4A9EA

N-terminal bromodomain of human brd2 with 3-methyl-1,2,3,4- tetrahydroquinazolin-2-one
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
112
structure length
112
Chain Sequence
VTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BROMODOMAIN-CONTAINING PROTEIN 2
publication title Fragment-Based Discovery of Bromodomain Inhibitors Part 1: Inhibitor Binding Modes and Implications for Lead Discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 38
structure length 112
sequence length 112
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4a9eA00
3JVJA 4X2IA 5FG6A 4KV1A 4MR3A 4QSPA 4LZ2A 5D3LA 4YBSA 5I7YA 4UYEA 5EM3A 5LKTA 4QY4A 3D7CA 4LZSA 4HXNA 5DYXA 5AMFA 5LUUA 5DYAA 4MR6A 5E9YA 4YY4A 5E73A 3I3JA 4LYIA 4IOOA 5DKDA 5ENGA 5JI8A 4YH4A 5I83A 5F61A 3U5OA 3O35A 4O71A 3SVHA 2R0SA 4PCEA 4Q0OA 4HXMA 4TU4A 4A9JA 3Q2FA 5CQ6A 4YATA 4N3WA 4MEOA 2YQDA 5CTLA 5HELA 3AQAA 4NRBA 4QEWA 4ALGA 5E9VA 4IR3A 5EP7A 3U5NA 3O33A 4LC2A 5KU3A 5ETDA 5CQ7A 2R0VA 4QR3A 3LXJA 5DFDA 5CUGA 4LZRA 2RNWA 4QB3A 5CUEA 5EICA 3Q2EA 5FG4A 5C85A 5KO4A 1JM4B 4Z6IA 3UVXA 5ENHA 3U5MA 5I1QA 1E6IA 5FE6A 5CQ5A 5HRXA 4O7FA 4MR4A 4PTBA 2DVSA 4CFLA 3FKMX 4BW4A 4HXRA 5L8UA 4QZSA 3RCWA 2WP1A 2E3KA 5EPRA 4NRAA 5BT4A 1ZS5A 5ENJA 4TT2A 5D0CA 5D3RA 3UVYA 3UVDA 4YADA 2OSSA 4Z1SA 4A9HA 4UYFA 5CUDA 4A9NA 5L98A 4YYHA 1N72A 5D3HA 5LVRA 5EQ1A 2E7NA 4O78A 3UV2A 4PY6A 1F68A 2RO1A 4O75A 5ACYA 4ALHA 4N4HA 4A9MA 5CUCA 5KTUA 3MULA 2YEKA 4PS5A 5CQTA 4MEQA 4LYWA 4XY9A 2F6JA 5E9LA 5F60A 4IORA 4YYMA 4HBYA 4ZW1A 3JVKA 3HMEA 4UYHA 5EWCA 1WUGA 4QBMA 4HXPA 4RVRA 5D3TA 4NQMA 5H1UA 4LRGA 2DVVA 5F62A 2RNYA 2YYNA 2L5EA 4O7CA 5EWWA 4BW3A 5ENFA 4WIVA 4QYLA 4KV4A 4A9IA 4NR9A 4UIZA 5E74A 4UIXA 5CUAA 5C8GA 5EK9A 4QR5A 5C7NA 4CURA 3GG3A 4J3IA 4A9OA 5A82A 5E9KA 4Z1QA 4QSSA 2YDWA 5D3NA 3MB4A 5EA1A 4YBMA 4TYLA 5CQAA 5FFYA 5EU1A 5F2PA 5CP5A 4NQNA 4HXSA 4OGJA 5DLZA 4NXJA 5EGUA 4O7AA 5HJCA 2LSPB 5FE0A 3P5OA 4QEVA 4CUPA 5AD3A 2E7OA 4TQNA 4NS5A 3O34A 4DONA 2FSAA 5D3JA 5DFCA 4IR6A 4BW2A 4CUSA 4QSQA 4QSXA 5CGPA 4C67A 3UW9A 4YK0A 4QC1A 5BT3A 5I89A 5I40A 3JVLA 4GPJA 4TZ2A 4A9EA 2OO1A 4Y03A 4J1PA 3LQJA 5AMEA 4YYJA 3DAIA 4TZ8A 3G0LA 4NR6A 2KTBB 5D24A 2D82A 3S91A 4LDFA 4YAXA 5F3AA 5IGNA 5FFWA 5E3GA 4HBXA 4UYFB 4QR4A 3P1EA 3QZVA 5LKUA 4UIUA 3U5LA 4UYGA 4NR7A 3TLPA 3HMFA 5JWMA 5E9MA 5EV9A 3ZYUA 4MR5A 5FB0A 4CUTA 5FE9A 5F5ZA 5KTXA 5CQ8A 5LKXA 4XY8A 4Z6HA 5HQ5A 5H1TA 4YBTA 3O37A 4A9KA 4QSVA 2GRCA 4NR8A 4QYDA 4NRCA 4NYVA 4NYWA 5FH7A 3JVMA 4TT4A 2YEMA 5K29A 5IG6A 3LQIA 2RFJA 5CQ4A 4IR5A 4HBVA 5E9IA 2MJVB 5A5OA 5G4RA 5A5PA 4UIVA 4HXOA 5AD2A 4BJXA 1EQFA 5L8TA 4O72A 3P1FA 4TS8A 4CUQA 5FH6A 4QC3A 2L84A 5HRWA 2R10A 5ENIA 5D26A 5H85A 2DVQA 5LKZA 4XUBA 5DFBA 3MB3A 4Q0NA 4OGIA 4YYKA 5F1HA 4J0RA 5DW1A 3QZSA 5C89A 5HFRA 4WHUA 5EWHA 4AKNA 4HXKA 5EWDA 4QSUA 5DW2A 5EISA 3DWYA 4NUDA 5KTWA 5EVAA 5ENBA 5I7XA 4QSTA 5FE7A 2WP2A 5I86A 5DBMA 5F63A 4E96A 2I8NA 2F6NA 5HFQA 5EWVA 4NYXA 4YH3A 5A5RA 3G0JA 5DLXA 5L97A 5LJ1A 3U5KA 3U5PA 5HQ6A 3HMHA 4HXLA 5C87A 4QNSA 3NXBA 5I80A 5I88A 3IU5A 4CL9A 5FE5A 5HCLA 3U5JA 4YYDA 4NUEA 3S92A 3AADA 2RI7A 5H1VA 4ZQLA 2YELA 4TT6A 5E0RA 5ENEA 5FB1A 4F3IA 5A81A 5CRMA 5CUBA 3QZTA 3LJWA 5FG5A 5FE4A 5TB6A 5LJ2A 5HEMA 5FFVA 4YY6A 3SVFA 4YC9A 5HRVA 4Z93A 4QSWA 5G4SA 4J0SA 5C4QA 2G4AA 4IR4A 2DWWA 4ZC9A 2OUOA 3SVGA 5FE2A 4BHWA 5A5NA 5BT5A 5CU8A 5FE3A 4YYGA 4IOQA 2NXBA 4NR4A 2I7KA 5D3PA 5CY9A 4QEUA 5ENCA 5CFWA 4N4FA 4QUTA 5FE8A 4O74A 5IGMA 4HBWA 1X0JA 5CS8A 3MUKA 5J0DA 4WHWA 5LJ0A 5IBNA 5F1LA 3LQHA 4PCIA 2DVRA 3P1DA 5ETBA 2R0YA 4UYDA 5DKHA 3IU6A 5CZGA 5CQ3A 2YW5A 4A9FA 3ONIA 5L99A 4KCXA 5FH8A 4O76A 4A9LA 2H60A 5A5SA 2DKWA 3K2JA 5D7XA 5E7DA 5A7CA 1WUMA 5COIA 4FLPA 5D3SA 4PKLA 3O36A 4NR5A 4UITA 2L85A 5FE1A 5IIDA 4CLBA 4XYAA 5FBXA 4YABA 2N9GA 5DYUA 5EPSA 5F36A 2DATA 4C66A 4YYIA 5KHMA 4CFKA 5II2A 4N4IA 4MEPA 5DX4A 3UV4A 4BW1A 5DY7A 5A83A 5F25A 4XUAA 4YYNA 1JSPB 3UVWA 5HENA 5CPEA 5HM0A 4NUCA 3P1CA 5II1A 4OUFA 4MENA 2RNXA 3MXFA 4LR6A 5E3DA 4TU6A 5HQ7A 4UIWA 5EI4A 5LVQA 4O7BA 2D9EA 5DKCA 5A85A 4UIYA 5DYCA 4O7EA 3UV5A 2RS9B 5A5QA 4QUUA 5IGLA 4LYSA 4O70A 4CUUA 5IGKA 5EPBA 5HLSA 5D25A 4O77A 4TTEA 5TCMA 5L96A 5FDZA 4N4GA 5I29A 5CRZA 4QSRA 3MQMA
chains in the Genus database with same CATH superfamily
3JVJA 4X2IA 5FG6A 4KV1A 4MR3A 4QSPA 4LZ2A 5D3LA 4YBSA 5I7YA 4UYEA 5EM3A 5LKTA 4QY4A 3D7CA 4LZSA 4HXNA 5DYXA 5AMFA 5LUUA 5DYAA 4MR6A 5E9YA 4YY4A 5E73A 3I3JA 4LYIA 4IOOA 5DKDA 5ENGA 5JI8A 4YH4A 5I83A 5F61A 3U5OA 3O35A 4O71A 3SVHA 2R0SA 4PCEA 4Q0OA 4HXMA 4TU4A 4A9JA 3Q2FA 5CQ6A 4YATA 4N3WA 4MEOA 2YQDA 5CTLA 5HELA 3AQAA 4NRBA 4QEWA 4ALGA 5E9VA 4IR3A 5EP7A 3U5NA 3O33A 4LC2A 5KU3A 5ETDA 5CQ7A 2R0VA 4QR3A 3LXJA 5DFDA 5CUGA 4LZRA 2RNWA 4QB3A 5CUEA 5EICA 3Q2EA 5FG4A 5C85A 5KO4A 1JM4B 4Z6IA 3UVXA 4AKIA 5ENHA 4AKGA 3U5MA 5I1QA 1E6IA 5FE6A 5CQ5A 5HRXA 4O7FA 4MR4A 4PTBA 2DVSA 4CFLA 3FKMX 4BW4A 4HXRA 5L8UA 4QZSA 3RCWA 2WP1A 2E3KA 5EPRA 4NRAA 5BT4A 1ZS5A 5ENJA 4TT2A 5D0CA 5D3RA 3UVYA 3UVDA 3D1DA 4YADA 2OSSA 4Z1SA 4A9HA 4UYFA 5CUDA 4A9NA 5L98A 4YYHA 1N72A 5D3HA 5LVRA 5EQ1A 2E7NA 4O78A 3UV2A 4PY6A 1F68A 2RO1A 4O75A 5ACYA 4ALHA 4N4HA 4A9MA 5CUCA 5KTUA 3MULA 2YEKA 4PS5A 5CQTA 4MEQA 4LYWA 4XY9A 2F6JA 5E9LA 5F60A 4IORA 4YYMA 4HBYA 4ZW1A 3JVKA 3HMEA 3VKHA 4UYHA 5EWCA 1WUGA 4QBMA 4HXPA 1ZKRA 4RVRA 5D3TA 4NQMA 5H1UA 4LRGA 2DVVA 5F62A 2RNYA 2YYNA 2L5EA 4O7CA 5EWWA 4BW3A 5ENFA 4WIVA 4QYLA 4KV4A 4A9IA 4NR9A 4UIZA 5E74A 4UIXA 5CUAA 5C8GA 5EK9A 4QR5A 5C7NA 4CURA 3GG3A 4J3IA 4A9OA 5A82A 5E9KA 4Z1QA 4QSSA 2YDWA 5D3NA 3MB4A 5EA1A 4YBMA 4TYLA 5CQAA 5FFYA 5EU1A 5F2PA 5CP5A 4NQNA 4HXSA 4OGJA 5DLZA 4NXJA 5EGUA 4AKHA 4O7AA 5HJCA 2LSPB 5FE0A 3P5OA 4QEVA 4CUPA 5AD3A 2E7OA 4TQNA 4NS5A 3O34A 4DONA 2FSAA 5D3JA 5DFCA 4IR6A 4BW2A 4CUSA 4QSQA 4QSXA 5CGPA 4C67A 3UW9A 4YK0A 4QC1A 3VKGA 5BT3A 5I89A 5I40A 3JVLA 4GPJA 4TZ2A 4A9EA 2OO1A 4Y03A 4J1PA 3LQJA 5AMEA 4YYJA 3DAIA 4TZ8A 3G0LA 4NR6A 2KTBB 5D24A 2D82A 3S91A 4LDFA 4YAXA 5F3AA 5IGNA 5FFWA 5E3GA 4HBXA 4UYFB 4QR4A 3P1EA 3QZVA 5LKUA 4UIUA 3U5LA 4UYGA 4NR7A 3TLPA 3HMFA 5JWMA 5E9MA 5EV9A 3ZYUA 4MR5A 5FB0A 4CUTA 5FE9A 5F5ZA 5KTXA 5CQ8A 5LKXA 4XY8A 4Z6HA 5HQ5A 5H1TA 4YBTA 3O37A 4A9KA 4QSVA 2GRCA 4NR8A 4QYDA 4NRCA 4NYVA 4NYWA 5FH7A 3JVMA 4TT4A 2YEMA 5K29A 5IG6A 3LQIA 2RFJA 5CQ4A 4IR5A 4HBVA 5E9IA 2MJVB 5A5OA 5G4RA 5A5PA 4UIVA 4HXOA 5AD2A 4BJXA 1EQFA 5L8TA 4O72A 1PUOA 3P1FA 4TS8A 4CUQA 5FH6A 4QC3A 2L84A 5HRWA 2R10A 5ENIA 5D26A 5H85A 2DVQA 5LKZA 4XUBA 5DFBA 3MB3A 4Q0NA 4OGIA 4YYKA 5F1HA 4J0RA 5DW1A 3QZSA 5C89A 5HFRA 4WHUA 5EWHA 4AKNA 4HXKA 5EWDA 4QSUA 5DW2A 5EISA 3DWYA 4NUDA 5KTWA 5EVAA 5ENBA 5I7XA 4QSTA 5FE7A 2WP2A 5I86A 5DBMA 5F63A 4E96A 2I8NA 2F6NA 5HFQA 5EWVA 4NYXA 4YH3A 5A5RA 3G0JA 5DLXA 5L97A 5LJ1A 3U5KA 3U5PA 5HQ6A 3HMHA 4HXLA 5C87A 4QNSA 3NXBA 3D1BA 5I80A 5I88A 3IU5A 4CL9A 5FE5A 5HCLA 3U5JA 4YYDA 4NUEA 3S92A 3AADA 2RI7A 2EJNA 5H1VA 4ZQLA 2YELA 4TT6A 5E0RA 5ENEA 5FB1A 4F3IA 5A81A 5CRMA 5CUBA 3QZTA 3LJWA 5FG5A 5FE4A 5TB6A 5LJ2A 5HEMA 5FFVA 4YY6A 3SVFA 4YC9A 5HRVA 4Z93A 4QSWA 5G4SA 4J0SA 5C4QA 2G4AA 4IR4A 2DWWA 4ZC9A 2OUOA 3SVGA 5FE2A 4BHWA 5A5NA 5BT5A 5CU8A 5FE3A 4YYGA 4IOQA 2NXBA 4NR4A 2I7KA 5D3PA 5CY9A 4QEUA 5ENCA 5CFWA 4N4FA 4QUTA 5FE8A 4O74A 5IGMA 4HBWA 1X0JA 5CS8A 3MUKA 5J0DA 4WHWA 5LJ0A 5IBNA 5F1LA 3LQHA 4PCIA 2DVRA 3ERRA 3P1DA 5ETBA 2R0YA 4UYDA 4AI6A 5DKHA 3IU6A 5CZGA 5CQ3A 2YW5A 4A9FA 3ONIA 5L99A 4KCXA 5FH8A 4O76A 4A9LA 2H60A 5A5SA 2DKWA 3K2JA 5D7XA 5E7DA 5A7CA 1WUMA 5COIA 4FLPA 5D3SA 4PKLA 3O36A 4NR5A 4UITA 2L85A 5FE1A 5IIDA 4CLBA 4XYAA 5FBXA 4YABA 2N9GA 5DYUA 5EPSA 5F36A 2DATA 4C66A 4YYIA 5KHMA 4CFKA 5II2A 4N4IA 4MEPA 5DX4A 3UV4A 4BW1A 5DY7A 5A83A 5F25A 4XUAA 4YYNA 1JSPB 3UVWA 5HENA 5CPEA 5HM0A 4NUCA 3P1CA 5II1A 4OUFA 4MENA 2RNXA 3MXFA 4LR6A 5E3DA 4TU6A 5HQ7A 4UIWA 5EI4A 5LVQA 4O7BA 2D9EA 5DKCA 5A85A 4UIYA 5DYCA 4O7EA 3UV5A 2RS9B 5A5QA 4QUUA 5IGLA 4LYSA 4O70A 4CUUA 5IGKA 5EPBA 5HLSA 5D25A 4O77A 4TTEA 5TCMA 5L96A 5FDZA 4N4GA 5I29A 5CRZA 4QSRA 3MQMA
chains in the Genus database with same CATH topology
3JVJA 4X2IA 5FG6A 4KV1A 4MR3A 4QSPA 4LZ2A 5D3LA 4YBSA 5I7YA 4UYEA 5EM3A 5LKTA 4QY4A 3D7CA 4LZSA 4HXNA 5DYXA 5AMFA 5LUUA 5DYAA 4MR6A 5E9YA 4YY4A 5E73A 3I3JA 4LYIA 4IOOA 5DKDA 5ENGA 5JI8A 4YH4A 5I83A 5F61A 3U5OA 3O35A 4O71A 3SVHA 2R0SA 4PCEA 4Q0OA 4HXMA 4TU4A 4A9JA 3Q2FA 5CQ6A 4YATA 4N3WA 4MEOA 2YQDA 5CTLA 5HELA 3AQAA 4NRBA 4QEWA 4ALGA 5E9VA 4IR3A 5EP7A 3U5NA 3O33A 4LC2A 5KU3A 5ETDA 5CQ7A 2R0VA 4QR3A 3LXJA 5DFDA 5CUGA 4LZRA 2RNWA 4QB3A 5CUEA 5EICA 3Q2EA 5FG4A 5C85A 5KO4A 1JM4B 4Z6IA 3UVXA 5ENHA 3U5MA 5I1QA 1E6IA 5FE6A 5CQ5A 5HRXA 4O7FA 4MR4A 4PTBA 2DVSA 4CFLA 3FKMX 4BW4A 4HXRA 5L8UA 4QZSA 3RCWA 2WP1A 2E3KA 5EPRA 4NRAA 5BT4A 1ZS5A 5ENJA 4TT2A 5D0CA 5D3RA 3UVYA 3UVDA 4YADA 2OSSA 4Z1SA 4A9HA 4UYFA 5CUDA 4A9NA 5L98A 4YYHA 1N72A 5D3HA 5LVRA 5EQ1A 2E7NA 4O78A 3UV2A 4PY6A 1F68A 2RO1A 4O75A 5ACYA 4ALHA 4N4HA 4A9MA 5CUCA 5KTUA 3MULA 2YEKA 4PS5A 5CQTA 4MEQA 4LYWA 4XY9A 2F6JA 5E9LA 5F60A 4IORA 4YYMA 4HBYA 4ZW1A 3JVKA 3HMEA 4UYHA 5EWCA 1WUGA 4QBMA 4HXPA 4RVRA 5D3TA 4NQMA 5H1UA 4LRGA 2DVVA 5F62A 2RNYA 2YYNA 2L5EA 4O7CA 5EWWA 4BW3A 5ENFA 4WIVA 4QYLA 4KV4A 4A9IA 4NR9A 4UIZA 5E74A 4UIXA 5CUAA 5C8GA 5EK9A 4QR5A 5C7NA 4CURA 3GG3A 4J3IA 4A9OA 5A82A 5E9KA 4Z1QA 4QSSA 2YDWA 5D3NA 3MB4A 5EA1A 4YBMA 4TYLA 5CQAA 5FFYA 5EU1A 5F2PA 5CP5A 4NQNA 4HXSA 4OGJA 5DLZA 4NXJA 5EGUA 4O7AA 5HJCA 2LSPB 5FE0A 3P5OA 4QEVA 4CUPA 5AD3A 2E7OA 4TQNA 4NS5A 3O34A 4DONA 2FSAA 5D3JA 5DFCA 4IR6A 4BW2A 4CUSA 4QSQA 4QSXA 5CGPA 4C67A 3UW9A 4YK0A 4QC1A 5BT3A 5I89A 5I40A 3JVLA 4GPJA 4TZ2A 4A9EA 2OO1A 4Y03A 4J1PA 3LQJA 5AMEA 4YYJA 3DAIA 4TZ8A 3G0LA 4NR6A 2KTBB 5D24A 2D82A 3S91A 4LDFA 4YAXA 5F3AA 5IGNA 5FFWA 5E3GA 4HBXA 4UYFB 4QR4A 3P1EA 3QZVA 5LKUA 4UIUA 3U5LA 4UYGA 4NR7A 3TLPA 3HMFA 5JWMA 5E9MA 5EV9A 3ZYUA 4MR5A 5FB0A 4CUTA 5FE9A 5F5ZA 5KTXA 5CQ8A 5LKXA 4XY8A 4Z6HA 5HQ5A 5H1TA 4YBTA 3O37A 4A9KA 4QSVA 2GRCA 4NR8A 4QYDA 4NRCA 4NYVA 4NYWA 5FH7A 3JVMA 4TT4A 2YEMA 5K29A 5IG6A 3LQIA 2RFJA 5CQ4A 4IR5A 4HBVA 5E9IA 2MJVB 5A5OA 5G4RA 5A5PA 4UIVA 4HXOA 5AD2A 4BJXA 1EQFA 5L8TA 4O72A 3P1FA 4TS8A 4CUQA 5FH6A 4QC3A 2L84A 5HRWA 2R10A 5ENIA 5D26A 5H85A 2DVQA 5LKZA 4XUBA 5DFBA 3MB3A 4Q0NA 4OGIA 4YYKA 5F1HA 4J0RA 5DW1A 3QZSA 5C89A 5HFRA 4WHUA 5EWHA 4AKNA 4HXKA 5EWDA 4QSUA 5DW2A 5EISA 3DWYA 4NUDA 5KTWA 5EVAA 5ENBA 5I7XA 4QSTA 5FE7A 2WP2A 5I86A 5DBMA 5F63A 4E96A 2I8NA 2F6NA 5HFQA 5EWVA 4NYXA 4YH3A 5A5RA 3G0JA 5DLXA 5L97A 5LJ1A 3U5KA 3U5PA 5HQ6A 3HMHA 4HXLA 5C87A 4QNSA 3NXBA 5I80A 5I88A 3IU5A 4CL9A 5FE5A 5HCLA 3U5JA 4YYDA 4NUEA 3S92A 3AADA 2RI7A 5H1VA 4ZQLA 2YELA 4TT6A 5E0RA 5ENEA 5FB1A 4F3IA 5A81A 5CRMA 5CUBA 3QZTA 3LJWA 5FG5A 5FE4A 5TB6A 5LJ2A 5HEMA 5FFVA 4YY6A 3SVFA 4YC9A 5HRVA 4Z93A 4QSWA 5G4SA 4J0SA 5C4QA 2G4AA 4IR4A 2DWWA 4ZC9A 2OUOA 3SVGA 5FE2A 4BHWA 5A5NA 5BT5A 5CU8A 5FE3A 4YYGA 4IOQA 2NXBA 4NR4A 2I7KA 5D3PA 5CY9A 4QEUA 5ENCA 5CFWA 4N4FA 4QUTA 5FE8A 4O74A 5IGMA 4HBWA 1X0JA 5CS8A 3MUKA 5J0DA 4WHWA 5LJ0A 5IBNA 5F1LA 3LQHA 4PCIA 2DVRA 3P1DA 5ETBA 2R0YA 4UYDA 5DKHA 3IU6A 5CZGA 5CQ3A 2YW5A 4A9FA 3ONIA 5L99A 4KCXA 5FH8A 4O76A 4A9LA 2H60A 5A5SA 2DKWA 3K2JA 5D7XA 5E7DA 5A7CA 1WUMA 5COIA 4FLPA 5D3SA 4PKLA 3O36A 4NR5A 4UITA 2L85A 5FE1A 5IIDA 4CLBA 4XYAA 5FBXA 4YABA 2N9GA 5DYUA 5EPSA 5F36A 2DATA 4C66A 4YYIA 5KHMA 4CFKA 5II2A 4N4IA 4MEPA 5DX4A 3UV4A 4BW1A 5DY7A 5A83A 5F25A 4XUAA 4YYNA 1JSPB 3UVWA 5HENA 5CPEA 5HM0A 4NUCA 3P1CA 5II1A 4OUFA 4MENA 2RNXA 3MXFA 4LR6A 5E3DA 4TU6A 5HQ7A 4UIWA 5EI4A 5LVQA 4O7BA 2D9EA 5DKCA 5A85A 4UIYA 5DYCA 4O7EA 3UV5A 2RS9B 5A5QA 4QUUA 5IGLA 4LYSA 4O70A 4CUUA 5IGKA 5EPBA 5HLSA 5D25A 4O77A 4TTEA 5TCMA 5L96A 5FDZA 4N4GA 5I29A 5CRZA 4QSRA 3MQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JVJ A;  4X2I A;  5FG6 A;  4KV1 A;  4MR3 A;  4QSP A;  4LZ2 A;  5D3L A;  4YBS A;  5I7Y A;  4UYE A;  5EM3 A;  5LKT A;  4QY4 A;  3D7C A;  4LZS A;  4HXN A;  5DYX A;  5AMF A;  5LUU A;  5DYA A;  4MR6 A;  5E9Y A;  4YY4 A;  5E73 A;  3I3J A;  4LYI A;  4IOO A;  5DKD A;  5ENG A;  5JI8 A;  4YH4 A;  5I83 A;  5F61 A;  3U5O A;  3O35 A;  4O71 A;  3SVH A;  2R0S A;  4PCE A;  4Q0O A;  4HXM A;  4TU4 A;  4A9J A;  3Q2F A;  5CQ6 A;  4YAT A;  4N3W A;  4MEO A;  2YQD A;  5CTL A;  5HEL A;  3AQA A;  4NRB A;  4QEW A;  4ALG A;  5E9V A;  4IR3 A;  5EP7 A;  3U5N A;  3O33 A;  4LC2 A;  5KU3 A;  5ETD A;  5CQ7 A;  2R0V A;  4QR3 A;  3LXJ A;  5DFD A;  5CUG A;  4LZR A;  2RNW A;  4QB3 A;  5CUE A;  5EIC A;  3Q2E A;  5FG4 A;  5C85 A;  5KO4 A;  1JM4 B;  4Z6I A;  3UVX A;  5ENH A;  3U5M A;  5I1Q A;  1E6I A;  5FE6 A;  5CQ5 A;  5HRX A;  4O7F A;  4MR4 A;  4PTB A;  2DVS A;  4CFL A;  3FKM X;  4BW4 A;  4HXR A;  5L8U A;  4QZS A;  3RCW A;  2WP1 A;  2E3K A;  5EPR A;  4NRA A;  5BT4 A;  1ZS5 A;  5ENJ A;  4TT2 A;  5D0C A;  5D3R A;  3UVY A;  3UVD A;  4YAD A;  2OSS A;  4Z1S A;  4A9H A;  4UYF A;  5CUD A;  4A9N A;  5L98 A;  4YYH A;  1N72 A;  5D3H A;  5LVR A;  5EQ1 A;  2E7N A;  4O78 A;  3UV2 A;  4PY6 A;  1F68 A;  2RO1 A;  4O75 A;  5ACY A;  4ALH A;  4N4H A;  4A9M A;  5CUC A;  5KTU A;  3MUL A;  2YEK A;  4PS5 A;  5CQT A;  4MEQ A;  4LYW A;  4XY9 A;  2F6J A;  5E9L A;  5F60 A;  4IOR A;  4YYM A;  4HBY A;  4ZW1 A;  3JVK A;  3HME A;  4UYH A;  5EWC A;  1WUG A;  4QBM A;  4HXP A;  4RVR A;  5D3T A;  4NQM A;  5H1U A;  4LRG A;  2DVV A;  5F62 A;  2RNY A;  2YYN A;  2L5E A;  4O7C A;  5EWW A;  4BW3 A;  5ENF A;  4WIV A;  4QYL A;  4KV4 A;  4A9I A;  4NR9 A;  4UIZ A;  5E74 A;  4UIX A;  5CUA A;  5C8G A;  5EK9 A;  4QR5 A;  5C7N A;  4CUR A;  3GG3 A;  4J3I A;  4A9O A;  5A82 A;  5E9K A;  4Z1Q A;  4QSS A;  2YDW A;  5D3N A;  3MB4 A;  5EA1 A;  4YBM A;  4TYL A;  5CQA A;  5FFY A;  5EU1 A;  5F2P A;  5CP5 A;  4NQN A;  4HXS A;  4OGJ A;  5DLZ A;  4NXJ A;  5EGU A;  4O7A A;  5HJC A;  2LSP B;  5FE0 A;  3P5O A;  4QEV A;  4CUP A;  5AD3 A;  2E7O A;  4TQN A;  4NS5 A;  3O34 A;  4DON A;  2FSA A;  5D3J A;  5DFC A;  4IR6 A;  4BW2 A;  4CUS A;  4QSQ A;  4QSX A;  5CGP A;  4C67 A;  3UW9 A;  4YK0 A;  4QC1 A;  5BT3 A;  5I89 A;  5I40 A;  3JVL A;  4GPJ A;  4TZ2 A;  4A9E A;  2OO1 A;  4Y03 A;  4J1P A;  3LQJ A;  5AME A;  4YYJ A;  3DAI A;  4TZ8 A;  3G0L A;  4NR6 A;  2KTB B;  5D24 A;  2D82 A;  3S91 A;  4LDF A;  4YAX A;  5F3A A;  5IGN A;  5FFW A;  5E3G A;  4HBX A;  4UYF B;  4QR4 A;  3P1E A;  3QZV A;  5LKU A;  4UIU A;  3U5L A;  4UYG A;  4NR7 A;  3TLP A;  3HMF A;  5JWM A;  5E9M A;  5EV9 A;  3ZYU A;  4MR5 A;  5FB0 A;  4CUT A;  5FE9 A;  5F5Z A;  5KTX A;  5CQ8 A;  5LKX A;  4XY8 A;  4Z6H A;  5HQ5 A;  5H1T A;  4YBT A;  3O37 A;  4A9K A;  4QSV A;  2GRC A;  4NR8 A;  4QYD A;  4NRC A;  4NYV A;  4NYW A;  5FH7 A;  3JVM A;  4TT4 A;  2YEM A;  5K29 A;  5IG6 A;  3LQI A;  2RFJ A;  5CQ4 A;  4IR5 A;  4HBV A;  5E9I A;  2MJV B;  5A5O A;  5G4R A;  5A5P A;  4UIV A;  4HXO A;  5AD2 A;  4BJX A;  1EQF A;  5L8T A;  4O72 A;  3P1F A;  4TS8 A;  4CUQ A;  5FH6 A;  4QC3 A;  2L84 A;  5HRW A;  2R10 A;  5ENI A;  5D26 A;  5H85 A;  2DVQ A;  5LKZ A;  4XUB A;  5DFB A;  3MB3 A;  4Q0N A;  4OGI A;  4YYK A;  5F1H A;  4J0R A;  5DW1 A;  3QZS A;  5C89 A;  5HFR A;  4WHU A;  5EWH A;  4AKN A;  4HXK A;  5EWD A;  4QSU A;  5DW2 A;  5EIS A;  3DWY A;  4NUD A;  5KTW A;  5EVA A;  5ENB A;  5I7X A;  4QST A;  5FE7 A;  2WP2 A;  5I86 A;  5DBM A;  5F63 A;  4E96 A;  2I8N A;  2F6N A;  5HFQ A;  5EWV A;  4NYX A;  4YH3 A;  5A5R A;  3G0J A;  5DLX A;  5L97 A;  5LJ1 A;  3U5K A;  3U5P A;  5HQ6 A;  3HMH A;  4HXL A;  5C87 A;  4QNS A;  3NXB A;  5I80 A;  5I88 A;  3IU5 A;  4CL9 A;  5FE5 A;  5HCL A;  3U5J A;  4YYD A;  4NUE A;  3S92 A;  3AAD A;  2RI7 A;  5H1V A;  4ZQL A;  2YEL A;  4TT6 A;  5E0R A;  5ENE A;  5FB1 A;  4F3I A;  5A81 A;  5CRM A;  5CUB A;  3QZT A;  3LJW A;  5FG5 A;  5FE4 A;  5TB6 A;  5LJ2 A;  5HEM A;  5FFV A;  4YY6 A;  3SVF A;  4YC9 A;  5HRV A;  4Z93 A;  4QSW A;  5G4S A;  4J0S A;  5C4Q A;  2G4A A;  4IR4 A;  2DWW A;  4ZC9 A;  2OUO A;  3SVG A;  5FE2 A;  4BHW A;  5A5N A;  5BT5 A;  5CU8 A;  5FE3 A;  4YYG A;  4IOQ A;  2NXB A;  4NR4 A;  2I7K A;  5D3P A;  5CY9 A;  4QEU A;  5ENC A;  5CFW A;  4N4F A;  4QUT A;  5FE8 A;  4O74 A;  5IGM A;  4HBW A;  1X0J A;  5CS8 A;  3MUK A;  5J0D A;  4WHW A;  5LJ0 A;  5IBN A;  5F1L A;  3LQH A;  4PCI A;  2DVR A;  3P1D A;  5ETB A;  2R0Y A;  4UYD A;  5DKH A;  3IU6 A;  5CZG A;  5CQ3 A;  2YW5 A;  4A9F A;  3ONI A;  5L99 A;  4KCX A;  5FH8 A;  4O76 A;  4A9L A;  2H60 A;  5A5S A;  2DKW A;  3K2J A;  5D7X A;  5E7D A;  5A7C A;  1WUM A;  5COI A;  4FLP A;  5D3S A;  4PKL A;  3O36 A;  4NR5 A;  4UIT A;  2L85 A;  5FE1 A;  5IID A;  4CLB A;  4XYA A;  5FBX A;  4YAB A;  2N9G A;  5DYU A;  5EPS A;  5F36 A;  2DAT A;  4C66 A;  4YYI A;  5KHM A;  4CFK A;  5II2 A;  4N4I A;  4MEP A;  5DX4 A;  3UV4 A;  4BW1 A;  5DY7 A;  5A83 A;  5F25 A;  4XUA A;  4YYN A;  1JSP B;  3UVW A;  5HEN A;  5CPE A;  5HM0 A;  4NUC A;  3P1C A;  5II1 A;  4OUF A;  4MEN A;  2RNX A;  3MXF A;  4LR6 A;  5E3D A;  4TU6 A;  5HQ7 A;  4UIW A;  5EI4 A;  5LVQ A;  4O7B A;  2D9E A;  5DKC A;  5A85 A;  4UIY A;  5DYC A;  4O7E A;  3UV5 A;  2RS9 B;  5A5Q A;  4QUU A;  5IGL A;  4LYS A;  4O70 A;  4CUU A;  5IGK A;  5EPB A;  5HLS A;  5D25 A;  4O77 A;  4TTE A;  5TCM A;  5L96 A;  5FDZ A;  4N4G A;  5I29 A;  5CRZ A;  4QSR A;  3MQM A; 
#chains in the Genus database with same CATH topology
 3JVJ A;  4X2I A;  5FG6 A;  4KV1 A;  4MR3 A;  4QSP A;  4LZ2 A;  5D3L A;  4YBS A;  5I7Y A;  4UYE A;  5EM3 A;  5LKT A;  4QY4 A;  3D7C A;  4LZS A;  4HXN A;  5DYX A;  5AMF A;  5LUU A;  5DYA A;  4MR6 A;  5E9Y A;  4YY4 A;  5E73 A;  3I3J A;  4LYI A;  4IOO A;  5DKD A;  5ENG A;  5JI8 A;  4YH4 A;  5I83 A;  5F61 A;  3U5O A;  3O35 A;  4O71 A;  3SVH A;  2R0S A;  4PCE A;  4Q0O A;  4HXM A;  4TU4 A;  4A9J A;  3Q2F A;  5CQ6 A;  4YAT A;  4N3W A;  4MEO A;  2YQD A;  5CTL A;  5HEL A;  3AQA A;  4NRB A;  4QEW A;  4ALG A;  5E9V A;  4IR3 A;  5EP7 A;  3U5N A;  3O33 A;  4LC2 A;  5KU3 A;  5ETD A;  5CQ7 A;  2R0V A;  4QR3 A;  3LXJ A;  5DFD A;  5CUG A;  4LZR A;  2RNW A;  4QB3 A;  5CUE A;  5EIC A;  3Q2E A;  5FG4 A;  5C85 A;  5KO4 A;  1JM4 B;  4Z6I A;  3UVX A;  4AKI A;  5ENH A;  4AKG A;  3U5M A;  5I1Q A;  1E6I A;  5FE6 A;  5CQ5 A;  5HRX A;  4O7F A;  4MR4 A;  4PTB A;  2DVS A;  4CFL A;  3FKM X;  4BW4 A;  4HXR A;  5L8U A;  4QZS A;  3RCW A;  2WP1 A;  2E3K A;  5EPR A;  4NRA A;  5BT4 A;  1ZS5 A;  5ENJ A;  4TT2 A;  5D0C A;  5D3R A;  3UVY A;  3UVD A;  3D1D A;  4YAD A;  2OSS A;  4Z1S A;  4A9H A;  4UYF A;  5CUD A;  4A9N A;  5L98 A;  4YYH A;  1N72 A;  5D3H A;  5LVR A;  5EQ1 A;  2E7N A;  4O78 A;  3UV2 A;  4PY6 A;  1F68 A;  2RO1 A;  4O75 A;  5ACY A;  4ALH A;  4N4H A;  4A9M A;  5CUC A;  5KTU A;  3MUL A;  2YEK A;  4PS5 A;  5CQT A;  4MEQ A;  4LYW A;  4XY9 A;  2F6J A;  5E9L A;  5F60 A;  4IOR A;  4YYM A;  4HBY A;  4ZW1 A;  3JVK A;  3HME A;  3VKH A;  4UYH A;  5EWC A;  1WUG A;  4QBM A;  4HXP A;  1ZKR A;  4RVR A;  5D3T A;  4NQM A;  5H1U A;  4LRG A;  2DVV A;  5F62 A;  2RNY A;  2YYN A;  2L5E A;  4O7C A;  5EWW A;  4BW3 A;  5ENF A;  4WIV A;  4QYL A;  4KV4 A;  4A9I A;  4NR9 A;  4UIZ A;  5E74 A;  4UIX A;  5CUA A;  5C8G A;  5EK9 A;  4QR5 A;  5C7N A;  4CUR A;  3GG3 A;  4J3I A;  4A9O A;  5A82 A;  5E9K A;  4Z1Q A;  4QSS A;  2YDW A;  5D3N A;  3MB4 A;  5EA1 A;  4YBM A;  4TYL A;  5CQA A;  5FFY A;  5EU1 A;  5F2P A;  5CP5 A;  4NQN A;  4HXS A;  4OGJ A;  5DLZ A;  4NXJ A;  5EGU A;  4AKH A;  4O7A A;  5HJC A;  2LSP B;  5FE0 A;  3P5O A;  4QEV A;  4CUP A;  5AD3 A;  2E7O A;  4TQN A;  4NS5 A;  3O34 A;  4DON A;  2FSA A;  5D3J A;  5DFC A;  4IR6 A;  4BW2 A;  4CUS A;  4QSQ A;  4QSX A;  5CGP A;  4C67 A;  3UW9 A;  4YK0 A;  4QC1 A;  3VKG A;  5BT3 A;  5I89 A;  5I40 A;  3JVL A;  4GPJ A;  4TZ2 A;  4A9E A;  2OO1 A;  4Y03 A;  4J1P A;  3LQJ A;  5AME A;  4YYJ A;  3DAI A;  4TZ8 A;  3G0L A;  4NR6 A;  2KTB B;  5D24 A;  2D82 A;  3S91 A;  4LDF A;  4YAX A;  5F3A A;  5IGN A;  5FFW A;  5E3G A;  4HBX A;  4UYF B;  4QR4 A;  3P1E A;  3QZV A;  5LKU A;  4UIU A;  3U5L A;  4UYG A;  4NR7 A;  3TLP A;  3HMF A;  5JWM A;  5E9M A;  5EV9 A;  3ZYU A;  4MR5 A;  5FB0 A;  4CUT A;  5FE9 A;  5F5Z A;  5KTX A;  5CQ8 A;  5LKX A;  4XY8 A;  4Z6H A;  5HQ5 A;  5H1T A;  4YBT A;  3O37 A;  4A9K A;  4QSV A;  2GRC A;  4NR8 A;  4QYD A;  4NRC A;  4NYV A;  4NYW A;  5FH7 A;  3JVM A;  4TT4 A;  2YEM A;  5K29 A;  5IG6 A;  3LQI A;  2RFJ A;  5CQ4 A;  4IR5 A;  4HBV A;  5E9I A;  2MJV B;  5A5O A;  5G4R A;  5A5P A;  4UIV A;  4HXO A;  5AD2 A;  4BJX A;  1EQF A;  5L8T A;  4O72 A;  1PUO A;  3P1F A;  4TS8 A;  4CUQ A;  5FH6 A;  4QC3 A;  2L84 A;  5HRW A;  2R10 A;  5ENI A;  5D26 A;  5H85 A;  2DVQ A;  5LKZ A;  4XUB A;  5DFB A;  3MB3 A;  4Q0N A;  4OGI A;  4YYK A;  5F1H A;  4J0R A;  5DW1 A;  3QZS A;  5C89 A;  5HFR A;  4WHU A;  5EWH A;  4AKN A;  4HXK A;  5EWD A;  4QSU A;  5DW2 A;  5EIS A;  3DWY A;  4NUD A;  5KTW A;  5EVA A;  5ENB A;  5I7X A;  4QST A;  5FE7 A;  2WP2 A;  5I86 A;  5DBM A;  5F63 A;  4E96 A;  2I8N A;  2F6N A;  5HFQ A;  5EWV A;  4NYX A;  4YH3 A;  5A5R A;  3G0J A;  5DLX A;  5L97 A;  5LJ1 A;  3U5K A;  3U5P A;  5HQ6 A;  3HMH A;  4HXL A;  5C87 A;  4QNS A;  3NXB A;  3D1B A;  5I80 A;  5I88 A;  3IU5 A;  4CL9 A;  5FE5 A;  5HCL A;  3U5J A;  4YYD A;  4NUE A;  3S92 A;  3AAD A;  2RI7 A;  2EJN A;  5H1V A;  4ZQL A;  2YEL A;  4TT6 A;  5E0R A;  5ENE A;  5FB1 A;  4F3I A;  5A81 A;  5CRM A;  5CUB A;  3QZT A;  3LJW A;  5FG5 A;  5FE4 A;  5TB6 A;  5LJ2 A;  5HEM A;  5FFV A;  4YY6 A;  3SVF A;  4YC9 A;  5HRV A;  4Z93 A;  4QSW A;  5G4S A;  4J0S A;  5C4Q A;  2G4A A;  4IR4 A;  2DWW A;  4ZC9 A;  2OUO A;  3SVG A;  5FE2 A;  4BHW A;  5A5N A;  5BT5 A;  5CU8 A;  5FE3 A;  4YYG A;  4IOQ A;  2NXB A;  4NR4 A;  2I7K A;  5D3P A;  5CY9 A;  4QEU A;  5ENC A;  5CFW A;  4N4F A;  4QUT A;  5FE8 A;  4O74 A;  5IGM A;  4HBW A;  1X0J A;  5CS8 A;  3MUK A;  5J0D A;  4WHW A;  5LJ0 A;  5IBN A;  5F1L A;  3LQH A;  4PCI A;  2DVR A;  3ERR A;  3P1D A;  5ETB A;  2R0Y A;  4UYD A;  4AI6 A;  5DKH A;  3IU6 A;  5CZG A;  5CQ3 A;  2YW5 A;  4A9F A;  3ONI A;  5L99 A;  4KCX A;  5FH8 A;  4O76 A;  4A9L A;  2H60 A;  5A5S A;  2DKW A;  3K2J A;  5D7X A;  5E7D A;  5A7C A;  1WUM A;  5COI A;  4FLP A;  5D3S A;  4PKL A;  3O36 A;  4NR5 A;  4UIT A;  2L85 A;  5FE1 A;  5IID A;  4CLB A;  4XYA A;  5FBX A;  4YAB A;  2N9G A;  5DYU A;  5EPS A;  5F36 A;  2DAT A;  4C66 A;  4YYI A;  5KHM A;  4CFK A;  5II2 A;  4N4I A;  4MEP A;  5DX4 A;  3UV4 A;  4BW1 A;  5DY7 A;  5A83 A;  5F25 A;  4XUA A;  4YYN A;  1JSP B;  3UVW A;  5HEN A;  5CPE A;  5HM0 A;  4NUC A;  3P1C A;  5II1 A;  4OUF A;  4MEN A;  2RNX A;  3MXF A;  4LR6 A;  5E3D A;  4TU6 A;  5HQ7 A;  4UIW A;  5EI4 A;  5LVQ A;  4O7B A;  2D9E A;  5DKC A;  5A85 A;  4UIY A;  5DYC A;  4O7E A;  3UV5 A;  2RS9 B;  5A5Q A;  4QUU A;  5IGL A;  4LYS A;  4O70 A;  4CUU A;  5IGK A;  5EPB A;  5HLS A;  5D25 A;  4O77 A;  4TTE A;  5TCM A;  5L96 A;  5FDZ A;  4N4G A;  5I29 A;  5CRZ A;  4QSR A;  3MQM A; 
#chains in the Genus database with same CATH homology
 3JVJ A;  4X2I A;  5FG6 A;  4KV1 A;  4MR3 A;  4QSP A;  4LZ2 A;  5D3L A;  4YBS A;  5I7Y A;  4UYE A;  5EM3 A;  5LKT A;  4QY4 A;  3D7C A;  4LZS A;  4HXN A;  5DYX A;  5AMF A;  5LUU A;  5DYA A;  4MR6 A;  5E9Y A;  4YY4 A;  5E73 A;  3I3J A;  4LYI A;  4IOO A;  5DKD A;  5ENG A;  5JI8 A;  4YH4 A;  5I83 A;  5F61 A;  3U5O A;  3O35 A;  4O71 A;  3SVH A;  2R0S A;  4PCE A;  4Q0O A;  4HXM A;  4TU4 A;  4A9J A;  3Q2F A;  5CQ6 A;  4YAT A;  4N3W A;  4MEO A;  2YQD A;  5CTL A;  5HEL A;  3AQA A;  4NRB A;  4QEW A;  4ALG A;  5E9V A;  4IR3 A;  5EP7 A;  3U5N A;  3O33 A;  4LC2 A;  5KU3 A;  5ETD A;  5CQ7 A;  2R0V A;  4QR3 A;  3LXJ A;  5DFD A;  5CUG A;  4LZR A;  2RNW A;  4QB3 A;  5CUE A;  5EIC A;  3Q2E A;  5FG4 A;  5C85 A;  5KO4 A;  1JM4 B;  4Z6I A;  3UVX A;  5ENH A;  3U5M A;  5I1Q A;  1E6I A;  5FE6 A;  5CQ5 A;  5HRX A;  4O7F A;  4MR4 A;  4PTB A;  2DVS A;  4CFL A;  3FKM X;  4BW4 A;  4HXR A;  5L8U A;  4QZS A;  3RCW A;  2WP1 A;  2E3K A;  5EPR A;  4NRA A;  5BT4 A;  1ZS5 A;  5ENJ A;  4TT2 A;  5D0C A;  5D3R A;  3UVY A;  3UVD A;  4YAD A;  2OSS A;  4Z1S A;  4A9H A;  4UYF A;  5CUD A;  4A9N A;  5L98 A;  4YYH A;  1N72 A;  5D3H A;  5LVR A;  5EQ1 A;  2E7N A;  4O78 A;  3UV2 A;  4PY6 A;  1F68 A;  2RO1 A;  4O75 A;  5ACY A;  4ALH A;  4N4H A;  4A9M A;  5CUC A;  5KTU A;  3MUL A;  2YEK A;  4PS5 A;  5CQT A;  4MEQ A;  4LYW A;  4XY9 A;  2F6J A;  5E9L A;  5F60 A;  4IOR A;  4YYM A;  4HBY A;  4ZW1 A;  3JVK A;  3HME A;  4UYH A;  5EWC A;  1WUG A;  4QBM A;  4HXP A;  4RVR A;  5D3T A;  4NQM A;  5H1U A;  4LRG A;  2DVV A;  5F62 A;  2RNY A;  2YYN A;  2L5E A;  4O7C A;  5EWW A;  4BW3 A;  5ENF A;  4WIV A;  4QYL A;  4KV4 A;  4A9I A;  4NR9 A;  4UIZ A;  5E74 A;  4UIX A;  5CUA A;  5C8G A;  5EK9 A;  4QR5 A;  5C7N A;  4CUR A;  3GG3 A;  4J3I A;  4A9O A;  5A82 A;  5E9K A;  4Z1Q A;  4QSS A;  2YDW A;  5D3N A;  3MB4 A;  5EA1 A;  4YBM A;  4TYL A;  5CQA A;  5FFY A;  5EU1 A;  5F2P A;  5CP5 A;  4NQN A;  4HXS A;  4OGJ A;  5DLZ A;  4NXJ A;  5EGU A;  4O7A A;  5HJC A;  2LSP B;  5FE0 A;  3P5O A;  4QEV A;  4CUP A;  5AD3 A;  2E7O A;  4TQN A;  4NS5 A;  3O34 A;  4DON A;  2FSA A;  5D3J A;  5DFC A;  4IR6 A;  4BW2 A;  4CUS A;  4QSQ A;  4QSX A;  5CGP A;  4C67 A;  3UW9 A;  4YK0 A;  4QC1 A;  5BT3 A;  5I89 A;  5I40 A;  3JVL A;  4GPJ A;  4TZ2 A;  4A9E A;  2OO1 A;  4Y03 A;  4J1P A;  3LQJ A;  5AME A;  4YYJ A;  3DAI A;  4TZ8 A;  3G0L A;  4NR6 A;  2KTB B;  5D24 A;  2D82 A;  3S91 A;  4LDF A;  4YAX A;  5F3A A;  5IGN A;  5FFW A;  5E3G A;  4HBX A;  4UYF B;  4QR4 A;  3P1E A;  3QZV A;  5LKU A;  4UIU A;  3U5L A;  4UYG A;  4NR7 A;  3TLP A;  3HMF A;  5JWM A;  5E9M A;  5EV9 A;  3ZYU A;  4MR5 A;  5FB0 A;  4CUT A;  5FE9 A;  5F5Z A;  5KTX A;  5CQ8 A;  5LKX A;  4XY8 A;  4Z6H A;  5HQ5 A;  5H1T A;  4YBT A;  3O37 A;  4A9K A;  4QSV A;  2GRC A;  4NR8 A;  4QYD A;  4NRC A;  4NYV A;  4NYW A;  5FH7 A;  3JVM A;  4TT4 A;  2YEM A;  5K29 A;  5IG6 A;  3LQI A;  2RFJ A;  5CQ4 A;  4IR5 A;  4HBV A;  5E9I A;  2MJV B;  5A5O A;  5G4R A;  5A5P A;  4UIV A;  4HXO A;  5AD2 A;  4BJX A;  1EQF A;  5L8T A;  4O72 A;  3P1F A;  4TS8 A;  4CUQ A;  5FH6 A;  4QC3 A;  2L84 A;  5HRW A;  2R10 A;  5ENI A;  5D26 A;  5H85 A;  2DVQ A;  5LKZ A;  4XUB A;  5DFB A;  3MB3 A;  4Q0N A;  4OGI A;  4YYK A;  5F1H A;  4J0R A;  5DW1 A;  3QZS A;  5C89 A;  5HFR A;  4WHU A;  5EWH A;  4AKN A;  4HXK A;  5EWD A;  4QSU A;  5DW2 A;  5EIS A;  3DWY A;  4NUD A;  5KTW A;  5EVA A;  5ENB A;  5I7X A;  4QST A;  5FE7 A;  2WP2 A;  5I86 A;  5DBM A;  5F63 A;  4E96 A;  2I8N A;  2F6N A;  5HFQ A;  5EWV A;  4NYX A;  4YH3 A;  5A5R A;  3G0J A;  5DLX A;  5L97 A;  5LJ1 A;  3U5K A;  3U5P A;  5HQ6 A;  3HMH A;  4HXL A;  5C87 A;  4QNS A;  3NXB A;  5I80 A;  5I88 A;  3IU5 A;  4CL9 A;  5FE5 A;  5HCL A;  3U5J A;  4YYD A;  4NUE A;  3S92 A;  3AAD A;  2RI7 A;  5H1V A;  4ZQL A;  2YEL A;  4TT6 A;  5E0R A;  5ENE A;  5FB1 A;  4F3I A;  5A81 A;  5CRM A;  5CUB A;  3QZT A;  3LJW A;  5FG5 A;  5FE4 A;  5TB6 A;  5LJ2 A;  5HEM A;  5FFV A;  4YY6 A;  3SVF A;  4YC9 A;  5HRV A;  4Z93 A;  4QSW A;  5G4S A;  4J0S A;  5C4Q A;  2G4A A;  4IR4 A;  2DWW A;  4ZC9 A;  2OUO A;  3SVG A;  5FE2 A;  4BHW A;  5A5N A;  5BT5 A;  5CU8 A;  5FE3 A;  4YYG A;  4IOQ A;  2NXB A;  4NR4 A;  2I7K A;  5D3P A;  5CY9 A;  4QEU A;  5ENC A;  5CFW A;  4N4F A;  4QUT A;  5FE8 A;  4O74 A;  5IGM A;  4HBW A;  1X0J A;  5CS8 A;  3MUK A;  5J0D A;  4WHW A;  5LJ0 A;  5IBN A;  5F1L A;  3LQH A;  4PCI A;  2DVR A;  3P1D A;  5ETB A;  2R0Y A;  4UYD A;  5DKH A;  3IU6 A;  5CZG A;  5CQ3 A;  2YW5 A;  4A9F A;  3ONI A;  5L99 A;  4KCX A;  5FH8 A;  4O76 A;  4A9L A;  2H60 A;  5A5S A;  2DKW A;  3K2J A;  5D7X A;  5E7D A;  5A7C A;  1WUM A;  5COI A;  4FLP A;  5D3S A;  4PKL A;  3O36 A;  4NR5 A;  4UIT A;  2L85 A;  5FE1 A;  5IID A;  4CLB A;  4XYA A;  5FBX A;  4YAB A;  2N9G A;  5DYU A;  5EPS A;  5F36 A;  2DAT A;  4C66 A;  4YYI A;  5KHM A;  4CFK A;  5II2 A;  4N4I A;  4MEP A;  5DX4 A;  3UV4 A;  4BW1 A;  5DY7 A;  5A83 A;  5F25 A;  4XUA A;  4YYN A;  1JSP B;  3UVW A;  5HEN A;  5CPE A;  5HM0 A;  4NUC A;  3P1C A;  5II1 A;  4OUF A;  4MEN A;  2RNX A;  3MXF A;  4LR6 A;  5E3D A;  4TU6 A;  5HQ7 A;  4UIW A;  5EI4 A;  5LVQ A;  4O7B A;  2D9E A;  5DKC A;  5A85 A;  4UIY A;  5DYC A;  4O7E A;  3UV5 A;  2RS9 B;  5A5Q A;  4QUU A;  5IGL A;  4LYS A;  4O70 A;  4CUU A;  5IGK A;  5EPB A;  5HLS A;  5D25 A;  4O77 A;  4TTE A;  5TCM A;  5L96 A;  5FDZ A;  4N4G A;  5I29 A;  5CRZ A;  4QSR A;  3MQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...