4A9JA

N-terminal bromodomain of human brd2 with n-(4-hydroxyphenyl) acetamide
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
112
structure length
112
Chain Sequence
b'VTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BROMODOMAIN CONTAINING 2
publication title Fragment-Based Discovery of Bromodomain Inhibitors Part 1: Inhibitor Binding Modes and Implications for Lead Discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 38
structure length 112
sequence length 112
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4a9jA00
5I7XA 5CUDA 1WUMA 2YW5A 4CURA 3MB4A 5HRVA 4QZSA 4XYAA 5FG4A 4CUUA 5D3PA 5HM0A 4NR4A 5DBMA 4IR5A 4Z1SA 2I8NA 5CTLA 5DYAA 4IOOA 4CFLA 5DW2A 5FBXA 1E6IA 5L98A 4HBXA 4TQNA 5ENFA 4YYMA 4UIWA 2YYNA 3Q2FA 3HMEA 5HFRA 3MXFA 5F36A 4NYVA 4TZ2A 5I7YA 3JVJA 5A5SA 5F25A 4KV1A 5FE7A 4FLPA 4HXSA 5HRWA 4O7AA 4QSSA 5ETBA 4N4FA 5E9VA 5DYCA 5L96A 5L8UA 4Z6HA 2F6NA 4O70A 4HXOA 5FH8A 3O34A 4TS8A 4NR6A 3UV5A 4LZSA 4CL9A 5H1UA 5CP5A 5A5QA 3JVKA 5IIDA 5LKTA 5E7DA 2D82A 4ZQLA 5E9MA 5EU1A 4KV4A 4A9FA 4BW3A 5DFBA 5FFVA 5HJCA 4PS5A 4HXKA 4HXMA 5H85A 4NRAA 4N3WA 4QR5A 4A9JA 3HMHA 4QNSA 5H1TA 3G0LA 4LZRA 4QYDA 4UIUA 5EA1A 5AD3A 3P1DA 2DVSA 4MR5A 3LQJA 2DVQA 5D0CA 3P1EA 3IU6A 5FE4A 2L85A 4YAXA 4CUQA 4O7CA 2FSAA 5ENIA 2G4AA 5HFQA 4LZ2A 4QSXA 4QEVA 5EI4A 4HXRA 5BT4A 5LUUA 5E3GA 3UVYA 5EGUA 3U5KA 4NR9A 4BJXA 4HBVA 5FFWA 2I7KA 4MR6A 5IGKA 4CUPA 2RI7A 3O33A 4YYKA 2D9EA 4PKLA 2E3KA 5DKCA 5FE9A 4QB3A 5F3AA 2OSSA 2H60A 3DWYA 4CUSA 4YBMA 5F61A 5IGMA 3O35A 3MB3A 4TT2A 5F5ZA 5ETDA 5II1A 3MULA 5K29A 5CGPA 5DW1A 3D7CA 3GG3A 4J0SA 5EK9A 4Z1QA 5C7NA 4YY6A 4C66A 4BW2A 3U5PA 4YYJA 5CRZA 4O72A 3UV4A 5HQ5A 4DONA 4PCEA 3IU5A 4TT4A 4TZ8A 5FE2A 4CLBA 4NXJA 4O76A 4QR3A 4A9KA 5CUBA 3I3JA 4UYGA 5D26A 5A82A 4NYWA 2OO1A 5LJ1A 5ENBA 4QC3A 5E74A 3P1CA 5F60A 4QEWA 5ENCA 5CUGA 5EWCA 3QZSA 4Z6IA 4F3IA 5FH6A 5DY7A 4QR4A 2RO1A 5CY9A 5D3HA 5ENJA 5CQ8A 3RCWA 5I83A 5LKUA 5D3JA 3FKMX 5TCMA 5FDZA 3U5LA 5DKHA 5A5RA 3AADA 5CQ6A 5LVQA 2RS9B 5D7XA 5HELA 4QSRA 1EQFA 5F2PA 5CUCA 4NUEA 5L97A 5FB1A 1JM4B 2DKWA 4LR6A 5A7CA 5F63A 5COIA 4J0RA 3O36A 5C85A 5DX4A 5E9LA 4ZC9A 5CS8A 5HLSA 4O7EA 3U5JA 4C67A 3MQMA 5E73A 3P1FA 4UIXA 4UIZA 4E96A 5CUAA 4UYDA 5C87A 4J3IA 4A9HA 5HRXA 4QSTA 4HXLA 4XUAA 5I29A 4QEUA 3MUKA 4TT6A 5DLXA 4QBMA 5HEMA 5KU3A 4O75A 2NXBA 4HXPA 5AMEA 4IR6A 2YELA 3AQAA 4YYDA 2R10A 2YQDA 4N4GA 5KTUA 3LJWA 4WHUA 5DLZA 5L8TA 3ONIA 5I89A 4YYNA 2WP2A 3UW9A 5J0DA 4MEOA 5FG6A 3U5OA 2DATA 2YDWA 5BT3A 2LSPB 4N4HA 4X2IA 4J1PA 3DAIA 4HXNA 2RNYA 4TU4A 4YADA 4LC2A 5EV9A 5AMFA 4NQMA 5JI8A 4A9MA 4QYLA 4YYHA 5I80A 5EICA 4YK0A 3HMFA 5FE1A 2R0SA 3P5OA 4O78A 5DFCA 5FH7A 2L84A 5FE5A 5ENHA 5HENA 5I86A 5DYXA 4NUDA 4BW1A 2DVVA 3UV2A 3U5NA 4PTBA 2RNXA 4BHWA 3UVDA 3O37A 5CQAA 2YEKA 5EPBA 3S91A 5II2A 5EWHA 5LJ0A 4A9NA 5D3LA 4QSWA 3TLPA 5IGNA 2DVRA 4NUCA 4NR8A 4Q0NA 3Q2EA 5EPRA 4LRGA 5E3DA 5ACYA 3JVMA 4UYFA 5FB0A 5C89A 5A5NA 4YH3A 4O71A 2E7OA 5IGLA 2YEMA 5EM3A 5FE3A 4XY9A 5L99A 4UIYA 4YATA 3JVLA 4IORA 4Z93A 4TTEA 5FE6A 4RVRA 5D3TA 2MJVB 4YH4A 5DKDA 5IBNA 4YBTA 5F62A 5E9IA 1ZS5A 2WP1A 4IOQA 4N4IA 5H1VA 5G4SA 5KTXA 4ALHA 2DWWA 3NXBA 4YY4A 5CQ7A 4A9EA 4PY6A 5FFYA 4A9OA 5C4QA 5I88A 4Q0OA 4MENA 5CZGA 4LYIA 2F6JA 3K2JA 3UVXA 4KCXA 5D24A 4O74A 5E0RA 5A83A 5CQTA 4YABA 5A5OA 4QC1A 5CFWA 5EISA 5JWMA 4QUTA 5HCLA 5FE0A 2RFJA 4CUTA 4O7BA 5EWWA 4XY8A 5F1LA 4TU6A 4HBWA 5CQ4A 5ENEA 5E9KA 2E7NA 3QZTA 3QZVA 4NRBA 4OGIA 5E9YA 4UITA 4UYEA 4MEPA 3SVGA 3LXJA 2R0VA 4AKNA 4WIVA 5HQ7A 5TB6A 4O77A 4QY4A 5CQ3A 4ALGA 5EPSA 4NR7A 5HQ6A 1JSPB 3LQHA 5LJ2A 2R0YA 5D3RA 4UYFB 5EP7A 4OGJA 4UIVA 5D3NA 5F1HA 2RNWA 1WUGA 4YBSA 5EWVA 4MEQA 4Y03A 4WHWA 5CRMA 5EWDA 5D25A 5CU8A 2OUOA 5FG5A 5A81A 2L5EA 4ZW1A 4UYHA 5A5PA 3G0JA 5KHMA 5ENGA 5EVAA 4YYGA 4A9IA 4O7FA 5FE8A 5EQ1A 4NYXA 5DYUA 4PCIA 5LKXA 4IR4A 4TYLA 5IG6A 4YC9A 4OUFA 5I1QA 4QUUA 2KTBB 5LVRA 5DFDA 4QSQA 5CUEA 4LYWA 4A9LA 4NRCA 5CPEA 4XUBA 4LDFA 5D3SA 5G4RA 5A85A 3S92A 4YYIA 4MR3A 3U5MA 5C8GA 5KTWA 4CFKA 1X0JA 1F68A 3ZYUA 5LKZA 5CQ5A 4QSPA 5AD2A 4HBYA 4BW4A 5I40A 5KO4A 3LQIA 3SVFA 4GPJA 5BT5A 1N72A 4NR5A 3UVWA 4NS5A 2GRCA 4NQNA 2N9GA 4MR4A 4QSUA 4IR3A 3SVHA 4QSVA 4LYSA
chains in the Genus database with same CATH superfamily
5I7XA 5CUDA 1WUMA 2YW5A 4CURA 3MB4A 5HRVA 4QZSA 4XYAA 5FG4A 4CUUA 5D3PA 5HM0A 4NR4A 5DBMA 4IR5A 4Z1SA 2I8NA 5CTLA 5DYAA 4IOOA 4CFLA 5DW2A 5FBXA 4AI6A 1E6IA 5L98A 4HBXA 4TQNA 5ENFA 4YYMA 4UIWA 2YYNA 3Q2FA 3HMEA 5HFRA 3MXFA 5F36A 4NYVA 4TZ2A 5I7YA 3JVJA 5A5SA 5F25A 4KV1A 5FE7A 4FLPA 4HXSA 5HRWA 4O7AA 4QSSA 5ETBA 4N4FA 5E9VA 5DYCA 5L96A 5L8UA 4Z6HA 2F6NA 4O70A 4HXOA 5FH8A 3O34A 4TS8A 4NR6A 3UV5A 4LZSA 4CL9A 5H1UA 5CP5A 5A5QA 3JVKA 5IIDA 5LKTA 5E7DA 2D82A 4ZQLA 5E9MA 5EU1A 4KV4A 4A9FA 4BW3A 5DFBA 5FFVA 5HJCA 4PS5A 4HXKA 4HXMA 5H85A 4NRAA 4N3WA 4QR5A 4A9JA 3HMHA 4QNSA 5H1TA 3G0LA 4LZRA 4QYDA 4UIUA 5EA1A 5AD3A 3P1DA 2DVSA 4MR5A 3LQJA 2DVQA 5D0CA 3P1EA 3IU6A 5FE4A 2L85A 4YAXA 4CUQA 4O7CA 2FSAA 5ENIA 2G4AA 5HFQA 4LZ2A 4QSXA 4QEVA 5EI4A 4HXRA 5BT4A 5LUUA 5E3GA 3UVYA 5EGUA 3U5KA 4NR9A 4BJXA 4HBVA 5FFWA 2I7KA 4MR6A 5IGKA 4CUPA 2RI7A 3D1DA 3O33A 4YYKA 2D9EA 4PKLA 2E3KA 5DKCA 5FE9A 4QB3A 5F3AA 2OSSA 2H60A 3DWYA 4CUSA 4YBMA 5F61A 5IGMA 3O35A 3MB3A 4TT2A 5F5ZA 5ETDA 5II1A 3MULA 5K29A 5CGPA 5DW1A 3D7CA 3GG3A 4J0SA 5EK9A 4Z1QA 5C7NA 4YY6A 4C66A 4BW2A 3U5PA 4YYJA 5CRZA 4O72A 3UV4A 5HQ5A 4DONA 4PCEA 3IU5A 4TT4A 4TZ8A 5FE2A 4CLBA 4NXJA 4O76A 4QR3A 4A9KA 5CUBA 3I3JA 4UYGA 5D26A 5A82A 4NYWA 2OO1A 5LJ1A 5ENBA 4QC3A 5E74A 3P1CA 5F60A 4QEWA 5ENCA 5CUGA 5EWCA 4AKIA 3QZSA 4Z6IA 4F3IA 5FH6A 5DY7A 4QR4A 2RO1A 5CY9A 5D3HA 5ENJA 5CQ8A 3RCWA 5I83A 5LKUA 5D3JA 3FKMX 5TCMA 5FDZA 3U5LA 5DKHA 5A5RA 3AADA 5CQ6A 5LVQA 2RS9B 5D7XA 5HELA 4QSRA 1EQFA 5F2PA 5CUCA 4NUEA 5L97A 5FB1A 1JM4B 2DKWA 4LR6A 5A7CA 5F63A 5COIA 4J0RA 3O36A 5C85A 5DX4A 5E9LA 4ZC9A 5CS8A 5HLSA 4O7EA 3U5JA 4C67A 3MQMA 5E73A 3P1FA 4UIXA 4UIZA 4E96A 5CUAA 4UYDA 1ZKRA 5C87A 4J3IA 4A9HA 5HRXA 4QSTA 4HXLA 4XUAA 5I29A 4QEUA 3MUKA 4TT6A 5DLXA 4QBMA 5HEMA 5KU3A 4O75A 2NXBA 4HXPA 5AMEA 4IR6A 2YELA 3AQAA 4YYDA 2R10A 2YQDA 4N4GA 5KTUA 3LJWA 4WHUA 5DLZA 5L8TA 3ONIA 5I89A 4YYNA 2WP2A 3UW9A 5J0DA 4MEOA 5FG6A 3U5OA 2DATA 2YDWA 5BT3A 2LSPB 4N4HA 4X2IA 4J1PA 3DAIA 4HXNA 2RNYA 2EJNA 4TU4A 4YADA 4LC2A 4AKGA 5EV9A 5AMFA 4NQMA 5JI8A 4A9MA 4QYLA 4YYHA 5I80A 5EICA 4YK0A 3HMFA 5FE1A 2R0SA 3P5OA 4O78A 5DFCA 5FH7A 2L84A 5FE5A 5ENHA 5HENA 5I86A 5DYXA 4NUDA 3ERRA 4BW1A 2DVVA 3UV2A 3U5NA 4PTBA 2RNXA 4BHWA 3UVDA 3O37A 5CQAA 2YEKA 5EPBA 3D1BA 3S91A 3VKGA 5II2A 5EWHA 5LJ0A 4A9NA 5D3LA 4QSWA 3TLPA 5IGNA 2DVRA 4NUCA 4NR8A 4Q0NA 3Q2EA 5EPRA 4LRGA 5E3DA 5ACYA 3JVMA 4UYFA 5FB0A 5C89A 5A5NA 4YH3A 4O71A 2E7OA 5IGLA 2YEMA 5EM3A 5FE3A 4XY9A 5L99A 4UIYA 4YATA 3JVLA 4IORA 4Z93A 4TTEA 5FE6A 4RVRA 5D3TA 2MJVB 4YH4A 5DKDA 5IBNA 4YBTA 5F62A 5E9IA 1ZS5A 2WP1A 4IOQA 4N4IA 5H1VA 5G4SA 5KTXA 4ALHA 2DWWA 3NXBA 3VKHA 4YY4A 5CQ7A 4A9EA 4PY6A 5FFYA 4A9OA 5C4QA 5I88A 4Q0OA 4MENA 5CZGA 4LYIA 4AKHA 2F6JA 3K2JA 3UVXA 4KCXA 5D24A 4O74A 5E0RA 5A83A 5CQTA 4YABA 5A5OA 4QC1A 5CFWA 5EISA 5JWMA 4QUTA 5HCLA 5FE0A 2RFJA 4CUTA 4O7BA 5EWWA 4XY8A 5F1LA 4TU6A 4HBWA 5CQ4A 5ENEA 5E9KA 2E7NA 3QZTA 3QZVA 4NRBA 4OGIA 5E9YA 4UITA 4UYEA 4MEPA 3SVGA 3LXJA 2R0VA 4AKNA 4WIVA 5HQ7A 5TB6A 4O77A 4QY4A 5CQ3A 4ALGA 5EPSA 4NR7A 5HQ6A 1JSPB 3LQHA 5LJ2A 2R0YA 5D3RA 4UYFB 5EP7A 4OGJA 4UIVA 5D3NA 5F1HA 2RNWA 1WUGA 4YBSA 5EWVA 4MEQA 4Y03A 4WHWA 5CRMA 5EWDA 5D25A 5CU8A 2OUOA 5FG5A 5A81A 2L5EA 4ZW1A 4UYHA 5A5PA 3G0JA 5KHMA 5ENGA 5EVAA 4YYGA 4A9IA 4O7FA 5FE8A 5EQ1A 4NYXA 5DYUA 1PUOA 4PCIA 5LKXA 4IR4A 4TYLA 5IG6A 4YC9A 4OUFA 5I1QA 4QUUA 2KTBB 5LVRA 4QSQA 5DFDA 5CUEA 4LYWA 4A9LA 4NRCA 5CPEA 4XUBA 4LDFA 5D3SA 5G4RA 5A85A 3S92A 4YYIA 4MR3A 3U5MA 5C8GA 5KTWA 4CFKA 1X0JA 1F68A 3ZYUA 5LKZA 5CQ5A 4QSPA 5AD2A 4HBYA 4BW4A 5I40A 5KO4A 3LQIA 3SVFA 4GPJA 5BT5A 1N72A 4NR5A 3UVWA 4NS5A 2GRCA 4NQNA 2N9GA 4MR4A 4QSUA 4IR3A 3SVHA 4QSVA 4LYSA
chains in the Genus database with same CATH topology
5I7XA 5CUDA 1WUMA 2YW5A 4CURA 3MB4A 5HRVA 4QZSA 4XYAA 5FG4A 4CUUA 5D3PA 5HM0A 4NR4A 5DBMA 4IR5A 4Z1SA 2I8NA 5CTLA 5DYAA 4IOOA 4CFLA 5DW2A 5FBXA 1E6IA 5L98A 4HBXA 4TQNA 5ENFA 4YYMA 4UIWA 2YYNA 3Q2FA 3HMEA 5HFRA 3MXFA 5F36A 4NYVA 4TZ2A 5I7YA 3JVJA 5A5SA 5F25A 4KV1A 5FE7A 4FLPA 4HXSA 5HRWA 4O7AA 4QSSA 5ETBA 4N4FA 5E9VA 5DYCA 5L96A 5L8UA 4Z6HA 2F6NA 4O70A 4HXOA 5FH8A 3O34A 4TS8A 4NR6A 3UV5A 4LZSA 4CL9A 5H1UA 5CP5A 5A5QA 3JVKA 5IIDA 5LKTA 5E7DA 2D82A 4ZQLA 5E9MA 5EU1A 4KV4A 4A9FA 4BW3A 5DFBA 5FFVA 5HJCA 4PS5A 4HXKA 4HXMA 5H85A 4NRAA 4N3WA 4QR5A 4A9JA 3HMHA 4QNSA 5H1TA 3G0LA 4LZRA 4QYDA 4UIUA 5EA1A 5AD3A 3P1DA 2DVSA 4MR5A 3LQJA 2DVQA 5D0CA 3P1EA 3IU6A 5FE4A 2L85A 4YAXA 4CUQA 4O7CA 2FSAA 5ENIA 2G4AA 5HFQA 4LZ2A 4QSXA 4QEVA 5EI4A 4HXRA 5BT4A 5LUUA 5E3GA 3UVYA 5EGUA 3U5KA 4NR9A 4BJXA 4HBVA 5FFWA 2I7KA 4MR6A 5IGKA 4CUPA 2RI7A 3O33A 4YYKA 2D9EA 4PKLA 2E3KA 5DKCA 5FE9A 4QB3A 5F3AA 2OSSA 2H60A 3DWYA 4CUSA 4YBMA 5F61A 5IGMA 3O35A 3MB3A 4TT2A 5F5ZA 5ETDA 5II1A 3MULA 5K29A 5CGPA 5DW1A 3D7CA 3GG3A 4J0SA 5EK9A 4Z1QA 5C7NA 4YY6A 4C66A 4BW2A 3U5PA 4YYJA 5CRZA 4O72A 3UV4A 5HQ5A 4DONA 4PCEA 3IU5A 4TT4A 4TZ8A 5FE2A 4CLBA 4NXJA 4O76A 4QR3A 4A9KA 5CUBA 3I3JA 4UYGA 5D26A 5A82A 4NYWA 2OO1A 5LJ1A 5ENBA 4QC3A 5E74A 3P1CA 5F60A 4QEWA 5ENCA 5CUGA 5EWCA 3QZSA 4Z6IA 4F3IA 5FH6A 5DY7A 4QR4A 2RO1A 5CY9A 5D3HA 5ENJA 5CQ8A 3RCWA 5I83A 5LKUA 5D3JA 3FKMX 5TCMA 5FDZA 3U5LA 5DKHA 5A5RA 3AADA 5CQ6A 5LVQA 2RS9B 5D7XA 5HELA 4QSRA 1EQFA 5F2PA 5CUCA 4NUEA 5L97A 5FB1A 1JM4B 2DKWA 4LR6A 5A7CA 5F63A 5COIA 4J0RA 3O36A 5C85A 5DX4A 5E9LA 4ZC9A 5CS8A 5HLSA 4O7EA 3U5JA 4C67A 3MQMA 5E73A 3P1FA 4UIXA 4UIZA 4E96A 5CUAA 4UYDA 5C87A 4J3IA 4A9HA 5HRXA 4QSTA 4HXLA 4XUAA 5I29A 4QEUA 3MUKA 4TT6A 5DLXA 4QBMA 5HEMA 5KU3A 4O75A 2NXBA 4HXPA 5AMEA 4IR6A 2YELA 3AQAA 4YYDA 2R10A 2YQDA 4N4GA 5KTUA 3LJWA 4WHUA 5DLZA 5L8TA 3ONIA 5I89A 4YYNA 2WP2A 3UW9A 5J0DA 4MEOA 5FG6A 3U5OA 2DATA 2YDWA 5BT3A 2LSPB 4N4HA 4X2IA 4J1PA 3DAIA 4HXNA 2RNYA 4TU4A 4YADA 4LC2A 5EV9A 5AMFA 4NQMA 5JI8A 4A9MA 4QYLA 4YYHA 5I80A 5EICA 4YK0A 3HMFA 5FE1A 2R0SA 3P5OA 4O78A 5DFCA 5FH7A 2L84A 5FE5A 5ENHA 5HENA 5I86A 5DYXA 4NUDA 4BW1A 2DVVA 3UV2A 3U5NA 4PTBA 2RNXA 4BHWA 3UVDA 3O37A 5CQAA 2YEKA 5EPBA 3S91A 5II2A 5EWHA 5LJ0A 4A9NA 5D3LA 4QSWA 3TLPA 5IGNA 2DVRA 4NUCA 4NR8A 4Q0NA 3Q2EA 5EPRA 4LRGA 5E3DA 5ACYA 3JVMA 4UYFA 5FB0A 5C89A 5A5NA 4YH3A 4O71A 2E7OA 5IGLA 2YEMA 5EM3A 5FE3A 4XY9A 5L99A 4UIYA 4YATA 3JVLA 4IORA 4Z93A 4TTEA 5FE6A 4RVRA 5D3TA 2MJVB 4YH4A 5DKDA 5IBNA 4YBTA 5F62A 5E9IA 1ZS5A 2WP1A 4IOQA 4N4IA 5H1VA 5G4SA 5KTXA 4ALHA 2DWWA 3NXBA 4YY4A 5CQ7A 4A9EA 4PY6A 5FFYA 4A9OA 5C4QA 5I88A 4Q0OA 4MENA 5CZGA 4LYIA 2F6JA 3K2JA 3UVXA 4KCXA 5D24A 4O74A 5E0RA 5A83A 5CQTA 4YABA 5A5OA 4QC1A 5CFWA 5EISA 5JWMA 4QUTA 5HCLA 5FE0A 2RFJA 4CUTA 4O7BA 5EWWA 4XY8A 5F1LA 4TU6A 4HBWA 5CQ4A 5ENEA 5E9KA 2E7NA 3QZTA 3QZVA 4NRBA 4OGIA 5E9YA 4UITA 4UYEA 4MEPA 3SVGA 3LXJA 2R0VA 4AKNA 4WIVA 5HQ7A 5TB6A 4O77A 4QY4A 5CQ3A 4ALGA 5EPSA 4NR7A 5HQ6A 1JSPB 3LQHA 5LJ2A 2R0YA 5D3RA 4UYFB 5EP7A 4OGJA 4UIVA 5D3NA 5F1HA 2RNWA 1WUGA 4YBSA 5EWVA 4MEQA 4Y03A 4WHWA 5CRMA 5EWDA 5D25A 5CU8A 2OUOA 5FG5A 5A81A 2L5EA 4ZW1A 4UYHA 5A5PA 3G0JA 5KHMA 5ENGA 5EVAA 4YYGA 4A9IA 4O7FA 5FE8A 5EQ1A 4NYXA 5DYUA 4PCIA 5LKXA 4IR4A 4TYLA 5IG6A 4YC9A 4OUFA 5I1QA 4QUUA 2KTBB 5LVRA 5DFDA 4QSQA 5CUEA 4LYWA 4A9LA 4NRCA 5CPEA 4XUBA 4LDFA 5D3SA 5G4RA 5A85A 3S92A 4YYIA 4MR3A 3U5MA 5C8GA 5KTWA 4CFKA 1X0JA 1F68A 3ZYUA 5LKZA 5CQ5A 4QSPA 5AD2A 4HBYA 4BW4A 5I40A 5KO4A 3LQIA 3SVFA 4GPJA 5BT5A 1N72A 4NR5A 3UVWA 4NS5A 2GRCA 4NQNA 2N9GA 4MR4A 4QSUA 4IR3A 3SVHA 4QSVA 4LYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I7X A;  5CUD A;  1WUM A;  2YW5 A;  4CUR A;  3MB4 A;  5HRV A;  4QZS A;  4XYA A;  5FG4 A;  4CUU A;  5D3P A;  5HM0 A;  4NR4 A;  5DBM A;  4IR5 A;  4Z1S A;  2I8N A;  5CTL A;  5DYA A;  4IOO A;  4CFL A;  5DW2 A;  5FBX A;  1E6I A;  5L98 A;  4HBX A;  4TQN A;  5ENF A;  4YYM A;  4UIW A;  2YYN A;  3Q2F A;  3HME A;  5HFR A;  3MXF A;  5F36 A;  4NYV A;  4TZ2 A;  5I7Y A;  3JVJ A;  5A5S A;  5F25 A;  4KV1 A;  5FE7 A;  4FLP A;  4HXS A;  5HRW A;  4O7A A;  4QSS A;  5ETB A;  4N4F A;  5E9V A;  5DYC A;  5L96 A;  5L8U A;  4Z6H A;  2F6N A;  4O70 A;  4HXO A;  5FH8 A;  3O34 A;  4TS8 A;  4NR6 A;  3UV5 A;  4LZS A;  4CL9 A;  5H1U A;  5CP5 A;  5A5Q A;  3JVK A;  5IID A;  5LKT A;  5E7D A;  2D82 A;  4ZQL A;  5E9M A;  5EU1 A;  4KV4 A;  4A9F A;  4BW3 A;  5DFB A;  5FFV A;  5HJC A;  4PS5 A;  4HXK A;  4HXM A;  5H85 A;  4NRA A;  4N3W A;  4QR5 A;  4A9J A;  3HMH A;  4QNS A;  5H1T A;  3G0L A;  4LZR A;  4QYD A;  4UIU A;  5EA1 A;  5AD3 A;  3P1D A;  2DVS A;  4MR5 A;  3LQJ A;  2DVQ A;  5D0C A;  3P1E A;  3IU6 A;  5FE4 A;  2L85 A;  4YAX A;  4CUQ A;  4O7C A;  2FSA A;  5ENI A;  2G4A A;  5HFQ A;  4LZ2 A;  4QSX A;  4QEV A;  5EI4 A;  4HXR A;  5BT4 A;  5LUU A;  5E3G A;  3UVY A;  5EGU A;  3U5K A;  4NR9 A;  4BJX A;  4HBV A;  5FFW A;  2I7K A;  4MR6 A;  5IGK A;  4CUP A;  2RI7 A;  3O33 A;  4YYK A;  2D9E A;  4PKL A;  2E3K A;  5DKC A;  5FE9 A;  4QB3 A;  5F3A A;  2OSS A;  2H60 A;  3DWY A;  4CUS A;  4YBM A;  5F61 A;  5IGM A;  3O35 A;  3MB3 A;  4TT2 A;  5F5Z A;  5ETD A;  5II1 A;  3MUL A;  5K29 A;  5CGP A;  5DW1 A;  3D7C A;  3GG3 A;  4J0S A;  5EK9 A;  4Z1Q A;  5C7N A;  4YY6 A;  4C66 A;  4BW2 A;  3U5P A;  4YYJ A;  5CRZ A;  4O72 A;  3UV4 A;  5HQ5 A;  4DON A;  4PCE A;  3IU5 A;  4TT4 A;  4TZ8 A;  5FE2 A;  4CLB A;  4NXJ A;  4O76 A;  4QR3 A;  4A9K A;  5CUB A;  3I3J A;  4UYG A;  5D26 A;  5A82 A;  4NYW A;  2OO1 A;  5LJ1 A;  5ENB A;  4QC3 A;  5E74 A;  3P1C A;  5F60 A;  4QEW A;  5ENC A;  5CUG A;  5EWC A;  3QZS A;  4Z6I A;  4F3I A;  5FH6 A;  5DY7 A;  4QR4 A;  2RO1 A;  5CY9 A;  5D3H A;  5ENJ A;  5CQ8 A;  3RCW A;  5I83 A;  5LKU A;  5D3J A;  3FKM X;  5TCM A;  5FDZ A;  3U5L A;  5DKH A;  5A5R A;  3AAD A;  5CQ6 A;  5LVQ A;  2RS9 B;  5D7X A;  5HEL A;  4QSR A;  1EQF A;  5F2P A;  5CUC A;  4NUE A;  5L97 A;  5FB1 A;  1JM4 B;  2DKW A;  4LR6 A;  5A7C A;  5F63 A;  5COI A;  4J0R A;  3O36 A;  5C85 A;  5DX4 A;  5E9L A;  4ZC9 A;  5CS8 A;  5HLS A;  4O7E A;  3U5J A;  4C67 A;  3MQM A;  5E73 A;  3P1F A;  4UIX A;  4UIZ A;  4E96 A;  5CUA A;  4UYD A;  5C87 A;  4J3I A;  4A9H A;  5HRX A;  4QST A;  4HXL A;  4XUA A;  5I29 A;  4QEU A;  3MUK A;  4TT6 A;  5DLX A;  4QBM A;  5HEM A;  5KU3 A;  4O75 A;  2NXB A;  4HXP A;  5AME A;  4IR6 A;  2YEL A;  3AQA A;  4YYD A;  2R10 A;  2YQD A;  4N4G A;  5KTU A;  3LJW A;  4WHU A;  5DLZ A;  5L8T A;  3ONI A;  5I89 A;  4YYN A;  2WP2 A;  3UW9 A;  5J0D A;  4MEO A;  5FG6 A;  3U5O A;  2DAT A;  2YDW A;  5BT3 A;  2LSP B;  4N4H A;  4X2I A;  4J1P A;  3DAI A;  4HXN A;  2RNY A;  4TU4 A;  4YAD A;  4LC2 A;  5EV9 A;  5AMF A;  4NQM A;  5JI8 A;  4A9M A;  4QYL A;  4YYH A;  5I80 A;  5EIC A;  4YK0 A;  3HMF A;  5FE1 A;  2R0S A;  3P5O A;  4O78 A;  5DFC A;  5FH7 A;  2L84 A;  5FE5 A;  5ENH A;  5HEN A;  5I86 A;  5DYX A;  4NUD A;  4BW1 A;  2DVV A;  3UV2 A;  3U5N A;  4PTB A;  2RNX A;  4BHW A;  3UVD A;  3O37 A;  5CQA A;  2YEK A;  5EPB A;  3S91 A;  5II2 A;  5EWH A;  5LJ0 A;  4A9N A;  5D3L A;  4QSW A;  3TLP A;  5IGN A;  2DVR A;  4NUC A;  4NR8 A;  4Q0N A;  3Q2E A;  5EPR A;  4LRG A;  5E3D A;  5ACY A;  3JVM A;  4UYF A;  5FB0 A;  5C89 A;  5A5N A;  4YH3 A;  4O71 A;  2E7O A;  5IGL A;  2YEM A;  5EM3 A;  5FE3 A;  4XY9 A;  5L99 A;  4UIY A;  4YAT A;  3JVL A;  4IOR A;  4Z93 A;  4TTE A;  5FE6 A;  4RVR A;  5D3T A;  2MJV B;  4YH4 A;  5DKD A;  5IBN A;  4YBT A;  5F62 A;  5E9I A;  1ZS5 A;  2WP1 A;  4IOQ A;  4N4I A;  5H1V A;  5G4S A;  5KTX A;  4ALH A;  2DWW A;  3NXB A;  4YY4 A;  5CQ7 A;  4A9E A;  4PY6 A;  5FFY A;  4A9O A;  5C4Q A;  5I88 A;  4Q0O A;  4MEN A;  5CZG A;  4LYI A;  2F6J A;  3K2J A;  3UVX A;  4KCX A;  5D24 A;  4O74 A;  5E0R A;  5A83 A;  5CQT A;  4YAB A;  5A5O A;  4QC1 A;  5CFW A;  5EIS A;  5JWM A;  4QUT A;  5HCL A;  5FE0 A;  2RFJ A;  4CUT A;  4O7B A;  5EWW A;  4XY8 A;  5F1L A;  4TU6 A;  4HBW A;  5CQ4 A;  5ENE A;  5E9K A;  2E7N A;  3QZT A;  3QZV A;  4NRB A;  4OGI A;  5E9Y A;  4UIT A;  4UYE A;  4MEP A;  3SVG A;  3LXJ A;  2R0V A;  4AKN A;  4WIV A;  5HQ7 A;  5TB6 A;  4O77 A;  4QY4 A;  5CQ3 A;  4ALG A;  5EPS A;  4NR7 A;  5HQ6 A;  1JSP B;  3LQH A;  5LJ2 A;  2R0Y A;  5D3R A;  4UYF B;  5EP7 A;  4OGJ A;  4UIV A;  5D3N A;  5F1H A;  2RNW A;  1WUG A;  4YBS A;  5EWV A;  4MEQ A;  4Y03 A;  4WHW A;  5CRM A;  5EWD A;  5D25 A;  5CU8 A;  2OUO A;  5FG5 A;  5A81 A;  2L5E A;  4ZW1 A;  4UYH A;  5A5P A;  3G0J A;  5KHM A;  5ENG A;  5EVA A;  4YYG A;  4A9I A;  4O7F A;  5FE8 A;  5EQ1 A;  4NYX A;  5DYU A;  4PCI A;  5LKX A;  4IR4 A;  4TYL A;  5IG6 A;  4YC9 A;  4OUF A;  5I1Q A;  4QUU A;  2KTB B;  5LVR A;  5DFD A;  4QSQ A;  5CUE A;  4LYW A;  4A9L A;  4NRC A;  5CPE A;  4XUB A;  4LDF A;  5D3S A;  5G4R A;  5A85 A;  3S92 A;  4YYI A;  4MR3 A;  3U5M A;  5C8G A;  5KTW A;  4CFK A;  1X0J A;  1F68 A;  3ZYU A;  5LKZ A;  5CQ5 A;  4QSP A;  5AD2 A;  4HBY A;  4BW4 A;  5I40 A;  5KO4 A;  3LQI A;  3SVF A;  4GPJ A;  5BT5 A;  1N72 A;  4NR5 A;  3UVW A;  4NS5 A;  2GRC A;  4NQN A;  2N9G A;  4MR4 A;  4QSU A;  4IR3 A;  3SVH A;  4QSV A;  4LYS A; 
#chains in the Genus database with same CATH topology
 5I7X A;  5CUD A;  1WUM A;  2YW5 A;  4CUR A;  3MB4 A;  5HRV A;  4QZS A;  4XYA A;  5FG4 A;  4CUU A;  5D3P A;  5HM0 A;  4NR4 A;  5DBM A;  4IR5 A;  4Z1S A;  2I8N A;  5CTL A;  5DYA A;  4IOO A;  4CFL A;  5DW2 A;  5FBX A;  4AI6 A;  1E6I A;  5L98 A;  4HBX A;  4TQN A;  5ENF A;  4YYM A;  4UIW A;  2YYN A;  3Q2F A;  3HME A;  5HFR A;  3MXF A;  5F36 A;  4NYV A;  4TZ2 A;  5I7Y A;  3JVJ A;  5A5S A;  5F25 A;  4KV1 A;  5FE7 A;  4FLP A;  4HXS A;  5HRW A;  4O7A A;  4QSS A;  5ETB A;  4N4F A;  5E9V A;  5DYC A;  5L96 A;  5L8U A;  4Z6H A;  2F6N A;  4O70 A;  4HXO A;  5FH8 A;  3O34 A;  4TS8 A;  4NR6 A;  3UV5 A;  4LZS A;  4CL9 A;  5H1U A;  5CP5 A;  5A5Q A;  3JVK A;  5IID A;  5LKT A;  5E7D A;  2D82 A;  4ZQL A;  5E9M A;  5EU1 A;  4KV4 A;  4A9F A;  4BW3 A;  5DFB A;  5FFV A;  5HJC A;  4PS5 A;  4HXK A;  4HXM A;  5H85 A;  4NRA A;  4N3W A;  4QR5 A;  4A9J A;  3HMH A;  4QNS A;  5H1T A;  3G0L A;  4LZR A;  4QYD A;  4UIU A;  5EA1 A;  5AD3 A;  3P1D A;  2DVS A;  4MR5 A;  3LQJ A;  2DVQ A;  5D0C A;  3P1E A;  3IU6 A;  5FE4 A;  2L85 A;  4YAX A;  4CUQ A;  4O7C A;  2FSA A;  5ENI A;  2G4A A;  5HFQ A;  4LZ2 A;  4QSX A;  4QEV A;  5EI4 A;  4HXR A;  5BT4 A;  5LUU A;  5E3G A;  3UVY A;  5EGU A;  3U5K A;  4NR9 A;  4BJX A;  4HBV A;  5FFW A;  2I7K A;  4MR6 A;  5IGK A;  4CUP A;  2RI7 A;  3D1D A;  3O33 A;  4YYK A;  2D9E A;  4PKL A;  2E3K A;  5DKC A;  5FE9 A;  4QB3 A;  5F3A A;  2OSS A;  2H60 A;  3DWY A;  4CUS A;  4YBM A;  5F61 A;  5IGM A;  3O35 A;  3MB3 A;  4TT2 A;  5F5Z A;  5ETD A;  5II1 A;  3MUL A;  5K29 A;  5CGP A;  5DW1 A;  3D7C A;  3GG3 A;  4J0S A;  5EK9 A;  4Z1Q A;  5C7N A;  4YY6 A;  4C66 A;  4BW2 A;  3U5P A;  4YYJ A;  5CRZ A;  4O72 A;  3UV4 A;  5HQ5 A;  4DON A;  4PCE A;  3IU5 A;  4TT4 A;  4TZ8 A;  5FE2 A;  4CLB A;  4NXJ A;  4O76 A;  4QR3 A;  4A9K A;  5CUB A;  3I3J A;  4UYG A;  5D26 A;  5A82 A;  4NYW A;  2OO1 A;  5LJ1 A;  5ENB A;  4QC3 A;  5E74 A;  3P1C A;  5F60 A;  4QEW A;  5ENC A;  5CUG A;  5EWC A;  4AKI A;  3QZS A;  4Z6I A;  4F3I A;  5FH6 A;  5DY7 A;  4QR4 A;  2RO1 A;  5CY9 A;  5D3H A;  5ENJ A;  5CQ8 A;  3RCW A;  5I83 A;  5LKU A;  5D3J A;  3FKM X;  5TCM A;  5FDZ A;  3U5L A;  5DKH A;  5A5R A;  3AAD A;  5CQ6 A;  5LVQ A;  2RS9 B;  5D7X A;  5HEL A;  4QSR A;  1EQF A;  5F2P A;  5CUC A;  4NUE A;  5L97 A;  5FB1 A;  1JM4 B;  2DKW A;  4LR6 A;  5A7C A;  5F63 A;  5COI A;  4J0R A;  3O36 A;  5C85 A;  5DX4 A;  5E9L A;  4ZC9 A;  5CS8 A;  5HLS A;  4O7E A;  3U5J A;  4C67 A;  3MQM A;  5E73 A;  3P1F A;  4UIX A;  4UIZ A;  4E96 A;  5CUA A;  4UYD A;  1ZKR A;  5C87 A;  4J3I A;  4A9H A;  5HRX A;  4QST A;  4HXL A;  4XUA A;  5I29 A;  4QEU A;  3MUK A;  4TT6 A;  5DLX A;  4QBM A;  5HEM A;  5KU3 A;  4O75 A;  2NXB A;  4HXP A;  5AME A;  4IR6 A;  2YEL A;  3AQA A;  4YYD A;  2R10 A;  2YQD A;  4N4G A;  5KTU A;  3LJW A;  4WHU A;  5DLZ A;  5L8T A;  3ONI A;  5I89 A;  4YYN A;  2WP2 A;  3UW9 A;  5J0D A;  4MEO A;  5FG6 A;  3U5O A;  2DAT A;  2YDW A;  5BT3 A;  2LSP B;  4N4H A;  4X2I A;  4J1P A;  3DAI A;  4HXN A;  2RNY A;  2EJN A;  4TU4 A;  4YAD A;  4LC2 A;  4AKG A;  5EV9 A;  5AMF A;  4NQM A;  5JI8 A;  4A9M A;  4QYL A;  4YYH A;  5I80 A;  5EIC A;  4YK0 A;  3HMF A;  5FE1 A;  2R0S A;  3P5O A;  4O78 A;  5DFC A;  5FH7 A;  2L84 A;  5FE5 A;  5ENH A;  5HEN A;  5I86 A;  5DYX A;  4NUD A;  3ERR A;  4BW1 A;  2DVV A;  3UV2 A;  3U5N A;  4PTB A;  2RNX A;  4BHW A;  3UVD A;  3O37 A;  5CQA A;  2YEK A;  5EPB A;  3D1B A;  3S91 A;  3VKG A;  5II2 A;  5EWH A;  5LJ0 A;  4A9N A;  5D3L A;  4QSW A;  3TLP A;  5IGN A;  2DVR A;  4NUC A;  4NR8 A;  4Q0N A;  3Q2E A;  5EPR A;  4LRG A;  5E3D A;  5ACY A;  3JVM A;  4UYF A;  5FB0 A;  5C89 A;  5A5N A;  4YH3 A;  4O71 A;  2E7O A;  5IGL A;  2YEM A;  5EM3 A;  5FE3 A;  4XY9 A;  5L99 A;  4UIY A;  4YAT A;  3JVL A;  4IOR A;  4Z93 A;  4TTE A;  5FE6 A;  4RVR A;  5D3T A;  2MJV B;  4YH4 A;  5DKD A;  5IBN A;  4YBT A;  5F62 A;  5E9I A;  1ZS5 A;  2WP1 A;  4IOQ A;  4N4I A;  5H1V A;  5G4S A;  5KTX A;  4ALH A;  2DWW A;  3NXB A;  3VKH A;  4YY4 A;  5CQ7 A;  4A9E A;  4PY6 A;  5FFY A;  4A9O A;  5C4Q A;  5I88 A;  4Q0O A;  4MEN A;  5CZG A;  4LYI A;  4AKH A;  2F6J A;  3K2J A;  3UVX A;  4KCX A;  5D24 A;  4O74 A;  5E0R A;  5A83 A;  5CQT A;  4YAB A;  5A5O A;  4QC1 A;  5CFW A;  5EIS A;  5JWM A;  4QUT A;  5HCL A;  5FE0 A;  2RFJ A;  4CUT A;  4O7B A;  5EWW A;  4XY8 A;  5F1L A;  4TU6 A;  4HBW A;  5CQ4 A;  5ENE A;  5E9K A;  2E7N A;  3QZT A;  3QZV A;  4NRB A;  4OGI A;  5E9Y A;  4UIT A;  4UYE A;  4MEP A;  3SVG A;  3LXJ A;  2R0V A;  4AKN A;  4WIV A;  5HQ7 A;  5TB6 A;  4O77 A;  4QY4 A;  5CQ3 A;  4ALG A;  5EPS A;  4NR7 A;  5HQ6 A;  1JSP B;  3LQH A;  5LJ2 A;  2R0Y A;  5D3R A;  4UYF B;  5EP7 A;  4OGJ A;  4UIV A;  5D3N A;  5F1H A;  2RNW A;  1WUG A;  4YBS A;  5EWV A;  4MEQ A;  4Y03 A;  4WHW A;  5CRM A;  5EWD A;  5D25 A;  5CU8 A;  2OUO A;  5FG5 A;  5A81 A;  2L5E A;  4ZW1 A;  4UYH A;  5A5P A;  3G0J A;  5KHM A;  5ENG A;  5EVA A;  4YYG A;  4A9I A;  4O7F A;  5FE8 A;  5EQ1 A;  4NYX A;  5DYU A;  1PUO A;  4PCI A;  5LKX A;  4IR4 A;  4TYL A;  5IG6 A;  4YC9 A;  4OUF A;  5I1Q A;  4QUU A;  2KTB B;  5LVR A;  4QSQ A;  5DFD A;  5CUE A;  4LYW A;  4A9L A;  4NRC A;  5CPE A;  4XUB A;  4LDF A;  5D3S A;  5G4R A;  5A85 A;  3S92 A;  4YYI A;  4MR3 A;  3U5M A;  5C8G A;  5KTW A;  4CFK A;  1X0J A;  1F68 A;  3ZYU A;  5LKZ A;  5CQ5 A;  4QSP A;  5AD2 A;  4HBY A;  4BW4 A;  5I40 A;  5KO4 A;  3LQI A;  3SVF A;  4GPJ A;  5BT5 A;  1N72 A;  4NR5 A;  3UVW A;  4NS5 A;  2GRC A;  4NQN A;  2N9G A;  4MR4 A;  4QSU A;  4IR3 A;  3SVH A;  4QSV A;  4LYS A; 
#chains in the Genus database with same CATH homology
 5I7X A;  5CUD A;  1WUM A;  2YW5 A;  4CUR A;  3MB4 A;  5HRV A;  4QZS A;  4XYA A;  5FG4 A;  4CUU A;  5D3P A;  5HM0 A;  4NR4 A;  5DBM A;  4IR5 A;  4Z1S A;  2I8N A;  5CTL A;  5DYA A;  4IOO A;  4CFL A;  5DW2 A;  5FBX A;  1E6I A;  5L98 A;  4HBX A;  4TQN A;  5ENF A;  4YYM A;  4UIW A;  2YYN A;  3Q2F A;  3HME A;  5HFR A;  3MXF A;  5F36 A;  4NYV A;  4TZ2 A;  5I7Y A;  3JVJ A;  5A5S A;  5F25 A;  4KV1 A;  5FE7 A;  4FLP A;  4HXS A;  5HRW A;  4O7A A;  4QSS A;  5ETB A;  4N4F A;  5E9V A;  5DYC A;  5L96 A;  5L8U A;  4Z6H A;  2F6N A;  4O70 A;  4HXO A;  5FH8 A;  3O34 A;  4TS8 A;  4NR6 A;  3UV5 A;  4LZS A;  4CL9 A;  5H1U A;  5CP5 A;  5A5Q A;  3JVK A;  5IID A;  5LKT A;  5E7D A;  2D82 A;  4ZQL A;  5E9M A;  5EU1 A;  4KV4 A;  4A9F A;  4BW3 A;  5DFB A;  5FFV A;  5HJC A;  4PS5 A;  4HXK A;  4HXM A;  5H85 A;  4NRA A;  4N3W A;  4QR5 A;  4A9J A;  3HMH A;  4QNS A;  5H1T A;  3G0L A;  4LZR A;  4QYD A;  4UIU A;  5EA1 A;  5AD3 A;  3P1D A;  2DVS A;  4MR5 A;  3LQJ A;  2DVQ A;  5D0C A;  3P1E A;  3IU6 A;  5FE4 A;  2L85 A;  4YAX A;  4CUQ A;  4O7C A;  2FSA A;  5ENI A;  2G4A A;  5HFQ A;  4LZ2 A;  4QSX A;  4QEV A;  5EI4 A;  4HXR A;  5BT4 A;  5LUU A;  5E3G A;  3UVY A;  5EGU A;  3U5K A;  4NR9 A;  4BJX A;  4HBV A;  5FFW A;  2I7K A;  4MR6 A;  5IGK A;  4CUP A;  2RI7 A;  3O33 A;  4YYK A;  2D9E A;  4PKL A;  2E3K A;  5DKC A;  5FE9 A;  4QB3 A;  5F3A A;  2OSS A;  2H60 A;  3DWY A;  4CUS A;  4YBM A;  5F61 A;  5IGM A;  3O35 A;  3MB3 A;  4TT2 A;  5F5Z A;  5ETD A;  5II1 A;  3MUL A;  5K29 A;  5CGP A;  5DW1 A;  3D7C A;  3GG3 A;  4J0S A;  5EK9 A;  4Z1Q A;  5C7N A;  4YY6 A;  4C66 A;  4BW2 A;  3U5P A;  4YYJ A;  5CRZ A;  4O72 A;  3UV4 A;  5HQ5 A;  4DON A;  4PCE A;  3IU5 A;  4TT4 A;  4TZ8 A;  5FE2 A;  4CLB A;  4NXJ A;  4O76 A;  4QR3 A;  4A9K A;  5CUB A;  3I3J A;  4UYG A;  5D26 A;  5A82 A;  4NYW A;  2OO1 A;  5LJ1 A;  5ENB A;  4QC3 A;  5E74 A;  3P1C A;  5F60 A;  4QEW A;  5ENC A;  5CUG A;  5EWC A;  3QZS A;  4Z6I A;  4F3I A;  5FH6 A;  5DY7 A;  4QR4 A;  2RO1 A;  5CY9 A;  5D3H A;  5ENJ A;  5CQ8 A;  3RCW A;  5I83 A;  5LKU A;  5D3J A;  3FKM X;  5TCM A;  5FDZ A;  3U5L A;  5DKH A;  5A5R A;  3AAD A;  5CQ6 A;  5LVQ A;  2RS9 B;  5D7X A;  5HEL A;  4QSR A;  1EQF A;  5F2P A;  5CUC A;  4NUE A;  5L97 A;  5FB1 A;  1JM4 B;  2DKW A;  4LR6 A;  5A7C A;  5F63 A;  5COI A;  4J0R A;  3O36 A;  5C85 A;  5DX4 A;  5E9L A;  4ZC9 A;  5CS8 A;  5HLS A;  4O7E A;  3U5J A;  4C67 A;  3MQM A;  5E73 A;  3P1F A;  4UIX A;  4UIZ A;  4E96 A;  5CUA A;  4UYD A;  5C87 A;  4J3I A;  4A9H A;  5HRX A;  4QST A;  4HXL A;  4XUA A;  5I29 A;  4QEU A;  3MUK A;  4TT6 A;  5DLX A;  4QBM A;  5HEM A;  5KU3 A;  4O75 A;  2NXB A;  4HXP A;  5AME A;  4IR6 A;  2YEL A;  3AQA A;  4YYD A;  2R10 A;  2YQD A;  4N4G A;  5KTU A;  3LJW A;  4WHU A;  5DLZ A;  5L8T A;  3ONI A;  5I89 A;  4YYN A;  2WP2 A;  3UW9 A;  5J0D A;  4MEO A;  5FG6 A;  3U5O A;  2DAT A;  2YDW A;  5BT3 A;  2LSP B;  4N4H A;  4X2I A;  4J1P A;  3DAI A;  4HXN A;  2RNY A;  4TU4 A;  4YAD A;  4LC2 A;  5EV9 A;  5AMF A;  4NQM A;  5JI8 A;  4A9M A;  4QYL A;  4YYH A;  5I80 A;  5EIC A;  4YK0 A;  3HMF A;  5FE1 A;  2R0S A;  3P5O A;  4O78 A;  5DFC A;  5FH7 A;  2L84 A;  5FE5 A;  5ENH A;  5HEN A;  5I86 A;  5DYX A;  4NUD A;  4BW1 A;  2DVV A;  3UV2 A;  3U5N A;  4PTB A;  2RNX A;  4BHW A;  3UVD A;  3O37 A;  5CQA A;  2YEK A;  5EPB A;  3S91 A;  5II2 A;  5EWH A;  5LJ0 A;  4A9N A;  5D3L A;  4QSW A;  3TLP A;  5IGN A;  2DVR A;  4NUC A;  4NR8 A;  4Q0N A;  3Q2E A;  5EPR A;  4LRG A;  5E3D A;  5ACY A;  3JVM A;  4UYF A;  5FB0 A;  5C89 A;  5A5N A;  4YH3 A;  4O71 A;  2E7O A;  5IGL A;  2YEM A;  5EM3 A;  5FE3 A;  4XY9 A;  5L99 A;  4UIY A;  4YAT A;  3JVL A;  4IOR A;  4Z93 A;  4TTE A;  5FE6 A;  4RVR A;  5D3T A;  2MJV B;  4YH4 A;  5DKD A;  5IBN A;  4YBT A;  5F62 A;  5E9I A;  1ZS5 A;  2WP1 A;  4IOQ A;  4N4I A;  5H1V A;  5G4S A;  5KTX A;  4ALH A;  2DWW A;  3NXB A;  4YY4 A;  5CQ7 A;  4A9E A;  4PY6 A;  5FFY A;  4A9O A;  5C4Q A;  5I88 A;  4Q0O A;  4MEN A;  5CZG A;  4LYI A;  2F6J A;  3K2J A;  3UVX A;  4KCX A;  5D24 A;  4O74 A;  5E0R A;  5A83 A;  5CQT A;  4YAB A;  5A5O A;  4QC1 A;  5CFW A;  5EIS A;  5JWM A;  4QUT A;  5HCL A;  5FE0 A;  2RFJ A;  4CUT A;  4O7B A;  5EWW A;  4XY8 A;  5F1L A;  4TU6 A;  4HBW A;  5CQ4 A;  5ENE A;  5E9K A;  2E7N A;  3QZT A;  3QZV A;  4NRB A;  4OGI A;  5E9Y A;  4UIT A;  4UYE A;  4MEP A;  3SVG A;  3LXJ A;  2R0V A;  4AKN A;  4WIV A;  5HQ7 A;  5TB6 A;  4O77 A;  4QY4 A;  5CQ3 A;  4ALG A;  5EPS A;  4NR7 A;  5HQ6 A;  1JSP B;  3LQH A;  5LJ2 A;  2R0Y A;  5D3R A;  4UYF B;  5EP7 A;  4OGJ A;  4UIV A;  5D3N A;  5F1H A;  2RNW A;  1WUG A;  4YBS A;  5EWV A;  4MEQ A;  4Y03 A;  4WHW A;  5CRM A;  5EWD A;  5D25 A;  5CU8 A;  2OUO A;  5FG5 A;  5A81 A;  2L5E A;  4ZW1 A;  4UYH A;  5A5P A;  3G0J A;  5KHM A;  5ENG A;  5EVA A;  4YYG A;  4A9I A;  4O7F A;  5FE8 A;  5EQ1 A;  4NYX A;  5DYU A;  4PCI A;  5LKX A;  4IR4 A;  4TYL A;  5IG6 A;  4YC9 A;  4OUF A;  5I1Q A;  4QUU A;  2KTB B;  5LVR A;  5DFD A;  4QSQ A;  5CUE A;  4LYW A;  4A9L A;  4NRC A;  5CPE A;  4XUB A;  4LDF A;  5D3S A;  5G4R A;  5A85 A;  3S92 A;  4YYI A;  4MR3 A;  3U5M A;  5C8G A;  5KTW A;  4CFK A;  1X0J A;  1F68 A;  3ZYU A;  5LKZ A;  5CQ5 A;  4QSP A;  5AD2 A;  4HBY A;  4BW4 A;  5I40 A;  5KO4 A;  3LQI A;  3SVF A;  4GPJ A;  5BT5 A;  1N72 A;  4NR5 A;  3UVW A;  4NS5 A;  2GRC A;  4NQN A;  2N9G A;  4MR4 A;  4QSU A;  4IR3 A;  3SVH A;  4QSV A;  4LYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...