4AAIA

Thermostable protein from hyperthermophilic virus ssv-rh
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
MVESKKIAKKKTTLAFDEDVYHTLKLVSVYLNRDMTEIIEEAVVMWLIQNKEKLPNELKPKIDEISKRFFPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of E73 from a Hyperthermophilic Archaeal Virus Identify the "Rh3" Domain, an Elaborated Ribbon-Helix- Helix Motif Involved in DNA Recognition.
pubmed doi rcsb
source organism Sulfolobus virus ragged hills
molecule tags Viral protein
molecule keywords ORF E73
total genus 16
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.150 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 4aaiA01
4AAIA
chains in the Genus database with same CATH superfamily
2WVCA 2HZAA 1Q5VA 3IR7A 4MJWA 4AAIA 2HZVA 2K1OA 2CKWA 1QTGA 1SH3A 2WK4A 1ARRA 3NAHA 2K9IA 1U9PA 4LRVA 2BJ8A 3GXQA 2WVBA 2WVDA 1OHNA 4D8JA 1IRQA 1OG7A 2KKEA 2ADLA 2KELA 4NRTA 2H3AA 2K5JA 3LGHA 2GPEA 4O4RA 3UQSA 2BSQE 2AN7A 1SH2A 2RBFA 2BJ3A 2UUTA 3QIDA 2WVFA 2BNWA 3UPFA 2AY0A 1Q16A 1SH0A 3NNEA 3H5XA 4LQ9A 2BNZA 4FXEA 2CAXA 1X93A 2Q2KA 1MYKA 3SFGA 2BA3A 1NLAA 2JXIA 1MNTA 2B43A 4ME7E 2CPGA 2KOEA 4LQ3A 2K29A 3VEAA 2A2BA 1BAZA 3FMTA 1P94A 2WVEA 3NAIA 4HV0A 3LJPA 3H5YA 3FT7A 4NRUA 1PARA 2JXGA 2UUWA 2CA9A 2BJ7A 3H87C 3QOQA 2JBVA 2CAJA 4QPXA 1BDTA 3SFUA 1EA4A 1BDVA 3VEBA 2BJ9A 1ARQA 1B01A 2K6LA 3UR0A 3BSOA 1SIWA 1MYLA 3NO7A 2JXHA 2H1OE 3G5OA 2BJ1A 3BSNA 3VW4A 3OD2A 2CADA 1B28A
chains in the Genus database with same CATH topology
2H3AA 4NRUA 3SFGA 2UUWA 3IR7A 2JBVA 4MJWA 4O4RA 2B43A 3UQSA 4AAIA 4QPXA 2KOEA 3SFUA 4LQ3A 2AN7A 1SH2A 2CKWA 2UUTA 3QIDA 1SH3A 2A2BA 3UR0A 3BSOA 1SIWA 2WK4A 3NAHA 3NO7A 4LRVA 3UPFA 1Q16A 3G5OA 1SH0A 1OHNA 3NNEA 4LQ9A 3BSNA 3H5XA 1OG7A 2KKEA 3NAIA 2ADLA 2Q2KA 4NRTA 3LJPA 3H5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AAI A; 
#chains in the Genus database with same CATH topology
 2WVC A;  2HZA A;  1Q5V A;  3IR7 A;  4MJW A;  4AAI A;  2HZV A;  2K1O A;  2CKW A;  1QTG A;  1SH3 A;  2WK4 A;  1ARR A;  3NAH A;  2K9I A;  1U9P A;  4LRV A;  2BJ8 A;  3GXQ A;  2WVB A;  2WVD A;  1OHN A;  4D8J A;  1IRQ A;  1OG7 A;  2KKE A;  2ADL A;  2KEL A;  4NRT A;  2H3A A;  2K5J A;  3LGH A;  2GPE A;  4O4R A;  3UQS A;  2BSQ E;  2AN7 A;  1SH2 A;  2RBF A;  2BJ3 A;  2UUT A;  3QID A;  2WVF A;  2BNW A;  3UPF A;  2AY0 A;  1Q16 A;  1SH0 A;  3NNE A;  3H5X A;  4LQ9 A;  2BNZ A;  4FXE A;  2CAX A;  1X93 A;  2Q2K A;  1MYK A;  3SFG A;  2BA3 A;  1NLA A;  2JXI A;  1MNT A;  2B43 A;  4ME7 E;  2CPG A;  2KOE A;  4LQ3 A;  2K29 A;  3VEA A;  2A2B A;  1BAZ A;  3FMT A;  1P94 A;  2WVE A;  3NAI A;  4HV0 A;  3LJP A;  3H5Y A;  3FT7 A;  4NRU A;  1PAR A;  2JXG A;  2UUW A;  2CA9 A;  2BJ7 A;  3H87 C;  3QOQ A;  2JBV A;  2CAJ A;  4QPX A;  1BDT A;  3SFU A;  1EA4 A;  1BDV A;  3VEB A;  2BJ9 A;  1ARQ A;  1B01 A;  2K6L A;  3UR0 A;  3BSO A;  1SIW A;  1MYL A;  3NO7 A;  2JXH A;  2H1O E;  3G5O A;  2BJ1 A;  3BSN A;  3VW4 A;  3OD2 A;  2CAD A;  1B28 A; 
#chains in the Genus database with same CATH homology
 2H3A A;  4NRU A;  3SFG A;  2UUW A;  3IR7 A;  2JBV A;  4MJW A;  4O4R A;  2B43 A;  3UQS A;  4AAI A;  4QPX A;  2KOE A;  3SFU A;  4LQ3 A;  2AN7 A;  1SH2 A;  2CKW A;  2UUT A;  3QID A;  1SH3 A;  2A2B A;  3UR0 A;  3BSO A;  1SIW A;  2WK4 A;  3NAH A;  3NO7 A;  4LRV A;  3UPF A;  1Q16 A;  3G5O A;  1SH0 A;  1OHN A;  3NNE A;  4LQ9 A;  3BSN A;  3H5X A;  1OG7 A;  2KKE A;  3NAI A;  2ADL A;  2Q2K A;  4NRT A;  3LJP A;  3H5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...