4A9SA

Crystal structure of human chk2 in complex with benzimidazole carboxamide inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
302
structure length
282
Chain Sequence
VYPKALRDEYIMSKTLEVKLAFERKTCKKVAIKIISKPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILTSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title Benzimidazole Inhibitors of the Protein Kinase Chk2: Clarification of the Binding Mode by Flexible Side Chain Docking and Protein-Ligand Crystallography.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 282
sequence length 302
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4a9sA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4a9sA01
3ZEWA 1YXXA 3R73A 3G5DA 4M0YA 4O2PA 3D5WA 3OCTA 4EJNA 2C5OA 2V7AA 4FSYA 3DAJA 3WZDA 4ANBA 3BWFA 3E7VA 1A06A 1W83A 2Y4PA 2Z7QA 5DR9A 4F7SA 3AC3A 3BEAA 4KSPA 4XBUA 2YDJA 4ZSLA 4EOKA 5F95A 2VWWA 3H0YA 4Z7GA 5IDNA 1PKDA 3R1YA 4FT0A 2HXLA 4IWQA 1GJOA 1PXJA 4Q9ZA 4DAWA 4BBEA 5M09A 5J8IA 4GVJA 4Y8DA 4U81A 3H0ZA 5AX9A 5LMKA 3FE3A 4FBXA 3H30A 4IBMA 4DH5A 4BZDA 3VS0A 5IH6A 4X3JA 4DGMA 3F2AA 4DN5A 2ZV8A 4FEQA 5JFWA 3C13A 1UKHA 4ONAA 5C26A 1STCE 2WTJA 3GCQA 3P86A 4DC2A 4DF3A 4CRSA 3UNZA 4WNKA 2LAVA 5CAPA 4IHPA 4B7TA 3KULB 3KMWA 4OTQA 1ZLTA 2FYSA 1QPJA 3BLRA 3R28A 4TWCA 4X21A 3FEGA 4O83A 4U42A 4NK9A 4D2PA 4EOLA 4BTJA 4BDIA 4M14A 4AWIA 3G15A 3I7CA 1OPKA 3FZPA 4DTBA 3F88A 2YCFA 3LCTA 1WBVA 2X2MA 3VQUA 4PNKA 2HW7A 4YC6A 2F49A 1PXOA 3WBLA 2I7QA 2EB2A 4ACGA 4IB5A 4MVFA 5DPVA 2AC5A 4BCMA 3ITZA 3TT0A 2VWZA 3ZDUA 2PULA 1OVEA 4FKJA 1YWNA 4FV9A 1FVRA 5AP4A 5KMNA 1OL6A 4WRGA 4I92A 2E9OA 3QYWA 5HE1A 1JBPE 4F9AA 4RWIA 3VJNA 4JJRA 4IEBA 3VS5A 5IQBA 4FTIA 3Q6WA 1R78A 1YRPA 4R3RA 4XOYA 1OKWA 3UQFA 2XIKA 2PE1A 4KKHA 4AZSA 4OW8A 2XK4A 3A4OX 3QD0A 3QTXA 3A8WA 2BFXA 5KHXA 4QMNA 3U55A 3A61A 4AW1A 3KXNA 4M67A 2PY3A 4RC2A 3QRTA 4FTKA 3RCDA 4AT4A 2JAVA 5CALA 2VO3A 3FY2A 2GU8A 3CS9A 3ZUTA 4HNFA 5IH4A 5KMJA 4W4VA 2WB8A 2VV9A 3CY3A 3O71A 4LGHA 5EDRA 3RWPA 4QPSA 4O0XA 2VTJA 4FSNA 5KX8A 4XG6A 3FYKX 4GT3A 2FH9A 3CQUA 4NFMA 3VUTA 2WFYA 1XH5A 4DEBA 4ZMFA 4UZHA 5FXQA 4QMZA 4TXCA 1BLXA 4FTCA 4GYGA 5CWZA 1KV1A 5HO6A 4X0MA 3U6JA 3FZTA 5KMOA 3ULZA 5M08A 3HNGA 2JIUA 4IAAA 5D11A 5B2KA 3QKMA 2G15A 3OWLA 5DRBA 5BUJA 3GU7A 1X8BA 2NO3A 3PJ8A 3PPKA 3BBTB 3RBWA 4Z3VA 1W82A 4YHJA 3FMEA 2QKRA 5IA3A 2ACXA 4C3FA 2X7FA 5AP7A 4YZNA 4QYEA 3DZQA 3AOXA 4U43A 2R4BA 3DGKA 4GK2A 2OW3A 4EHZA 3LKMA 4BIEA 5LMAA 3DBDA 1LEWA 3FAAA 4DH7A 2W05A 5EHOA 4L53A 4ANLA 1IRKA 1UNLA 2QOOA 5HHWA 4HZSA 4O7NA 4E4NA 2PZYA 3JY0A 4CV8A 3BPRA 4TY1A 2QO7A 4LUDA 2OH4A 1MRUA 3OWKA 4QMYA 3RPYA 1K9AA 3QTWA 2RIOA 5CAVA 4NYEA 3EQIA 2XIRA 4ERWA 2QC6A 3WIGA 3FZRA 3LJ1A 3OTUA 3UVPA 4EQCA 1SNUA 3EQGA 2XUUA 4D2WA 4O7RA 4TNDA 4TYHA 1FGKA 4GEOA 5HG9A 3O8UA 4PTCA 5L2IA 4YU2A 1UVRA 3O96A 4M97A 4S32A 4XEYA 3V8SA 1Y91A 3LFAA 4FV7A 3E8CA 2ZMCA 3F5UA 4IIRA 5E8XA 3FQSA 5GINE 2GNLA 4F99A 5CZIA 4BDCA 4MXXA 2HIWA 4K2RA 4OLIA 5FD2A 4BCHA 1BYGA 5IQCA 1JKTA 3FLYA 3KY2A 5M4CA 3F2RA 3LXNA 4I1ZA 3KXGA 1S9JA 4M84A 3GQLA 3QD2B 5DRDA 2PK9A 5EYMA 3MH3A 5AUZA 4CYIA 4D0XA 4EQMA 3ZLYA 4EHVA 4AE6A 2C1BA 4AXAA 3R7YA 2B54A 4O38A 4DEEA 3OD6X 2VTMA 3GC0A 3ROYA 4DLJA 1J1BA 3PP1A 4A9YA 3DJ5A 4FKTA 4YJTA 4A4XA 2IG7A 3EQCA 4GU6A 4GK3A 4O0UA 3QWJA 4R8QA 3G0FA 4EJ7A 5LVMA 1TQMA 5CU2A 3VRYA 3ERKA 3QHRA 4P7EA 5EM7A 4GT4A 4CLIA 5GIPE 3KA0A 3LXKA 5E8UA 2QONA 3GCVA 3DNDA 5C27A 3Q9ZA 1MUOA 4LRKA 3LLAA 1UA2A 4E4XA 3AC5A 1UWJA 4AQCA 3NNWA 2HYYA 2XNNA 1KSWA 2B9IA 3OWPA 3NVKI 2XH5A 1PXKA 1JAMA 3L8PA 2ONLC 4K6ZA 2W1CA 5IZFA 3HUCA 5HX6A 5IISA 1H4LA 1Q62A 3LCKA 4FEWA 3BHYA 3W2OA 4GL9A 4FKPA 3HX4A 3QQKA 1XH7A 3QQHA 4RVKA 1CKIA 2YHVA 1H1RA 5DFPA 4BDAA 5D9HA 4E4MA 3OCGA 4DFYA 4RX9A 2J0KA 3R00A 1Y57A 4QP2A 3HEGA 4RSSA 4EK3A 5CSXA 3FI4A 3T9IA 4IM2A 3MH0A 5CF6A 4KBAA 2XEZA 1KE7A 3GC7A 4MAOA 3LXLA 3P78A 1FBNA 1Q97A 3QA8A 5CVFA 3A60A 3SHEA 3BYMA 3LJ0A 5BMSA 3IDPA 3SC1A 3NNVA 2NRUA 4IC7A 2R64A 4YTHA 3TCPA 5IMEA 4WIHA 1J7IA 2YDIA 2WIPA 3DJ7A 3C0IA 3D7TA 4NZWB 4BTMA 4FK3A 5C4KA 1BL6A 2ZJWA 3ELJA 5E8VA 4BDDA 2YWVA 5EM8A 4IJPA 2EXMA 2BUJA 3ID6C 5AP0A 3ZO3A 4HNIA 1CM8A 3LPBA 2A27A 2ERKA 3E88A 4G17A 4CKRA 3FLZA 3QBNA 4DFBA 3ZXZA 4D2TA 4JLCA 4G3EA 4L67A 5JK3A 3QCQA 3E7OA 4B8LA 3ZM9A 3TWJA 3NR9A 4XJ0A 5IEYA 3K3IA 1BMKA 1DM2A 3R8LA 5HU3A 1G8AA 3PVGA 1ERKA 1OL1A 2PVNA 1A9UA 2R9SA 3BLQA 2PE2A 2IVUA 1S9IA 3O23A 4CMTA 4EH2A 4EH9A 4YURA 3BHHA 4K0YA 4TN6A 2GS6A 4AFEA 2YCRA 5KMLA 2F57A 1H1PA 4I3ZA 4IZAA 3DCVA 2ONLA 2CLQA 3GFEA 3GVUA 3PVBA 1IEPA 5C9CA 2IW9A 3ZEPA 2W99B 3W1FA 5JH6A 5A4TA 4RZVA 2VNYA 5L8KA 2WIHA 1SZMA 4EC8A 1PXPA 4RC3A 3MPAA 4JDJA 2Y9QA 1APME 1YXUA 3G90X 1KOAA 1HCLA 3FLWA 4QMXA 2P0CA 2Z7SA 5A9UA 4NM7A 5KBQA 2BHEA 4QT1A 4FKWA 3SDJA 3V5LA 3PWDA 2CNUA 4QRCA 1CKJA 1H1SA 1GY3A 5HO8A 3EN5A 3S95A 2O65A 3O8TA 3V5TA 3ZU7A 1Q24A 3AG9A 4ACMA 5BVOA 5IQDA 3F82A 5BNJA 4JR3A 4EYMA 4OT6A 4I41A 3PZHA 4A9UA 3U9CA 1OIYA 2W1GA 4KUJA 1PXMA 4PX6A 4IAZA 4BYIA 1R1WA 4R7HA 4UWYA 4C62A 3EH9A 3IW4A 4F64A 2I0VA 3A7GA 4B6LA 5AUUA 5G1XA 5AUTA 2RFDA 3OWJA 4FMQA 4BDFA 3MTLA 4MNFA 3KB7A 4KIKA 1H28A 2EWAA 5IG1A 4EH4A 4IX6A 4KIQA 2J5EA 3R9OA 4U9AA 4ZTQA 4FR4A 4Q2AA 3P7BA 5KO1A 1JSTA 4X3FC 3UNKA 5HBHA 3PLAE 4IAFA 5BUIA 3IK3A 3QLFA 1GNGA 1UU8A 2OIBA 1Q5KA 3AC1A 4IW0A 1OITA 2YISA 2CSNA 2XIYA 3MIAA 4QQJA 5EW9A 1FMOE 3DKFA 5KE0A 5I0BA 3K5UA 5JGAA 2WOTA 3VO3A 2C6MA 4YJOA 3HAVA 3CGOA 4L01A 3AGMA 4LRMA 3U9NA 5I9YA 3G6HA 2IZUA 2WTWA 3A4PA 4HVHA 2GTMA 3SD0A 4EQUA 3IONA 3NPCA 4GG7A 2FGIA 2H34A 4AS0A 4FT7A 1GZOA 1OPLA 2W96B 4G31A 2OZOA 2YJRA 3NW5A 3R04A 3OW4A 4EOOA 4DITA 3VF8A 4ALWA 3M42A 3OCSA 4H1JA 4LOQA 2ZV9A 4FIFA 5EYDA 2NP8A 1Q8UA 2GFCA 3ZZEA 3D5VA 4NCTC 3G33A 2WMSA 4QD6A 5L6WL 2OXYA 4AA5A 4GUEA 5IQEA 3O7LB 3Q32A 4WUNA 1ZOEA 3PY0A 3IDCA 3Q4ZA 4W4YA 4QTEA 2JIIA 4O2ZA 3KULA 5AJQA 3L8XA 4FG7A 4O96A 3RZBA 5EHYA 4EI4A 1QPCA 1Z57A 4ITIA 4TNBA 2C3IB 2HZIA 4PDSA 4G16A 3FZOA 5I9XA 3COIA 3A62A 4HVDA 2VTIA 2BRGA 4BCPA 4EWHA 4TYEA 5E1SA 4EH6A 4UXLA 5M53A 4ZP5A 2WMTA 3CKXA 4ZSGA 4BDJA 1WCCA 5TF9A 4X6QC 1XKKA 4MH7A 4CT1A 4G6OA 2UZBA 3FMHA 3FUPA 3R71A 5DEYA 3W33A 1QPDA 3MJ2A 3ZLSA 5IPJA 5KMIA 4H58A 4F9WA 4CRLA 2Q83A 2GNHA 2OXDA 2FB8A 3SOAA 3UO6A 5M07A 4RIYB 2X8DA 3WF5A 4E6QA 2R0IA 3HMMA 5EQPA 5J7HA 5EDQA 4GK4A 4PRJA 4BCNA 5HLNA 3CP9A 2R3MA 4AA0A 2O0UA 4R5SA 2OZAA 4KKEA 3G51A 4FICA 3BU6A 3BHVA 5EG3A 2ZMDA 4JBVA 3PRFA 1MQBA 5CT0A 2KTYA 4DEIA 3D0EA 4UV0A 4ZZOA 4D5KA 4RJ3A 4ZIMA 4KS7A 4NWMA 3ZS5A 2FA2A 3UYSA 2ITTA 5CEPA 2Y7JA 5CEMA 4D5HA 4DG2E 2BMCA 4J7BA 4CKJA 4FTUA 5JT2A 3QKKA 4DCEA 4B0GA 1XWSA 3HP5A 4PTEA 4EOMA 2G2FA 4RFYA 4FTLA 2UW0A 5M06A 4PL5A 2XA4A 3MFUA 4L46A 1PY5A 3PVWA 4BI1A 2YCQA 4H3BA 2V62A 3BZ3A 3EL8A 3LHJA 3BYUA 4OAVB 3FZ1A 3OUKA 1P2AA 5IF1A 3SG8A 1WBPA 4EL9A 2BIYA 4DTAA 2XCKA 4KNBA 4C58A 5HD7A 3LOKA 2YZLA 2QOQA 2C30A 4NM3A 1YKRA 4OTRA 1ND4A 3QX2A 4YTCA 1YI4A 5LXMA 3DXPA 1Y6BA 2JKKA 5ACKA 3IGOA 3W8LA 1Q61A 1O9UA 3V01A 2DWBA 2C1AA 2QO2A 3AC8A 4Z9LA 3MY1A 4F9BA 4TWOA 2R3IA 4AUAA 3GOPA 4QQ5A 3R8MA 3V51A 2YIXA 4HYUA 3EB0A 2YIQA 1H26A 4TYJA 4U41A 3BWJA 4EOQA 2B53A 4F08A 4QYYA 3G2FA 3N4UA 3GU6A 3OY1A 2W1EA 2JBPA 4F6WA 5GJFA 3OS3A 1BI7A 3A7HA 4CLJA 4FNYA 4FEVA 2PVKA 5M57A 2BZHB 1UKIA 1W8CA 2VTSA 3P79A 3EFWA 3PVUA 1YXVA 4TW9A 3NUNA 1JSUA 3IDBA 4NJ3A 3VQHA 5CU6A 1V0PA 4IX4A 5K5NA 2CLXA 4G3GA 2QOHA 4UBAA 5BVEA 3LFCA 2R5TA 3C50A 3GNIB 3W2QA 4ZTHA 5J87A 5AR3A 5FG8A 2QO9A 3VHKA 5A14A 5AIRA 2EU9A 4YO6A 4C4EA 3MN3A 5A3XA 4G3DA 4EKLA 5J95A 4WA9A 2ETMA 3QCXA 1ZOHA 5HTBA 1U59A 1R39A 5FUTA 4FT9A 3DPKA 2RFSA 4DGLC 1IAHA 3OROA 4XLVA 4WOVA 2BILB 2ZOQA 4H1MA 5TKDA 4AOIA 3AGLA 4E26A 1H1QA 2FVDA 1ZXEA 4BZNA 3ZFMA 2X2LA 2UW6A 1XQZA 2CCIA 3ORPA 4NT4A 4XRLA 4BC6A 5KMMA 2ESMA 3P1AA 4E4LA 4OTIA 4F0FA 3NGAA 2W5HA 3D2IA 5EW3A 3UIUA 4EUUA 4WD5A 4MCVA 3FZSA 2PMIA 3LXPA 4DFLA 5HD4A 3KK9A 4TWNA 3C4ZA 2C0IA 3BE2A 5DBXA 5HO7A 2DUVA 5CEIA 4JIAA 3CTHA 4ACHA 3S3IA 1ZARA 1EH4A 3IW8A 4GYIA 3DDQA 3MS9A 4KRCA 5A54A 4LOOA 3E93A 3I7BA 2X9EA 3UMWA 1OUYA 2E9PA 2C69A 3PY1A 4IQ6A 3QUEA 2XVDA 4IVBA 4JG6A 4NW6A 4V0GB 4AZVA 4GH2A 5CX9A 4WBOA 2KULA 4U0IA 1CKPA 2B1PA 4AACA 1M2PA 5ETAA 3SRVA 1V0BA 2ITXA 5DT0A 4UYAA 3MPTA 4BGHA 2UVXA 3R9DA 4BCOA 3Q2JA 4NKAA 3VUKA 2VTHA 4FKQA 2CGVA 1LUFA 2UZVA 4OTWA 5L3AA 1Q41A 5IH5A 2R3HA 4KB8A 2R3LA 4FTRA 4QNAA 4XRJA 3EOCA 3U87A 3DKOA 3NNUA 3VUDA 4N4SA 1H25A 3QUDA 3MV5A 3F6XA 2WELA 2XNMA 3KL8A 3MBLA 3LM5A 3PY3A 2B55A 4M13A 4E5AX 4HVIA 2HK5A 3QUPA 4ITHA 3N9XA 2PHKA 3SOCA 3HRBA 1GIIA 3C4XA 3IOKA 4GW8A 5AM7A 4IDTA 4QQCA 3DFAA 3F2NA 5HG5A 4EWQA 5HVYA 3AMYA 5EI6A 4C4GA 4I4EA 3TTIA 3G0EA 4WO5A 4BTKA 3EZVA 3RP9A 3ORIA 4ASEA 4DH8A 1J3HA 3EQPA 5AWMA 4C37A 2QOLA 3GENA 5AP1A 2A2AA 2ETKA 4OUCA 1T45A 3UYTA 5HKMA 4YHTA 1PXLA 3EYHA 4FE2A 3C1XA 3V5PA 4XV3A 1TQIA 3CSVA 3MY0A 4BBMA 4RJ6A 1PXIA 1NXKA 4JS8A 3SG9A 4FODA 2RL5A 3OBJA 5D1JA 2UUEA 4M12A 2O64A 2XMYA 4YC8A 4AG8A 5CASA 4MK0A 2PZIA 3GCUA 3CKWA 4C34A 4DGGA 5I5ZA 2QNJA 3QFVA 1R3CA 4F63A 1XHAA 1IA8A 3UP7A 4LUEA 3B2TA 4JAIA 4UMUA 2PZPA 1M7QA 4UN0C 4J52A 2VNWA 5B2LA 3ATTA 2X8EA 4QYGA 4D55A 3G9LX 5HG7A 4ENXA 5CU0A 4BWPA 1JLUE 5DI1A 3ZXTA 4GRBA 2AUHA 3F61A 4GIHA 3FMKA 3V5QA 2UVZA 2EB3A 2ZDTA 4J71A 2WO6A 1XH4A 2ZVAA 5IMXA 4P5ZA 5DIAA 4FOCA 2VWYA 2Z8CA 5BPYA 5L4QA 5HGIA 4DH3A 2Q0BA 4HPTE 2ITOA 3DV3A 3R7UA 4BCGA 4WUAA 4YTIA 2LGCA 4GJ3A 3RK9A 2W17A 4BCQA 5LJJA 2YEXA 4O7VA 2WGJA 3H9RA 2JKQA 4I23A 5TO8A 2JDSA 4YHFA 5J9YA 5M51A 5DVRA 5LWNA 5LVLA 2X6EA 4WBBB 3RINA 1SVHA 2RFEA 2X4ZA 1M2QA 1XH6A 4FUXA 5M4FA 1WBNA 2VX3A 1W98A 4RT7A 5L8JA 4J8MA 2PWLA 2J90A 4ZTSA 3BLHA 4AOTA 3UZTA 5J1VA 4TT7A 4ZSJA 3SXRA 1XH8A 2J6MA 4L3JA 3I0QA 4WT6A 4YR8A 4IAKA 5FGKA 5CANA 2OI4X 4FZFB 4AN3A 1RJBA 3WZJA 4X3FB 2PUPA 4UWBA 3ORXA 2IZRA 4L45A 4G9RA 4EOSA 4QMMA 3VWAA 1YOLA 3V6RA 3RVGA 5E8ZA 4NU1A 2UZUE 4BKJA 4HOKA 3I0OA 4BDEA 3VS2A 3GC9A 4LYNA 3ZHPC 5KNJA 4GJ2A 4IB1A 2WEIA 5IUIA 3ZBXA 1URWA 4FKIA 4QP7A 2QOBA 3Q9YA 2WD1A 2JBOA 2OZAB 5J9ZA 3C4EA 5D41A 4M66A 3PFQA 3QQLA 2IZTA 4FIEA 3QCSA 5I9WA 1XH9A 5K0XA 4MNEA 3DBFA 5E8TA 2GHGA 3AC2A 4MD8E 4MD9E 4D4SA 5HLWA 4F6SA 1REJA 2QLUA 2VO0A 3EQBA 4M69A 5HI2A 1K3AA 3OT3A 2I6LA 5H8EA 4YZBA 5HEZA 1BX6A 2OJJA 5BVNA 4Z16A 1PMUA 4UEUA 5CXZA 3VN9A 3IO7A 3VHEA 2UW8A 2P2HA 3O51A 4APCA 2WU6A 5CVHA 1U54B 3BIZA 4QTCA 4IM0A 3HDMA 4NM5A 3FMLA 4PPCA 4F7LA 4ZZNA 3WE8A 4CFFA 4JBOA 3W55A 3BQCA 3QC4A 3KXHA 2FSLX 3QA0A 4V01A 2XKFA 4YZCA 1ZYDA 3QL8A 2YLFA 4Q5EA 3MSSA 4ANSA 2X0GA 3UG1A 3PSCA 4D9TA 4I5CA 2IWIA 1T46A 3LLTA 4QNYA 1UWHA 2JIVA 2QCSA 4QMLA 2V0DA 5DT3A 2OXXA 3FC2A 5HTIA 5EQEA 1YWRA 3F9NA 4FC0A 3R7GA 5EM5A 3RAIA 4CCBA 5HVJA 3UBDA 3COKA 3RALA 4QP6A 5EK7A 3ZLWA 5CAQA 4LFIA 4EONA 4CTCA 2C68A 3AQVA 5DE2A 3VIDA 2QOFA 3HMOA 4YZDA 1I09A 2VRXA 5FM2A 3TN8A 4I94A 5ITAA 4YSMA 2V7OA 3ETAA 2PYWA 4HJOA 2IJMA 3M1SA 2CKEA 3D14A 2J51A 3SAYA 4A9RA 2OGVA 3G9NA 3NAXA 4QMWA 3UNJA 5L2WA 3D4QA 2QHNA 2O3PA 4W4WA 4EH8A 4O82A 3BU3A 5J79A 3T3UA 1TKIA 4USEA 4OTHA 5C4LA 1Z9XA 3DOGA 4L7SA 3W16A 5M56A 2RKUA 3KCKA 4RIYA 3MJ1A 5AFVA 2C47A 2E9UA 2J0LA 3GUBA 1YDSE 3LCDA 3PE1A 4FIJA 2R3PA 4FKVA 4P5QA 4YLKA 2B0QA 2C6TA 3PSDA 3GU5A 2A0CX 4O27B 3V5WA 3ZM4A 3W2CA 3V3VA 4E5WA 1Q4LA 1WZYA 2EXCX 2F7ZE 5CU3A 4EK8A 2PL0A 3IS5A 5EHLA 3UO4A 1Q3DA 3PG1A 2WNTA 3LAUA 1U5RA 2BZIB 2WEVA 2X8IA 1H01A 4RJ4A 5HOAA 4E93A 3KREA 5BVWA 2OK1A 5AP5A 4N0SA 1IA9A 3F3WA 4M68A 2J9MA 3UO5A 2OJ9A 5DEWA 4PUZA 4FZAB 3E8NA 4I0RA 5BMMA 4RLKA 3ZOSA 5K5XA 3PTGA 2VTQA 3R1SA 4OT5A 1JOWB 3DU8A 4G2FA 5I9UA 3UVRA 5JQ8A 4L00A 4R3CA 4Y73A 5JFXA 2QKWB 3RM7A 4ASDA 1OL7A 3E62A 5LVOA 3FXXA 5ETFA 3GGFA 1MRYA 2W7XA 2ZDUA 5J7BA 2ITVA 4IWPA 3WF8A 3EQHA 4GUBA 5H8GA 5J5SA 4BICA 4JDIA 4BGGA 3ALOA 3NEWA 4YLLA 3TZ7A 4QP8A 3F5PA 4I0TA 3MH1A 5EQYA 3NMUF 3VS6A 5HNIX 3KVWA 5FQDC 5CI6A 1ZAOA 4RVLA 1YWVA 3D83A 2I40A 3TACA 5L6PA 3CJGA 3OEFX 3ZLXA 4AE9A 5DYJA 4ZMEA 3FMJA 5HU9A 3NIZA 3UJGA 2NPQA 2YCSA 4FV8A 4FKSA 1VZOA 2HW6A 3FWQA 4CTBA 1R0PA 5LOHA 1JKSA 3NUXA 4IZ7A 4IADA 2OIQA 3TL8A 3HV7A 1PRYA 4E6AA 2VTNA 5CLPA 1K2PA 1OPJA 2R3OA 2YFXA 3O7LD 4E5BA 3WI6A 1ZYCA 2QU6A 4J96A 4H05A 4D9UA 4IAYA 3D2KA 4IVCA 3A7IA 4KD1A 4MF0A 3TKUA 2P2IA 3LW0A 3OP5A 1JWHA 1ZOGA 4U7ZA 2J5FA 3DQWA 3FHIA 5HE2A 3SRVB 1BI8A 5IQHA 4X2JA 3MWUA 4UY9A 5FXRA 1U5QA 3KXXA 4YJNA 3VW6A 3N4TA 2H96A 3UODA 4EZ5A 5CAUA 5L6OA 2BZKB 4JDHA 1OB3A 4J98A 4WSQA 2JDTA 4ZLYA 4FIHA 4CSVA 5AP2A 4K8AA 4U80A 4ANQA 4W8DA 4PDOA 3ENHA 3H9OA 4LL5A 4MTAA 3TZ9A 2UZLA 5IU2A 3U6IA 4BBFA 2JDRA 2YAAA 4DGOA 4MQ1A 3PDTA 3ZC5A 1PW2A 4O91A 2PTKA 3TNWA 4AF3A 3IPHA 1UV5A 4J99A 1CDKA 4N70A 4WG3A 3MVMA 1XO2B 5JGDA 4X2NA 4O81A 5AV3A 3CD3A 3QF9A 5ANIA 3FKNA 1O6LA 4O1OA 5AR7A 4EZ7A 2JC6A 3VC4A 5C1QB 2VZ6A 3KK8A 4G9CA 4C33A 3TNQB 4F70A 2I0YA 3DXNA 4EK4A 5I9ZA 2G01A 4RWKA 4X2KA 3BE9A 4S33A 3RZFA 3OC1A 1IASA 3DJ6A 2RGPA 4DFNA 3BCEA 4U44A 2Z60A 4RX8A 2QG5A 4J95A 5CSVA 3NCGA 3V6SA 4C2VA 4F65A 3F3ZA 4I6QA 5E8YA 4FL1A 4EBWA 4OBOA 4NKSA 2PUNA 4OAUC 1OBDA 2QD9A 3Q4TA 2XRWA 3NYVA 4CFNA 2UZDA 1FOTA 2A1AB 2X2KA 4G5JA 1NVRA 5BVKA 4C8BA 4I4FA 4A06A 1OM1A 2CN5A 2QLQA 4MWIA 4NUSA 1CMKE 1L3RE 4I0SA 3EIDA 4L68A 2WMAA 3HYHA 4IDVA 2GHLA 4JAJA 1QPEA 4LG4A 3ZMMA 5JEBA 4FK6A 2H6DA 4H3QA 1KE5A 3ET7A 3UPZA 3MVLA 2VUWA 3BGQA 3BRBA 1ZZLA 3PXYA 2CNQA 4BI2A 3DXQA 3ZSGA 3WF9A 3EFJA 4RJ5A 4V0GA 4O7YA 3QTSA 4NTTA 1WBSA 2QVSE 4AGDA 3TI1A 5AV4A 2UW5A 2REIA 4DA5A 4YC3A 3F5GA 2BKZA 4AP7A 2XNEA 3WF6A 5CU4A 5EW8A 3ZC6A 3UIMA 4XG8A 4C7TA 4DEDA 3MFTA 3SX9A 4H39A 2C4GA 1SVGA 2W4JA 3ORMA 4MBLA 2JLDA 4D2VA 5FEQA 5L2TA 4R1VA 2X7OA 3BBWA 3UQCA 1XR1A 4RQVA 4ORKA 1ZZ2A 1IAJA 1PKGA 3JVRA 1LEZA 4NL0A 5EKOA 3VS7A 1PF8A 2PSQA 4PL3A 4FZ6A 4QP4A 4YUQA 3EN9A 1UU9A 4V04A 3GI3A 2QHMA 3W2PA 4EK5A 5CT7A 3R8VA 3PA4A 3I5ZA 5AADA 4OR5A 4O0SA 2F2CB 3ZCLA 5I4NA 4I6HA 1M14A 4E73A 1NA7A 2YJSA 3IGGA 4GMYA 2JFLA 1AD5A 4XP2A 2XKDA 4F7JA 4TTHB 5GZ8A 4PPBA 3FMMA 2VTAA 3AXWA 4F0IA 5CVGA 3U4WA 4O7TA 3CQWA 2YIWA 3QTZA 4Z55A 3VVHA 1H08A 1ZMUA 5GZ9A 3Q9XA 5FEDA 4D1SA 4FG9A 2QR7A 2ZB1A 2ITZA 4DEGA 3K5VA 3K3JA 4C3RA 1ZYLA 3VNTA 4ACCA 2UZTA 3R22A 3ZFYA 4MNEB 3M11A 4XHKB 4G3CA 4NIFA 4C4FA 5M55A 2GNIA 4M69B 3WF7A 2J0IA 2W06A 5M44A 4BY9E 3P23A 4UALA 5A4CA 3U51A 2WTKC 4LV8A 3PPZA 1LPUA 4FTNA 3ZSHA 4M7IA 3C0HA 4GVAA 4UMQA 3C4FA 4CCUA 3TNPC 4F1OA 4F1MA 2AC3A 5KUPA 2W4OA 1Q3WA 4R78A 4E8AA 3CLYA 4LM5A 3FLSA 4ZY4A 3GOKA 5CEKA 4IFGA 2VWVA 3EKKA 4C3PA 5CEOA 1NW1A 3MI9A 2XZSA 4G1WA 4BCKA 2OU7A 3NYOA 5CYIA 4D58A 5FEEA 2PU8A 3EHAA 5FLFA 2J2IB 3JPVA 3CE3A 2YDKA 4R7IA 4X6RA 3SQQA 3LFBA 2DYLA 4R3PA 5LCKA 3TKHA 2F7EE 1JQHA 4BHNA 5DA3A 2WU7A 4ZLZA 3CIKA 3DBCA 1OBGA 3CD8A 3TV6A 5ETCA 3TJCA 3UIBA 3VULA 3MESA 2HCKA 4O7ZA 5K3YA 3SXSA 1G3NA 2XK8A 5K0KA 3NUAA 1GOLA 4CZUA 5M4UA 3ENMA 4QMPA 3GU8A 5G6VA 3R8PA 3DLZA 3UDBA 4FZ7A 3NUSA 4ZOGA 3ZSIA 2XIXA 1YI3A 2B9HA 4CZYB 3GC8A 3D15A 4GV1A 2Z02A 2JITA 3DY7A 3F7ZA 3ZO2A 4EH7A 4DT9A 4AGCA 4FZDB 4JX3A 4I5MA 1BL7A 3CEKA 4BYJA 2C0OA 3FI8A 4X3FA 3CBLA 2HZ4A 4DYMA 3W8QA 4ANOA 2YM6A 3UOLA 2WMXA 2WQEA 4LQMA 3Q6UA 4F0GA 4FEXA 4BWKA 4C2WA 1F5QA 1J7UA 5HORA 1YVJA 2JDOA 1P4FA 4IX3A 3WARA 4UWCA 3K54A 5CI7A 2OICA 3F3TA 3FKLA 3WOWA 5ANEA 3PSBA 2OH0E 4XG4A 3QQFA 3LFSA 1M52A 3QZFA 3LFQA 2EXEA 4X2FA 2XKCA 3GFWA 3NUYA 4AZWA 5DNRA 3DFCB 1H24A 4XOZA 4YJQA 1YDRE 1WVWA 4BKYA 3RHXA 5LMBA 4MXYA 3PJCA 4WNPA 4D2SA 4BDBA 2ITPA 2GNJA 1P5EA 5HNGA 3Q3BA 3PE2A 1RDQE 3KCFA 3OMVA 4OTFA 3TM0A 5KZ0A 4D2RA 4NCTA 5KHWA 3HMPA 1GZKA 4MBJA 2F2UA 5AR8A 4HYIA 5FXSA 2VTTA 3SGCA 1U54A 5LCJA 5HBJA 4RRVA 5IEVA 5AR4A 4K18A 5A4EA 5HESA 3LJ2A 5E90A 2XIZA 1ZY4A 4NJDA 4F9YA 1NVSA 3R83A 3E5AA 3OEZA 4ALUA 4D1ZA 3RGFA 1JNKA 3RMFA 4YJPA 3R21A 4EC9A 3L9LA 2G9XA 4FOBA 4I24A 4FKGA 4A4OA 2IZSA 3Q2MA 3VBWA 3LFEA 2R7BA 4FT3A 4I22A 3LFDA 2C6DA 3FQHA 3QWKA 2HZ0A 1IG1A 4O22A 4QMVA 3PXRA 3DLSA 5AP6A 1QL6A 5T6KA 4E6DA 3RI1A 5JZNA 3EMGA 1TQPA 5EI2A 2J50A 5E8WA 5H2UA 5KMKA 2QR8A 3CPCA 4UMPA 3UOJA 3B8RA 4IVAA 4KAOA 5BX0A 3NUPA 5A46A 4D4YA 1CTPE 3DTWA 1ZYJA 5E8SA 3UGCA 4C35A 3FMNA 4YZ9A 2IW6A 1OKYA 3TDVA 3RAHA 5CF5A 4B99A 4GFOA 3BKBA 4JBQA 5AV1A 2JDVA 3ULIA 5AM6A 4YSJA 5K4IA 4YJRA 4BIBA 2XJ0A 5HIEA 4DHFA 5FP6A 4XP3A 5CSWA 2BROA 3PXFA 3VRZA 1VR2A 2X6DA 4W9XA 2UV2A 3DA6A 3E64A 4JRNA 2QOIA 3PIZA 2YM4A 3JVSA 2HY0A 5DOSA 1XBCA 1SNXA 3R7OA 2YM3A 1SVEA 2CN8A 3NW7A 2PVFA 3W10A 4DH1A 4FTQA 3OXZA 5CEQA 4YMJA 2R3NA 5LVNA 4J1RA 3CR0A 4KSQA 5DT4A 3ZFXA 3OG7A 3KN6A 3FSKA 4PMPA 4O21A 1O6YA 4BB4A 2XNOA 3ORZA 5JSMA 3C4WA 1LR4A 2XK3A 3LQ3A 3KXMA 5BYZA 4IXPA 2XYNA 2CKPA 5AV2A 1WBWA 5HBEA 1UU3A 3MPMA 3MTFA 5ANJA 5F94A 2YACA 2GDOA 2OWBA 3ANQA 4FV1A 4JL9A 3ZRMA 2QQ7A 4PWNA 2WMRA 2OO8X 5C8MA 2C0TA 3MW1A 4GG5A 3MYGA 3KRJA 3KRXA 2B7AA 3WZEA 4APPA 3BHTA 5DG5A 1G8SA 1Q8YA 1Y8YA 4B8MA 4FT5A 2ETRA 2WMQA 4FSWA 4I21A 2HAKA 2PVRA 1FVVA 4ID7A 4AOJA 2EUFB 2V5QA 4PP7A 2H9VA 3TIYA 4CVAA 3TDWA 2XK6A 1OKVA 2UW3A 3HVCA 4K11A 4ZEGA 3UQGA 1WMKA 5I3OA 4OBPA 3WYYA 4A9TA 3OT8A 2VTOA 2ZV2A 4GCJA 2XM9A 4ZY6A 3FXZA 3UPXA 1H0WA 3A7FA 3GT8A 2VX0A 4L8MA 3S2PA 3DK7A 3I60A 4J53A 5ANDA 3ZUVA 5JKGA 2QU5A 1U46A 3A7JA 3QXOA 5FWKK 3NYXA 4K1BA 2R2PA 3JXWA 5D10A 4I5PA 1R0EA 3MH2A 1YOJA 3PJ3A 4GFGA 3II5A 3TKIA 4IWOA 3MDYA 3GB2A 5AV0A 4DLIA 3Q4UA 1MRVA 4FNZA 5JRSA 4S30A 3MVHA 3PIYA 4PTGA 5AUXA 4EOJA 4DBNA 2UVYA 4JQ7A 4UMTA 4ZS4A 4FTJA 3FC1X 4U3YA 5IA1A 5LWMA 3AC4A 1YDTE 4O0TA 4EZ3A 3EWHA 4QMQA 3LMHA 2W9FB 5FDPA 2PUIA 3QZGA 4AZFA 1OZ1A 3ANRA 3HECA 4YNOA 4FKLA 2B9FA 1RE8A 1KWPA 2EVAA 4JBPA 4JI9A 5FRIA 3ZZWA 3S0OA 2BKKA 3JS2A 2ZV7A 5ANKA 5IA5A 4YP8A 2WMWA 1DI9A 1DAYA 1YQJA 4FTAA 4RIWB 4AGWA 4LMNA 5KBRA 2G2HA 3MB7A 3CC6A 1WVXA 2XKEA 4LV5A 4QP3A 4PMSA 2CCHA 4JDKA 2ITNA 3F3UA 4U3ZA 1DI8A 1FVTA 3QD3A 4FNWA 4HPUE 5H9BA 2CKQA 1Y8GA 2WMVA 5HTCA 3DK3A 5LMKC 4YBJA 3ZRLA 5IKWA 4QPMA 2XNBA 3FKOA 3W2RA 4IWDA 3C0GA 3UTOA 4FV2A 4P90A 2GSFA 2VU3A 5JMSA 2XEYA 3QGWA 3REPA 4O0YA 4HVSA 1WVYA 2ITQA 2WXVA 3SA0A 2YABA 1H1WA 5HCZA 2BFYA 2JGZA 1QCFA 4R5YA 4MXCA 2SRCA 4P2KA 4Z7HA 4O6EA 5IA4A 1J1CA 2P3GX 5ETIA 2C5NA 3EL7A 3PA5A 3B2WA 2YZAA 2HZNA 3JYAA 4JG7A 4NIFB 3ZO4A 4C4IA 4JR7A 3NVMB 4YO4A 5BYLA 4BN1A 5AEPA 2ITYA 5I9VA 1W0XC 2XJ2A 4LRJA 4CT2A 3CQEA 5ACBC 2IVSA 3NYNA 4M15A 2ZB0A 2YA9A 4MQ2A 3TZMA 4BKZA 5T3QA 3COMA 4WKQA 4AW2A 4XNEA 4Q9SA 2Q0NA 3TIZA 4TYGA 2QOKA 3VJOA 1PXNA 3DDPA 2PPQA 5HE3A 4XP0A 1PMEA 3OCBA 3T9TA 3R8ZA 3TG1A 3KU2A 3E3BX 4FYNA 5HE0A 4CKIA 4EOIA 1YOMA 2RG5A 3P5KA 3R1NA 4UB7A 4Y95A 2Y4IC 5DHJA 5IDPA 4YTFA 5DN3A 2WQBA 4O0WA 2GHMA 3FMDA 3E8EA 3NCZA 3PLSA 4ZTRA 3GQIA 4JG8A 3FPQA 2G1TA 2PZ5A 4TYIA 4BDKA 4FEUA 4JVGA 2O8YA 2W1FA 4U79A 2ZM1A 3OBGA 3AMAA 5DWRA 2GFSA 3QTUA 4GKIA 3O2MA 4ZSEA 1M17A 4DTKA 5JFVA 3C5IA 2VAGA 3Q5ZA 1J7LA 4JXFA 4G5PA 2VWIA 4GIIA 3I4BA 4RQKA 5AA9A 5A4QA 3FXWA 4RJ7A 5GIOE 3COHA 5KCVA 4RIXB 4OTPA 3QTRA 3D7ZA 2IW8A 4XV2A 4ALVA 5L8LA 5IUHA 5FM3A 3FQEA 3P4KA 4PQNA 4XG2A 3TNHA 4Y5QA 1M7NA 4MEDA 3PIXA 4K33A 4C38A 4JOAA 4PV0A 3DNEA 5AA8A 4EORA 4RG0A 4BCJA 5CNNA 3MFSA 3CPBA 4RGJA 4I93A 4E1ZA 3LFNA 4EBVA 3R8UA 4FV4A 4U8ZA 3QU0A 4ZY5A 1GIJA 3FDNA 4N6YA 2OG8A 3R9HA 4BCIA 5ICPA 3E87A 4Y46A 4AT5A 4FI1A 4I6FA 2RSVA 4AN9A 4HGSA 3L1SA 4QOXA 3RWQA 4U6RA 4PDYA 3NIEA 3QCYA 2CGUA 2YIYA 2WTKB 1FPUA 3FYJX 3OOMA 1QMZA 4P4CA 4CMOA 4N57A 4HGTA 2XNGA 3DK6A 5AR5A 3OFMA 1VJYA 3NZ0A 3NAYA 5HNBA 4RWJA 3POOA 4FYOA 3RAWA 3R2YA 3UIXA 4C61A 1W84A 5HVKA 4DG0E 2AYPA 2NRYA 3RPSA 2B9JA 3L9NA 4OGRA 5A4LA 5CAOA 3T8OA 3EZRA 2A19B 3CTQA 4KIPA 3R9NA 1W7HA 2GPHA 4ZSAA 4I5HA 2WQNA 4D1XA 4HYSA 3RAKA 3RTPA 5IA0A 2X4FA 5IQIA 2C6EA 2BALA 4DINA 3JR1A 1H07A 1GZ8A 1ZMWA 2QOCA 4IB3A 2RG6A 3NW6A 4E6CA 2C3JA 4NH1A 5FBNC 3QZIA 5HZNA 1URCA 3KXZA 3U54A 1CSNA 5AP3A 5CTPA 5L2SA 4H3PA 3RJCA 4FSTA 5ANOA 5AUWA 4CFVA 3A8XA 5IUGA 4NW5A 5J9LA 4JT3A 2W1IA 4DEHA 4FTOA 3QAME 4C02A 4EH3A 2RF9A 3Q53A 1NVQA 2VGOA 3BYSA 4KIOA 2O63A 2PE0A 1V0OA 4G34A 2XJ1A 2C6LA 4E20A 5I3RA 3EN7A 3BX5A 3H10A 1P14A 5BUEA 3QYZA 4AT3A 2CDZA 4NEUA 3M2WA 3QQGA 5J5TA 2P33A 2V22A 3HV4A 3UVQA 1OGUA 2C3LA 2F9GA 4MXAA 1YXSA 2VTRA 3HL7A 5DR2A 3R7VA 3TV7A 4V05A 4ENYA 1FINA 3DKCA 3PUPA 5IA2A 4GKHA 3QQJA 3AT3A 4JQ8A 3HKOA 3PA3A 4CG9A 3TNIA 3P9JA 2WTCA 4FV0A 4OTGA 4XV1A 4C4JA 2HY81 4FUYA 2FO0A 4WRSA 2PVLA 4IANA 2BCJA 3F69A 4DEAA 3V8WA 4O6LA 3ZO1A 4CEGA 2HWPA 1YHWA 3EFLA 1OECA 3ORNA 3IW6A 3U8WA 5IQFA 5TE0A 3IG7A 4S2ZA 2YLEA 4R77A 3NDMA 4RX5A 1YHSA 4U5JA 3WZUA 4FGBA 3RPOA 2OLCA 3MB6A 4RFZA 3KC3A 3MA6A 4IAIA 2CNVA 4C59A 4R1YA 3PYYA 3PXKA 4HGLA 3LQ5A 4FV3A 3AT2A 4JRVA 5EH0A 5LQFA 3VS4A 5M4IA 5JZJA 2R0UA 5D7VA 3VF9A 4O0RA 4U45A 5KKRC 4IJ9A 1KE9A 2DQ7X 5JN2A 1YW2A 3EQRA 3FL4A 2YIRA 4EHEA 3BYVA 4QMUA 2W9ZB 4L42A 2BDJA 4Y83A 3ODZX 2P4IA 4ASXA 5GJGA 4F4PA 3BI6A 5GHVA 3EYGA 4FV6A 4UZDA 3V04A 5F9EA 3DTCA 5HG8A 4AGUA 5DMZA 1DS5A 1Q99A 4LGGA 1YI6A 3QLGA 4XYFA 4ZK5A 3E3PA 4L7FA 1REKA 1TVOA 1OIRA 2FSTX 3I79A 1ZMVA 4FL2A 4WSYA 4ZJVA 4QMTA 1J91A 3MVJA 5EOLA 3NNXA 3VUGA 4RBLA 5C8KA 4ZTNA 4D0WA 3CGFA 3MIYA 2BHHA 2F4JA 3D9VA 3GCPA 2HWOA 3TV4A 4KKGA 4YPSA 4G6NA 3UC4A 1OUKA 4AX8A 3CCNA 5L2QA 4O0VA 3OZ6A 5CZHA 4CQGA 3VBVA 4RVMA 4AZEA 3UE4A 4BDHA 3HV5A 4K9YA 5D7AA 4PP9A 3A99A 5EFQA 3R01A 4IZYA 4FIGA 2RFNA 4XG3A 5BVFA 4M0ZA 4PMMA 2E9VA 4L3PA 5A6OA 3R7EA 2XP2A 3Q52A 4F09A 5JGBA 5F20A 2Z7RA 1A48A 3D5XA 3HP2A 3THBA 1E1XA 3KRWA 4MHAA 2BRBA 5BVDA 4XX9A 2FSOX 2W5BA 1E1VA 4IH8A 3S4QA 3VUIA 4DCAA 2Y6MA 1XJDA 3IKAA 4XBRA 3RCJA 4CQEA 2C6KA 1JKLA 1OL5A 3W32A 2VWXA 2XM8A 5HIBA 4KS8A 3RNIA 4AW0A 4IB0A 4J8NA 4TPTA 3KVXA 1E9HA 4E7WA 1ZWSA 4YZMA 3KQ7A 3VS1A 3QRUA 2PMLX 2VO7A 3P7CA 3F66A 5C01A 3P0MA 1KE6A 1UNHA 2OF2A 4BCFA 1JPAA 2A4LA 3HAMA 2ZAZA 4QP1A 5LVPA 4YPDA 4FGRA 2R3JA 3E8DA 4TL0A 3EJ1A 3MGYA 4EK6A 5CQUA 4TWPA 4F1TA 3FSFA 3VBQA 2CJMA 2OSCA 3HUBA 3ORTA 3QKLA 3S00A 3HV3A 2HELA 4CFUA 1F0QA 3Q5IA 1BUHA 2JD5A 2R7IA 3LCOA 4FIIA 4A07A 2HOGA 4FL3A 4FSZA 3LIJA 4G3FA 3PJ2A 4GU9A 2V55A 3Q96A 4O7SA 4ZTLA 3AT4A 2BRMA 4RJ8A 5JRQA 4CGAA 4BGQA 3PG3A 3TUBA 4ERKA 3L8VA 3R7IA 3HGKA 3JY9A 3O17A 2X1NA 4O7WA 5DGZA 1YXTA 4XV9A 1KE8A 3F7WA 2OBJA 4ARKA 2UW7A 2Z7LA 1B6CB 2CHLA 3ZTXA 4A4LA 3ROCA 1WBTA 2W1ZA 4QTBA 3P7AA 3VBYA 5B7VA 4TRLA 3LVPA 2PVMA 4PDPA 3VBXA 2WAJA 4QTAA 5AAEA 3QRJA 4II5A 1LP4A 2E9NA 2BDFA 4AN2A 4JX7A 5DH3A 2BVAA 3C51A 4XS2A 3KRLA 2Z2WA 1ATPE 5AMNA 4EKKA 3HA6A 4G6LA 5CS6A 5IQGA 4PNIA 3HA8A 2C3KA 1Q8WA 4MBIA 2WTVA 3E92A 1NT2A 3SVVA 1Q8TA 2X81A 5H8BA 3WIKA 2JAMA 4JNWA 3QX4A 1XBBA 1GIHA 2WQOA 5EI8A 1UNGA 1AGWA 4BDGA 2BR1A 1JKKA 3EKNA 4R6VA 5F1ZA 4YJSA 5DR6A 4U97A 2BZJA 4PMTA 5EDPA 2WQMA 3SLSA 3WE4A 4IX5A 3DAEA 3FY0A 4YJVA 5DLSA 5F4NA 4CFXA 2GMXA 3QRKA 3I6UA 4FG8A 4OTDA 3UOKA 3D5UA 3ODYX 5FTQA 3W2SA 4ANNA 3KMUA 4K77A 4CYJA 3V8TA 3R30A 2OJIA 2BAJA 2QODA 4RIWA 4EUTA 3ZRKA 4C57A 3PXQA 3QZHA 4FKUA 4HZRA 1XBAA 4WG4A 3RKBA 3MFRA 4CNHA 2JKOA 2X7GA 4NSTA 5AUYA 4BZOA 2GS2A 2PMOX 4RPVA 4O7LA 3R1QA 2B4SB 2IO6A 3IQ7A 4AU8A 3RNYA 5CY3A 1SMHA 3FLNC 3OOGA 2GNFA 3CJFA 4KINA 2FSMX 4H36A 5IQAA 4ZTMA 3R02A 4MF1A 4IM3A 1OMWA 4XLIA 4LOPA 4CD0A 4ITJA 3MY5A 4QP9A 5FTOA 4FSQA 4FA2A 5IEXA 5FTGA 4RA4A 3BV2A 1I44A 2GCDA 5E9EA 3UZRA 4KBKA 3TTJA 3EQDA 2WHBA 3PJ1A 4LMUA 3TJDA 5HIDA 4ASZA 2J7TA 4X2GA 4XG7A 1OIUA 5GJDA 2X9FA 2YAKA 2C5YA 3QHWA 2Y4IB 3TEIA 4UMRA 1VYWA 5JQ5A 2C5XA 2E2BA 4DBXA 2WTIA 4IZ5A 1ZRZA 4ZS0A 4YBKA 4HYHA 5CQWA 2PZRA 4ZXTA 1Q8ZA 2W0JA 3TXOA 2VN9A 4PF4A 1H27A 4ZJJA 2I0HA 4HVGA 5GZAA 2ZM3A 2VWBA 4AW5A 2XK7A 2VD5A 1VYZA 2C6OA 3F5XA 3KN5A 4QMSA 3NX8A 1GAGA 2UW9A 2R3GA 4KWPA 4ZJIA 3AD4A 2DS1A 4FVRA 5EOBA 5T68A 4CXAA 3HDNA 2BIKB 5KZIA 3TUCA 4YGAA 2JFMA 3OUNB 3OXTA 4YNEA 1HCKA 3Q9WA 3TUDA 1AQ1A 4S34A 4MX9A 3W18A 2YM8A 2PUUA 1OIQA 3A2CA 3KF4A 3OHTA 4LI5A 4XH6A 4MXOA 3R6XA 4QTDA 4IVDA 5AAFA 3HMIA 3AD5A 3MA3A 3RM6A 4HW7A 2XK9A 4BR3A 3IOPA 1YHVA 2OJGA 5HX8A 3T3VA 3VS3A 3BV3A 3QALE 4I20A 4RIXA 5AX3A 3H9FA 2J0JA 4NFNA 2NNWB 3VUMA 3WZKA 4WNMA 5AR2A 4EYJA 5JFSA 3OF0A 3QTQA 2F7XE 5J1WA 5E4HA 2YERA 4QYHA 3NSZA 1RW8A 3SV0A 2OFUA 3RK7A 4AA4A 4BHZA 3SW7A 4F9CA 4F7NA 4B4LA 5LARA 4LGDA 5TOZA 4DFXE 1PJKA 4A9SA 4DT8A 4O1PA 5C03A 4QO9A 1NY3A 2QG7A 3I5NA 5K4JA 1MQ4A 3U4UA 4KABA 2XB7A 5HLPA 1ZY5A 2C5VA 3CTJA 2O5KA 3H4JA 3KEXA 3DB8A 4FTTA 3D94A 1V1KA 4YJUA 1KUTA 3IECA 2OKRA 3LMGA 3RPRA 4L3LA 4A7CA 4LL0A 3KF7A 4NTSA 2CKOA 2J0MB 4I6BA 2VX1A 3I81A 1JVPP 2QURA 3P08A 5CXHA 3SKCA 2XNPA 3N51A 4D4RA 5CNOA 2R3QA 3S1HA 3BELA 3BGZA 3R63A 4Y72A 3FI3A 1G5SA 5EYKA 5AAGA 4UYNA 2I1MA 4FSMA 4ZLOA 3Q04A 1H8FA 1O6KA 2J4ZA 4PY1A 4USFA 2OF4A 3F3VA 4B9DA 5ANGA 2CGWA 4EEVA 2ITUA 3ACKA 4IC8A 3GP0A 5FDXA 5A6NA 5CSPA 2BAQA 3DS6A 1OI9A 2B52A 2X39A 3LQ8A 4BIDA 2I0EA 1PHKA 3QGYA 4TYHB 4RWLA 3LFFA 2ERZE 2W1DA 1Z5MA 4RX7A 2BDWA 4DFZE 1VEBA 1WFCA 3H3CA 2O2UA 5EYCA 4MKCA 4XCUA 4Y85A 4F6UA 2WTDA 2PVJA 4JQEA 5CENA 2VGPA 4RLLA 1PMNA 4BRXA 3C4CA 3B8QA 5CF8A 4TKSA 3ZH8A 3ZDIA 2ZM4A 2WPAA 3PXZA 4Y5HA 1UU7A 3R2BA 4W8EA 3ZBFA 1IR3A 3ALNA 2OJFE 4WHZA 4XMOA 3VUHA 2WKMA 2PMNX 3NS9A 2OFVA 5HQ0A 3O8PA 4ACDA 4RVTA 2IPXA 4MYGA 3KMMA 3FPMA 2XF0A 3QXPA 4RMZA 3EN4A 2XS0A 4CMUA 3VBTA 3HZTA 3DZOA 2Y0AA 4EOPA 3E63A 5D12A 2CMWA 5FP5A 3BGPA 5E7RA 4CFWA 3DKGA 4BFMA 4BVUA 1H00A 5B2MA 5C8NA 4QPAA 2VO6A 1RQQA 4U40A 4ANMA 3ORKA 3UMXA 3SW4A 3KRRA 4FTMA 3N4VA 5E1EA 2GQRA 3PP0A 4NM0A 5BQ0A 2G2IA 4KBCA 4DFUA 1P4OA 4YLJA 3DQXA 5KKRB 4RA5A 3UC3A 2WOUA 2VTLA 4IE9A 3POZA 4OBQA 3QQUA 4C4HA 4FVPA 3FV8A 1OKZA 3DB6A 3BHUA 3OY3A 2PVYA 1BKXA 2W1HA 3RK5A 2GNGA 2YM5A 4L52A 5TT7A 3C5UA 1PYEA 3C9WA 4FX3A 2GTNA 4TZRA 3WILA 3EFKA 4GFMA 4XG9A 3PRIA 2W5AA 3L9MA 2C6IA 3LM0A 4FF8A 2IN6A 3FL5A 3GCSA 4GT5A 4L6QA 4O86A 2R3KA 4FSUA 4C0TA 3DBEA 2VTPA 4DG3E 5HCYA 2GS7A 5EM6A 4E3CA 4FV5A 4BTFA 3L9PA 3K2LA 3NLBA 4MXZA 2CGXA 2P55A 3RPVA 3PPJA 4RC4A 4CV9A 2UZWE 3DAKA 3IW7A 4HGEA 3U6HA 5K9IA 2QI8A 1SM2A 2UZNA 3AD6A 3CXWA 3HMNA 3O0GA 4AFJA 4FNXA 2OIDA 4WG5A 4N6ZA 3WYXA 4CFMA 3HRCA 4M3QA 4PPAA 3C7QA 3UG2A 1FMKA 3NRMA 4HCTA 3PZEA 3UOHA 5H3QA 3SXFA 5EKNA 2VWUA 2H8HA 3FJQE 3LE6A 3D7TB 4CG8A 5HICA 4QQTA 1FGIA 3LCSA 3JUHA 4HCVA 4HCUA 4L44A 4ZZMA 2HXQA 3GU4A 3HRFA 4L43A 1KOBA 4FSRA 2R3FA 2YWPA 4KRDA 4RFMA 3ZUUA 3LMIA 3TZ8A 2BPMA 4O84A 3HLLA 3PWYA 4CZTA 3HV6A 2GQSA 3UZPA 2UZEA 3LZBA 3OW3A 1M2RA 4Q5HA 3FHRA 2XBJA 2WMUA 3EQFA 2FUMA 4RIOA 3GXLA 3QC9A 3NWWA 4DGNA 4FKOA 4W4XA 4IMYA 4PL4A 4QMOA 2XCHA 4UX9A 2WMBA 4BWXA 4IACA 3Q4CA 3R9RA 1MP8A 1L8TA 5BYYA 1DAWA 4EHGA 5TR6A 4USDA 4W9WA 3GEQA 3I1AA 3G6GA 5E91A 5CF4A 1H0VA 3OXIA 2UZOA 1ZYSA 5HCXA 3VW8A 3DT1A 3Q60A 2IVTA 3AMBA 5FBOA 4BL1A 1F3MC 2CPKE 5CSHA 4R7BA 3EN6A 4BI0A 3ZYAA 3DBQA 1HOWA 3ZONA 3R0TA 4MWHA 2ZYBA 2Y8OA 2XYUA 1FQ1B 4X7QA 2PVHA 3QRIA 2XRUA 3OVVA 3QTIA 4GS6A 4XUFA 3V5JA 4ZAUA 4QYFA 3I6WA 4L9IA 4D4VA 4J97A 2YN8A 3O50A 4GSBA 5B0XA 3BEGA 4M8TA 2Y6OA 1Y6AA 1GZNA 3KKVA 3L8SA 2BRHA 3FLQA 3OTVA 2JKMA 2BRNA 3BYOA 3KGAA 4JIKA 2BTSA 1B39A 3NUUA 4FKRA 5AIKA 4S31A 4D28A 2IVVA 3FBVA 2GQGA 2XBAA 5GNKA 3UP2A 4BF2A 1KV2A 3GBZA 1PMVA 4MD7E 4KA3A 5E92A 4FVQA 2BAKA 2BTRA 1JSVA 1SYKA 4AAAA 4AZTA 4C36A 2HENA 3RHKA 3QD4A 2W4KA 3IW5A 2JEDA 4UXQA 4KIKB 4IFCA 3FI2A 2YM7A 4EH5A 2R3RA 3BQRA 3ACJA 4DE4A 1U4DA 4WNOA 1WAKA 2YITA 3KFAA 4RZWA 1B38A 2UW4A 1PYXA 1OL2A 3CY2A 5AUVA 3VAPA 2ITWA 2WZJA 3ORLA 3ATSA 3BU5A 1WBOA
chains in the Genus database with same CATH superfamily
3ZEWA 1YXXA 3R73A 3G5DA 4M0YA 4O2PA 3D5WA 3OCTA 4EJNA 2C5OA 2V7AA 4FSYA 3DAJA 3WZDA 4ANBA 3BWFA 3E7VA 1A06A 1W83A 2Y4PA 2Z7QA 5DR9A 4F7SA 3AC3A 3BEAA 4KSPA 4XBUA 2YDJA 4ZSLA 4EOKA 5F95A 2VWWA 3H0YA 4Z7GA 5IDNA 1PKDA 3R1YA 4FT0A 2HXLA 4IWQA 1GJOA 1PXJA 4Q9ZA 4DAWA 4BBEA 5M09A 5J8IA 4GVJA 4Y8DA 4U81A 3H0ZA 5AX9A 5LMKA 3FE3A 4FBXA 3H30A 4IBMA 4DH5A 4BZDA 3VS0A 5IH6A 4X3JA 4DGMA 3F2AA 4DN5A 2ZV8A 4FEQA 5JFWA 3C13A 1UKHA 4ONAA 5C26A 1STCE 2WTJA 3GCQA 3P86A 4DC2A 4DF3A 3W0QA 4CRSA 3UNZA 4WNKA 2LAVA 5CAPA 4IHPA 4B7TA 3KULB 3KMWA 4OTQA 3UDTA 1ZLTA 2FYSA 1QPJA 3BLRA 3R28A 4TWCA 4X21A 3AKLA 3FEGA 4O83A 4U42A 4NK9A 4D2PA 4EOLA 4BTJA 4BDIA 4M14A 4AWIA 3G15A 3I7CA 1OPKA 3FZPA 4DTBA 3F88A 2YCFA 3LCTA 1WBVA 2X2MA 3VQUA 4PNKA 2HW7A 4YC6A 2F49A 1PXOA 3WBLA 2I7QA 2EB2A 4ACGA 4IB5A 4MVFA 5DPVA 2AC5A 4BCMA 3ITZA 3TT0A 2VWZA 3ZDUA 2PULA 1OVEA 4FKJA 1YWNA 4FV9A 1FVRA 5AP4A 5KMNA 1OL6A 4WRGA 4I92A 2E9OA 3QYWA 5HE1A 1JBPE 4F9AA 4RWIA 3VJNA 4JJRA 4IEBA 3VS5A 5IQBA 4FTIA 3Q6WA 1R78A 1YRPA 4R3RA 4XOYA 2X0PA 1OKWA 3UQFA 2XIKA 2PE1A 4KKHA 4AZSA 4OW8A 2XK4A 3A4OX 3QD0A 3QTXA 3A8WA 2BFXA 5KHXA 4QMNA 3U55A 3A61A 4AW1A 3KXNA 4M67A 2PY3A 4RC2A 3QRTA 4FTKA 3RCDA 4AT4A 2JAVA 5CALA 3W0SA 2VO3A 3FY2A 2GU8A 3CS9A 3ZUTA 4HNFA 5IH4A 5KMJA 4W4VA 2WB8A 2VV9A 3CY3A 3O71A 4LGHA 5EDRA 3PUFC 3RWPA 4QPSA 4O0XA 2VTJA 4FSNA 5KX8A 4XG6A 3FYKX 4GT3A 2FH9A 3CQUA 4NFMA 3VUTA 2WFYA 1XH5A 4DEBA 4ZMFA 4UZHA 5FXQA 4QMZA 4TXCA 1BLXA 4FTCA 4GYGA 5CWZA 1KV1A 5HO6A 4X0MA 3U6JA 3FZTA 5KMOA 3ULZA 5M08A 3HNGA 2JIUA 4IAAA 2A98A 5D11A 5B2KA 3QKMA 2G15A 3OWLA 5DRBA 5BUJA 3GU7A 1X8BA 2NO3A 3PJ8A 3PPKA 3BBTB 3RBWA 4Z3VA 1W82A 4YHJA 3FMEA 2QKRA 5IA3A 2ACXA 4C3FA 2X7FA 5AP7A 4YZNA 4QYEA 3DZQA 3AOXA 4U43A 2R4BA 3DGKA 4GK2A 2OW3A 4EHZA 3LKMA 4BIEA 5LMAA 3DBDA 1W2FA 1LEWA 3FAAA 4DH7A 2W05A 5EHOA 4L53A 4ANLA 3W0PA 1IRKA 1UNLA 2QOOA 5HHWA 4HZSA 4O7NA 4E4NA 2PZYA 3JY0A 4CV8A 3BPRA 4TY1A 2QO7A 4LUDA 2OH4A 1MRUA 3OWKA 4QMYA 3RPYA 1K9AA 3QTWA 2RIOA 5CAVA 4NYEA 3EQIA 2XIRA 4ERWA 2QC6A 3WIGA 3FZRA 3LJ1A 3OTUA 3UVPA 4EQCA 1SNUA 3EQGA 2XUUA 4D2WA 4O7RA 4TNDA 4TYHA 1FGKA 4GEOA 5HG9A 3O8UA 4PTCA 5L2IA 4YU2A 4LV7A 1UVRA 3O96A 4M97A 4S32A 4XEYA 3V8SA 1Y91A 3LFAA 4FV7A 3NFFB 3E8CA 2ZMCA 3F5UA 4IIRA 5E8XA 3FQSA 5GINE 2GNLA 4F99A 5CZIA 4BDCA 4MXXA 2HIWA 4K2RA 4OLIA 5FD2A 4BCHA 1BYGA 5IQCA 1JKTA 3FLYA 3KY2A 5M4CA 3F2RA 3LXNA 4I1ZA 3KXGA 4QEBA 1S9JA 4M84A 3GQLA 3QD2B 5DRDA 2PK9A 5EYMA 3MH3A 5AUZA 4CYIA 4D0XA 4EQMA 3ZLYA 4EHVA 4AE6A 2C1BA 4AXAA 3R7YA 2B54A 4O38A 4DEEA 3OD6X 2NYAA 2VTMA 3GC0A 3ROYA 4DLJA 1J1BA 3PP1A 4A9YA 3DJ5A 4FKTA 4YJTA 4A4XA 2IG7A 3EQCA 4GU6A 4GK3A 4O0UA 3QWJA 4R8QA 3G0FA 4EJ7A 5LVMA 1TQMA 5CU2A 3VRYA 3ERKA 3QHRA 4P7EA 5EM7A 4GT4A 4CLIA 5GIPE 3KA0A 3LXKA 5E8UA 2QONA 3GCVA 3DNDA 5C27A 3Q9ZA 1MUOA 4LRKA 3LLAA 1UA2A 4E4XA 3AC5A 1UWJA 4AQCA 3NNWA 2HYYA 2XNNA 1KSWA 2B9IA 3OWPA 3NVKI 2XH5A 1PXKA 1JAMA 3L8PA 2ONLC 4K6ZA 2W1CA 5IZFA 3HUCA 5HX6A 5IISA 1H4LA 1Q62A 3LCKA 4FEWA 3BHYA 3W2OA 4GL9A 4FKPA 3HX4A 3QQKA 1XH7A 3QQHA 4RVKA 1CKIA 2YHVA 1H1RA 5DFPA 4BDAA 5D9HA 4E4MA 3OCGA 4DFYA 4O4BB 4RX9A 2J0KA 3R00A 1Y57A 4QP2A 3HEGA 4RSSA 4EK3A 5CSXA 3FI4A 3T9IA 4IM2A 3MH0A 5CF6A 4KBAA 2XEZA 1KE7A 3GC7A 4MAOA 3LXLA 3P78A 1FBNA 1Q97A 3QA8A 5CVFA 3A60A 3SHEA 3BYMA 3LJ0A 5BMSA 3IDPA 3SC1A 3NNVA 2NRUA 4IC7A 2R64A 4YTHA 3TCPA 5IMEA 4WIHA 1J7IA 2YDIA 2WIPA 3DJ7A 3C0IA 3D7TA 4NZWB 4BTMA 4FK3A 5C4KA 1BL6A 2ZJWA 3ELJA 5E8VA 4BDDA 2YWVA 5EM8A 4IJPA 2EXMA 2BUJA 3ID6C 5AP0A 3ZO3A 4HNIA 1CM8A 3LPBA 2A27A 2ERKA 3E88A 4G17A 4CKRA 3FLZA 3QBNA 4DFBA 3ZXZA 4D2TA 4JLCA 4G3EA 4L67A 5JK3A 3QCQA 3E7OA 4B8LA 3ZM9A 3TWJA 3NR9A 4XJ0A 5IEYA 3K3IA 1BMKA 1DM2A 3R8LA 5HU3A 1G8AA 3PVGA 1ERKA 1OL1A 2PVNA 1A9UA 2R9SA 3BLQA 2PE2A 2IVUA 1S9IA 3O23A 4CMTA 4EH2A 4EH9A 4YURA 3BHHA 4K0YA 4TN6A 2GS6A 4AFEA 2YCRA 5KMLA 2F57A 1H1PA 4BJJB 4I3ZA 4IZAA 3DCVA 2ONLA 2CLQA 3GFEA 3GVUA 3PVBA 1IEPA 5C9CA 2IW9A 3ZEPA 2W99B 3W1FA 5JH6A 5A4TA 4RZVA 2VNYA 5L8KA 2WIHA 1SZMA 4EC8A 1PXPA 4RC3A 3MPAA 4JDJA 1TFFA 2Y9QA 1APME 1YXUA 3G90X 1KOAA 1HCLA 3FLWA 4QMXA 2P0CA 2Z7SA 5A9UA 4NM7A 5KBQA 2BHEA 4QT1A 4FKWA 3SDJA 3V5LA 3PWDA 2CNUA 4F78A 4QRCA 1CKJA 1H1SA 1GY3A 5HO8A 3EN5A 3S95A 2O65A 3O8TA 3V5TA 3ZU7A 1Q24A 3AG9A 4ACMA 5BVOA 5IQDA 3F82A 5BNJA 4JR3A 4EYMA 4OT6A 4I41A 3PZHA 4A9UA 3U9CA 1OIYA 2W1GA 4KUJA 1PXMA 4PX6A 4IAZA 4BYIA 1R1WA 4R7HA 4UWYA 4C62A 3EH9A 3IW4A 4F64A 2I0VA 3A7GA 4B6LA 5AUUA 5G1XA 5AUTA 2RFDA 3OWJA 4FMQA 4BDFA 3MTLA 4MNFA 3KB7A 4KIKA 1H28A 2EWAA 5IG1A 4EH4A 4IX6A 4KIQA 2J5EA 3R9OA 4U9AA 4ZTQA 4FR4A 4Q2AA 3P7BA 5KO1A 1JSTA 4X3FC 3UNKA 5HBHA 3PLAE 4IAFA 5BUIA 3IK3A 3QLFA 1GNGA 1UU8A 2OIBA 1Q5KA 3AC1A 4IW0A 1OITA 2YISA 2CSNA 2XIYA 3MIAA 4QQJA 5EW9A 1FMOE 3DKFA 5KE0A 5I0BA 3K5UA 5JGAA 2WOTA 3VO3A 2C6MA 4YJOA 3HAVA 3CGOA 4L01A 3AGMA 4LRMA 3U9NA 5I9YA 3G6HA 2IZUA 2WTWA 3A4PA 4HVHA 2GTMA 3SD0A 4EQUA 3IONA 3NPCA 4GG7A 2FGIA 2H34A 4AS0A 4FT7A 1GZOA 1OPLA 2W96B 4G31A 2OZOA 2YJRA 3NW5A 3R04A 3OW4A 4EOOA 4DITA 3VF8A 4ALWA 3M42A 3OCSA 4H1JA 4LOQA 2ZV9A 4FIFA 5EYDA 2NP8A 1Q8UA 2GFCA 3ZZEA 3D5VA 4NCTC 3G33A 2WMSA 4QD6A 5L6WL 2OXYA 4AA5A 4GUEA 5IQEA 3O7LB 3Q32A 4WUNA 1ZOEA 3PY0A 3IDCA 3Q4ZA 4W4YA 4QTEA 2JIIA 4O2ZA 3KULA 5AJQA 3L8XA 4FG7A 4O96A 3RZBA 5EHYA 4EI4A 1QPCA 1Z57A 4ITIA 4TNBA 2C3IB 2HZIA 4PDSA 4G16A 3FZOA 5I9XA 3COIA 3A62A 4HVDA 2VTIA 2BRGA 4BCPA 4EWHA 4TYEA 5E1SA 4EH6A 4UXLA 5M53A 4ZP5A 2WMTA 3CKXA 4ZSGA 4BDJA 1WCCA 5TF9A 4X6QC 1XKKA 4MH7A 4CT1A 4G6OA 2UZBA 3FMHA 3FUPA 3R71A 5DEYA 3W33A 1QPDA 3MJ2A 3ZLSA 5IPJA 5KMIA 4H58A 4F9WA 4CRLA 2Q83A 2GNHA 2OXDA 2FB8A 3SOAA 3UO6A 5M07A 4RIYB 2X8DA 3WF5A 4E6QA 2R0IA 3HMMA 5EQPA 5J7HA 5EDQA 4GK4A 4PRJA 4BCNA 5HLNA 3CP9A 2R3MA 4AA0A 2O0UA 4R5SA 2OZAA 4KKEA 3G51A 4FICA 3BU6A 3BHVA 5EG3A 2ZMDA 4JBVA 3PRFA 1MQBA 5CT0A 2KTYA 4DEIA 3D0EA 4UV0A 4ZZOA 4D5KA 4RJ3A 4ZIMA 4KS7A 4NWMA 3ZS5A 2FA2A 3UYSA 2ITTA 5CEPA 2Y7JA 1W2DA 5CEMA 4D5HA 4DG2E 2BMCA 4J7BA 4CKJA 4FTUA 5JT2A 3QKKA 4DCEA 4B0GA 1XWSA 3HP5A 4PTEA 4EOMA 2G2FA 4RFYA 4FTLA 2UW0A 5M06A 4PL5A 2XA4A 3MFUA 4L46A 1PY5A 3PVWA 4BI1A 2YCQA 4H3BA 2V62A 3BZ3A 3EL8A 3LHJA 3BYUA 4OAVB 3FZ1A 3OUKA 1P2AA 5IF1A 3SG8A 1WBPA 4EL9A 2BIYA 4DTAA 2XCKA 4KNBA 4C58A 5HD7A 3LOKA 2YZLA 2QOQA 4DHIB 2C30A 4NM3A 1YKRA 4OTRA 1ND4A 3QX2A 4YTCA 1YI4A 5LXMA 3DXPA 1Y6BA 2JKKA 5ACKA 3IGOA 3W8LA 1Q61A 1O9UA 3V01A 2DWBA 2C1AA 2QO2A 3AC8A 4Z9LA 3MY1A 4F9BA 4TWOA 2R3IA 4AUAA 3GOPA 4QQ5A 3R8MA 3V51A 2YIXA 4HYUA 3EB0A 2YIQA 1H26A 4TYJA 4U41A 3BWJA 4EOQA 2B53A 4F08A 4QYYA 3G2FA 3N4UA 3GU6A 3OY1A 2W1EA 2JBPA 4F6WA 5GJFA 3OS3A 1BI7A 3A7HA 4CLJA 4FNYA 4FEVA 2PVKA 5M57A 2BZHB 1UKIA 1W8CA 2VTSA 3P79A 3EFWA 3PVUA 1YXVA 4AXFA 4TW9A 3NUNA 1JSUA 3IDBA 4NJ3A 3VQHA 5CU6A 1V0PA 4IX4A 5K5NA 2CLXA 4G3GA 2QOHA 4UBAA 5BVEA 3LFCA 2R5TA 3C50A 3GNIB 3W2QA 4ZTHA 5J87A 5AR3A 5FG8A 2QO9A 3VHKA 5A14A 5AIRA 2EU9A 1G8KA 4YO6A 4C4EA 3MN3A 5A3XA 4G3DA 4EKLA 5J95A 4WA9A 2ETMA 3QCXA 1ZOHA 5HTBA 1U59A 1R39A 5FUTA 4FT9A 3DPKA 2RFSA 4DGLC 1IAHA 3OROA 4XLVA 4WOVA 2BILB 2ZOQA 4H1MA 5TKDA 4DDIA 4AOIA 3AGLA 4E26A 1H1QA 2FVDA 1ZXEA 4BZNA 3ZFMA 2X2LA 2UW6A 1XQZA 2CCIA 3ORPA 4NT4A 4XRLA 4BC6A 5KMMA 2ESMA 3P1AA 4E4LA 4OTIA 4F0FA 3NGAA 2W5HA 3D2IA 5EW3A 3UIUA 4EUUA 4WD5A 4MCVA 3FZSA 2PMIA 3LXPA 4DFLA 5HD4A 3KK9A 4TWNA 3C4ZA 2C0IA 3BE2A 5DBXA 5HO7A 2DUVA 5CEIA 4JIAA 3CTHA 4ACHA 3S3IA 1ZARA 1EH4A 3IW8A 4GYIA 3DDQA 3MS9A 4KRCA 5A54A 4LOOA 3E93A 3I7BA 2X9EA 3UMWA 1OUYA 2E9PA 2C69A 3PY1A 4IQ6A 3QUEA 2XVDA 4IVBA 4JG6A 4NW6A 4V0GB 4AZVA 4GH2A 5CX9A 4WBOA 2KULA 4U0IA 1CKPA 2B1PA 1OGYA 4AAYA 4AACA 1M2PA 5ETAA 3SRVA 1V0BA 2ITXA 5DT0A 3TMOA 4UYAA 3MPTA 4BGHA 3AKKA 2UVXA 3R9DA 4BCOA 3Q2JA 4NKAA 3VUKA 2VTHA 4FKQA 2CGVA 1LUFA 2UZVA 4OTWA 5L3AA 1Q41A 5IH5A 2R3HA 4KB8A 2R3LA 4FTRA 4QNAA 4XRJA 3EOCA 3U87A 3DKOA 3NNUA 3VUDA 4N4SA 1H25A 3QUDA 3MV5A 3F6XA 2WELA 2XNMA 3KL8A 3MBLA 3LM5A 3PY3A 2B55A 4M13A 4E5AX 4HVIA 2HK5A 3QUPA 4ITHA 3N9XA 2PHKA 3SOCA 3HRBA 1GIIA 3C4XA 3IOKA 4GW8A 5AM7A 4IDTA 4QQCA 3DFAA 3F2NA 5HG5A 4EWQA 5HVYA 3AMYA 5EI6A 4C4GA 4I4EA 3TTIA 3G0EA 4WO5A 4BTKA 3EZVA 3RP9A 3ORIA 4ASEA 4DH8A 1J3HA 3EQPA 5AWMA 4C37A 2QOLA 3GENA 5AP1A 2A2AA 2ETKA 4OUCA 1T45A 3UYTA 5HKMA 4YHTA 1PXLA 3EYHA 4FE2A 3C1XA 3V5PA 4XV3A 1TQIA 3CSVA 3MY0A 4BBMA 4RJ6A 3W0RA 1PXIA 1NXKA 4JS8A 3SG9A 4FODA 2RL5A 3OBJA 5D1JA 2UUEA 4M12A 2O64A 2XMYA 4YC8A 4AG8A 5CASA 4MK0A 2PZIA 3GCUA 3CKWA 4C34A 4DGGA 5I5ZA 2QNJA 3QFVA 1R3CA 4F63A 1XHAA 1IA8A 3UP7A 4LUEA 3B2TA 4JAIA 4UMUA 2PZPA 1M7QA 4UN0C 4J52A 2VNWA 5B2LA 3ATTA 2X8EA 4QYGA 4D55A 3G9LX 5HG7A 4ENXA 5CU0A 4BJJA 4BWPA 1JLUE 5DI1A 3ZXTA 4GRBA 2AUHA 3F61A 4GIHA 3FMKA 3V5QA 2UVZA 2EB3A 2ZDTA 4J71A 2WO6A 1XH4A 2ZVAA 5IMXA 4P5ZA 5DIAA 4FOCA 2VWYA 2Z8CA 5BPYA 5L4QA 5HGIA 4DH3A 2Q0BA 4HPTE 2ITOA 3DV3A 3R7UA 4BCGA 4WUAA 4YTIA 2LGCA 4GJ3A 3RK9A 2W17A 4BCQA 5LJJA 3PFYA 2YEXA 4O7VA 2WGJA 3H9RA 2JKQA 4I23A 5TO8A 2JDSA 4YHFA 5J9YA 5M51A 5DVRA 5LWNA 5LVLA 2X6EA 4WBBB 3RINA 1SVHA 2RFEA 2X4ZA 1M2QA 1XH6A 4FUXA 2XANA 5M4FA 1WBNA 2VX3A 1W98A 4RT7A 5L8JA 4J8MA 2PWLA 2J90A 4ZTSA 3BLHA 4AOTA 3UZTA 5J1VA 4TT7A 4ZSJA 3SXRA 1XH8A 2J6MA 4L3JA 3I0QA 4WT6A 4YR8A 4IAKA 5FGKA 5CANA 2OI4X 4FZFB 4AN3A 1RJBA 3WZJA 4X3FB 2PUPA 4UWBA 3ORXA 2IZRA 4L45A 4G9RA 4EOSA 4QMMA 3VWAA 1YOLA 3V6RA 3RVGA 5E8ZA 4NU1A 2UZUE 4BKJA 4HOKA 3I0OA 4BDEA 3VS2A 3GC9A 4LYNA 3ZHPC 5KNJA 4GJ2A 4IB1A 2WEIA 5IUIA 3ZBXA 1URWA 4FKIA 4QP7A 2QOBA 3Q9YA 2WD1A 2JBOA 2OZAB 5J9ZA 3C4EA 5D41A 4M66A 3PFQA 3QQLA 2IZTA 4FIEA 3QCSA 5I9WA 1XH9A 5K0XA 4MNEA 3DBFA 4MUQA 5E8TA 2GHGA 3AC2A 4MD8E 4MD9E 4D4SA 5HLWA 4F6SA 1REJA 2QLUA 2VO0A 3EQBA 4M69A 5HI2A 1K3AA 3OT3A 2I6LA 5H8EA 4YZBA 5HEZA 1BX6A 2OJJA 5BVNA 4Z16A 1PMUA 4UEUA 5CXZA 3VN9A 3IO7A 3VHEA 2UW8A 2P2HA 3O51A 4APCA 2WU6A 5CVHA 1U54B 3BIZA 4QTCA 4IM0A 3HDMA 4NM5A 3FMLA 4PPCA 4F7LA 4ZZNA 3WE8A 4CFFA 4JBOA 3W55A 3BQCA 3QC4A 3KXHA 2FSLX 3QA0A 4V01A 2XKFA 4YZCA 1ZYDA 3QL8A 3ML1A 2YLFA 4Q5EA 3MSSA 4ANSA 2X0GA 3UG1A 3PSCA 4D9TA 4I5CA 2IWIA 1T46A 3LLTA 2IEWA 4QNYA 1UWHA 2JIVA 2QCSA 4QMLA 2V0DA 5DT3A 2OXXA 3FC2A 5HTIA 5EQEA 1YWRA 3F9NA 4FC0A 3R7GA 5EM5A 3RAIA 4CCBA 5HVJA 3UBDA 3COKA 3RALA 4QP6A 5EK7A 3ZLWA 3W0MA 5CAQA 4LFIA 4EONA 4CTCA 2C68A 3AQVA 5DE2A 3VIDA 2QOFA 3HMOA 4YZDA 1I09A 2VRXA 5FM2A 3TN8A 4I94A 5ITAA 4YSMA 2V7OA 3ETAA 2PYWA 4HJOA 2IJMA 3M1SA 2CKEA 3D14A 2J51A 3SAYA 4A9RA 2OGVA 3G9NA 3NAXA 4QMWA 3UNJA 5L2WA 3D4QA 2QHNA 2O3PA 4W4WA 4EH8A 4O82A 3BU3A 5J79A 3T3UA 1TKIA 4USEA 4OTHA 5C4LA 1Z9XA 3DOGA 4L7SA 3W16A 5M56A 2RKUA 3KCKA 4RIYA 3MJ1A 5AFVA 2C47A 2E9UA 2J0LA 3GUBA 1YDSE 3LCDA 3PE1A 4FIJA 2R3PA 4FKVA 4P5QA 4YLKA 2B0QA 2C6TA 3PSDA 3GU5A 2A0CX 4O27B 3V5WA 3ZM4A 3W2CA 3V3VA 4E5WA 1Q4LA 1WZYA 2EXCX 2F7ZE 5CU3A 4EK8A 2PL0A 3IS5A 5EHLA 3UO4A 1Q3DA 3PG1A 2WNTA 3LAUA 1U5RA 2BZIB 2WEVA 2X8IA 1H01A 4RJ4A 5HOAA 4E93A 3KREA 5BVWA 2OK1A 5AP5A 4N0SA 1IA9A 3F3WA 4M68A 2J9MA 3UO5A 3VONA 2OJ9A 5DEWA 4PUZA 4FZAB 3E8NA 4I0RA 5BMMA 4RLKA 3ZOSA 5K5XA 3PTGA 2VTQA 3R1SA 4OT5A 1JOWB 3DU8A 4G2FA 5I9UA 3UVRA 5JQ8A 4L00A 4R3CA 4Y73A 5JFXA 2QKWB 3RM7A 4ASDA 1OL7A 3E62A 5LVOA 3FXXA 5ETFA 3GGFA 1MRYA 2W7XA 2ZDUA 5J7BA 2ITVA 4IWPA 3WF8A 3EQHA 4GUBA 5H8GA 5J5SA 4BICA 4JDIA 4BGGA 3ALOA 3NEWA 4YLLA 3TZ7A 4QP8A 5BV3A 3F5PA 4I0TA 3MH1A 5EQYA 3NMUF 3VS6A 5HNIX 3KVWA 5FQDC 5CI6A 1ZAOA 4RVLA 1YWVA 3D83A 2I40A 3TACA 5L6PA 3CJGA 3OEFX 3ZLXA 4AE9A 5DYJA 4ZMEA 3FMJA 5HU9A 3NIZA 3UJGA 2NPQA 2YCSA 4FV8A 4FKSA 1VZOA 2HW6A 3FWQA 4CTBA 1R0PA 5LOHA 1JKSA 3NUXA 4IZ7A 4IADA 2OIQA 3TL8A 3HV7A 1PRYA 4E6AA 2VTNA 5CLPA 1K2PA 1OPJA 2R3OA 2YFXA 3O7LD 4E5BA 3WI6A 1ZYCA 2QU6A 4J96A 4H05A 4D9UA 4IAYA 3D2KA 4IVCA 3A7IA 4KD1A 4MF0A 3TKUA 2P2IA 3LW0A 3BL7A 3OP5A 1JWHA 1ZOGA 4U7ZA 2J5FA 3DQWA 3FHIA 5HE2A 3SRVB 1BI8A 5IQHA 4X2JA 3MWUA 4UY9A 5FXRA 1U5QA 3KXXA 4YJNA 3VW6A 3N4TA 2H96A 3UODA 4EZ5A 5CAUA 5L6OA 2BZKB 4JDHA 1OB3A 4J98A 4WSQA 2JDTA 4ZLYA 4FIHA 4CSVA 5AP2A 4K8AA 4U80A 4ANQA 4W8DA 4PDOA 3ENHA 3H9OA 4LL5A 4MTAA 3TZ9A 2UZLA 5IU2A 3U6IA 4BBFA 2JDRA 2YAAA 4DGOA 4MQ1A 3PDTA 3ZC5A 1PW2A 4O91A 2PTKA 3TNWA 4AF3A 3IPHA 1UV5A 4J99A 1CDKA 4N70A 4WG3A 3MVMA 1XO2B 5JGDA 4X2NA 4O81A 5AV3A 3CD3A 3QF9A 5ANIA 3FKNA 1O6LA 4O1OA 5AR7A 4EZ7A 2JC6A 3VC4A 5C1QB 2VZ6A 3KK8A 4G9CA 4C33A 3TNQB 4F70A 2I0YA 3DXNA 4EK4A 5I9ZA 2G01A 4RWKA 4X2KA 3BE9A 4S33A 3RZFA 3OC1A 1IASA 3DJ6A 2RGPA 4DFNA 3BCEA 4U44A 2Z60A 4RX8A 2QG5A 4J95A 5CSVA 3NCGA 3V6SA 4C2VA 4F65A 3F3ZA 4I6QA 5E8YA 4FL1A 4EBWA 4OBOA 4NKSA 2PUNA 4OAUC 1OBDA 2QD9A 3Q4TA 2XRWA 3NYVA 4CFNA 2UZDA 1FOTA 2A1AB 2X2KA 4G5JA 1NVRA 5BVKA 4C8BA 4I4FA 4A06A 3UDZA 3SW7A 1OM1A 2CN5A 2QLQA 4MWIA 4NUSA 1CMKE 1L3RE 4I0SA 3EIDA 4LDTA 4L68A 3TYKA 2WMAA 3HYHA 4IDVA 2GHLA 4JAJA 1QPEA 4LG4A 3ZMMA 5JEBA 4FK6A 2AQXA 2H6DA 4H3QA 1KE5A 3ET7A 3UPZA 3MVLA 2VUWA 3BGQA 3BRBA 1ZZLA 3PXYA 2CNQA 4BI2A 3DXQA 3ZSGA 3WF9A 3EFJA 4RJ5A 4V0GA 4O7YA 3QTSA 4NTTA 1WBSA 2QVSE 4AGDA 3TI1A 5AV4A 2UW5A 2REIA 4DA5A 4YC3A 3F5GA 2BKZA 4AP7A 2XNEA 3WF6A 5CU4A 5EW8A 3ZC6A 3UIMA 4XG8A 4C7TA 4DEDA 3MFTA 3SX9A 4H39A 2C4GA 1SVGA 2W4JA 3ORMA 4MBLA 2JLDA 4D2VA 5FEQA 5L2TA 4R1VA 2X7OA 3BBWA 3UQCA 1XR1A 4RQVA 4ORKA 1ZZ2A 1IAJA 1PKGA 3JVRA 1LEZA 4NL0A 5EKOA 3VS7A 1PF8A 2PSQA 4PL3A 4FZ6A 4QP4A 4YUQA 3EN9A 1UU9A 4V04A 3GI3A 2QHMA 3W2PA 4EK5A 5CT7A 3R8VA 3PA4A 3I5ZA 5AADA 4OR5A 4O0SA 2F2CB 3ZCLA 5I4NA 4I6HA 1M14A 4E73A 1NA7A 2YJSA 3IGGA 4GMYA 2JFLA 1AD5A 4XP2A 2XKDA 4F7JA 4TTHB 5GZ8A 4PPBA 3FMMA 2VTAA 3AXWA 4F0IA 3NFGB 5CVGA 3U4WA 4O7TA 3CQWA 2YIWA 3QTZA 4Z55A 3VVHA 1H08A 1ZMUA 5GZ9A 3Q9XA 5FEDA 4D1SA 4FG9A 2QR7A 2ZB1A 2ITZA 4DEGA 3K5VA 3K3JA 4C3RA 1ZYLA 3VNTA 4ACCA 2UZTA 3R22A 3ZFYA 4MNEB 3M11A 4XHKB 4G3CA 4NIFA 4C4FA 5M55A 2GNIA 4M69B 3WF7A