4A9SA

Crystal structure of human chk2 in complex with benzimidazole carboxamide inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
302
structure length
282
Chain Sequence
VYPKALRDEYIMSKTLEVKLAFERKTCKKVAIKIISKPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILTSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title Benzimidazole Inhibitors of the Protein Kinase Chk2: Clarification of the Binding Mode by Flexible Side Chain Docking and Protein-Ligand Crystallography.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 282
sequence length 302
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4a9sA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4a9sA01
3SOCA 3RPYA 3DXPA 4X2JA 2X81A 4F6UA 3CKXA 5CU0A 4BCPA 5HE3A 3TM0A 2RGPA 3Q52A 5AM7A 2QOCA 5DEWA 1Q4LA 3A8WA 4QYYA 3FY2A 3WIGA 2ZB0A 4DLJA 2XNPA 3M2WA 3ENHA 2PZIA 4U42A 4G17A 2C5VA 2FSTX 3UOKA 3ZONA 4CV8A 2J2IB 3QD2B 4BWKA 2QO9A 2Y6OA 3ZO3A 5LJJA 3W16A 4WNMA 1H28A 4RJ6A 3G5DA 3ZLYA 4F9CA 4JR3A 4PMTA 4D28A 2Z7QA 3HAVA 3HVCA 3AC4A 4EQMA 4E6AA 2AUHA 3C5UA 5JQ8A 5H3QA 5HLWA 4O91A 1OUKA 4AW5A 4TYHA 2QO7A 4GUEA 4ERWA 4PMPA 3KN6A 3TKUA 1Z9XA 4YJUA 3E5AA 4FL1A 3G90X 5I3OA 4BDHA 3G33A 2YIRA 3FLWA 3QUDA 4D0WA 1K2PA 5B0XA 3ORLA 4F1TA 2UZUE 2XK3A 4PV0A 5LOHA 4LL5A 3W2CA 4BF2A 4MBLA 2XIZA 4ZXTA 1X8BA 2O64A 4IAAA 3NUSA 3RHXA 3ENMA 5C03A 3A7JA 4AFJA 4PRJA 1NVRA 3PJ8A 1Q8UA 3MBLA 4WRSA 4E4NA 4A9UA 3C4WA 3ZBFA 5BMSA 4AG8A 3MIYA 3D83A 3MFRA 4AACA 3GCUA 3M42A 4RLLA 1ZZ2A 4G31A 4RRVA 5CWZA 2HWOA 4ZTSA 2UZNA 4IXPA 3IGGA 4PL5A 4APCA 3ZUVA 2XRUA 3FL5A 2YIYA 4AA5A 4G3EA 3DQWA 4ASXA 3AXWA 3MN3A 2W7XA 3A7IA 1H4LA 3LE6A 4IFGA 3L9MA 3KB7A 4EI4A 1BI8A 1GY3A 1IRKA 1OL6A 4ZMFA 4CFMA 3GFEA 4FI1A 2ACXA 2BIKB 4LV5A 4JIKA 4QQCA 4QQTA 3DCVA 3VJOA 5CEMA 5LMKC 4YZCA 2XKEA 3II5A 4GK3A 4F7JA 2WO6A 4EK5A 1FBNA 2P0CA 3EN9A 2J0MB 5CVGA 2WTVA 5AFVA 4WO5A 3SRVA 4UYAA 4XOYA 5C01A 4CFXA 2F7XE 2O65A 5FDPA 1SM2A 3EWHA 3LJ1A 4RJ7A 4UN0C 4Y5HA 1T46A 3QTQA 3DLSA 3KU2A 2BZJA 4O7YA 3SG9A 2XNEA 4BTJA 2XJ1A 3JPVA 2CKQA 1FVRA 1A9UA 3RZBA 2PMIA 3TG1A 1K3AA 5AMNA 4G1WA 3SW4A 4IC7A 4OTGA 1SVHA 3BGQA 1REJA 2I0EA 2PHKA 4YTIA 5CYIA 3BYUA 4I3ZA 3HL7A 2OJIA 4EH3A 3PXRA 5CASA 5M4FA 2QO2A 2QG5A 2HZ4A 4S34A 3BQRA 1Q99A 4FEWA 2ITTA 3EQDA 5GJGA 3DKGA 3R71A 2W9FB 2GHMA 4DEDA 4FL3A 3UYTA 3DK3A 4EHZA 4XRLA 4OBOA 3OROA 3LW0A 4FKQA 1FMOE 4C62A 3A7FA 4Y8DA 3ZFMA 3PG3A 5I9UA 1JKTA 4RIOA 1ZYSA 4FIHA 3TJCA 4BTFA 5IQAA 5TF9A 2XVDA 4DA5A 4HJOA 2E9UA 4ACMA 4PTGA 3ZDIA 2PZYA 3LJ2A 3LAUA 3OTUA 4TNDA 4MYGA 2XK4A 3QALE 2OH0E 4RWIA 1VYWA 1V0BA 2XJ2A 4FT5A 4U45A 3NS9A 1GJOA 4U44A 4TYJA 3NNXA 4U97A 3LOKA 3QBNA 4F70A 5E4HA 2CJMA 3V5JA 4S2ZA 3QRJA 3PXFA 3EQHA 2R3KA 4TYEA 1PXOA 2GTNA 4TNBA 4O7VA 3CD3A 2ITXA 4JOAA 4QT1A 3GVUA 5GNKA 2PWLA 3KULA 3ZH8A 4RIYA 4B7TA 2OO8X 2A2AA 3OOGA 5AUTA 2IVTA 2V7AA 3C4XA 4UWBA 1J91A 1OKYA 2I40A 4UV0A 3JVRA 4G3DA 3KK8A 3QRIA 3QWKA 5HGIA 4B8LA 5HO7A 4O1PA 4XP2A 5ETCA 4ZZMA 5EM5A 3DLZA 5J87A 4KSQA 3BHYA 3LKMA 2CDZA 2VO7A 3BHTA 3LM0A 3AD5A 1WBNA 2XB7A 5DR2A 2VWIA 2UW9A 4W8DA 4JBPA 5ETFA 2WTKC 2WAJA 4I93A 4D9TA 3DS6A 3P7CA 2R3NA 3KMMA 5CTPA 1TQIA 4PNKA 1S9JA 4YJNA 4IX6A 3VVHA 2VAGA 3R9RA 3TL8A 4IH8A 4IQ6A 5AX9A 1WZYA 2FSMX 3P78A 4FTQA 3FPMA 4HZSA 4FV1A 3RPRA 3I6WA 3V04A 1J3HA 4MHAA 3NNVA 3MI9A 4M15A 2XCHA 4MQ1A 3DK6A 4ZTRA 4YLLA 3U8WA 3KCKA 1QPJA 2VTLA 2YWPA 3TNQB 1OKWA 4RJ8A 5EK7A 5LXMA 4CFUA 5K5XA 4L9IA 3C50A 5AV3A 2RG5A 1STCE 4NU1A 3R7OA 3QUPA 2WIHA 3EQFA 2JITA 4EK3A 3W33A 3ZSHA 3W55A 5BVKA 4DITA 2ZV9A 3TNHA 4G3GA 1YOMA 2FO0A 1OMWA 4CZUA 2JC6A 3F7ZA 4H1MA 3SXFA 4ZMEA 2BZIB 2X7OA 1YWVA 2RKUA 3DTWA 5DVRA 4MVFA 5T3QA 4IM3A 4F64A 1JPAA 4WNKA 4Z7GA 4AE9A 5E9EA 3GGFA 1YWRA 2C6KA 3RMFA 4DH5A 1YXXA 3F3ZA 3HA8A 3MPTA 4CLJA 5KMIA 4QP7A 2OI4X 4W4VA 2X8IA 3EN4A 1P4OA 2R5TA 3GU7A 3LFAA 4QMMA 5A3XA 2QOQA 2W5BA 4BZOA 2GQRA 4F65A 2W1IA 4J71A 3I4BA 5FEDA 3WE4A 2CKOA 4YSMA 4RFMA 3FMEA 4EK6A 4M0ZA 2CNUA 5IEXA 5TR6A 4D4VA 4HVIA 4UZHA 4ZTLA 3NYOA 4IX4A 4D1ZA 2I7QA 4KSPA 4L45A 5BYLA 3P9JA 3PZEA 2UZOA 5AA9A 3Q6WA 3AG9A 4ZZOA 3D7TA 2UUEA 4KKEA 4QOXA 4F7NA 4EOLA 3ZO4A 3RPOA 4M69A 2XYNA 1EH4A 4DBXA 4F9WA 3MFUA 1WBVA 3EH9A 3HX4A 3CQUA 1PXPA 3NW5A 5HG8A 2VTPA 3TDVA 4OTQA 3WI6A 3DXQA 3PVUA 4F7LA 1XO2B 5HO8A 5IUIA 4D2RA 1MRYA 4DCAA 2J0JA 4Q5EA 3KRLA 4IBMA 4AZVA 5IQFA 4NKSA 2CCIA 2GS7A 3CTHA 3K3IA 3NEWA 3QFVA 5J7BA 4GVJA 5JRSA 1ZARA 2ZOQA 4CQGA 4C8BA 1VZOA 2OXDA 4YC3A 5AV4A 5FXRA 2PUUA 3W8QA 2JKQA 4QYEA 5EQYA 3VQUA 1OIYA 2W1ZA 5L2TA 5EOBA 3E8DA 4I6BA 3UPXA 4GT5A 3KVWA 2WEIA 5CQUA 3WBLA 2YA9A 3QHRA 1GZOA 3GC0A 2WQBA 3R7GA 1XH8A 5DFPA 1XH5A 3VF9A 4YU2A 3QZFA 3PPJA 1UU7A 3O8PA 5BNJA 5HG7A 3FLNC 3BCEA 2CGWA 2UW6A 2P33A 2XNMA 3FZOA 3T9TA 4FKJA 2IVUA 2V7OA 3E3PA 4LGDA 3DBQA 2VZ6A 3DTCA 3G6GA 3UE4A 3C4FA 5L2IA 5IA3A 2HK5A 3UIBA 2FSLX 3ZLSA 4FVQA 3TUDA 5AP2A 1ZWSA 4OTDA 5HU9A 5HZNA 4RX7A 2JDVA 1Y91A 4EOJA 2WMRA 5C26A 1R1WA 2WMAA 3DOGA 5KX8A 2BRHA 4JBOA 3VUDA 2C5XA 4MXYA 2VTJA 3NVMB 1PW2A 3VHEA 3ZOSA 4C59A 1Y8YA 3QXOA 3TDWA 3QCQA 1ZAOA 3TEIA 5E92A 4O7SA 4KIQA 4QMXA 5EQPA 4ARKA 4V05A 1GIHA 1JAMA 1YRPA 4IVDA 3D9VA 4O7LA 2XNGA 4GUBA 4C35A 2LAVA 2IW8A 1RDQE 3SOAA 3D7ZA 2CNQA 4O86A 4E4XA 4FIGA 4ACGA 3QKMA 3EIDA 2EUFB 3OXIA 2BALA 4RGJA 5FEEA 4CG9A 3ODYX 4E5WA 5M08A 3R9DA 1ZYJA 5HVJA 5L8JA 3BRBA 1XQZA 3R1SA 4LUDA 3GEQA 1UKHA 3ZCLA 1KE5A 2IWIA 5CI6A 4GG7A 4F9AA 4PP9A 4Y73A 5B2MA 5AM6A 4EOOA 4CGAA 5J1VA 4OT6A 2XS0A 4G6LA 4KBKA 3V5LA 4C02A 4D0XA 2W1EA 2XUUA 1AGWA 2PMOX 4KAOA 2H9VA 4OW8A 4XRJA 3NZ0A 2HXQA 3F82A 4PPCA 3P79A 3ZUUA 4M67A 1YI3A 4RIWB 3R8VA 4HVDA 2NRYA 2PZRA 2VGOA 1GNGA 2P55A 2ONLA 4UMTA 3R1NA 3TV4A 4AUAA 3QKKA 5EOLA 4IFCA 4BFMA 2WMTA 4NTTA 4MNFA 3DJ6A 4ASEA 5K4IA 3C7QA 2OICA 3FWQA 4D1SA 4O83A 3S3IA 4CTCA 5KHWA 4C38A 4NSTA 5GZ9A 4IWPA 5LCKA 4ANNA 2GNIA 2WTWA 2E9PA 3IO7A 4MK0A 5EKOA 3D0EA 2X0GA 3HLLA 3H0YA 3S95A 1U46A 4YZDA 5CT0A 4F0IA 4DFLA 4X7QA 2WU7A 3IDCA 2HZIA 1BX6A 4FTJA 5HX8A 3PP0A 4XMOA 3R8MA 3UG2A 4FKRA 2WMVA 4XP0A 4CSVA 2RSVA 4FTCA 4S30A 1KUTA 3O2MA 4U5JA 3QA8A 3MB6A 3WILA 3GOKA 4CEGA 4F4PA 2WKMA 3LCSA 2GDOA 4GFOA 5LVPA 4U3YA 2OKRA 4QD6A 2YDIA 4BB4A 2EB3A 5KKRC 4L3PA 3IONA 2O2UA 4HGEA 1YXTA 3DK7A 3OWKA 4FV2A 1T45A 5H9BA 1SMHA 4CVAA 4C7TA 1ZY4A 3MH3A 3KF4A 2J0KA 3AMBA 3PA3A 3BBTB 3LFDA 5CT7A 3EB0A 2J6MA 4C2WA 4M14A 2XP2A 2VO3A 3LVPA 2W1DA 4XV2A 2JDSA 2WTDA 4ANLA 4IADA 4P2KA 5CVHA 4L52A 2AC5A 2WMXA 5KZ0A 2J0IA 3FE3A 4G3FA 4P5QA 4BTKA 3EHAA 4JX3A 3UC4A 5L4QA 2FA2A 3TXOA 3NW6A 4ANQA 1HCKA 4F99A 4IVCA 2YCQA 4RPVA 4I24A 2Y7JA 4DGOA 5EM8A 3ANRA 3F3TA 2C3LA 3PG1A 4FNXA 4RJ5A 4DGNA 3MPMA 1UA2A 3F88A 1H25A 2XIYA 3U9NA 3VAPA 2XK7A 4A4XA 4EKLA 1H08A 4BDFA 4IAKA 2R9SA 3CEKA 4YJQA 3UIXA 1Q8ZA 4YHFA 2GPHA 2XIKA 3ELJA 4G6NA 3VBTA 4A4OA 2BDWA 5J9ZA 5ACKA 4L7SA 4R7HA 5IQEA 2DWBA 1HOWA 2Y4IC 3DGKA 3PPZA 3O0GA 5CF4A 2QURA 4J1RA 2XA4A 3V6SA 4B6LA 4I22A 3Q4TA 3COKA 4D9UA 3IK3A 2A4LA 1M7QA 4J8MA 2NP8A 3ZDUA 1Z57A 4EYJA 3AC8A 5M4CA 2BAJA 3QHWA 4ZTQA 3EQIA 2PSQA 2PVRA 3D2IA 5KKRB 4MXXA 1ZRZA 4EK4A 3DDQA 3WF9A 4EK8A 4DN5A 4BN1A 4MWIA 5M51A 4UB7A 4EKKA 3BU3A 4MBIA 2HENA 2QKRA 1KV1A 5FP5A 3KMWA 3PSCA 1IAHA 5JSMA 3P7AA 1JWHA 3R02A 4FKWA 3WIKA 4A9YA 4XV9A 5EW8A 4HOKA 5DR6A 2O3PA 3ID6C 5D9HA 4AA4A 4E4LA 5A6NA 3HUCA 3EMGA 3EQBA 3AC3A 1JSVA 4O0YA 3UO4A 4BDKA 2SRCA 3ORPA 4FMQA 5AV0A 1OL5A 5FBOA 1SZMA 3OY3A 5LMAA 4ALUA 2Y0AA 4ZTHA 5I3RA 4JI9A 3ZHPC 2DS1A 3R6XA 4B99A 5AV1A 1ZMVA 3TIZA 3VUIA 4LRKA 3FXXA 4ZP5A 4KUJA 1WVWA 3FZSA 4DFZE 4DG3E 3KCFA 4RT7A 5A4QA 4EH7A 2OW3A 3FI2A 2R64A 4RLKA 3QTWA 3VC4A 4HCUA 1CKIA 4C3PA 2PVJA 3LCDA 4AWIA 4CKRA 2PVHA 3PSDA 2VV9A 4HNIA 5TKDA 2VTHA 4H36A 1I44A 2R2PA 4G5JA 1GOLA 3MTLA 3ROYA 5DLSA 4ALWA 5IQIA 1TVOA 2B54A 4ZLZA 3T8OA 2C6TA 4LGHA 3C0HA 2YISA 1ATPE 3FI3A 1QCFA 2ITPA 3EQRA 5C4LA 3ZLWA 1H8FA 3IOPA 2YDKA 4AQCA 3GU6A 4E5AX 4KIOA 5IA2A 2BPMA 4ZTMA 2VTAA 2WIPA 2J9MA 3D5WA 3BU5A 3GCVA 4BZNA 3IW8A 5IU2A 5IQDA 3TUCA 3BBWA 4RBLA 3WE8A 4U80A 1U4DA 3ZXTA 1AD5A 4O96A 4J96A 4I23A 4QTAA 4YMJA 5LMKA 4JXFA 1M2PA 2VNWA 4FUXA 2B1PA 3WZEA 3BZ3A 3JYAA 2Z7SA 2O8YA 1UU3A 2ETRA 1NVSA 3COMA 4UMPA 3LMHA 4PDPA 3LQ5A 5K0KA 3C4ZA 2G1TA 2GNFA 2A0CX 2UVXA 4RC3A 4YZMA 5EHOA 2IN6A 3FSFA 3D15A 4XX9A 4F1OA 1U5RA 2R3HA 3HMMA 3Q04A 4WG5A 2ZMDA 2ITUA 2R3OA 4LV8A 5M4UA 3NUYA 4KWPA 5BQ0A 3R9NA 4L3LA 3ZUTA 4M12A 5HBHA 2X4FA 4H3BA 5CEOA 3DBCA 3PRIA 4HCTA 1F5QA 2IW9A 3F5UA 5EQEA 5BUJA 4AZFA 4OR5A 4F09A 4FV6A 2F7EE 3E8NA 5KNJA 3MW1A 1Y8GA 5IZFA 3BYSA 3DKFA 3EFWA 4OBQA 3VW8A 4JR7A 4DFUA 3EFJA 4RMZA 3JUHA 3TACA 2G01A 3AT2A 2C0OA 3OEZA 2GS2A 3SDJA 4QMPA 2ZM3A 1J7LA 3DAJA 4ZSJA 4BI2A 4ORKA 4KB8A 2ZMCA 4ANBA 3BI6A 4C58A 4FT9A 5T6KA 3PE1A 1BYGA 3PSBA 3RM6A 5G1XA 3R01A 3ZM9A 3FZTA 5D41A 3PXZA 2NNWB 5EYCA 1L3RE 2XK9A 3HRBA 5AIKA 3VS3A 4E4MA 4ERKA 3EOCA 2VU3A 2C1AA 1H0VA 4OTHA 4FSTA 1TQMA 1YVJA 2JDTA 3HV3A 3FMMA 4GT3A 3V01A 4CXAA 3OY1A 4GEOA 3OCTA 2ERKA 1ZYLA 2PZPA 2HYYA 4JLCA 5CF8A 3MIAA 3I5ZA 2C0IA 4DINA 5FG8A 2WXVA 5AIRA 2J50A 4R1VA 3A4OX 5CU2A 1KE8A 3UNZA 3WZJA 4XG2A 3R7IA 3S00A 3BLHA 4K18A 2G2HA 5IA4A 3FKLA 3Q9XA 4O0SA 4ZIMA 3RPSA 3MDYA 5EDQA 1GZNA 3KMUA 4AZSA 5CAQA 4EWHA 4BKZA 2R3MA 4MWHA 4IHPA 4XLIA 5IQGA 3U87A 5EI2A 2ITNA 4NEUA 4P7EA 3C13A 3R2YA 4IACA 4WBOA 1KWPA 3R1QA 4DFYA 4FX3A 5AA8A 2IVVA 3DY7A 3KY2A 4LI5A 4D58A 4CRLA 4ASDA 3O71A 4LQMA 1ZXEA 4LOOA 4R7IA 3NAYA 2B9JA 2A1AB 3F7WA 2BAKA 2C3KA 4AGUA 4D2WA 2VX1A 1LR4A 4AW1A 3MY1A 3ZEPA 3HV5A 4JNWA 3KK9A 5CU3A 4HGTA 1H07A 3D5XA 1JKSA 2UZBA 3AMYA 2W05A 4AN3A 4FK3A 3MSSA 1G5SA 4RVKA 2IJMA 4X2GA 4UX9A 1OITA 3BV2A 4AN2A 3ZFXA 4J8NA 5ANKA 4JG7A 3LFBA 2VRXA 4YO6A 3FXZA 3O8UA 3UBDA 3VRZA 3HMPA 3BYMA 1JSTA 3GT8A 3O7LD 3OT8A 3RK7A 5AR4A 3OWPA 4YZBA 5L6WL 1YXSA 3OTVA 5HCYA 3DNDA 4YC8A 1J1CA 4L53A 3O51A 4R6VA 1Y6AA 3R8UA 3W8LA 4JAIA 2R7IA 4AOJA 4IJPA 2VWBA 3RAHA 3S2PA 5HKMA 4WSYA 2GNJA 5BX0A 3G15A 5E8UA 5D10A 2ETMA 2I0VA 4FL2A 2X7GA 4AP7A 4XG6A 4OAUC 2Y8OA 2OU7A 5HOAA 4JDJA 2RIOA 3Q4UA 3PVBA 3PXQA 1YDSE 4FZ7A 2YJRA 3GXLA 3I5NA 3R00A 3RCJA 3F5PA 2XNOA 4OTFA 3IDPA 4FTAA 2EXCX 1Q41A 4QMUA 3ROCA 3LZBA 4Y83A 4BI1A 3DQXA 4H05A 3H9OA 2BMCA 2UW4A 4L67A 2OIBA 4RG0A 3S1HA 4IZ5A 3DB8A 4YBKA 1U59A 3MWUA 3I7BA 3VW6A 4CMTA 4BDAA 4LUEA 5CAUA 5HU3A 3QQLA 1CTPE 2BHEA 3QUEA 3ATTA 5HEZA 4HVSA 4BHNA 3MB7A 3JY9A 3MH2A 1H0WA 5AX3A 2HZ0A 3QX2A 2FYSA 1H1WA 3MV5A 4MXOA 4UZDA 4XV3A 3UQCA 3NCZA 3TUBA 4O1OA 4Y46A 3DBEA 3MPAA 2W17A 3IW4A 4RX5A 4HPTE 3KGAA 2NPQA 4HVGA 3E3BX 1YWNA 2H34A 3EJ1A 1OUYA 3NIEA 3PY1A 5DWRA 3UGCA 1ZOGA 5FEQA 1WBPA 4EJNA 3EKNA 4C4EA 3PP1A 4LOQA 3S4QA 3LIJA 5DR9A 5EKNA 5CEKA 3NUAA 3AQVA 3NNUA 3BQCA 3QRUA 2VWZA 2R0IA 2W99B 2PY3A 3POOA 2BRBA 5F20A 4RWJA 3OXTA 4BL1A 5JT2A 1JOWB 3F2NA 1ZOHA 4O2ZA 4W8EA 4R77A 3VBQA 3TNWA 5IF1A 1V1KA 4OBPA 5K3YA 4RIWA 3NVKI 4KNBA 3LXKA 5E1EA 1DM2A 2ITZA 4YUQA 2CKPA 4WT6A 2HY81 3Q5IA 1YHWA 4RWLA 4YLJA 3NLBA 3OUNB 3VN9A 4BIDA 5IMEA 3I6UA 1OECA 3K54A 3K2LA 3A62A 4FKSA 5IG1A 5T68A 3C0IA 5JZJA 4YLKA 3VHKA 2BRGA 3PJ1A 2C3IB 4FSMA 5K5NA 3FHIA 3L8XA 3THBA 2WQEA 3OBGA 2FUMA 4K9YA 3BU6A 2HW7A 5BVDA 5DPVA 1MUOA 1XWSA 3HMIA 3UVPA 4BWXA 3VUGA 3FHRA 3QF9A 1XBBA 4WRGA 3PLAE 4RA4A 4PTEA 2XCKA 2C30A 1PMVA 2ZDUA 3CGOA 4E7WA 5IMXA 3MYGA 3OF0A 3REPA 4K6ZA 4IWDA 3AD6A 4RFZA 5DRDA 5J7HA 2PVLA 1JKLA 5L8LA 2YIXA 4TYGA 4ZJVA 2I0HA 5J1WA 4BCMA 4F6WA 4RZVA 2REIA 2C47A 2E9NA 3QAME 4FZDB 5LVOA 1RW8A 1OBDA 3TZ7A 2EVAA 4IB0A 4C4IA 4KS7A 4AX8A 4QRCA 3SXSA 2OLCA 5HBJA 1FINA 4TYIA 2QOLA 2Z7LA 2QODA 4KBCA 3UG1A 4R1YA 2DUVA 4GYGA 4MKCA 3RZFA 3OD6X 4BR3A 1W0XC 1MQ4A 3T3VA 2X6DA 4U43A 3MY0A 3UP2A 2XKDA 3A99A 1YXVA 3LQ3A 4QP4A 4DBNA 4X3FC 4WA9A 3DA6A 2DQ7X 1YW2A 4Q9SA 3FV8A 3E88A 3DT1A 4UMQA 4XCUA 4AN9A 5JFSA 4FYNA 4J98A 3GC9A 5HE0A 4Z3VA 3NIZA 2JIVA 4C61A 3FMKA 5D7VA 5JMSA 3PA4A 4YO4A 4FTUA 1URCA 1V0OA 2WEVA 3QQJA 3LM5A 5L8KA 5CXZA 3E7OA 1WFCA 3CXWA 3EN7A 4FTKA 4MBJA 3ORNA 3PRFA 4PMMA 4QMTA 1SVGA 5GINE 2UW3A 4A06A 1PYXA 5H2UA 3FZ1A 3E8EA 2BFYA 5HHWA 4FSUA 4EHEA 3ZM4A 3E8CA 2O0UA 3JS2A 4LMUA 3FXWA 4IX3A 2WTKB 4J99A 3W18A 3ZO1A 3UP7A 4AZTA 2W5HA 4EORA 3O17A 3RAWA 5JH6A 2VX3A 5I9ZA 3QQGA 2JBOA 3LQ8A 5HG9A 3BWFA 5HLNA 2QOIA 4FOBA 3CY2A 2C4GA 3NGAA 3ZRLA 2IZRA 2VO6A 3VIDA 4ANSA 3HDMA 4QYFA 2VTIA 3DKCA 1W84A 1F0QA 2RG6A 4IM0A 4J97A 1B39A 1UWHA 2GMXA 4I0SA 2E9OA 2X2KA 4XG3A 1P5EA 1XH9A 2CGUA 4GKIA 4FTNA 5EHYA 4JDKA 3LFSA 2V5QA 2X1NA 4O7NA 3LJ0A 4BCOA 5A4LA 5D11A 4BYIA 2XIXA 4CLIA 3UPZA 5JKGA 3LCOA 5AAEA 3KRXA 3WF6A 3BELA 3MESA 3HKOA 4S31A 2VTSA 3FLQA 3N4VA 1QPEA 5CI7A 3GC8A 2OZOA 3HUBA 5ITAA 2CLXA 2VTTA 2Y6MA 1BMKA 5DGZA 2R3JA 3COHA 3OHTA 4FSZA 3W32A 5FP6A 4J7BA 4FTLA 4IB3A 2JIUA 4NM3A 3KVXA 4ZEGA 2UZWE 2WB8A 2VUWA 2R3QA 2XBAA 3WOWA 4XG8A 4EBVA 4R3CA 3OP5A 4U79A 5ANDA 2YM5A 3ZYAA 4I6HA 4DE4A 5I0BA 3QQKA 1GAGA 4UMRA 3A4PA 3PYYA 1PXIA 4XHKB 4CZTA 2B9HA 4I4FA 4O0XA 1UNLA 2OBJA 4I5CA 4BGHA 4AU8A 1JSUA 4C2VA 1IA8A 3OBJA 1RJBA 3VBVA 2RF9A 3VRYA 3RWPA 5F95A 2YHVA 1WBWA 4GSBA 5AR7A 3TT0A 4FICA 3VS5A 4W9WA 4BCNA 2PYWA 3BWJA 3Q9ZA 3R8LA 2FGIA 4PPAA 4ZK5A 3SAYA 3DPKA 3TN8A 1U54B 3ANQA 3UOLA 2YITA 5LQFA 5DMZA 3I0OA 4NUSA 4XNEA 4BWPA 2PMLX 3MVMA 4EYMA 4DGLC 2YJSA 5HIEA 2CGXA 4AGWA 4AE6A 2RFEA 1H1QA 2JEDA 4W4WA 1PKGA 5BMMA 5J5TA 4GKHA 4K2RA 2QVSE 2XJ0A 4B4LA 2OIQA 1BLXA 3QCYA 5FDXA 4A07A 4FF8A 4WNPA 3VNTA 5ANEA 5KO1A 1W7HA 3C51A 4YBJA 5HD4A 3JXWA 3O96A 5DE2A 4M66A 2YZAA 3POZA 3NCGA 4I4EA 5EM6A 5A4TA 4YJTA 4IZAA 4O6LA 4ANOA 4X2FA 3KXXA 4QYGA 2VWWA 1LPUA 4IMYA 3IOKA 2R7BA 4DYMA 2GCDA 2B55A 5HICA 1CKPA 4FT7A 3UNJA 2FH9A 1UU9A 1LP4A 3QQFA 3AGMA 3GU4A 3RHKA 4LYNA 4YJOA 4K77A 3VS4A 3KRJA 3E63A 2C3JA 2XBJA 3BKBA 3QTZA 4HVHA 3FJQE 4RJ4A 5FUTA 3DDPA 3QL8A 4N6YA 4DG2E 4QP9A 3LFCA 2RFNA 4JDHA 2WMUA 4DFXE 4PDYA 2WOUA 1RE8A 3VS7A 4DEHA 4D5KA 2ITOA 2JD5A 4FSYA 3PIXA 4BI0A 2C5NA 2X6EA 2UV2A 4BTMA 2BCJA 3BLRA 1G3NA 4TWOA 1REKA 2XKCA 3AMAA 2PVFA 4GV1A 5BYYA 5JN2A 4KINA 4TKSA 2QOFA 2VN9A 3FMNA 3H10A 4UBAA 3UDBA 5IA5A 5DT0A 2VX0A 2ZB1A 4Z7HA 3LXPA 3DKOA 2GFCA 5AP0A 3RK5A 4E93A 2WMWA 3CD8A 4DGGA 5HNIX 2W1CA 1M2RA 4MD8E 1PF8A 2ZV8A 3FZRA 2Q0NA 2H96A 2GNGA 2VWUA 3A2CA 2XMYA 3RGFA 2X9EA 3U4WA 5FRIA 4O0RA 4RZWA 4EH9A 5KHXA 3B2TA 3L8SA 3FAAA 2JGZA 1W8CA 2FB8A 1Q8YA 3BYOA 3F2RA 3S0OA 5EH0A 3KXMA 4NK9A 3FLZA 2X7FA 3OFMA 4NCTC 3JVSA 4GH2A 3FL4A 2F7ZE 4L46A 2P2HA 4CKIA 2W5AA 3E64A 1E1VA 4GCJA 5C8KA 4KABA 1GZ8A 1DAWA 3F5XA 4XG4A 3CPBA 2YFXA 3N4TA 4WBBB 3AD4A 3TZ8A 4GG5A 4PUZA 4AF3A 3R83A 4V04A 3HYHA 4XOZA 2HY0A 1FOTA 5BYZA 4ZSGA 3PXYA 4AAAA 3LPBA 4E8AA 3PXKA 4D1XA 4YTFA 1IAJA 2X8EA 5AP5A 1NXKA 1OKVA 4IZ7A 1R3CA 3B8QA 2UVYA 4I1ZA 4LRMA 1R39A 3D4QA 4NM5A 4EH6A 4USDA 1Q8TA 4C4JA 5GJDA 4IM2A 1OPKA 3KXHA 5HORA 1VEBA 3SD0A 2PPQA 4FZFB 3GOPA 5AP4A 4PQNA 4QNYA 1PKDA 2WMQA 1R0PA 3EYHA 4UYNA 4D2VA 4JBQA 4RA5A 2C6LA 3FI4A 4DHFA 1PXKA 2Z60A 5BUIA 5G6VA 4QTDA 4BDGA 4U3ZA 2JDRA 3R7VA 3ORXA 4NKAA 4FKIA 5L6OA 4U40A 5IKWA 4APPA 1CM8A 1ZLTA 1W82A 3ZXZA 3RJCA 4C36A 3FKNA 4NZWB 4L01A 1JNKA 3P7BA 3BGPA 2W1HA 5EYDA 4JRNA 4DH3A 3GCQA 3F66A 4BBMA 4O7WA 4BYJA 4CMOA 5ETIA 5DT4A 2BFXA 4FKPA 5JGBA 2R3GA 3QC9A 2GU8A 4IB5A 3HDNA 5KMJA 3FBVA 4TTHB 4EOIA 5KMMA 4DH1A 3NAXA 2EXMA 2X2MA 4ITHA 2UZTA 4BDBA 2YWVA 3OMVA 3W2OA 3V6RA 3UQFA 4S32A 3ZRMA 1ZYCA 3ORMA 4DT9A 2E9VA 1J1BA 4GRBA 3QTRA 4HYIA 4O21A 4HZRA 4JX7A 4MTAA 3V5WA 3VWAA 4AGCA 4BCQA 1OBGA 4O7TA 2Z2WA 2VTQA 3L9LA 2C0TA 5IH6A 5CNOA 5HCZA 1Q3DA 5AUYA 1H00A 4BIBA 5IQHA 4E20A 3IS5A 2OZAB 1FQ1B 4QTBA 3RPVA 2OJGA 4DH7A 3QD3A 3LXLA 4EJ7A 5J5SA 1GIJA 5H8EA 4Y95A 1NT2A 2WQMA 4I20A 2A19B 2FSOX 2PTKA 4Y72A 1Y6BA 2UW8A 5DRBA 5FTQA 4QPAA 1B38A 4QMWA 4DEGA 3L8PA 3FUPA 5F94A 3TV7A 4QP2A 3WF5A 3HRFA 5H8BA 3CLYA 1CDKA 1H27A 3V8SA 4FKOA 1ZZLA 2RL5A 4QNAA 5IQCA 1H24A 4BZDA 4TT7A 2GNLA 1MP8A 4JG8A 5AADA 3NUXA 3EN6A 5K9IA 3IQ7A 4P90A 1APME 4CFVA 3CY3A 2XK8A 2PUIA 4HGLA 2X4ZA 3U54A 3T3UA 3R30A 4M97A 3UZTA 4QMOA 4EC8A 3QYZA 4LGGA 5CY3A 4AW2A 4G6OA 2PUPA 2G2IA 2Y4IB 4W4YA 1H1SA 3NYNA 1U5QA 4JJRA 5AR8A 4CG8A 5LCJA 5JFXA 3CSVA 3UO5A 3WZDA 4NYEA 4FEQA 2JKKA 5FM3A 2P3GX 2UW5A 5A46A 2WPAA 3O23A 1BL6A 5HLPA 4D4SA 3P5KA 4JS8A 3SGCA 2XK6A 3MVJA 4QO9A 5A4CA 2YCFA 3KN5A 4IAIA 4BDEA 5CEQA 4QPSA 1IR3A 2IW6A 3CGFA 5DOSA 1P2AA 3LLAA 1XHAA 5EG3A 5GJFA 5L2WA 3HV4A 3PIZA 1MRVA 3ODZX 4UXLA 2ZDTA 4USEA 4UY9A 5F9EA 3F61A 5EI6A 2ZVAA 5IEYA 5FXQA 1CKJA 3GCSA 4D2SA 2UW0A 4FVRA 4XBUA 2YERA 2BTRA 3FPQA 3WZKA 3AT3A 1ERKA 3Q9WA 2W96B 5AAFA 5EYMA 4FV4A 2BKKA 4C33A 3ZU7A 3WARA 3MVLA 4JDIA 3AC5A 4ZOGA 5CSPA 4ZSLA 2QKWB 4FA2A 1ZMWA 4BY9E 2OXXA 4F0FA 4EH4A 2GHLA 3CKWA 4A7CA 5DT3A 4L6QA 5L6PA 3QU0A 2CGVA 5AR5A 3W10A 3UIMA 2QCSA 4BBEA 4HW7A 3EYGA 4F1MA 4IDTA 1LUFA 4QQJA 1OIQA 5JRQA 4NW6A 1SYKA 4RIXB 2UZEA 5D7AA 3F3WA 2PVMA 4JRVA 1G8AA 1Q8WA 3CQWA 1J7IA 4Z55A 3QC4A 2G15A 3RCDA 3UNKA 5LVMA 4E26A 2YDJA 3CJGA 4K1BA 3O50A 2ONLC 2DYLA 2QOOA 3R21A 3PDTA 2HAKA 5BUEA 3A7HA 3VUMA 1R78A 4BDJA 2BDJA 4IVBA 5LWNA 5FXSA 4O0UA 2OF4A 5HVYA 4FIJA 4BDIA 4TXCA 3C0GA 4ASZA 4NH1A 3GNIB 1NY3A 4IE9A 4II5A 3QGYA 3DJ7A 3MVHA 4CCBA 4UWCA 3ZSGA 4OUCA 3BHHA 2JKMA 4U8ZA 5FD2A 5KCVA 3SG8A 4GJ2A 3KQ7A 1BUHA 3NSZA 5KE0A 1PRYA 3DZOA 2Y9QA 2F9GA 3Q2JA 3P0MA 3TNPC 2QD9A 3V5TA 3W2PA 4CFFA 5HE1A 1FGIA 3SW7A 5BVOA 4AOIA 2CLQA 3ZC5A 4FNZA 3E62A 5J9LA 3U6JA 2OJJA 2UW7A 3IW6A 3KA0A 1VJYA 2RFDA 4JBVA 3DBDA 3L1SA 4XG9A 3PZHA 5CZIA 4E6QA 4EWQA 5JK3A 3FMDA 1YKRA 3GC7A 4XLVA 4CNHA 3BHUA 3OC1A 2I6LA 4F63A 2PL0A 2B9IA 2Z8CA 3ACJA 3Q96A 4ZSAA 5F1ZA 1QPCA 3SHEA 1KOAA 4TWNA 5HCXA 5BPYA 2JKOA 2PVKA 4FYOA 4A4LA 3TWJA 4YTCA 5EDRA 1TQPA 1UV5A 4FSRA 4H39A 4LL0A 3GQLA 3WYXA 4QMLA 5HD7A 3DZQA 3VS0A 3DXNA 1XBCA 3PA5A 4LMNA 4HYSA 5HVKA 3ACKA 4AFEA 5A54A 1WBTA 1WCCA 1DI8A 3UZRA 3W2SA 1WBSA 5L3AA 4KD1A 5KBQA 2XEZA 4PPBA 5HIBA 3C9WA 3I60A 4WUNA 5CAVA 1Q3WA 4U7ZA 4DC2A 1IA9A 1M14A 1FMKA 4UXQA 1PYEA 1XH6A 3D5VA 4CT2A 2PMNX 4IJ9A 2GQSA 4WNOA 1XR1A 3D2KA 4L3JA 4Q5HA 3W1FA 1Q5KA 4BCIA 4D4RA 2CPKE 3VS6A 3VF8A 3SVVA 5M07A 4F9BA 3RAKA 4EZ7A 5EDPA 5DN3A 2C68A 4R5YA 3VJNA 4D2PA 2VTOA 4X21A 4RVTA 1OL7A 2QLQA 3PJ3A 4N70A 2P2IA 4FBXA 4C57A 2RFSA 3M11A 4ACCA 2PE0A 2IG7A 4FGRA 5BVNA 5CS6A 1VR2A 5DI1A 2VO0A 2WU6A 4E73A 5KUPA 3KXNA 3A8XA 4IANA 2BHHA 3U9CA 3HECA 3PJCA 4FSNA 2J4ZA 2WELA 3ZMMA 3U55A 2XNBA 3AT4A 2QR8A 3FZPA 3HP5A 3KRRA 4L8MA 3TIYA 4O27B 4TPTA 4NIFB 4KRCA 3BIZA 5C8MA 4ACHA 4W4XA 3BGZA 3OEFX 4GT4A 3HAMA 1OGUA 3UQGA 4CYJA 3ORIA 5FBNC 5M4IA 3HNGA 3NUPA 4TWPA 3D5UA 2X39A 2X9FA 1PXNA 4GK4A 5CALA 5I5ZA 3Q53A 4DFNA 1NVQA 1YDRE 1NW1A 5HNGA 3LCKA 1XH4A 2C6IA 1U54A 4OTIA 4AXAA 4UALA 3LFNA 4AGDA 2OFVA 4TY1A 4F08A 2ITVA 3BLQA 3IW5A 2PZ5A 1H01A 1QMZA 1V0PA 4QTCA 5CENA 1OIRA 3Q4ZA 2JFMA 1WVXA 2R3PA 2R3LA 4HYHA 4O38A 3G9LX 2QG7A 1YHSA 1P14A 5D12A 3ULIA 3Q3BA 5ACBC 1HCLA 1KE7A 4FSQA 5E90A 4FG7A 5CEPA 4G34A 2OH4A 3SQQA 3OCGA 5GZAA 3F9NA 3HMNA 4I41A 2PU8A 2EU9A 2PVNA 4G3CA 2VGPA 2VWXA 4I0TA 3QRKA 5HG5A 4O81A 2WTJA 2XH5A 2WZJA 1RQQA 2WGJA 3PFQA 4YSJA 4BCJA 4FZ6A 4O7RA 2HW6A 4K11A 1Z5MA 5KBRA 1FGKA 4KA3A 4KS8A 2HIWA 4DTKA 2IO6A 2YM8A 3VUTA 2LGCA 1PXMA 2ITWA 5AUXA 2YABA 3A60A 2BIYA 3R63A 5TO8A 5J79A 3B8RA 3CPCA 4YC6A 3F6XA 3P08A 4PF4A 3KXGA 3MH0A 1SNXA 3SV0A 3TZMA 2WTIA 5CF5A 5I9VA 2CHLA 4EONA 1WAKA 3NW7A 4YZ9A 2EXEA 5J8IA 2QOKA 4AW0A 2CNVA 1YI6A 2G2FA 2QC6A 4DAWA 3CJFA 4TWCA 2Y4PA 1M52A 1H26A 1O6YA 3K3JA 4Z16A 5AWMA 3BEAA 4YPDA 1M7NA 1OZ1A 4J95A 2ZM4A 4PL3A 2XF0A 3CC6A 4DEIA 2WNTA 3ZTXA 2F57A 5LVNA 3QCSA 3KKVA 3QTXA 1K9AA 1W83A 4BGGA 4NL0A 3B2WA 3DNEA 4EH8A 2B0QA 2JDOA 3FYJX 4JVGA 3BV3A 3IG7A 2XKFA 5AP7A 3IPHA 3ZFYA 1FPUA 4CD0A 4DEAA 5AUUA 4JT3A 2F2UA 3OWJA 4QP1A 1Q97A 3UODA 2C6EA 3QXPA 4RQVA 4PY1A 3QRTA 5CX9A 3NRMA 2HXLA 3TTJA 3GU5A 5HBEA 3BYVA 3RALA 3OWLA 4JL9A 1Q62A 5E8WA 4ZSEA 2W1FA 3NWWA 2GS6A 3DV3A 5CLPA 3FMLA 4CMUA 3R1YA 4PX6A 2BZHB 4IB1A 1OL2A 2W4JA 3MY5A 4MNEB 4ZAUA 1YHVA 4RWKA 5JQ5A 2WFYA 4WHZA 3AC2A 3GBZA 1IEPA 3HA6A 4X2NA 3LFFA 3HEGA 3G51A 5K0XA 4O2PA 3U4UA 5LARA 4LFIA 2X8DA 5ANGA 4FTOA 5DG5A 4AT4A 1TKIA 3NUNA 4QP6A 5J95A 4RQKA 4MXZA 2C5OA 3PLSA 2KULA 5M55A 4XYFA 4ZZNA 2NRUA 3CCNA 4PL4A 5CSXA 4EQCA 1IASA 2R4BA 2F2CB 4LM5A 3Q6UA 4U6RA 3N51A 4R5SA 5F4NA 2IZUA 4MF1A 3TV6A 4TN6A 3SA0A 4M3QA 3OS3A 3G0EA 3RTPA 5HQ0A 3G2FA 1YQJA 5AR2A 2YIQA 2ESMA 5EW9A 5B2KA 3UZPA 5JGDA 2Z02A 3M1SA 4XV1A 3R7UA 3SXRA 2JBPA 2UZVA 4QPMA 4BDCA 3UO6A 4C4HA 1BL7A 5LMBA 3FQHA 3PWDA 2YCSA 4DEBA 4FVPA 3E87A 5EFQA 5B2LA 2YM3A 3HZTA 5EI8A 3QLGA 5IEVA 3KEXA 3HV7A 4MAOA 3PVWA 2C5YA 3Q4CA 5C27A 4GYIA 4KBAA 3JY0A 4YGAA 3FYKX 4NCTA 5E8TA 1DAYA 1YOJA 3BPRA 4FTMA 2QU6A 4X0MA 4GIHA 4LG4A 4F7SA 5L2SA 4FG9A 4N6ZA 2X2LA 2ZAZA 3NR9A 1UVRA 5IH4A 1OPJA 1OPLA 3ZS5A 4AZWA 4ZJJA 5DEYA 4AT5A 3VQHA 4ANMA 3CQEA 4CFWA 3R28A 4L00A 3RK9A 1OIUA 3BHVA 3NYXA 5AUZA 3FC1X 2C1BA 3V3VA 4K8AA 4O22A 4GVAA 4R3RA 1OI9A 3NX8A 3DAKA 3R7YA 3ULZA 5BVWA 3VULA 5DYJA 2W1GA 3LLTA 3LHJA 3Q60A 3W2RA 2QQ7A 4M8TA 1O9UA 3QZGA 2JFLA 3OT3A 1BI7A 3UJGA 2CSNA 3FLSA 4DH8A 5HX6A 4QMNA 3QTSA 2JAMA 4YZNA 5IISA 2BRNA 4KIKB 2XNNA 3QLFA 4DG0E 4WIHA 4H58A 3ZZEA 5L2QA 4DEEA 4U9AA 2BUJA 2OZAA 4NM7A 4PDOA 1VYZA 4JQEA 4K33A 2EB2A 5E91A 4YTHA 2A27A 4EOKA 4HCVA 3QGWA 3FQEA 4FIFA 5J9YA 4BKJA 5CQWA 3C1XA 3N9XA 4I5PA 1P4FA 3L8VA 4IAFA 5IPJA 3MH1A 3HV6A 4Z9LA 3MS9A 5C4KA 4HNFA 2UZDA 1JVPP 2VD5A 2WQOA 3QD0A 4QP8A 4O6EA 3TKIA 4XP3A 2GHGA 4G2FA 1KOBA 3ZRKA 2B7AA 4R3PA 4XH6A 2QLUA 1A48A 2PULA 4GL9A 3RM7A 4FEUA 4X3FB 3UVQA 2NO3A 1OVEA 5JEBA 4V0GB 3AOXA 3OVVA 4IEBA 3H9FA 3MA3A 3GUBA 1YDTE 3QTUA 3RKBA 1S9IA 3KL8A 3UTOA 4ONAA 5KMNA 1A06A 4ITJA 1DI9A 4G9RA 1ND4A 2BTSA 4QP3A 3QTIA 3CP9A 4C3FA 3TZ9A 3F69A 3HRCA 1UWJA 2H6DA 4I5MA 3AC1A 4R8QA 4U0IA 4YJRA 4M0YA 1OM1A 1YXUA 3ATSA 3QKLA 5TT7A 5ETAA 4J53A 3I81A 3EN5A 3UYSA 4QMYA 2Q83A 2J7TA 1KSWA 4A9SA 2OF2A 3O7LB 4CFNA 4GIIA 5A14A 2VTMA 5TOZA 3OW4A 3L9NA 5M56A 1ZYDA 3MJ1A 5M57A 3LFEA 5IH5A 2OIDA 4ZY6A 1E1XA 2VTNA 5CANA 1KE9A 1PHKA 4LOPA 4PNIA 4A9TA 4CRSA 5CXHA 5CSWA 4NT4A 4BC6A 1QL6A 2F49A 2ZM1A 4NW5A 3G0FA 5CU4A 4N4SA 4RVLA 3QA0A 4ENXA 5CSVA 4TYHB 5M53A 4EHVA 4MX9A 2OSCA 5B7VA 4DTAA 4BICA 4FT0A 1JBPE 2XM8A 4XJ0A 5BVFA 3ZZWA 3DU8A 4C0TA 5IA0A 4CTBA 4BKYA 3ERKA 1MRUA 3ET7A 4FIEA 1SVEA 5CAPA 5C8NA 2HCKA 4YNOA 4E5BA 4C34A 1YI4A 2R3FA 3IKAA 4RVMA 5M06A 4OAVB 1UKIA 4ZY5A 2Z7RA 5GIPE 4HYUA 3A7GA 5E8SA 2ZV2A 5CU6A 3C4CA 4X6RA 4C4GA 4DGMA 1L8TA 5E8YA 2XEYA 3TI1A 3PY3A 5FM2A 2YEXA 3CR0A 3KXZA 3RI1A 1OKZA 3KREA 4O0WA 2PK9A 4RIXA 5HNBA 1B6CB 2Q0BA 4JQ8A 5BVEA 3RAIA 4ALVA 3H3CA 3PE2A 4FUYA 4QMVA 4GU6A 4H3PA 3BX5A 4QYHA 3ZLXA 2W06A 5JZNA 3QX4A 2BILB 5CVFA 3TTIA 2YM6A 1I09A 2XRWA 4RC2A 5C1QB 4O84A 2ITQA 2J90A 3PIYA 2HOGA 1MQBA 4FODA 4FIIA 2QU5A 3RP9A 4EH5A 3OOMA 3F2AA 4GJ3A 4Y5QA 4M7IA 5CAOA 5C9CA 3PY0A 2WHBA 2GSFA 4L68A 3RNIA 1GIIA 4WUAA 1NA7A 2AC3A 5IDNA 5FQDC 3SRVB 3FY0A 3GQIA 4GFMA 1IG1A 2QHMA 1PMEA 4NTSA 4YJVA 1JLUE 4CYIA 1UU8A 3BE2A 4YHJA 3VUKA 4BVUA 3FQSA 2XIRA 3I0QA 3OXZA 4TRLA 5E7RA 4EZ5A 4CKJA 3IECA 2UZLA 2YIWA 3IW7A 5I9XA 4IAZA 4AZEA 2B53A 1BKXA 3CIKA 3VBXA 2QHNA 4G5PA 3KF7A 3OCBA 3PTGA 3RINA 5KMKA 4HPUE 3FKOA 4ZLYA 2QI8A 1F3MC 4O7ZA 3V8WA 4IX5A 4X3JA 2BRMA 4G16A 4GK2A 3HGKA 3UC3A 3VO3A 4FR4A 4UWYA 1OL1A 4WOVA 4B0GA 4D55A 3QQUA 3GI3A 1PMUA 4MEDA 1PJKA 3DAEA 3U6IA 4PP7A 1KE6A 2OJFE 3FSKA 3WF7A 2ERZE 4GMYA 3SKCA 3V51A 3V8TA 2HWPA 4AA0A 4AS0A 3PJ2A 4UEUA 2KTYA 1O6LA 4NJDA 4EQUA 4EEVA 4BBFA 4Q9ZA 3R2BA 4H3QA 4RFYA 5IDPA 2C6DA 4DT8A 3FMHA 4V01A 5HIDA 5FTGA 4B8MA 4BCGA 1XBAA 3GP0A 1FVTA 1M2QA 3R0TA 5HTIA 2QOHA 2W4OA 4U81A 3R8PA 4QMQA 1E9HA 3RWQA 3LFQA 3H9RA 5I9WA 2GQGA 3SX9A 4WSQA 5A6OA 3GB2A 3BEGA 2YM4A 4CZYB 1PY5A 2CN5A 3K5UA 5CZHA 4FKVA 4W9XA 2QOBA 4I6FA 2YN8A 3C4EA 3JR1A 2V55A 2VWVA 3ZO2A 3ORKA 3NMUF 5HI2A 4ACDA 3KULB 4LRJA 3Q32A 4I5HA 4P4CA 4RIYB 1JKKA 3VS1A 3W2QA 1CMKE 2CN8A 4C37A 2R0UA 3K5VA 2PUNA 4M84A 4MD9E 3DFCB 2XYUA 5CNNA 4FV0A 5AUWA 5TE0A 2OFUA 5LVLA 4DLIA 4R78A 4JIAA 4YJSA 3ZSIA 4I0RA 3EFKA 3DFAA 4MF0A 5DNRA 1UNHA 2ZJWA 1UNGA 3CBLA 3MJ2A 5DA3A 4FEVA 4KKGA 2WD1A 3QYWA 3V5QA 4BGQA 4NFNA 2YLFA 4NM0A 5EYKA 4N57A 4OT5A 3P86A 3G9NA 4NIFA 3UOHA 4KIPA 4BCKA 4CV9A 4FOCA 4BCFA 4EOSA 4DF3A 4FEXA 3R73A 2QR7A 4GS6A 4I92A 4S33A 4D4YA 4Q2AA 5AR3A 1ZY5A 4RX9A 4L43A 1ZMUA 3EQCA 4M13A 2WMBA 4D2TA 3LXNA 3Q2MA 3VS2A 1KV2A 3RNYA 4YURA 1WBOA 4PMSA 2YCRA 2F4JA 2IPXA 3ORTA 3OCSA 3F5GA 5AP3A 4E3CA 4ENYA 4IW0A 2HELA 4J52A 4XUFA 4R7BA 2AYPA 1AQ1A 5ANIA 4YNEA 1Q61A 3RVGA 4XBRA 2O63A 2V22A 1SNUA 5M09A 2B9FA 5EM7A 2JAVA 2GNHA 4GFGA 2B52A 3ALNA 3QCXA 3GFWA 4IIRA 4DTBA 4C4FA 3VUHA 2WTCA 2HZNA 3GCPA 2R3IA 2XZSA 2J0LA 4EBWA 1LEZA 1JQHA 3OG7A 5HE2A 1H1PA 4BIEA 4UMUA 3FEGA 3NDMA 4JG6A 1M17A 2J51A 4EL9A 4K0YA 1CSNA 3CTJA 2BDFA 2WMSA 4MCVA 3RBWA 1LEWA 1PXJA 4IDVA 2BAQA 4IC8A 5AP1A 2OJ9A 4EZ3A 4PWNA 3TKHA 4EOQA 2W9ZB 1Y57A 3ORZA 3P23A 3KFAA 4FV7A 2XM9A 4RSSA 5DIAA 4YP8A 2H8HA 4FKLA 2O5KA 3A61A 3BE9A 3KC3A 4OLIA 4RJ3A 1PXLA 4I21A 4IVAA 2YAAA 3CTQA 5AJQA 3I1AA 5AUVA 3D7TB 2PE2A 2OXYA 3WZUA 3D14A 4ID7A 4M69B 4TZRA 4U41A 3R7EA 3FI8A 4ZTNA 4PDSA 3EFLA 2BZKB 4BDDA 2PVYA 4EUUA 3HMOA 4I94A 3G6HA 4KRDA 4E6DA 4EUTA 5CEIA 3EZRA 2CCHA 1URWA 4FNWA 1DS5A 3NNWA 4MQ2A 2IZTA 5HESA 2G9XA 5GIOE 4C3RA 4I6QA 4YPSA 5A9UA 3DB6A 4KKHA 4OTPA 1Q24A 1WVYA 4FG8A 3MFTA 4ZJIA 4QMZA 3ZC6A 4FK6A 3D94A 5DHJA 3DBFA 5E1SA 3UMXA 3L9PA 4O0VA 3OUKA 4BHZA 4N0SA 4ZY4A 3EKKA 3SLSA 3TCPA 3U6HA 2C69A 4JAJA 5AP6A 3FDNA 4MXAA 4D5HA 5AAGA 4BRXA 3R04A 2C6MA 3H4JA 2I1MA 4TW9A 4WD5A 1PMNA 4X6QC 3OZ6A 4EC9A 5LWMA 2QNJA 2YACA 4JQ7A 5I4NA 3GENA 4RX8A 5IUGA 3N4UA 4DFBA 4MNEA 4RC4A 4FE2A 4IWOA 5I9YA 3MGYA 4L7FA 3CS9A 5E8ZA 4F6SA 4H1JA 5EW3A 4CQEA 1O6KA 4FSWA 4MD7E 2IVSA 2C6OA 2B4SB 4NWMA 3U51A 2ITYA 5KZIA 5CF6A 3KRWA 2BKZA 3VBWA 5GZ8A 4YHTA 1G8SA 5E8XA 2GFSA 2BROA 3NUUA 4XG7A 4WG4A 4IAYA 4NFMA 4F9YA 1W98A 2WQNA 1QPDA 3I7CA 4WKQA 5EHLA 2W0JA 3QWJA 4FZAB 1YOLA 5DH3A 4CCUA 1OB3A 2OG8A 3ETAA 4ZS0A 5HTBA 1J7UA 3EL8A 5ANOA 4E6CA 5FGKA 2BVAA 3FMJA 4FV9A 4L42A 5E8VA 3E7VA 2V0DA 4MH7A 2ETKA 2J5FA 2VNYA 5IQBA 5KMOA 3EQPA 4E1ZA 2OK1A 2WOTA 2I0YA 3EZVA 4OTWA 5JGAA 2EWAA 2V62A 5HTCA 3NPCA 4G9CA 4HGSA 3GU8A 3H30A 3ITZA 3P4KA 4NJ3A 1XKKA 4OTRA 4L44A 2VWYA 2YAKA 3ZEWA 3I79A 3Q5ZA 3R8ZA 3MFSA 5AEPA 2YZLA 2R3RA 4AOTA 3PVGA 3TJDA 3TNIA 4EOPA 3EL7A 3O8TA 3PWYA 1H1RA 3PUPA 2P4IA 5FLFA 4FT3A 4USFA 4XEYA 4F0GA 2JIIA 5ANJA 3LMGA 3QD4A 3R9HA 4EOMA 3F3VA 4IZYA 4B9DA 3FC2A 3EQGA 4IWQA 3AGLA 3E92A 5D1JA 2GTMA 3LMIA 5FTOA 4FGBA 5ICPA 3LCTA 3MTFA 4GW8A 3UMWA 5HO6A 4FTRA 4Y85A 3CE3A 1XH7A 2FVDA 3UIUA 2CKEA 4EHGA 4ITIA 4O0TA 4FV3A 4EH2A 5M44A 5H8GA 3F3UA 3R22A 4TL0A 3UVRA 3IGOA 1XJDA 1GZKA 4AT3A 2E2BA 3PPKA 4FC0A 3ZBXA 2YM7A 4DCEA 1WMKA 3COIA 4ZLOA 5JFVA 3IDBA 4WG3A 4YJPA 3NYVA 1ZOEA 3R9OA 2W4KA 3SC1A 4GU9A 2BR1A 4KIKA 5KMLA 2VTRA 2PE1A 3ALOA 3OW3A 4FV5A 2CMWA 4FNYA 4FKGA 4X2KA 3WF8A 3FLYA 3MA6A 2QONA 3DJ5A 5IA1A 3C5IA 2J5EA 2ZYBA 3QQHA 4QQ5A 4QMSA 3E93A 2OGVA 4FTTA 4MXCA 4XS2A 2UVZA 5FWKK 4BCHA 4YR8A 5JFWA 2YLEA 2JLDA 3H0ZA 3P1AA 1R0EA 3Q9YA 3T9IA 5IUHA 2ZV7A 4O82A 3VBYA 3QZIA 3WYYA 5CSHA 4ZS4A 4P5ZA 4FKUA 5GHVA 4CT1A 2OWBA 4FKTA 3V5PA 4FV8A 4M68A 4X3FA 4V0GA 3QZHA 5K4JA 4A9RA 4QTEA 2IZSA 4PTCA 1FVVA 5A4EA 3HP2A 4OGRA 5AV2A 4FTIA 5DBXA 3UOJA
chains in the Genus database with same CATH superfamily
3SOCA 3RPYA 3DXPA 4X2JA 2X81A 4F6UA 3CKXA 5CU0A 4BCPA 5HE3A 3TM0A 2RGPA 3Q52A 5AM7A 2QOCA 5DEWA 1Q4LA 3A8WA 4QYYA 3FY2A 3WIGA 2ZB0A 4DLJA 2XNPA 3M2WA 3ENHA 2PZIA 4U42A 4G17A 2C5VA 2FSTX 3UOKA 3ZONA 4CV8A 2J2IB 3QD2B 4BWKA 2QO9A 2Y6OA 3ZO3A 5LJJA 3W16A 4WNMA 1H28A 4RJ6A 3G5DA 3ZLYA 4F9CA 4JR3A 4PMTA 4D28A 2Z7QA 3HAVA 3HVCA 3AC4A 4EQMA 4E6AA 2AUHA 3C5UA 5JQ8A 5H3QA 5HLWA 4O91A 1OUKA 4AW5A 4TYHA 2QO7A 4GUEA 4ERWA 4PMPA 3KN6A 3TKUA 1Z9XA 4YJUA 3E5AA 4FL1A 3G90X 5I3OA 4BDHA 3G33A 2YIRA 3FLWA 3QUDA 4D0WA 1K2PA 5B0XA 3ORLA 4F1TA 2UZUE 2XK3A 4PV0A 5LOHA 4LL5A 3W2CA 4BF2A 4MBLA 2XIZA 4ZXTA 1X8BA 2O64A 4IAAA 3NUSA 3RHXA 3ENMA 5C03A 3A7JA 4AFJA 4PRJA 1NVRA 3PJ8A 1Q8UA 3MBLA 4WRSA 4E4NA 4A9UA 3C4WA 3ZBFA 5BMSA 4AG8A 3MIYA 3D83A 3MFRA 4AACA 3GCUA 3M42A 4RLLA 1ZZ2A 4G31A 4RRVA 5CWZA 2HWOA 4ZTSA 2UZNA 4IXPA 3IGGA 4PL5A 4APCA 3ZUVA 2XRUA 3FL5A 2YIYA 4AA5A 4G3EA 3DQWA 4ASXA 3AXWA 3MN3A 2W7XA 3A7IA 1H4LA 3LE6A 4IFGA 3L9MA 3KB7A 4EI4A 1BI8A 1GY3A 1IRKA 1OL6A 4ZMFA 4CFMA 3GFEA 4FI1A 2ACXA 2BIKB 4LV5A 4JIKA 4QQCA 4QQTA 3DCVA 3VJOA 5CEMA 5LMKC 4YZCA 2XKEA 3II5A 4GK3A 4F7JA 2WO6A 4EK5A 1FBNA 2P0CA 3EN9A 2J0MB 5CVGA 2WTVA 5AFVA 4WO5A 3SRVA 4UYAA 4XOYA 5C01A 4CFXA 2F7XE 2O65A 5FDPA 1SM2A 3EWHA 3LJ1A 4RJ7A 4UN0C 4Y5HA 1T46A 3QTQA 3DLSA 3KU2A 2BZJA 4O7YA 3SG9A 2XNEA 4BTJA 2XJ1A 3JPVA 2CKQA 1FVRA 1A9UA 3RZBA 2PMIA 3TG1A 1K3AA 5AMNA 4G1WA 3SW4A 4IC7A 4OTGA 1SVHA 3BGQA 1REJA 2I0EA 2PHKA 4YTIA 5CYIA 3BYUA 4I3ZA 3HL7A 2OJIA 4EH3A 3PXRA 5CASA 5M4FA 2QO2A 2QG5A 2HZ4A 4S34A 3BQRA 1Q99A 4FEWA 2ITTA 3EQDA 5GJGA 3DKGA 3R71A 2W9FB 2GHMA 4DEDA 4FL3A 3UYTA 3DK3A 4EHZA 4XRLA 4OBOA 3OROA 3LW0A 4FKQA 1FMOE 4C62A 3A7FA 4Y8DA 3ZFMA 3PG3A 5I9UA 1JKTA 4RIOA 1ZYSA 4FIHA 3TJCA 4BTFA 5IQAA 5TF9A 2XVDA 4DA5A 4HJOA 2E9UA 4ACMA 4PTGA 3ZDIA 2PZYA 3LJ2A 3LAUA 3OTUA 4TNDA 4MYGA 2XK4A 3QALE 2OH0E 1G8JA 3AKKA 4RWIA 1VYWA 1V0BA 2XJ2A 4FT5A 4U45A 3NS9A 1GJOA 4U44A 4TYJA 3NNXA 4U97A 3LOKA 3QBNA 4F70A 3BL9A 5E4HA 2CJMA 3V5JA 4S2ZA 3QRJA 3PXFA 3EQHA 2R3KA 4TYEA 1PXOA 2GTNA 4TNBA 4O7VA 3CD3A 2ITXA 4JOAA 4QT1A 3GVUA 5GNKA 2PWLA 3KULA 3ZH8A 4RIYA 4B7TA 2OO8X 2A2AA 3OOGA 5AUTA 2IVTA 2V7AA 3C4XA 4UWBA 1J91A 1OKYA 2I40A 4UV0A 3JVRA 4G3DA 3KK8A 3QRIA 3QWKA 5HGIA 4B8LA 2ZFYA 5HO7A 4O1PA 4XP2A 5ETCA 4ZZMA 5EM5A 3DLZA 5J87A 4KSQA 3BHYA 3LKMA 2CDZA 2VO7A 3BHTA 3LM0A 3AD5A 1WBNA 2XB7A 5DR2A 2VWIA 2UW9A 4W8DA 4JBPA 5ETFA 2WTKC 2WAJA 4I93A 4D9TA 3DS6A 3P7CA 2R3NA 3KMMA 5CTPA 1TQIA 4PNKA 1S9JA 4YJNA 4IX6A 3VVHA 2VAGA 3R9RA 3TL8A 4IH8A 4IQ6A 5AX9A 1WZYA 2FSMX 3P78A 4FTQA 3FPMA 4HZSA 4FV1A 3RPRA 3I6WA 3V04A 1J3HA 4MHAA 3NNVA 3MI9A 4M15A 2XCHA 4MQ1A 3DK6A 4ZTRA 4YLLA 3U8WA 3KCKA 1QPJA 2VTLA 2YWPA 3TNQB 1OKWA 4RJ8A 5EK7A 5LXMA 4CFUA 5K5XA 4L9IA 3C50A 5AV3A 2RG5A 1STCE 4NU1A 3R7OA 3QUPA 2WIHA 3EQFA 2JITA 4EK3A 3W33A 3ZSHA 3W55A 5BVKA 4DITA 2ZV9A 3TNHA 4G3GA 1YOMA 2FO0A 1OMWA 4CZUA 2JC6A 3F7ZA 4H1MA 3SXFA 4ZMEA 2BZIB 2X7OA 1YWVA 2RKUA 3DTWA 5DVRA 4MVFA 5T3QA 4IM3A 4F64A 1JPAA 4WNKA 4Z7GA 4AE9A 5E9EA 3GGFA 1YWRA 2C6KA 3RMFA 4DH5A 1YXXA 3F3ZA 3HA8A 3MPTA 4FRFA 4CLJA 5KMIA 4QP7A 2OI4X 4W4VA 2X8IA 3EN4A 1P4OA 2R5TA 3GU7A 3LFAA 4QMMA 5A3XA 2QOQA 2W5BA 4BZOA 4QEBA 2GQRA 4F65A 2W1IA 4J71A 3I4BA 5FEDA 3WE4A 2CKOA 4YSMA 4RFMA 3FMEA 4EK6A 4M0ZA 2CNUA 5IEXA 5TR6A 4D4VA 4HVIA 4UZHA 4ZTLA 3NYOA 4IX4A 4D1ZA 2I7QA 4KSPA 4L45A 5BYLA 3P9JA 3PZEA 2UZOA 5AA9A 3Q6WA 3AG9A 4ZZOA 3D7TA 2UUEA 4KKEA 4QOXA 4F7NA 4EOLA 3ZO4A 3RPOA 4M69A 2XYNA 1EH4A 4DBXA 4F9WA 3MFUA 1WBVA 3EH9A 3HX4A 3CQUA 1PXPA 3NW5A 5HG8A 2VTPA 3TDVA 4OTQA 3WI6A 3DXQA 3PVUA 4F7LA 1XO2B 5HO8A 5IUIA 4D2RA 1MRYA 4DCAA 2J0JA 4Q5EA 3KRLA 4IBMA 3W0NA 4AZVA 5IQFA 4NKSA 2CCIA 2GS7A 3CTHA 3K3IA 3NEWA 3QFVA 5J7BA 4GVJA 5JRSA 1ZARA 2ZOQA 4CQGA 4C8BA 1VZOA 2OXDA 4YC3A 5AV4A 5FXRA 2PUUA 3W8QA 2JKQA 4QYEA 5EQYA 3VQUA 1OIYA 2W1ZA 5L2TA 5EOBA 3E8DA 4I6BA 3UPXA 4GT5A 3KVWA 2WEIA 5CQUA 3WBLA 2YA9A 3QHRA 1GZOA 3GC0A 2WQBA 3R7GA 1XH8A 5DFPA 1XH5A 3VF9A 4YU2A 3QZFA 3PPJA 1UU7A 3O8PA 5BNJA 5HG7A 3FLNC 3BCEA 2CGWA 2UW6A 2P33A 2XNMA 2X0OA 3FZOA 3T9TA 4FKJA 2IVUA 2V7OA 3E3PA 4LGDA 3DBQA 2VZ6A 3DTCA 3G6GA 3UE4A 3C4FA 5L2IA 5IA3A 2HK5A 3UIBA 2FSLX 3ZLSA 4FVQA 3TUDA 5AP2A 1ZWSA 4OTDA 5HU9A 5HZNA 4RX7A 2JDVA 1Y91A 4EOJA 2WMRA 5C26A 1R1WA 2WMAA 3DOGA 5KX8A 2BRHA 4JBOA 3VUDA 2C5XA 4MXYA 2VTJA 3NVMB 1PW2A 3VHEA 3ZOSA 4C59A 1Y8YA 3QXOA 3TDWA 3QCQA 1ZAOA 3TEIA 5E92A 4O7SA 4KIQA 4QMXA 5EQPA 4ARKA 4V05A 3UDSA 1GIHA 1JAMA 1YRPA 4IVDA 3D9VA 4O7LA 2XNGA 4GUBA 4C35A 2LAVA 2IW8A 1RDQE 3SOAA 3D7ZA 2CNQA 4O86A 4E4XA 4FIGA 4ACGA 3QKMA 3EIDA 2EUFB 3OXIA 2BALA 4RGJA 5FEEA 4CG9A 3ODYX 4E5WA 5M08A 3R9DA 1ZYJA 5HVJA 5L8JA 3BRBA 1XQZA 3R1SA 4LUDA 3GEQA 1UKHA 3ZCLA 1KE5A 2IWIA 5CI6A 4GG7A 4F9AA 4PP9A 4Y73A 5B2MA 5AM6A 4EOOA 4CGAA 5J1VA 4OT6A 2XS0A 4G6LA 4KBKA 3V5LA 4C02A 4D0XA 2W1EA 2XUUA 1AGWA 2PMOX 4KAOA 2H9VA 4OW8A 4XRJA 3NZ0A 2HXQA 3F82A 4PPCA 3P79A 3ZUUA 4M67A 1YI3A 4RIWB 3R8VA 4HVDA 2NRYA 2PZRA 2VGOA 1GNGA 2P55A 2ONLA 4UMTA 3R1NA 3TV4A 4AUAA 3QKKA 5EOLA 4IFCA 4BFMA 2WMTA 4NTTA 4MNFA 3DJ6A 4ASEA 5K4IA 3C7QA 2OICA 3FWQA 4AAYA 4D1SA 4O83A 3S3IA 4CTCA 5KHWA 4C38A 4NSTA 5GZ9A 4IWPA 5LCKA 4ANNA 2GNIA 2WTWA 2E9PA 3IO7A 4MK0A 5EKOA 3D0EA 2X0GA 3HLLA 3H0YA 3S95A 1U46A 4YZDA 5CT0A 4F0IA 4DFLA 4X7QA 2WU7A 3IDCA 2HZIA 1BX6A 4FTJA 5HX8A 3PP0A 4XMOA 3R8MA 3UG2A 4FKRA 2WMVA 4XP0A 4CSVA 2RSVA 4FTCA 4S30A 1KUTA 3O2MA 4U5JA 3QA8A 3MB6A 3WILA 3GOKA 4CEGA 4F4PA 2WKMA 3LCSA 2GDOA 4GFOA 5LVPA 4U3YA 2OKRA 4QD6A 2YDIA 4BB4A 2EB3A 5KKRC 4L3PA 3IONA 2O2UA 4HGEA 1YXTA 3DK7A 3OWKA 4FV2A 1T45A 5H9BA 1SMHA 4CVAA 4C7TA 1ZY4A 3MH3A 3KF4A 2J0KA 3AMBA 3PA3A 3BBTB 3LFDA 5CT7A 3EB0A 2J6MA 4C2WA 4M14A 2XP2A 2VO3A 3LVPA 2W1DA 4XV2A 2JDSA 2WTDA 4ANLA 4IADA 4P2KA 5CVHA 4L52A 2AC5A 2WMXA 5KZ0A 2J0IA 3FE3A 4G3FA 4P5QA 4BTKA 3EHAA 4JX3A 3UC4A 5L4QA 2FA2A 3TXOA 3NW6A 4ANQA 1HCKA 4F99A 1W2FA 4IVCA 2YCQA 4RPVA 2A98A 4I24A 2Y7JA 4DGOA 5EM8A 3W0PA 3ANRA 3F3TA 2C3LA 3PG1A 4FNXA 4RJ5A 4DGNA 3MPMA 1UA2A 3F88A 1H25A 2XIYA 3U9NA 3VAPA 2XK7A 4A4XA 4EKLA 1H08A 4BDFA 4IAKA 2R9SA 3CEKA 4YJQA 3UIXA 1Q8ZA 4YHFA 2GPHA 2XIKA 3ELJA 4G6NA 3VBTA 4A4OA 2BDWA 5J9ZA 5ACKA 4L7SA 4R7HA 5IQEA 2DWBA 1HOWA 2Y4IC 3DGKA 3PPZA 3O0GA 5CF4A 2QURA 4J1RA 2XA4A 3V6SA 4B6LA 4I22A 3Q4TA 3COKA 4D9UA 3IK3A 2A4LA 1M7QA 4J8MA 2NP8A 3ZDUA 1Z57A 4EYJA 3AC8A 5M4CA 2BAJA 4MUQA 3QHWA 4ZTQA 3EQIA 2PSQA 2PVRA 3D2IA 5KKRB 4MXXA 1ZRZA 4EK4A 3DDQA 3WF9A 4EK8A 4DN5A 4BN1A 4MWIA 5M51A 4UB7A 4EKKA 3BU3A 4MBIA 2HENA 2QKRA 1KV1A 5FP5A 3KMWA 3PSCA 1IAHA 5JSMA 3P7AA 1JWHA 3R02A 4FKWA 3WIKA 4A9YA 4XV9A 5EW8A 4HOKA 5DR6A 2O3PA 3ID6C 5D9HA 4AA4A 4E4LA 5A6NA 3HUCA 3EMGA 3EQBA 3AC3A 1JSVA 4O0YA 3UO4A 4BDKA 2SRCA 3ORPA 4FMQA 5AV0A 1OL5A 5FBOA 1SZMA 3OY3A 5LMAA 4ALUA 2Y0AA 4ZTHA 5I3RA 4JI9A 3ZHPC 2DS1A 3R6XA 4B99A 5AV1A 1ZMVA 3TIZA 3VUIA 4FJVA 4LRKA 3FXXA 4ZP5A 4KUJA 1WVWA 3FZSA 4DFZE 4DG3E 3KCFA 4RT7A 5A4QA 4EH7A 2OW3A 3FI2A 2R64A 4RLKA 3QTWA 3VC4A 4HCUA 1CKIA 4C3PA 2PVJA 3LCDA 4AWIA 4CKRA 2PVHA 3PSDA 2VV9A 4HNIA 5TKDA 2VTHA 4H36A 1I44A 2R2PA 4G5JA 1GOLA 3MTLA 3ROYA 5DLSA 4ALWA 5IQIA 1TVOA 2B54A 4ZLZA 3T8OA 2C6TA 4LGHA 3C0HA 2YISA 1ATPE 3FI3A 1QCFA 2ITPA 3EQRA 5C4LA 3ZLWA 1H8FA 3IOPA 2YDKA 4AQCA 3GU6A 2X0QA 4E5AX 4KIOA 5IA2A 2BPMA 4ZTMA 2VTAA 2WIPA 2J9MA 3D5WA 3BU5A 3GCVA 4BZNA 3IW8A 3TYKA 5IU2A 5IQDA 3TUCA 3BBWA 4RBLA 3WE8A 4U80A 1U4DA 3ZXTA 1AD5A 4O96A 4J96A 4I23A 4QTAA 4YMJA 5LMKA 4JXFA 1M2PA 2VNWA 4FUXA 2B1PA 3WZEA 3BZ3A 3JYAA 2Z7SA 2O8YA 1UU3A 2ETRA 1NVSA 3COMA 4UMPA 3LMHA 4PDPA 3LQ5A 5K0KA 3C4ZA 2G1TA 2GNFA 2A0CX 2UVXA 4RC3A 4YZMA 5EHOA 2IN6A 3FSFA 3D15A 4XX9A 4F1OA 1U5RA 2R3HA 3HMMA 3Q04A 4WG5A 2ZMDA 2ITUA 2R3OA 4LV8A 5M4UA 3NUYA 4KWPA 5BQ0A 3R9NA 4L3LA 3ZUTA 4M12A 5HBHA 2X4FA 4H3BA 5CEOA 3DBCA 3PRIA 4HCTA 1F5QA 2IW9A 3F5UA 5EQEA 5BUJA 4AZFA 4OR5A 4F09A 4FV6A 2F7EE 3E8NA 5KNJA 3MW1A 1Y8GA 5IZFA 3BYSA 3DKFA 3EFWA 4OBQA 3VW8A 4JR7A 4DFUA 3EFJA 4RMZA 3JUHA 3TACA 2G01A 3AT2A 3ML1A 2C0OA 3OEZA 2GS2A 3SDJA 4QMPA 2ZM3A 1J7LA 3DAJA 4ZSJA 4BI2A 1VLRA 4KB8A 2ZMCA 4ANBA 4ORKA 3BI6A 4C58A 4FT9A 5T6KA 3PE1A 1BYGA 3PSBA 3RM6A 5G1XA 3R01A 3ZM9A 3FZTA 5D41A 3PXZA 2NNWB 5EYCA 1L3RE 2XK9A 3HRBA 5AIKA 3VS3A 4E4MA 4ERKA 3EOCA 2VU3A 2C1AA 1H0VA 4OTHA 4FSTA 1TQMA 1YVJA 2JDTA 3HV3A 3FMMA 4GT3A 3V01A 4CXAA 3OY1A 4GEOA 3OCTA 2ERKA 1ZYLA 2PZPA 2HYYA 4JLCA 5CF8A 3MIAA 3I5ZA 2C0IA 4DINA 5FG8A 2WXVA 5AIRA 2J50A 4R1VA 3A4OX 5CU2A 1KE8A 3UNZA 3WZJA 4XG2A 3R7IA 3S00A 3BLHA 2AEGA 4K18A 2G2HA 5IA4A 3FKLA 3Q9XA 4O0SA 4ZIMA 3RPSA 3MDYA 5EDQA 1GZNA 3KMUA 4AZSA 5CAQA 4EWHA 4BKZA 4O4DA 2R3MA 4MWHA 4IHPA 4XLIA 5IQGA 3U87A 5EI2A 2ITNA 4NEUA 4P7EA 3C13A 3R2YA 4IACA 4WBOA 1KWPA 3R1QA 4DFYA 4FX3A 5AA8A 2IVVA 3DY7A 3KY2A 4LI5A 4D58A 4CRLA 4ASDA 3O71A 4LQMA 1ZXEA 4LOOA 4R7IA 3NAYA 2B9JA 2A1AB 3F7WA 2BAKA 2C3KA 4AGUA 4D2WA 2VX1A 1LR4A 4AW1A 3MY1A 3ZEPA 3HV5A 4JNWA 3KK9A 5CU3A 4HGTA 1H07A 3D5XA 1JKSA 2UZBA 3AMYA 2W05A 4AN3A 4FK3A 3MSSA 1G5SA 4RVKA 2IJMA 4X2GA 4UX9A 1OITA 3BV2A 4AN2A 3ZFXA 4J8NA 5ANKA 4JG7A 3LFBA 2VRXA 4YO6A 3FXZA 3O8UA 3UBDA 3VRZA 3HMPA 3BYMA 1JSTA 3GT8A 3O7LD 3OT8A 3RK7A 5AR4A 3OWPA 4YZBA 5L6WL 1YXSA 3OTVA 5HCYA 3DNDA 4YC8A 1J1CA 4L53A 3O51A 4R6VA 1Y6AA 3R8UA 3W8LA 4JAIA 2R7IA 4AOJA 4IJPA 2VWBA 3RAHA 3S2PA 5HKMA 4WSYA 2GNJA 5BX0A 3G15A 5E8UA 5D10A 2ETMA 2I0VA 4FL2A 2X7GA 4AP7A 4XG6A 4OAUC 2Y8OA 2OU7A 5HOAA 4JDJA 2RIOA 3Q4UA 3PVBA 3PXQA 1YDSE 4FZ7A 2YJRA 3GXLA 3I5NA 3R00A 3RCJA 3F5PA 2XNOA 4OTFA 3IDPA 4FTAA 2EXCX 1Q41A 4QMUA 3ROCA 3LZBA 4Y83A 4BI1A 3DQXA 4H05A 3H9OA 2BMCA 2UW4A 4L67A 2OIBA 4RG0A 3S1HA 4IZ5A 3DB8A 4YBKA 1U59A 3MWUA 3I7BA 3VW6A 4CMTA 4BDAA 4LUEA 5CAUA 5HU3A 3QQLA 1CTPE 2BHEA 3QUEA 3ATTA 5HEZA 4HVSA 4BJJB 4BHNA 3MB7A 4O4FA 4QDEA 3JY9A 3MH2A 1H0WA 5AX3A 2HZ0A 3QX2A 2FYSA 1H1WA 3MV5A 4MXOA 4UZDA 4XV3A 3UQCA 3NCZA 3TUBA 4O1OA 4Y46A 3DBEA 3MPAA 2W17A 3IW4A 4RX5A 4HPTE 3KGAA 2NPQA 4HVGA 3E3BX 1YWNA 2H34A 3EJ1A 1OUYA 3NIEA 3PY1A 5DWRA 3UGCA 1ZOGA 5FEQA 1WBPA 4EJNA 3EKNA 4C4EA 3PP1A 4LOQA 3PFYA 3S4QA 3LIJA 5DR9A 5EKNA 5CEKA 3NUAA 3AQVA 3NNUA 3BQCA 3QRUA 2VWZA 2R0IA 2W99B 2PY3A 3POOA 2BRBA 5F20A 4RWJA 3OXTA 4BL1A 5JT2A 1JOWB 3F2NA 1ZOHA 4O2ZA 4W8EA 4R77A 3VBQA 3TNWA 5IF1A 1V1KA 4OBPA 5K3YA 4RIWA 3NVKI 4KNBA 3LXKA 5E1EA 1DM2A 2ITZA 4YUQA 2CKPA 4JMQA 4WT6A 2HY81 3Q5IA 1YHWA 4RWLA 4YLJA 3NLBA 3OUNB 3VN9A 4BIDA 5IMEA 3I6UA 1OECA 3K54A 3K2LA 3A62A 4FKSA 5IG1A 5T68A 3C0IA 5JZJA 4YLKA 3VHKA 2BRGA 3PJ1A 2C3IB 4FSMA 5K5NA 3FHIA 3L8XA 3THBA 2WQEA 3OBGA 2FUMA 4K9YA 3BU6A 2HW7A 5BVDA 5DPVA 1MUOA 1XWSA 3HMIA 3UVPA 4BWXA 3VUGA 3FHRA 3QF9A 1XBBA 4WRGA 3PLAE 4RA4A 4PTEA 2XCKA 3KIOC 2C30A 1PMVA 2ZDUA 3CGOA 4E7WA 5IMXA 3MYGA 3OF0A 3REPA 4K6ZA 4IWDA 3AD6A 4RFZA 5DRDA 5J7HA 2PVLA 1JKLA 5L8LA 2YIXA 4TYGA 4ZJVA 2I0HA 5J1WA 4BCMA 4F6WA 4RZVA 2REIA 2C47A 2E9NA 3QAME 4FZDB 5LVOA 1RW8A 1OBDA 3TZ7A 2EVAA 4IB0A 4C4IA 4KS7A 4AX8A 4O4BB 4QRCA 4LDTA 3SXSA 2OLCA 5HBJA 1FINA 4TYIA 2QOLA 2Z7LA 2QODA 4KBCA 3UG1A 4R1YA 2DUVA 4GYGA 4MKCA 3RZFA 3OD6X 4BR3A 1W0XC 1MQ4A 3T3VA 2X6DA 4U43A 3MY0A 3UP2A 2XKDA 3A99A 1YXVA 3LQ3A 4QP4A 4DBNA 4X3FC 4WA9A 3DA6A 2DQ7X 1YW2A 4Q9SA 3FV8A 3E88A 3DT1A 4UMQA 4XCUA 4AN9A 5JFSA 4FYNA 4J98A 3GC9A 5HE0A 4Z3VA 3NIZA 2JIVA 4C61A 3FMKA 5D7VA 5JMSA 3PA4A 4YO4A 4FTUA 1URCA 1V0OA 2WEVA 3QQJA 3LM5A 5L8KA 5CXZA 3E7OA 1WFCA 3CXWA 3EN7A 4FTKA 4MBJA 3ORNA 3PRFA 4PMMA 4QMTA 1SVGA 5GINE 2UW3A 4A06A 1PYXA 5H2UA 3FZ1A 3E8EA 2BFYA 4DHIB 5HHWA 4FSUA 4EHEA 3ZM4A 3E8CA 2O0UA 3JS2A 4LMUA 3FXWA 4IX3A 2WTKB 4J99A 3W18A 3ZO1A 3UP7A 4AZTA 2W5HA 4EORA 3O17A 3RAWA 5JH6A 2VX3A 5I9ZA 3QQGA 2JBOA 3LQ8A 5HG9A 3BWFA 5HLNA 2QOIA 4FOBA 3CY2A 2C4GA 3NGAA 3ZRLA 2IZRA 2VO6A 3VIDA 4ANSA 3HDMA 4QYFA 2VTIA 3DKCA 1W84A 1F0QA 2RG6A 4IM0A 4J97A 1B39A 1UWHA 2GMXA 4I0SA 2E9OA 2X2KA 4XG3A 1P5EA 1XH9A 2CGUA 4GKIA 4DHJA 4FTNA 5EHYA 4JDKA 3LFSA 2V5QA 2X1NA 4O7NA 3LJ0A 4BCOA 5A4LA 5D11A 4BYIA 2XIXA 4CLIA 3UPZA 5JKGA 3LCOA 5AAEA 3KRXA 3WF6A 3BELA 3MESA 3HKOA 4S31A 2VTSA 3FLQA 3N4VA 1QPEA 5CI7A 3GC8A 2OZOA 3HUBA 5ITAA 2CLXA 2VTTA 2Y6MA 1BMKA 5DGZA 2R3JA 3COHA 3OHTA 4FSZA 3W32A 5FP6A 4J7BA 4FTLA 4IB3A 2JIUA 4NM3A 3KVXA 4ZEGA 2UZWE 2WB8A 2VUWA 2R3QA 2XBAA 3WOWA 4XG8A 4EBVA 4R3CA 3OP5A 4U79A 5ANDA 2YM5A 3ZYAA 4I6HA 4DE4A 5I0BA 3QQKA 1GAGA 4UMRA 3A4PA 3PYYA 1PXIA 2AQXA 4XHKB 4CZTA 2B9HA 4I4FA 4O0XA 1UNLA 2OBJA 4I5CA 4BGHA 4AU8A 1JSUA 4C2VA 1IA8A 3OBJA 1RJBA 3VBVA 2RF9A 3VRYA 3RWPA 5F95A 2YHVA 1WBWA 4GSBA 5AR7A 3TT0A 4FICA 3VS5A 4W9WA 4BCNA 2PYWA 3BWJA 3Q9ZA 3R8LA 2FGIA 4PPAA 4ZK5A 3SAYA 3DPKA 3TN8A 1U54B 3ANQA 3UOLA 2YITA 5LQFA 5DMZA 3I0OA 4NUSA 4XNEA 4BWPA 2PMLX 3MVMA 4EYMA 4QDVA 4DGLC 2YJSA 5HIEA 2CGXA 4AGWA 4AE6A 2RFEA 1H1QA 2JEDA 4W4WA 1PKGA 5BMMA 5J5TA 4GKHA 4K2RA 2QVSE 2XJ0A 4B4LA 2OIQA 1BLXA 3QCYA 5FDXA 4A07A 4FF8A 4WNPA 3VNTA 5ANEA 5KO1A 1W7HA 3C51A 4YBJA 5HD4A 3JXWA 3O96A 5DE2A 4M66A 2YZAA 3POZA 3NCGA 4I4EA 5EM6A 5A4TA 4YJTA 4IZAA 4O6LA 4ANOA 4X2FA 3KXXA 4QYGA 2VWWA 1LPUA 4IMYA 3IOKA 2R7BA 4DYMA 2GCDA 2B55A 5HICA 1CKPA 4FT7A 3UNJA 2FH9A 1UU9A 1LP4A 3QQFA 3AGMA 3GU4A 3RHKA 4LYNA 4YJOA 4K77A 3VS4A 3KRJA 3E63A 2C3JA 2XBJA 3BKBA 3QTZA 4HVHA 3FJQE 4RJ4A 5FUTA 3DDPA 3QL8A 4N6YA 4DG2E 4QP9A 3LFCA 2RFNA 4JDHA 2WMUA 4DFXE 4PDYA 3W0SA 2WOUA 1RE8A 3VS7A 4DEHA 4D5KA 2ITOA 2JD5A 4FSYA 3PIXA 4BI0A 2C5NA 2X6EA 2UV2A 4BTMA 2BCJA 3BLRA 1G3NA 4TWOA 1REKA 2XKCA 3AMAA 2PVFA 4GV1A 5BYYA 5JN2A 4KINA 4TKSA 2QOFA 2VN9A 3FMNA 3H10A 4UBAA 3UDBA 5IA5A 5DT0A 2VX0A 2ZB1A 4Z7HA 3LXPA 3DKOA 2GFCA 5AP0A 3RK5A 4E93A 2WMWA 3CD8A 4DGGA 5HNIX 2W1CA 1M2RA 4MD8E 1PF8A 2ZV8A 3FZRA 2Q0NA 2H96A 2GNGA 2VWUA 3A2CA 2XMYA 3RGFA 2X9EA 3U4WA 5FRIA 4O0RA 4RZWA 4EH9A 5KHXA 3B2TA 3L8SA 3FAAA 2JGZA 1W8CA 2FB8A 1Q8YA