4A9JA

N-terminal bromodomain of human brd2 with n-(4-hydroxyphenyl) acetamide
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
112
structure length
112
Chain Sequence
VTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BROMODOMAIN CONTAINING 2
publication title Fragment-Based Discovery of Bromodomain Inhibitors Part 1: Inhibitor Binding Modes and Implications for Lead Discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 38
structure length 112
sequence length 112
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4a9jA00
4QSVA 5CQ7A 3LQHA 4MR5A 4MEQA 3QZTA 5II1A 5A5RA 5FE6A 4O7BA 5L8TA 5HQ7A 3AADA 5I40A 4TU4A 5CU8A 4X2IA 5CFWA 5HELA 5FH6A 2KTBB 3MUKA 4LZSA 4KV4A 5E9YA 5E9MA 4O74A 1E6IA 2NXBA 4TQNA 5FE7A 2F6JA 5KHMA 2FSAA 4CL9A 3U5PA 5FDZA 4IOOA 4YATA 5F2PA 4Z6IA 4YY6A 5E7DA 4NUEA 4TZ8A 4O72A 4UYHA 5DKHA 4HXMA 5DW1A 3U5OA 3O34A 2YQDA 3JVKA 5I7XA 5JI8A 4O7EA 4ZC9A 5H85A 5KO4A 5IGNA 5KTXA 4N4GA 4IOQA 4NYVA 4YAXA 4Y03A 5D0CA 5CUAA 5E0RA 4BW2A 4NQMA 5I7YA 5CUCA 4IORA 4A9JA 4YY4A 3UVYA 3MB4A 3I3JA 4TZ2A 3U5JA 4QSWA 4Z1SA 2E3KA 4QZSA 4N4HA 5HJCA 3MQMA 4FLPA 3TLPA 5JWMA 5CQ3A 3P1CA 5EK9A 5EV9A 4Q0OA 4NR8A 5A5OA 4UIWA 5FB0A 4QEWA 5E74A 3LQJA 5HRVA 2RNYA 4NRCA 5FE3A 3G0JA 3U5MA 5DKDA 4A9HA 3P5OA 5BT5A 4BJXA 5FE2A 4IR5A 5HLSA 4LYIA 4CUUA 4NR6A 5DLZA 5C4QA 5DYXA 5DY7A 5IGMA 5CP5A 2E7NA 4N4IA 5HEMA 5C87A 3SVHA 4NQNA 5EA1A 4YYMA 3MXFA 4TT4A 5TB6A 4LZRA 5D3NA 1F68A 2OSSA 4F3IA 4O7AA 5FE1A 5EU1A 4XYAA 5E3DA 4YYNA 5HRWA 5FH8A 4BHWA 4UIVA 5AMFA 5A5QA 2YYNA 3HMEA 4J1PA 4A9FA 4XUBA 4YK0A 4RVRA 5D3JA 2RFJA 4A9LA 2L84A 4QR3A 5C7NA 3Q2FA 4NUCA 2D9EA 4QC1A 5CQ4A 5ETBA 2YDWA 4IR6A 3U5KA 3QZSA 5DBMA 5CUBA 5ENIA 1EQFA 5F61A 5HFQA 2WP2A 5DW2A 5G4SA 4C67A 5D3SA 4QC3A 1JSPB 5DYCA 5CUGA 5ENGA 5FG6A 5KTWA 5EM3A 4AKNA 4BW4A 5EWVA 5CQ5A 3AQAA 5A5SA 3U5NA 3IU5A 3QZVA 4DONA 5EWWA 5EP7A 4XY8A 4QEVA 1JM4B 4TT2A 4XY9A 5EPSA 5E9VA 5FE0A 4N3WA 4HBVA 5HRXA 4MR6A 4TTEA 3ONIA 5HM0A 3FKMX 5AD2A 5DFBA 4YBTA 4QYLA 5DYAA 3SVFA 4LDFA 5I86A 4QUUA 2R0SA 5D24A 5E73A 4QUTA 4NXJA 5EQ1A 4J0SA 2LSPB 4NRAA 5F3AA 4QSPA 2GRCA 2D82A 1WUGA 4Q0NA 4O71A 4OGIA 5H1UA 5LKXA 4KCXA 2DATA 4UYFA 5FH7A 3SVGA 3P1EA 4A9NA 3UW9A 4WHUA 5D3LA 5FE4A 3DWYA 5I89A 2R0YA 4ALHA 4UIXA 4O7CA 1X0JA 5HQ5A 5CZGA 5A82A 5FFYA 4E96A 5D3PA 4NYXA 5J0DA 5FG4A 3UVXA 5FFWA 4QB3A 5EGUA 5IGLA 5LVQA 4CUQA 4O75A 5HENA 3MB3A 4PCIA 4IR4A 3O33A 3MULA 5EWHA 4QR4A 5H1TA 4A9EA 4QYDA 4PY6A 3O36A 5II2A 3UVDA 4NRBA 2DVSA 2I8NA 4UIYA 5CQ8A 4YYJA 3ZYUA 1WUMA 4UYDA 2YELA 5C89A 5D7XA 5CTLA 5HCLA 2F6NA 4TU6A 5ENBA 5LVRA 4UIUA 5CQ6A 4WIVA 5I80A 4UYFB 4TT6A 2RS9B 5E9IA 5A81A 3D7CA 5CQTA 5CS8A 4TYLA 5EWDA 5FB1A 5DYUA 3LJWA 2H60A 5IGKA 4ZQLA 4YYDA 5I83A 4NUDA 5ENFA 4C66A 5L98A 4QSTA 5EISA 5FFVA 4A9MA 5EICA 4GPJA 5LKZA 4NS5A 5BT4A 2OO1A 5F5ZA 5EWCA 4IR3A 4NR4A 4N4FA 4QSUA 5LJ1A 3G0LA 5G4RA 4A9IA 4CFKA 5ACYA 5CQAA 4O70A 4WHWA 4LZ2A 4QNSA 4NYWA 3P1FA 3JVLA 2RNXA 3O35A 4HXRA 4KV1A 5DLXA 5F62A 4QEUA 4ALGA 3UV4A 5D3RA 3JVJA 2WP1A 5F60A 4LYWA 5C8GA 4YYIA 5F1LA 3K2JA 4NR9A 5LKTA 5DX4A 3DAIA 5E9KA 4HXLA 4HBWA 3HMFA 4UITA 4YBMA 4MEOA 2RO1A 4HBYA 4QSSA 4O76A 4BW3A 5ENJA 5DKCA 5AMEA 4UYEA 4HXNA 2N9GA 4CLBA 4YADA 4LC2A 5D3HA 4CUSA 2R10A 2DKWA 4QY4A 5CPEA 4YYKA 5DFDA 5H1VA 3RCWA 4CUTA 5C85A 5FE5A 4QSXA 5EPBA 4NR5A 4PTBA 4MENA 2L5EA 4PS5A 4PKLA 5CY9A 5DFCA 4A9OA 5KTUA 3NXBA 4QSRA 4LR6A 2OUOA 4YABA 4LYSA 4XUAA 1ZS5A 4YYGA 5FE9A 5F63A 4Z6HA 5HQ6A 3UV5A 5A5PA 4HBXA 5D26A 5CRZA 3P1DA 4YH3A 4Z93A 5LJ0A 4J0RA 3UV2A 4HXOA 3HMHA 5TCMA 5L8UA 5F25A 5L96A 5ENHA 4OUFA 3Q2EA 5CGPA 5KU3A 4J3IA 5LJ2A 2DVQA 3JVMA 5F36A 3GG3A 4MR3A 4O77A 4HXKA 4YBSA 5I29A 5A7CA 4UIZA 2YEMA 4UYGA 5EI4A 3LQIA 5L99A 2DVRA 5L97A 4TS8A 3IU6A 3UVWA 5A83A 5FE8A 2DVVA 2DWWA 5CUEA 5A5NA 5EPRA 5HFRA 4A9KA 4YYHA 4QSQA 4Z1QA 4YC9A 5ENCA 5AD3A 4BW1A 3S92A 2MJVB 2YW5A 5LKUA 3LXJA 5BT3A 4QBMA 5IIDA 2G4AA 3O37A 4MR4A 4CURA 4ZW1A 2E7OA 5D3TA 5D25A 5COIA 4OGJA 4QR5A 5EVAA 3U5LA 2RNWA 4CUPA 5FG5A 4LRGA 4CFLA 5K29A 4HXSA 5E3GA 5A85A 4PCEA 5F1HA 4MEPA 2L85A 2R0VA 5CUDA 5E9LA 5CRMA 5I1QA 4NR7A 5ENEA 2I7KA 4O78A 5IBNA 5IG6A 4O7FA 2YEKA 5LUUA 4HXPA 5ETDA 4YH4A 3S91A 2RI7A 5I88A 5FBXA 1N72A
chains in the Genus database with same CATH superfamily
4QSVA 5CQ7A 3LQHA 4MR5A 4MEQA 3QZTA 5II1A 5A5RA 5FE6A 4O7BA 5L8TA 5HQ7A 3AADA 5I40A 4TU4A 5CU8A 4X2IA 5CFWA 5HELA 5FH6A 2KTBB 3MUKA 4LZSA 4KV4A 5E9YA 5E9MA 4O74A 1E6IA 2NXBA 4TQNA 5FE7A 2F6JA 5KHMA 2FSAA 4CL9A 3U5PA 5FDZA 4IOOA 4YATA 5F2PA 4Z6IA 4YY6A 5E7DA 4NUEA 4TZ8A 4O72A 4UYHA 5DKHA 4HXMA 5DW1A 1ZKRA 3U5OA 3O34A 2YQDA 3JVKA 5I7XA 5JI8A 4O7EA 4ZC9A 2EJNA 5H85A 5KO4A 5IGNA 5KTXA 4N4GA 4IOQA 4NYVA 4YAXA 4Y03A 5D0CA 5CUAA 5E0RA 4BW2A 4NQMA 5I7YA 5CUCA 4IORA 4A9JA 4YY4A 3UVYA 3MB4A 3I3JA 4TZ2A 3U5JA 4QSWA 4Z1SA 2E3KA 4QZSA 4N4HA 5HJCA 3MQMA 4FLPA 3TLPA 5JWMA 5CQ3A 3P1CA 5EK9A 5EV9A 4Q0OA 4NR8A 5A5OA 4UIWA 5FB0A 4QEWA 5E74A 3LQJA 5HRVA 2RNYA 4NRCA 5FE3A 3G0JA 3U5MA 5DKDA 4A9HA 3P5OA 5BT5A 4BJXA 5FE2A 4IR5A 5HLSA 4LYIA 4CUUA 4NR6A 5DLZA 5C4QA 5DYXA 5DY7A 5IGMA 5CP5A 2E7NA 4N4IA 5HEMA 5C87A 3SVHA 4NQNA 5EA1A 4YYMA 3MXFA 4TT4A 5TB6A 4LZRA 5D3NA 1F68A 2OSSA 4F3IA 4O7AA 5FE1A 5EU1A 4XYAA 5E3DA 4YYNA 5HRWA 5FH8A 4BHWA 4UIVA 5AMFA 3ERRA 5A5QA 2YYNA 3HMEA 4J1PA 4A9FA 4XUBA 4YK0A 4RVRA 5D3JA 2RFJA 4A9LA 2L84A 4QR3A 5C7NA 3Q2FA 4NUCA 2D9EA 4QC1A 5CQ4A 5ETBA 2YDWA 4IR6A 3U5KA 3QZSA 5DBMA 5CUBA 5ENIA 1EQFA 5F61A 5HFQA 2WP2A 5DW2A 5G4SA 4C67A 5D3SA 4QC3A 1JSPB 5DYCA 5CUGA 5ENGA 5FG6A 5KTWA 5EM3A 4AKNA 4BW4A 5EWVA 5CQ5A 3AQAA 5A5SA 3U5NA 3IU5A 3QZVA 4DONA 5EWWA 5EP7A 4XY8A 4QEVA 1JM4B 4TT2A 4XY9A 5EPSA 5E9VA 5FE0A 4N3WA 4HBVA 5HRXA 4MR6A 4TTEA 3ONIA 5HM0A 3FKMX 5AD2A 5DFBA 4YBTA 4QYLA 5DYAA 3SVFA 4LDFA 5I86A 4QUUA 2R0SA 5D24A 5E73A 4QUTA 4NXJA 5EQ1A 4J0SA 2LSPB 4NRAA 5F3AA 4QSPA 2GRCA 2D82A 1WUGA 4Q0NA 4O71A 4OGIA 5H1UA 5LKXA 4KCXA 2DATA 4UYFA 5FH7A 3SVGA 3P1EA 4A9NA 3UW9A 4WHUA 5D3LA 5FE4A 3DWYA 5I89A 2R0YA 4ALHA 4UIXA 4O7CA 1X0JA 5HQ5A 5CZGA 5A82A 5FFYA 4E96A 5D3PA 4NYXA 5J0DA 5FG4A 3UVXA 5FFWA 4QB3A 5EGUA 5IGLA 5LVQA 4AKIA 4CUQA 4O75A 5HENA 3MB3A 4PCIA 4IR4A 3O33A 3MULA 5EWHA 4QR4A 5H1TA 4A9EA 4QYDA 4PY6A 3O36A 5II2A 3UVDA 4NRBA 2DVSA 2I8NA 4UIYA 5CQ8A 4YYJA 3ZYUA 1WUMA 4UYDA 2YELA 5C89A 5D7XA 5CTLA 5HCLA 2F6NA 4TU6A 5ENBA 5LVRA 4UIUA 5CQ6A 4WIVA 5I80A 4UYFB 4TT6A 2RS9B 5E9IA 5A81A 3D7CA 5CQTA 4AKGA 5CS8A 4TYLA 5EWDA 5FB1A 5DYUA 3LJWA 2H60A 5IGKA 4ZQLA 4YYDA 5I83A 4NUDA 5ENFA 4C66A 5L98A 4QSTA 5EISA 5FFVA 4A9MA 5EICA 4GPJA 5LKZA 4NS5A 5BT4A 2OO1A 5F5ZA 5EWCA 4IR3A 4NR4A 4N4FA 4QSUA 5LJ1A 3G0LA 5G4RA 4A9IA 4CFKA 5ACYA 5CQAA 4O70A 4WHWA 4LZ2A 4QNSA 4NYWA 3P1FA 3JVLA 2RNXA 3O35A 4HXRA 4KV1A 5DLXA 5F62A 4QEUA 4ALGA 3UV4A 5D3RA 3JVJA 2WP1A 5F60A 4LYWA 5C8GA 4YYIA 5F1LA 3K2JA 4NR9A 5LKTA 5DX4A 3DAIA 5E9KA 4HXLA 4HBWA 3HMFA 4UITA 4YBMA 4MEOA 2RO1A 4HBYA 4QSSA 4O76A 4BW3A 5ENJA 5DKCA 5AMEA 4UYEA 4HXNA 2N9GA 4CLBA 4YADA 4LC2A 5D3HA 4CUSA 2R10A 2DKWA 4QY4A 5CPEA 4YYKA 5DFDA 5H1VA 3RCWA 4CUTA 5C85A 5FE5A 4QSXA 5EPBA 4NR5A 4PTBA 4MENA 2L5EA 4PS5A 4PKLA 5CY9A 5DFCA 4A9OA 5KTUA 3NXBA 4QSRA 4LR6A 2OUOA 4YABA 4LYSA 4XUAA 1ZS5A 4YYGA 5FE9A 5F63A 4Z6HA 5HQ6A 3UV5A 5A5PA 4HBXA 5D26A 5CRZA 3P1DA 4YH3A 4Z93A 5LJ0A 4J0RA 3UV2A 4HXOA 3HMHA 5TCMA 5L8UA 5F25A 5L96A 5ENHA 4OUFA 3Q2EA 5CGPA 5KU3A 4J3IA 5LJ2A 2DVQA 3JVMA 5F36A 3GG3A 4MR3A 4O77A 4HXKA 4YBSA 5I29A 5A7CA 4UIZA 2YEMA 4UYGA 5EI4A 3LQIA 5L99A 3D1DA 2DVRA 5L97A 4TS8A 3IU6A 4AI6A 3UVWA 1PUOA 5A83A 5FE8A 2DVVA 2DWWA 5CUEA 4AKHA 5A5NA 5EPRA 5HFRA 4A9KA 4YYHA 4QSQA 4Z1QA 4YC9A 5ENCA 5AD3A 4BW1A 3S92A 2MJVB 2YW5A 5LKUA 3VKHA 3LXJA 5BT3A 4QBMA 5IIDA 2G4AA 3D1BA 3VKGA 3O37A 4MR4A 4CURA 4ZW1A 2E7OA 5D3TA 5D25A 5COIA 4OGJA 4QR5A 5EVAA 3U5LA 2RNWA 4CUPA 5FG5A 4LRGA 4CFLA 5K29A 4HXSA 5E3GA 5A85A 4PCEA 5F1HA 4MEPA 2L85A 2R0VA 5CUDA 5E9LA 5CRMA 5I1QA 4NR7A 5ENEA 2I7KA 4O78A 5IBNA 5IG6A 4O7FA 2YEKA 5LUUA 4HXPA 5ETDA 4YH4A 3S91A 2RI7A 5I88A 5FBXA 1N72A
chains in the Genus database with same CATH topology
4QSVA 5CQ7A 3LQHA 4MR5A 4MEQA 3QZTA 5II1A 5A5RA 5FE6A 4O7BA 5L8TA 5HQ7A 3AADA 5I40A 4TU4A 5CU8A 4X2IA 5CFWA 5HELA 5FH6A 2KTBB 3MUKA 4LZSA 4KV4A 5E9YA 5E9MA 4O74A 1E6IA 2NXBA 4TQNA 5FE7A 2F6JA 5KHMA 2FSAA 4CL9A 3U5PA 5FDZA 4IOOA 4YATA 5F2PA 4Z6IA 4YY6A 5E7DA 4NUEA 4TZ8A 4O72A 4UYHA 5DKHA 4HXMA 5DW1A 3U5OA 3O34A 2YQDA 3JVKA 5I7XA 5JI8A 4O7EA 4ZC9A 5H85A 5KO4A 5IGNA 5KTXA 4N4GA 4IOQA 4NYVA 4YAXA 4Y03A 5D0CA 5CUAA 5E0RA 4BW2A 4NQMA 5I7YA 5CUCA 4IORA 4A9JA 4YY4A 3UVYA 3MB4A 3I3JA 4TZ2A 3U5JA 4QSWA 4Z1SA 2E3KA 4QZSA 4N4HA 5HJCA 3MQMA 4FLPA 3TLPA 5JWMA 5CQ3A 3P1CA 5EK9A 5EV9A 4Q0OA 4NR8A 5A5OA 4UIWA 5FB0A 4QEWA 5E74A 3LQJA 5HRVA 2RNYA 4NRCA 5FE3A 3G0JA 3U5MA 5DKDA 4A9HA 3P5OA 5BT5A 4BJXA 5FE2A 4IR5A 5HLSA 4LYIA 4CUUA 4NR6A 5DLZA 5C4QA 5DYXA 5DY7A 5IGMA 5CP5A 2E7NA 4N4IA 5HEMA 5C87A 3SVHA 4NQNA 5EA1A 4YYMA 3MXFA 4TT4A 5TB6A 4LZRA 5D3NA 1F68A 2OSSA 4F3IA 4O7AA 5FE1A 5EU1A 4XYAA 5E3DA 4YYNA 5HRWA 5FH8A 4BHWA 4UIVA 5AMFA 5A5QA 2YYNA 3HMEA 4J1PA 4A9FA 4XUBA 4YK0A 4RVRA 5D3JA 2RFJA 4A9LA 2L84A 4QR3A 5C7NA 3Q2FA 4NUCA 2D9EA 4QC1A 5CQ4A 5ETBA 2YDWA 4IR6A 3U5KA 3QZSA 5DBMA 5CUBA 5ENIA 1EQFA 5F61A 5HFQA 2WP2A 5DW2A 5G4SA 4C67A 5D3SA 4QC3A 1JSPB 5DYCA 5CUGA 5ENGA 5FG6A 5KTWA 5EM3A 4AKNA 4BW4A 5EWVA 5CQ5A 3AQAA 5A5SA 3U5NA 3IU5A 3QZVA 4DONA 5EWWA 5EP7A 4XY8A 4QEVA 1JM4B 4TT2A 4XY9A 5EPSA 5E9VA 5FE0A 4N3WA 4HBVA 5HRXA 4MR6A 4TTEA 3ONIA 5HM0A 3FKMX 5AD2A 5DFBA 4YBTA 4QYLA 5DYAA 3SVFA 4LDFA 5I86A 4QUUA 2R0SA 5D24A 5E73A 4QUTA 4NXJA 5EQ1A 4J0SA 2LSPB 4NRAA 5F3AA 4QSPA 2GRCA 2D82A 1WUGA 4Q0NA 4O71A 4OGIA 5H1UA 5LKXA 4KCXA 2DATA 4UYFA 5FH7A 3SVGA 3P1EA 4A9NA 3UW9A 4WHUA 5D3LA 5FE4A 3DWYA 5I89A 2R0YA 4ALHA 4UIXA 4O7CA 1X0JA 5HQ5A 5CZGA 5A82A 5FFYA 4E96A 5D3PA 4NYXA 5J0DA 5FG4A 3UVXA 5FFWA 4QB3A 5EGUA 5IGLA 5LVQA 4CUQA 4O75A 5HENA 3MB3A 4PCIA 4IR4A 3O33A 3MULA 5EWHA 4QR4A 5H1TA 4A9EA 4QYDA 4PY6A 3O36A 5II2A 3UVDA 4NRBA 2DVSA 2I8NA 4UIYA 5CQ8A 4YYJA 3ZYUA 1WUMA 4UYDA 2YELA 5C89A 5D7XA 5CTLA 5HCLA 2F6NA 4TU6A 5ENBA 5LVRA 4UIUA 5CQ6A 4WIVA 5I80A 4UYFB 4TT6A 2RS9B 5E9IA 5A81A 3D7CA 5CQTA 5CS8A 4TYLA 5EWDA 5FB1A 5DYUA 3LJWA 2H60A 5IGKA 4ZQLA 4YYDA 5I83A 4NUDA 5ENFA 4C66A 5L98A 4QSTA 5EISA 5FFVA 4A9MA 5EICA 4GPJA 5LKZA 4NS5A 5BT4A 2OO1A 5F5ZA 5EWCA 4IR3A 4NR4A 4N4FA 4QSUA 5LJ1A 3G0LA 5G4RA 4A9IA 4CFKA 5ACYA 5CQAA 4O70A 4WHWA 4LZ2A 4QNSA 4NYWA 3P1FA 3JVLA 2RNXA 3O35A 4HXRA 4KV1A 5DLXA 5F62A 4QEUA 4ALGA 3UV4A 5D3RA 3JVJA 2WP1A 5F60A 4LYWA 5C8GA 4YYIA 5F1LA 3K2JA 4NR9A 5LKTA 5DX4A 3DAIA 5E9KA 4HXLA 4HBWA 3HMFA 4UITA 4YBMA 4MEOA 2RO1A 4HBYA 4QSSA 4O76A 4BW3A 5ENJA 5DKCA 5AMEA 4UYEA 4HXNA 2N9GA 4CLBA 4YADA 4LC2A 5D3HA 4CUSA 2R10A 2DKWA 4QY4A 5CPEA 4YYKA 5DFDA 5H1VA 3RCWA 4CUTA 5C85A 5FE5A 4QSXA 5EPBA 4NR5A 4PTBA 4MENA 2L5EA 4PS5A 4PKLA 5CY9A 5DFCA 4A9OA 5KTUA 3NXBA 4QSRA 4LR6A 2OUOA 4YABA 4LYSA 4XUAA 1ZS5A 4YYGA 5FE9A 5F63A 4Z6HA 5HQ6A 3UV5A 5A5PA 4HBXA 5D26A 5CRZA 3P1DA 4YH3A 4Z93A 5LJ0A 4J0RA 3UV2A 4HXOA 3HMHA 5TCMA 5L8UA 5F25A 5L96A 5ENHA 4OUFA 3Q2EA 5CGPA 5KU3A 4J3IA 5LJ2A 2DVQA 3JVMA 5F36A 3GG3A 4MR3A 4O77A 4HXKA 4YBSA 5I29A 5A7CA 4UIZA 2YEMA 4UYGA 5EI4A 3LQIA 5L99A 2DVRA 5L97A 4TS8A 3IU6A 3UVWA 5A83A 5FE8A 2DVVA 2DWWA 5CUEA 5A5NA 5EPRA 5HFRA 4A9KA 4YYHA 4QSQA 4Z1QA 4YC9A 5ENCA 5AD3A 4BW1A 3S92A 2MJVB 2YW5A 5LKUA 3LXJA 5BT3A 4QBMA 5IIDA 2G4AA 3O37A 4MR4A 4CURA 4ZW1A 2E7OA 5D3TA 5D25A 5COIA 4OGJA 4QR5A 5EVAA 3U5LA 2RNWA 4CUPA 5FG5A 4LRGA 4CFLA 5K29A 4HXSA 5E3GA 5A85A 4PCEA 5F1HA 4MEPA 2L85A 2R0VA 5CUDA 5E9LA 5CRMA 5I1QA 4NR7A 5ENEA 2I7KA 4O78A 5IBNA 5IG6A 4O7FA 2YEKA 5LUUA 4HXPA 5ETDA 4YH4A 3S91A 2RI7A 5I88A 5FBXA 1N72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QSV A;  5CQ7 A;  3LQH A;  4MR5 A;  4MEQ A;  3QZT A;  5II1 A;  5A5R A;  5FE6 A;  4O7B A;  5L8T A;  5HQ7 A;  3AAD A;  5I40 A;  4TU4 A;  5CU8 A;  4X2I A;  5CFW A;  5HEL A;  5FH6 A;  2KTB B;  3MUK A;  4LZS A;  4KV4 A;  5E9Y A;  5E9M A;  4O74 A;  1E6I A;  2NXB A;  4TQN A;  5FE7 A;  2F6J A;  5KHM A;  2FSA A;  4CL9 A;  3U5P A;  5FDZ A;  4IOO A;  4YAT A;  5F2P A;  4Z6I A;  4YY6 A;  5E7D A;  4NUE A;  4TZ8 A;  4O72 A;  4UYH A;  5DKH A;  4HXM A;  5DW1 A;  3U5O A;  3O34 A;  2YQD A;  3JVK A;  5I7X A;  5JI8 A;  4O7E A;  4ZC9 A;  5H85 A;  5KO4 A;  5IGN A;  5KTX A;  4N4G A;  4IOQ A;  4NYV A;  4YAX A;  4Y03 A;  5D0C A;  5CUA A;  5E0R A;  4BW2 A;  4NQM A;  5I7Y A;  5CUC A;  4IOR A;  4A9J A;  4YY4 A;  3UVY A;  3MB4 A;  3I3J A;  4TZ2 A;  3U5J A;  4QSW A;  4Z1S A;  2E3K A;  4QZS A;  4N4H A;  5HJC A;  3MQM A;  4FLP A;  3TLP A;  5JWM A;  5CQ3 A;  3P1C A;  5EK9 A;  5EV9 A;  4Q0O A;  4NR8 A;  5A5O A;  4UIW A;  5FB0 A;  4QEW A;  5E74 A;  3LQJ A;  5HRV A;  2RNY A;  4NRC A;  5FE3 A;  3G0J A;  3U5M A;  5DKD A;  4A9H A;  3P5O A;  5BT5 A;  4BJX A;  5FE2 A;  4IR5 A;  5HLS A;  4LYI A;  4CUU A;  4NR6 A;  5DLZ A;  5C4Q A;  5DYX A;  5DY7 A;  5IGM A;  5CP5 A;  2E7N A;  4N4I A;  5HEM A;  5C87 A;  3SVH A;  4NQN A;  5EA1 A;  4YYM A;  3MXF A;  4TT4 A;  5TB6 A;  4LZR A;  5D3N A;  1F68 A;  2OSS A;  4F3I A;  4O7A A;  5FE1 A;  5EU1 A;  4XYA A;  5E3D A;  4YYN A;  5HRW A;  5FH8 A;  4BHW A;  4UIV A;  5AMF A;  5A5Q A;  2YYN A;  3HME A;  4J1P A;  4A9F A;  4XUB A;  4YK0 A;  4RVR A;  5D3J A;  2RFJ A;  4A9L A;  2L84 A;  4QR3 A;  5C7N A;  3Q2F A;  4NUC A;  2D9E A;  4QC1 A;  5CQ4 A;  5ETB A;  2YDW A;  4IR6 A;  3U5K A;  3QZS A;  5DBM A;  5CUB A;  5ENI A;  1EQF A;  5F61 A;  5HFQ A;  2WP2 A;  5DW2 A;  5G4S A;  4C67 A;  5D3S A;  4QC3 A;  1JSP B;  5DYC A;  5CUG A;  5ENG A;  5FG6 A;  5KTW A;  5EM3 A;  4AKN A;  4BW4 A;  5EWV A;  5CQ5 A;  3AQA A;  5A5S A;  3U5N A;  3IU5 A;  3QZV A;  4DON A;  5EWW A;  5EP7 A;  4XY8 A;  4QEV A;  1JM4 B;  4TT2 A;  4XY9 A;  5EPS A;  5E9V A;  5FE0 A;  4N3W A;  4HBV A;  5HRX A;  4MR6 A;  4TTE A;  3ONI A;  5HM0 A;  3FKM X;  5AD2 A;  5DFB A;  4YBT A;  4QYL A;  5DYA A;  3SVF A;  4LDF A;  5I86 A;  4QUU A;  2R0S A;  5D24 A;  5E73 A;  4QUT A;  4NXJ A;  5EQ1 A;  4J0S A;  2LSP B;  4NRA A;  5F3A A;  4QSP A;  2GRC A;  2D82 A;  1WUG A;  4Q0N A;  4O71 A;  4OGI A;  5H1U A;  5LKX A;  4KCX A;  2DAT A;  4UYF A;  5FH7 A;  3SVG A;  3P1E A;  4A9N A;  3UW9 A;  4WHU A;  5D3L A;  5FE4 A;  3DWY A;  5I89 A;  2R0Y A;  4ALH A;  4UIX A;  4O7C A;  1X0J A;  5HQ5 A;  5CZG A;  5A82 A;  5FFY A;  4E96 A;  5D3P A;  4NYX A;  5J0D A;  5FG4 A;  3UVX A;  5FFW A;  4QB3 A;  5EGU A;  5IGL A;  5LVQ A;  4CUQ A;  4O75 A;  5HEN A;  3MB3 A;  4PCI A;  4IR4 A;  3O33 A;  3MUL A;  5EWH A;  4QR4 A;  5H1T A;  4A9E A;  4QYD A;  4PY6 A;  3O36 A;  5II2 A;  3UVD A;  4NRB A;  2DVS A;  2I8N A;  4UIY A;  5CQ8 A;  4YYJ A;  3ZYU A;  1WUM A;  4UYD A;  2YEL A;  5C89 A;  5D7X A;  5CTL A;  5HCL A;  2F6N A;  4TU6 A;  5ENB A;  5LVR A;  4UIU A;  5CQ6 A;  4WIV A;  5I80 A;  4UYF B;  4TT6 A;  2RS9 B;  5E9I A;  5A81 A;  3D7C A;  5CQT A;  5CS8 A;  4TYL A;  5EWD A;  5FB1 A;  5DYU A;  3LJW A;  2H60 A;  5IGK A;  4ZQL A;  4YYD A;  5I83 A;  4NUD A;  5ENF A;  4C66 A;  5L98 A;  4QST A;  5EIS A;  5FFV A;  4A9M A;  5EIC A;  4GPJ A;  5LKZ A;  4NS5 A;  5BT4 A;  2OO1 A;  5F5Z A;  5EWC A;  4IR3 A;  4NR4 A;  4N4F A;  4QSU A;  5LJ1 A;  3G0L A;  5G4R A;  4A9I A;  4CFK A;  5ACY A;  5CQA A;  4O70 A;  4WHW A;  4LZ2 A;  4QNS A;  4NYW A;  3P1F A;  3JVL A;  2RNX A;  3O35 A;  4HXR A;  4KV1 A;  5DLX A;  5F62 A;  4QEU A;  4ALG A;  3UV4 A;  5D3R A;  3JVJ A;  2WP1 A;  5F60 A;  4LYW A;  5C8G A;  4YYI A;  5F1L A;  3K2J A;  4NR9 A;  5LKT A;  5DX4 A;  3DAI A;  5E9K A;  4HXL A;  4HBW A;  3HMF A;  4UIT A;  4YBM A;  4MEO A;  2RO1 A;  4HBY A;  4QSS A;  4O76 A;  4BW3 A;  5ENJ A;  5DKC A;  5AME A;  4UYE A;  4HXN A;  2N9G A;  4CLB A;  4YAD A;  4LC2 A;  5D3H A;  4CUS A;  2R10 A;  2DKW A;  4QY4 A;  5CPE A;  4YYK A;  5DFD A;  5H1V A;  3RCW A;  4CUT A;  5C85 A;  5FE5 A;  4QSX A;  5EPB A;  4NR5 A;  4PTB A;  4MEN A;  2L5E A;  4PS5 A;  4PKL A;  5CY9 A;  5DFC A;  4A9O A;  5KTU A;  3NXB A;  4QSR A;  4LR6 A;  2OUO A;  4YAB A;  4LYS A;  4XUA A;  1ZS5 A;  4YYG A;  5FE9 A;  5F63 A;  4Z6H A;  5HQ6 A;  3UV5 A;  5A5P A;  4HBX A;  5D26 A;  5CRZ A;  3P1D A;  4YH3 A;  4Z93 A;  5LJ0 A;  4J0R A;  3UV2 A;  4HXO A;  3HMH A;  5TCM A;  5L8U A;  5F25 A;  5L96 A;  5ENH A;  4OUF A;  3Q2E A;  5CGP A;  5KU3 A;  4J3I A;  5LJ2 A;  2DVQ A;  3JVM A;  5F36 A;  3GG3 A;  4MR3 A;  4O77 A;  4HXK A;  4YBS A;  5I29 A;  5A7C A;  4UIZ A;  2YEM A;  4UYG A;  5EI4 A;  3LQI A;  5L99 A;  2DVR A;  5L97 A;  4TS8 A;  3IU6 A;  3UVW A;  5A83 A;  5FE8 A;  2DVV A;  2DWW A;  5CUE A;  5A5N A;  5EPR A;  5HFR A;  4A9K A;  4YYH A;  4QSQ A;  4Z1Q A;  4YC9 A;  5ENC A;  5AD3 A;  4BW1 A;  3S92 A;  2MJV B;  2YW5 A;  5LKU A;  3LXJ A;  5BT3 A;  4QBM A;  5IID A;  2G4A A;  3O37 A;  4MR4 A;  4CUR A;  4ZW1 A;  2E7O A;  5D3T A;  5D25 A;  5COI A;  4OGJ A;  4QR5 A;  5EVA A;  3U5L A;  2RNW A;  4CUP A;  5FG5 A;  4LRG A;  4CFL A;  5K29 A;  4HXS A;  5E3G A;  5A85 A;  4PCE A;  5F1H A;  4MEP A;  2L85 A;  2R0V A;  5CUD A;  5E9L A;  5CRM A;  5I1Q A;  4NR7 A;  5ENE A;  2I7K A;  4O78 A;  5IBN A;  5IG6 A;  4O7F A;  2YEK A;  5LUU A;  4HXP A;  5ETD A;  4YH4 A;  3S91 A;  2RI7 A;  5I88 A;  5FBX A;  1N72 A; 
#chains in the Genus database with same CATH topology
 4QSV A;  5CQ7 A;  3LQH A;  4MR5 A;  4MEQ A;  3QZT A;  5II1 A;  5A5R A;  5FE6 A;  4O7B A;  5L8T A;  5HQ7 A;  3AAD A;  5I40 A;  4TU4 A;  5CU8 A;  4X2I A;  5CFW A;  5HEL A;  5FH6 A;  2KTB B;  3MUK A;  4LZS A;  4KV4 A;  5E9Y A;  5E9M A;  4O74 A;  1E6I A;  2NXB A;  4TQN A;  5FE7 A;  2F6J A;  5KHM A;  2FSA A;  4CL9 A;  3U5P A;  5FDZ A;  4IOO A;  4YAT A;  5F2P A;  4Z6I A;  4YY6 A;  5E7D A;  4NUE A;  4TZ8 A;  4O72 A;  4UYH A;  5DKH A;  4HXM A;  5DW1 A;  1ZKR A;  3U5O A;  3O34 A;  2YQD A;  3JVK A;  5I7X A;  5JI8 A;  4O7E A;  4ZC9 A;  2EJN A;  5H85 A;  5KO4 A;  5IGN A;  5KTX A;  4N4G A;  4IOQ A;  4NYV A;  4YAX A;  4Y03 A;  5D0C A;  5CUA A;  5E0R A;  4BW2 A;  4NQM A;  5I7Y A;  5CUC A;  4IOR A;  4A9J A;  4YY4 A;  3UVY A;  3MB4 A;  3I3J A;  4TZ2 A;  3U5J A;  4QSW A;  4Z1S A;  2E3K A;  4QZS A;  4N4H A;  5HJC A;  3MQM A;  4FLP A;  3TLP A;  5JWM A;  5CQ3 A;  3P1C A;  5EK9 A;  5EV9 A;  4Q0O A;  4NR8 A;  5A5O A;  4UIW A;  5FB0 A;  4QEW A;  5E74 A;  3LQJ A;  5HRV A;  2RNY A;  4NRC A;  5FE3 A;  3G0J A;  3U5M A;  5DKD A;  4A9H A;  3P5O A;  5BT5 A;  4BJX A;  5FE2 A;  4IR5 A;  5HLS A;  4LYI A;  4CUU A;  4NR6 A;  5DLZ A;  5C4Q A;  5DYX A;  5DY7 A;  5IGM A;  5CP5 A;  2E7N A;  4N4I A;  5HEM A;  5C87 A;  3SVH A;  4NQN A;  5EA1 A;  4YYM A;  3MXF A;  4TT4 A;  5TB6 A;  4LZR A;  5D3N A;  1F68 A;  2OSS A;  4F3I A;  4O7A A;  5FE1 A;  5EU1 A;  4XYA A;  5E3D A;  4YYN A;  5HRW A;  5FH8 A;  4BHW A;  4UIV A;  5AMF A;  3ERR A;  5A5Q A;  2YYN A;  3HME A;  4J1P A;  4A9F A;  4XUB A;  4YK0 A;  4RVR A;  5D3J A;  2RFJ A;  4A9L A;  2L84 A;  4QR3 A;  5C7N A;  3Q2F A;  4NUC A;  2D9E A;  4QC1 A;  5CQ4 A;  5ETB A;  2YDW A;  4IR6 A;  3U5K A;  3QZS A;  5DBM A;  5CUB A;  5ENI A;  1EQF A;  5F61 A;  5HFQ A;  2WP2 A;  5DW2 A;  5G4S A;  4C67 A;  5D3S A;  4QC3 A;  1JSP B;  5DYC A;  5CUG A;  5ENG A;  5FG6 A;  5KTW A;  5EM3 A;  4AKN A;  4BW4 A;  5EWV A;  5CQ5 A;  3AQA A;  5A5S A;  3U5N A;  3IU5 A;  3QZV A;  4DON A;  5EWW A;  5EP7 A;  4XY8 A;  4QEV A;  1JM4 B;  4TT2 A;  4XY9 A;  5EPS A;  5E9V A;  5FE0 A;  4N3W A;  4HBV A;  5HRX A;  4MR6 A;  4TTE A;  3ONI A;  5HM0 A;  3FKM X;  5AD2 A;  5DFB A;  4YBT A;  4QYL A;  5DYA A;  3SVF A;  4LDF A;  5I86 A;  4QUU A;  2R0S A;  5D24 A;  5E73 A;  4QUT A;  4NXJ A;  5EQ1 A;  4J0S A;  2LSP B;  4NRA A;  5F3A A;  4QSP A;  2GRC A;  2D82 A;  1WUG A;  4Q0N A;  4O71 A;  4OGI A;  5H1U A;  5LKX A;  4KCX A;  2DAT A;  4UYF A;  5FH7 A;  3SVG A;  3P1E A;  4A9N A;  3UW9 A;  4WHU A;  5D3L A;  5FE4 A;  3DWY A;  5I89 A;  2R0Y A;  4ALH A;  4UIX A;  4O7C A;  1X0J A;  5HQ5 A;  5CZG A;  5A82 A;  5FFY A;  4E96 A;  5D3P A;  4NYX A;  5J0D A;  5FG4 A;  3UVX A;  5FFW A;  4QB3 A;  5EGU A;  5IGL A;  5LVQ A;  4AKI A;  4CUQ A;  4O75 A;  5HEN A;  3MB3 A;  4PCI A;  4IR4 A;  3O33 A;  3MUL A;  5EWH A;  4QR4 A;  5H1T A;  4A9E A;  4QYD A;  4PY6 A;  3O36 A;  5II2 A;  3UVD A;  4NRB A;  2DVS A;  2I8N A;  4UIY A;  5CQ8 A;  4YYJ A;  3ZYU A;  1WUM A;  4UYD A;  2YEL A;  5C89 A;  5D7X A;  5CTL A;  5HCL A;  2F6N A;  4TU6 A;  5ENB A;  5LVR A;  4UIU A;  5CQ6 A;  4WIV A;  5I80 A;  4UYF B;  4TT6 A;  2RS9 B;  5E9I A;  5A81 A;  3D7C A;  5CQT A;  4AKG A;  5CS8 A;  4TYL A;  5EWD A;  5FB1 A;  5DYU A;  3LJW A;  2H60 A;  5IGK A;  4ZQL A;  4YYD A;  5I83 A;  4NUD A;  5ENF A;  4C66 A;  5L98 A;  4QST A;  5EIS A;  5FFV A;  4A9M A;  5EIC A;  4GPJ A;  5LKZ A;  4NS5 A;  5BT4 A;  2OO1 A;  5F5Z A;  5EWC A;  4IR3 A;  4NR4 A;  4N4F A;  4QSU A;  5LJ1 A;  3G0L A;  5G4R A;  4A9I A;  4CFK A;  5ACY A;  5CQA A;  4O70 A;  4WHW A;  4LZ2 A;  4QNS A;  4NYW A;  3P1F A;  3JVL A;  2RNX A;  3O35 A;  4HXR A;  4KV1 A;  5DLX A;  5F62 A;  4QEU A;  4ALG A;  3UV4 A;  5D3R A;  3JVJ A;  2WP1 A;  5F60 A;  4LYW A;  5C8G A;  4YYI A;  5F1L A;  3K2J A;  4NR9 A;  5LKT A;  5DX4 A;  3DAI A;  5E9K A;  4HXL A;  4HBW A;  3HMF A;  4UIT A;  4YBM A;  4MEO A;  2RO1 A;  4HBY A;  4QSS A;  4O76 A;  4BW3 A;  5ENJ A;  5DKC A;  5AME A;  4UYE A;  4HXN A;  2N9G A;  4CLB A;  4YAD A;  4LC2 A;  5D3H A;  4CUS A;  2R10 A;  2DKW A;  4QY4 A;  5CPE A;  4YYK A;  5DFD A;  5H1V A;  3RCW A;  4CUT A;  5C85 A;  5FE5 A;  4QSX A;  5EPB A;  4NR5 A;  4PTB A;  4MEN A;  2L5E A;  4PS5 A;  4PKL A;  5CY9 A;  5DFC A;  4A9O A;  5KTU A;  3NXB A;  4QSR A;  4LR6 A;  2OUO A;  4YAB A;  4LYS A;  4XUA A;  1ZS5 A;  4YYG A;  5FE9 A;  5F63 A;  4Z6H A;  5HQ6 A;  3UV5 A;  5A5P A;  4HBX A;  5D26 A;  5CRZ A;  3P1D A;  4YH3 A;  4Z93 A;  5LJ0 A;  4J0R A;  3UV2 A;  4HXO A;  3HMH A;  5TCM A;  5L8U A;  5F25 A;  5L96 A;  5ENH A;  4OUF A;  3Q2E A;  5CGP A;  5KU3 A;  4J3I A;  5LJ2 A;  2DVQ A;  3JVM A;  5F36 A;  3GG3 A;  4MR3 A;  4O77 A;  4HXK A;  4YBS A;  5I29 A;  5A7C A;  4UIZ A;  2YEM A;  4UYG A;  5EI4 A;  3LQI A;  5L99 A;  3D1D A;  2DVR A;  5L97 A;  4TS8 A;  3IU6 A;  4AI6 A;  3UVW A;  1PUO A;  5A83 A;  5FE8 A;  2DVV A;  2DWW A;  5CUE A;  4AKH A;  5A5N A;  5EPR A;  5HFR A;  4A9K A;  4YYH A;  4QSQ A;  4Z1Q A;  4YC9 A;  5ENC A;  5AD3 A;  4BW1 A;  3S92 A;  2MJV B;  2YW5 A;  5LKU A;  3VKH A;  3LXJ A;  5BT3 A;  4QBM A;  5IID A;  2G4A A;  3D1B A;  3VKG A;  3O37 A;  4MR4 A;  4CUR A;  4ZW1 A;  2E7O A;  5D3T A;  5D25 A;  5COI A;  4OGJ A;  4QR5 A;  5EVA A;  3U5L A;  2RNW A;  4CUP A;  5FG5 A;  4LRG A;  4CFL A;  5K29 A;  4HXS A;  5E3G A;  5A85 A;  4PCE A;  5F1H A;  4MEP A;  2L85 A;  2R0V A;  5CUD A;  5E9L A;  5CRM A;  5I1Q A;  4NR7 A;  5ENE A;  2I7K A;  4O78 A;  5IBN A;  5IG6 A;  4O7F A;  2YEK A;  5LUU A;  4HXP A;  5ETD A;  4YH4 A;  3S91 A;  2RI7 A;  5I88 A;  5FBX A;  1N72 A; 
#chains in the Genus database with same CATH homology
 4QSV A;  5CQ7 A;  3LQH A;  4MR5 A;  4MEQ A;  3QZT A;  5II1 A;  5A5R A;  5FE6 A;  4O7B A;  5L8T A;  5HQ7 A;  3AAD A;  5I40 A;  4TU4 A;  5CU8 A;  4X2I A;  5CFW A;  5HEL A;  5FH6 A;  2KTB B;  3MUK A;  4LZS A;  4KV4 A;  5E9Y A;  5E9M A;  4O74 A;  1E6I A;  2NXB A;  4TQN A;  5FE7 A;  2F6J A;  5KHM A;  2FSA A;  4CL9 A;  3U5P A;  5FDZ A;  4IOO A;  4YAT A;  5F2P A;  4Z6I A;  4YY6 A;  5E7D A;  4NUE A;  4TZ8 A;  4O72 A;  4UYH A;  5DKH A;  4HXM A;  5DW1 A;  3U5O A;  3O34 A;  2YQD A;  3JVK A;  5I7X A;  5JI8 A;  4O7E A;  4ZC9 A;  5H85 A;  5KO4 A;  5IGN A;  5KTX A;  4N4G A;  4IOQ A;  4NYV A;  4YAX A;  4Y03 A;  5D0C A;  5CUA A;  5E0R A;  4BW2 A;  4NQM A;  5I7Y A;  5CUC A;  4IOR A;  4A9J A;  4YY4 A;  3UVY A;  3MB4 A;  3I3J A;  4TZ2 A;  3U5J A;  4QSW A;  4Z1S A;  2E3K A;  4QZS A;  4N4H A;  5HJC A;  3MQM A;  4FLP A;  3TLP A;  5JWM A;  5CQ3 A;  3P1C A;  5EK9 A;  5EV9 A;  4Q0O A;  4NR8 A;  5A5O A;  4UIW A;  5FB0 A;  4QEW A;  5E74 A;  3LQJ A;  5HRV A;  2RNY A;  4NRC A;  5FE3 A;  3G0J A;  3U5M A;  5DKD A;  4A9H A;  3P5O A;  5BT5 A;  4BJX A;  5FE2 A;  4IR5 A;  5HLS A;  4LYI A;  4CUU A;  4NR6 A;  5DLZ A;  5C4Q A;  5DYX A;  5DY7 A;  5IGM A;  5CP5 A;  2E7N A;  4N4I A;  5HEM A;  5C87 A;  3SVH A;  4NQN A;  5EA1 A;  4YYM A;  3MXF A;  4TT4 A;  5TB6 A;  4LZR A;  5D3N A;  1F68 A;  2OSS A;  4F3I A;  4O7A A;  5FE1 A;  5EU1 A;  4XYA A;  5E3D A;  4YYN A;  5HRW A;  5FH8 A;  4BHW A;  4UIV A;  5AMF A;  5A5Q A;  2YYN A;  3HME A;  4J1P A;  4A9F A;  4XUB A;  4YK0 A;  4RVR A;  5D3J A;  2RFJ A;  4A9L A;  2L84 A;  4QR3 A;  5C7N A;  3Q2F A;  4NUC A;  2D9E A;  4QC1 A;  5CQ4 A;  5ETB A;  2YDW A;  4IR6 A;  3U5K A;  3QZS A;  5DBM A;  5CUB A;  5ENI A;  1EQF A;  5F61 A;  5HFQ A;  2WP2 A;  5DW2 A;  5G4S A;  4C67 A;  5D3S A;  4QC3 A;  1JSP B;  5DYC A;  5CUG A;  5ENG A;  5FG6 A;  5KTW A;  5EM3 A;  4AKN A;  4BW4 A;  5EWV A;  5CQ5 A;  3AQA A;  5A5S A;  3U5N A;  3IU5 A;  3QZV A;  4DON A;  5EWW A;  5EP7 A;  4XY8 A;  4QEV A;  1JM4 B;  4TT2 A;  4XY9 A;  5EPS A;  5E9V A;  5FE0 A;  4N3W A;  4HBV A;  5HRX A;  4MR6 A;  4TTE A;  3ONI A;  5HM0 A;  3FKM X;  5AD2 A;  5DFB A;  4YBT A;  4QYL A;  5DYA A;  3SVF A;  4LDF A;  5I86 A;  4QUU A;  2R0S A;  5D24 A;  5E73 A;  4QUT A;  4NXJ A;  5EQ1 A;  4J0S A;  2LSP B;  4NRA A;  5F3A A;  4QSP A;  2GRC A;  2D82 A;  1WUG A;  4Q0N A;  4O71 A;  4OGI A;  5H1U A;  5LKX A;  4KCX A;  2DAT A;  4UYF A;  5FH7 A;  3SVG A;  3P1E A;  4A9N A;  3UW9 A;  4WHU A;  5D3L A;  5FE4 A;  3DWY A;  5I89 A;  2R0Y A;  4ALH A;  4UIX A;  4O7C A;  1X0J A;  5HQ5 A;  5CZG A;  5A82 A;  5FFY A;  4E96 A;  5D3P A;  4NYX A;  5J0D A;  5FG4 A;  3UVX A;  5FFW A;  4QB3 A;  5EGU A;  5IGL A;  5LVQ A;  4CUQ A;  4O75 A;  5HEN A;  3MB3 A;  4PCI A;  4IR4 A;  3O33 A;  3MUL A;  5EWH A;  4QR4 A;  5H1T A;  4A9E A;  4QYD A;  4PY6 A;  3O36 A;  5II2 A;  3UVD A;  4NRB A;  2DVS A;  2I8N A;  4UIY A;  5CQ8 A;  4YYJ A;  3ZYU A;  1WUM A;  4UYD A;  2YEL A;  5C89 A;  5D7X A;  5CTL A;  5HCL A;  2F6N A;  4TU6 A;  5ENB A;  5LVR A;  4UIU A;  5CQ6 A;  4WIV A;  5I80 A;  4UYF B;  4TT6 A;  2RS9 B;  5E9I A;  5A81 A;  3D7C A;  5CQT A;  5CS8 A;  4TYL A;  5EWD A;  5FB1 A;  5DYU A;  3LJW A;  2H60 A;  5IGK A;  4ZQL A;  4YYD A;  5I83 A;  4NUD A;  5ENF A;  4C66 A;  5L98 A;  4QST A;  5EIS A;  5FFV A;  4A9M A;  5EIC A;  4GPJ A;  5LKZ A;  4NS5 A;  5BT4 A;  2OO1 A;  5F5Z A;  5EWC A;  4IR3 A;  4NR4 A;  4N4F A;  4QSU A;  5LJ1 A;  3G0L A;  5G4R A;  4A9I A;  4CFK A;  5ACY A;  5CQA A;  4O70 A;  4WHW A;  4LZ2 A;  4QNS A;  4NYW A;  3P1F A;  3JVL A;  2RNX A;  3O35 A;  4HXR A;  4KV1 A;  5DLX A;  5F62 A;  4QEU A;  4ALG A;  3UV4 A;  5D3R A;  3JVJ A;  2WP1 A;  5F60 A;  4LYW A;  5C8G A;  4YYI A;  5F1L A;  3K2J A;  4NR9 A;  5LKT A;  5DX4 A;  3DAI A;  5E9K A;  4HXL A;  4HBW A;  3HMF A;  4UIT A;  4YBM A;  4MEO A;  2RO1 A;  4HBY A;  4QSS A;  4O76 A;  4BW3 A;  5ENJ A;  5DKC A;  5AME A;  4UYE A;  4HXN A;  2N9G A;  4CLB A;  4YAD A;  4LC2 A;  5D3H A;  4CUS A;  2R10 A;  2DKW A;  4QY4 A;  5CPE A;  4YYK A;  5DFD A;  5H1V A;  3RCW A;  4CUT A;  5C85 A;  5FE5 A;  4QSX A;  5EPB A;  4NR5 A;  4PTB A;  4MEN A;  2L5E A;  4PS5 A;  4PKL A;  5CY9 A;  5DFC A;  4A9O A;  5KTU A;  3NXB A;  4QSR A;  4LR6 A;  2OUO A;  4YAB A;  4LYS A;  4XUA A;  1ZS5 A;  4YYG A;  5FE9 A;  5F63 A;  4Z6H A;  5HQ6 A;  3UV5 A;  5A5P A;  4HBX A;  5D26 A;  5CRZ A;  3P1D A;  4YH3 A;  4Z93 A;  5LJ0 A;  4J0R A;  3UV2 A;  4HXO A;  3HMH A;  5TCM A;  5L8U A;  5F25 A;  5L96 A;  5ENH A;  4OUF A;  3Q2E A;  5CGP A;  5KU3 A;  4J3I A;  5LJ2 A;  2DVQ A;  3JVM A;  5F36 A;  3GG3 A;  4MR3 A;  4O77 A;  4HXK A;  4YBS A;  5I29 A;  5A7C A;  4UIZ A;  2YEM A;  4UYG A;  5EI4 A;  3LQI A;  5L99 A;  2DVR A;  5L97 A;  4TS8 A;  3IU6 A;  3UVW A;  5A83 A;  5FE8 A;  2DVV A;  2DWW A;  5CUE A;  5A5N A;  5EPR A;  5HFR A;  4A9K A;  4YYH A;  4QSQ A;  4Z1Q A;  4YC9 A;  5ENC A;  5AD3 A;  4BW1 A;  3S92 A;  2MJV B;  2YW5 A;  5LKU A;  3LXJ A;  5BT3 A;  4QBM A;  5IID A;  2G4A A;  3O37 A;  4MR4 A;  4CUR A;  4ZW1 A;  2E7O A;  5D3T A;  5D25 A;  5COI A;  4OGJ A;  4QR5 A;  5EVA A;  3U5L A;  2RNW A;  4CUP A;  5FG5 A;  4LRG A;  4CFL A;  5K29 A;  4HXS A;  5E3G A;  5A85 A;  4PCE A;  5F1H A;  4MEP A;  2L85 A;  2R0V A;  5CUD A;  5E9L A;  5CRM A;  5I1Q A;  4NR7 A;  5ENE A;  2I7K A;  4O78 A;  5IBN A;  5IG6 A;  4O7F A;  2YEK A;  5LUU A;  4HXP A;  5ETD A;  4YH4 A;  3S91 A;  2RI7 A;  5I88 A;  5FBX A;  1N72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...