQCL 2WPHE 4CUEA 2Q1JB 1PTHA 3ENSA 1WHEA 3PGHA 4CSYA 2EI7B 3HS6A 4BXSA 1YUGA 1EZQB 4XLWA 2VWMK 5E8DA 4BDXA 1APOA 1EPIA 3P5BL 2DDUA 2RNLA 1F0RB 2I9AA 4Z0LA 4A94C 1CVUA 6COXA 1JL9A 3V65B 2WPME 3GCWE 1IQLL 1Z6CA 1F7MA 5L30L 1IJQA 2J4IB 2P95L 4BTTA 3Q3KB 2P3TA 1DDXA 1B9WA 1N7DA 3N8XA 2RHPA 4JYVL 1P0SL 4XBMA 4M10A 5JBBE 2BQWA 1F0SB 2Y5GL 3N8WB 4RRWA 2BQ7A 3NJPC 4ISIL 2B7DL 1HAFA 1APQA 1IQJL 1LPZA 1CEJA 2XBVL 1QFKL 1AUTL 3OLUA 1YO8A 1NPEB 4D90A 2W26B 1FAXL 2VVCK 4E1GA 3SW2A 2WYGB 1CQEA 2XBWL 4RUTA 1EQGA 1IQFL 3TZIA 3ASIA 2BOUA 5CKMA 1LQDA 1GK5A 1IOEL 2H9EC 3RR3A 5K0HB 2D1JB 4COXA 1LMMA 3CA7A 5JB9E 1HRFA 3ZYGA 4LORA 1EPGA 3SOQA 1M1XB 2H9EL 3OLTA 3TH3L 3V64C 5F1AA 3HS7A 1Q4GA 1FSBA 4YT6L 1FE2A 1HX2A 1CVWL 1DVAL 2AYLA 2FLGA 1EQHA 2Y38A 2P3UA 2FLRL 5IKVA 1EGFA 2I9BA 1PFXL 4JZEL 1HAEA 1KSNB 1NQLB 2BOXA 4AQTA 2W3KB 3ELAL 1YGCL 2YGOA 4MMYB 4X8SL 3CFWA 1UZKA 2W3IB 4JZDL 4NA9L 2KV4A 3DEMA 2ADXA 2WG3C 2BOHA 3N8YB 3QMOA 3LN1A 4C16A 5L2YL 1IQKL 1RFNB 5FDQA 2OYEP 3HO4A 1Z6EL 3BPSE 1OB1C 1LPKA 2BMGA 1JBUL 1EBVA 4JZFL 1ATEA 2VWOL 4RRYA 2G00L 1PRHA 4XL1A 1NFYB 2KB9A 3C9AC 1ADXA 2Y5FL 1WU1B 1MQ5L 2Y7ZB 2WZPP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A94 C; 
#chains in the Genus database with same CATH topology
 1V1H A;  3MDL A;  4MMZ B;  2VH6 B;  1NFU B;  1IP0 A;  1J9C L;  3LC3 B;  2W2M E;  1NFX B;  4M11 A;  4OTY A;  5COX A;  2UWP B;  5JVY A;  4Z0K B;  4D0E A;  2W2P E;  3LC5 B;  1EPJ A;  1FAK L;  3KL6 B;  2XC5 L;  2F9B L;  3LAQ A;  4TGF A;  2P94 L;  4X8V L;  2J94 B;  4ZH8 B;  2Y82 B;  2W2Q E;  1NZI A;  4BTU A;  4CUF A;  2OYU P;  1A3P A;  1IQI L;  4RS0 A;  1PXX A;  5IKQ A;  3R05 A;  4Y76 B;  4NGA L;  1L3Y A;  4ISH L;  1U67 A;  4Y79 B;  1HZ8 A;  4RRZ A;  1N1I A;  1ATD A;  2WG4 B;  2J95 B;  1U8C B;  3KQD L;  2K2S B;  2FLB L;  1KLI L;  2K2T A;  4Y7B B;  1F7E A;  1EPH A;  2PUQ L;  2VWN L;  1G1S A;  3S6X A;  1BF9 A;  5EGM B;  2BQ6 A;  5JBA E;  1XFE A;  3QCW A;  5IKT A;  4Y7A B;  3SOB B;  1MOX C;  2BSF A;  4O02 B;  1URK A;  4NG9 L;  1C5M F;  1YUF A;  1P9J A;  2GD4 A;  3FFG L;  2P3F L;  5CKQ A;  5KIR A;  3N8W A;  3NTB A;  1KLO A;  2WPJ E;  4LMF A;  1KLJ L;  1HT5 A;  4OTJ A;  3TK5 B;  2WYJ B;  2NPR A;  1IQE L;  1TOZ A;  2P16 L;  1ZAQ A;  1HCG B;  2J38 B;  3FCS B;  4Z6A L;  3KRK A;  1K36 A;  3ZYJ B;  1CCV A;  5IKR A;  1DIY A;  2XBY L;  3GIS X;  2VJ3 A;  1IQM L;  1X7A L;  2MGP A;  1ATA A;  4Y71 B;  4ZAE B;  3LTF B;  1I0U A;  2W2N E;  1XKB A;  3FBY A;  4CUD A;  1G1R A;  2BZ6 L;  3TK6 B;  1O5D L;  5CKN A;  4ZXY L;  1XDT R;  2P26 A;  3HO3 A;  2KL7 A;  2W86 A;  1G2L B;  2P93 L;  1NT0 A;  2UWL B;  3N8V A;  3KQB L;  1YUK B;  1W8B L;  1IGX A;  2FZZ L;  5F19 A;  3CS7 L;  1K37 A;  4O1Z A;  4PH9 A;  1HJ7 A;  1HRE A;  2TGF A;  3HS5 A;  3TBD A;  3BT1 A;  1G2M B;  2XBX L;  4A7I A;  1IQG L;  3IJE B;  5L2Z L;  1IQH L;  1TLE A;  2WPI E;  4YZU B;  3N8Z A;  1TPG A;  3N8Y A;  4X8U L;  1IVO C;  4BTI A;  1IQN L;  2VWL L;  5JB8 E;  4BXW A;  3KCG L;  2YGP A;  2EI8 B;  1W7X L;  2Y7X B;  2XC4 L;  1ATB A;  1L5G B;  3CEN L;  1V3X B;  3LTG D;  2PR3 B;  3EGF A;  3K9X A;  2MGR A;  4ZXX L;  2W2O E;  2PHB B;  3M37 L;  5JW1 A;  4MMX B;  5JVZ A;  2WFX B;  2WFT A;  5CIS A;  1DX5 I;  2Y80 B;  2KNI A;  3HO5 A;  4G1M B;  5KN5 C;  2JKH L;  4X8T L;  1IOX A;  2UWO B;  3F6U L;  3POY A;  3KQE L;  3GCX E;  5JBC E;  3U73 A;  2MHP A;  3QH0 A;  3H5C B;  2Y81 B;  1HT8 A;  4BDW A;  1COU A;  2XC0 L;  3IIT B;  1CCF A;  2EI6 B;  1LPG A;  1FFM A;  3HPT A;  3KK6 A;  1SZB A;  2HOR A;  3NT1 A;  2VVV L;  4FM5 A;  3U7U G;  4Y6D B;  4D0F A;  2RA0 L;  4JYU L;  2CJI B;  2FD6 A;  2J34 B;  3TGF A;  1UZP A;  1QIU A;  1JV2 B;  1G1T A;  1EMN A;  1EMO A;  2BO2 A;  3Q7D A;  4YT7 L;  2BT7 A;  1IGZ A;  4ZHA B;  1EAI C;  2VVU L;  1LMJ A;  1UZJ A;  3LN0 A;  2Y5H L;  2WPK E;  2HOX A;  3NTG A;  4RRX A;  1KIG L;  1G1Q A;  3LIW B;  2YGQ A;  1FF7 A;  1PGE A;  5I46 L;  3SOV A;  2P28 B;  1MQ6 L;  1UZQ A;  2VH0 B;  3F1S B;  1DQB A;  2J2U B;  1XKA L;  1FJS L;  3BT2 A;  3ZYI B;  1CX2 A;  2BOK L;  3MQE A;  2M74 A;  1NFW B;  1WHF A;  3M36 L;  2WPL E;  2P3F N;  3KQC L;  1V1I A;  2WPH E;  4CUE A;  2Q1J B;  1PTH A;  3ENS A;  1WHE A;  1LK9 A;  3PGH A;  4CSY A;  2EI7 B;  3HS6 A;  4BXS A;  1YUG A;  1EZQ B;  4XLW A;  2VWM K;  5E8D A;  4BDX A;  1APO A;  1EPI A;  3P5B L;  2DDU A;  2RNL A;  1F0R B;  2I9A A;  4Z0L A;  4A94 C;  1CVU A;  6COX A;  1JL9 A;  3V65 B;  2WPM E;  3GCW E;  1IQL L;  1Z6C A;  1F7M A;  5L30 L;  1IJQ A;  2J4I B;  2P95 L;  4BTT A;  3Q3K B;  2P3T A;  1DDX A;  1B9W A;  1N7D A;  3N8X A;  2RHP A;  4JYV L;  1P0S L;  4XBM A;  4M10 A;  5JBB E;  2BQW A;  1F0S B;  2Y5G L;  3N8W B;  4RRW A;  2BQ7 A;  3NJP C;  4ISI L;  2B7D L;  1HAF A;  1APQ A;  1IQJ L;  1LPZ A;  1CEJ A;  2XBV L;  1QFK L;  1KKE A;  1AUT L;  3OLU A;  1YO8 A;  1NPE B;  4D90 A;  2W26 B;  1FAX L;  2VVC K;  4E1G A;  3SW2 A;  2WYG B;  1CQE A;  2XBW L;  4RUT A;  1EQG A;  1IQF L;  3TZI A;  3ASI A;  2BOU A;  5CKM A;  1LQD A;  1GK5 A;  1IOE L;  2H9E C;  3RR3 A;  5K0H B;  2D1J B;  4COX A;  1LMM A;  3CA7 A;  5JB9 E;  1HRF A;  3ZYG A;  4LOR A;  1EPG A;  3SOQ A;  1M1X B;  2H9E L;  3OLT A;  3TH3 L;  3V64 C;  5F1A A;  3HS7 A;  1Q4G A;  1FSB A;  4YT6 L;  1FE2 A;  4GU3 A;  1HX2 A;  1CVW L;  1DVA L;  2AYL A;  2FLG A;  1EQH A;  2Y38 A;  2P3U A;  2FLR L;  5IKV A;  1EGF A;  2I9B A;  1PFX L;  4JZE L;  1HAE A;  1KSN B;  1NQL B;  2VRS A;  2BOX A;  4AQT A;  2W3K B;  3ELA L;  1YGC L;  2BT8 A;  2YGO A;  4MMY B;  4X8S L;  3CFW A;  1UZK A;  2W3I B;  4JZD L;  4NA9 L;  2JJL A;  2KV4 A;  3DEM A;  2ADX A;  2WG3 C;  2BOH A;  3N8Y B;  3QMO A;  3LN1 A;  4C16 A;  5L2Y L;  1IQK L;  1RFN B;  5FDQ A;  2OYE P;  3HO4 A;  1Z6E L;  3BPS E;  1OB1 C;  1LPK A;  2BMG A;  1JBU L;  1EBV A;  4JZF L;  1ATE A;  2VWO L;  4RRY A;  2G00 L;  1PRH A;  4XL1 A;  1NFY B;  2KB9 A;  3C9A C;  4GU4 A;  1ADX A;  2Y5F L;  1WU1 B;  1MQ5 L;  2Y7Z B;  2WZP P; 
#chains in the Genus database with same CATH homology
 3MDL A;  4MMZ B;  2VH6 B;  1NFU B;  1IP0 A;  1J9C L;  3LC3 B;  2W2M E;  1NFX B;  4M11 A;  4OTY A;  5COX A;  2UWP B;  5JVY A;  4Z0K B;  4D0E A;  2W2P E;  3LC5 B;  1EPJ A;  1FAK L;  3KL6 B;  2XC5 L;  2F9B L;  3LAQ A;  4TGF A;  2P94 L;  4X8V L;  2J94 B;  4ZH8 B;  2Y82 B;  2W2Q E;  1NZI A;  4BTU A;  4CUF A;  2OYU P;  1A3P A;  1IQI L;  4RS0 A;  1PXX A;  5IKQ A;  3R05 A;  4Y76 B;  4NGA L;  1L3Y A;  4ISH L;  1U67 A;  4Y79 B;  1HZ8 A;  4RRZ A;  1N1I A;  1ATD A;  2WG4 B;  2J95 B;  1U8C B;  3KQD L;  2K2S B;  2FLB L;  1KLI L;  2K2T A;  4Y7B B;  1F7E A;  1EPH A;  2PUQ L;  2VWN L;  1G1S A;  3S6X A;  1BF9 A;  5EGM B;  2BQ6 A;  5JBA E;  1XFE A;  3QCW A;  5IKT A;  4Y7A B;  3SOB B;  1MOX C;  4O02 B;  1URK A;  4NG9 L;  1C5M F;  1YUF A;  1P9J A;  2GD4 A;  3FFG L;  2P3F L;  5CKQ A;  5KIR A;  3N8W A;  3NTB A;  1KLO A;  2WPJ E;  4LMF A;  1KLJ L;  1HT5 A;  4OTJ A;  3TK5 B;  2WYJ B;  2NPR A;  1IQE L;  1TOZ A;  2P16 L;  1ZAQ A;  1HCG B;  2J38 B;  3FCS B;  4Z6A L;  3KRK A;  1K36 A;  3ZYJ B;  1CCV A;  5IKR A;  1DIY A;  2XBY L;  3GIS X;  2VJ3 A;  1IQM L;  1X7A L;  2MGP A;  1ATA A;  4Y71 B;  4ZAE B;  3LTF B;  1I0U A;  2W2N E;  1XKB A;  3FBY A;  4CUD A;  1G1R A;  2BZ6 L;  3TK6 B;  1O5D L;  5CKN A;  4ZXY L;  1XDT R;  2P26 A;  3HO3 A;  2KL7 A;  2W86 A;  1G2L B;  2P93 L;  1NT0 A;  2UWL B;  3N8V A;  3KQB L;  1YUK B;  1W8B L;  1IGX A;  2FZZ L;  5F19 A;  3CS7 L;  1K37 A;  4O1Z A;  4PH9 A;  1HJ7 A;  1HRE A;  2TGF A;  3HS5 A;  3TBD A;  3BT1 A;  1G2M B;  2XBX L;  4A7I A;  1IQG L;  3IJE B;  5L2Z L;  1IQH L;  1TLE A;  2WPI E;  4YZU B;  3N8Z A;  1TPG A;  3N8Y A;  4X8U L;  1IVO C;  4BTI A;  1IQN L;  2VWL L;  5JB8 E;  4BXW A;  3KCG L;  2YGP A;  2EI8 B;  1W7X L;  2Y7X B;  2XC4 L;  1ATB A;  1L5G B;  3CEN L;  1V3X B;  3LTG D;  2PR3 B;  3EGF A;  3K9X A;  2MGR A;  4ZXX L;  2W2O E;  2PHB B;  3M37 L;  5JW1 A;  4MMX B;  5JVZ A;  2WFX B;  2WFT A;  5CIS A;  1DX5 I;  2Y80 B;  2KNI A;  3HO5 A;  4G1M B;  5KN5 C;  2JKH L;  4X8T L;  1IOX A;  2UWO B;  3F6U L;  3POY A;  3KQE L;  3GCX E;  5JBC E;  3U73 A;  2MHP A;  3QH0 A;  3H5C B;  2Y81 B;  1HT8 A;  4BDW A;  1COU A;  2XC0 L;  3IIT B;  1CCF A;  2EI6 B;  1LPG A;  1FFM A;  3HPT A;  3KK6 A;  1SZB A;  3NT1 A;  2VVV L;  4FM5 A;  3U7U G;  4Y6D B;  4D0F A;  2RA0 L;  4JYU L;  2CJI B;  2FD6 A;  2J34 B;  3TGF A;  1UZP A;  1JV2 B;  1G1T A;  1EMN A;  1EMO A;  2BO2 A;  3Q7D A;  4YT7 L;  1IGZ A;  4ZHA B;  1EAI C;  2VVU L;  1LMJ A;  1UZJ A;  3LN0 A;  2Y5H L;  2WPK E;  3NTG A;  4RRX A;  1KIG L;  1G1Q A;  3LIW B;  2YGQ A;  1FF7 A;  1PGE A;  5I46 L;  3SOV A;  2P28 B;  1MQ6 L;  1UZQ A;  2VH0 B;  3F1S B;  1DQB A;  2J2U B;  1XKA L;  1FJS L;  3BT2 A;  3ZYI B;  1CX2 A;  2BOK L;  3MQE A;  2M74 A;  1NFW B;  1WHF A;  3M36 L;  2WPL E;  2P3F N;  3KQC L;  2WPH E;  4CUE A;  2Q1J B;  1PTH A;  3ENS A;  1WHE A;  3PGH A;  4CSY A;  2EI7 B;  3HS6 A;  4BXS A;  1YUG A;  1EZQ B;  4XLW A;  2VWM K;  5E8D A;  4BDX A;  1APO A;  1EPI A;  3P5B L;  2DDU A;  2RNL A;  1F0R B;  2I9A A;  4Z0L A;  4A94 C;  1CVU A;  6COX A;  1JL9 A;  3V65 B;  2WPM E;  3GCW E;  1IQL L;  1Z6C A;  1F7M A;  5L30 L;  1IJQ A;  2J4I B;  2P95 L;  4BTT A;  3Q3K B;  2P3T A;  1DDX A;  1B9W A;  1N7D A;  3N8X A;  2RHP A;  4JYV L;  1P0S L;  4XBM A;  4M10 A;  5JBB E;  2BQW A;  1F0S B;  2Y5G L;  3N8W B;  4RRW A;  2BQ7 A;  3NJP C;  4ISI L;  2B7D L;  1HAF A;  1APQ A;  1IQJ L;  1LPZ A;  1CEJ A;  2XBV L;  1QFK L;  1AUT L;  3OLU A;  1YO8 A;  1NPE B;  4D90 A;  2W26 B;  1FAX L;  2VVC K;  4E1G A;  3SW2 A;  2WYG B;  1CQE A;  2XBW L;  4RUT A;  1EQG A;  1IQF L;  3TZI A;  3ASI A;  2BOU A;  5CKM A;  1LQD A;  1GK5 A;  1IOE L;  2H9E C;  3RR3 A;  5K0H B;  2D1J B;  4COX A;  1LMM A;  3CA7 A;  5JB9 E;  1HRF A;  3ZYG A;  4LOR A;  1EPG A;  3SOQ A;  1M1X B;  2H9E L;  3OLT A;  3TH3 L;  3V64 C;  5F1A A;  3HS7 A;  1Q4G A;  1FSB A;  4YT6 L;  1FE2 A;  1HX2 A;  1CVW L;  1DVA L;  2AYL A;  2FLG A;  1EQH A;  2Y38 A;  2P3U A;  2FLR L;  5IKV A;  1EGF A;  2I9B A;  1PFX L;  4JZE L;  1HAE A;  1KSN B;  1NQL B;  2BOX A;  4AQT A;  2W3K B;  3ELA L;  1YGC L;  2YGO A;  4MMY B;  4X8S L;  3CFW A;  1UZK A;  2W3I B;  4JZD L;  4NA9 L;  2KV4 A;  3DEM A;  2ADX A;  2WG3 C;  2BOH A;  3N8Y B;  3QMO A;  3LN1 A;  4C16 A;  5L2Y L;  1IQK L;  1RFN B;  5FDQ A;  2OYE P;  3HO4 A;  1Z6E L;  3BPS E;  1OB1 C;  1LPK A;  2BMG A;  1JBU L;  1EBV A;  4JZF L;  1ATE A;  2VWO L;  4RRY A;  2G00 L;  1PRH A;  4XL1 A;  1NFY B;  2KB9 A;  3C9A C;  1ADX A;  2Y5F L;  1WU1 B;  1MQ5 L;  2Y7Z B;  2WZP P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...