4AAIA

Thermostable protein from hyperthermophilic virus ssv-rh
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
MVESKKIAKKKTTLAFDEDVYHTLKLVSVYLNRDMTEIIEEAVVMWLIQNKEKLPNELKPKIDEISKRFFPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of E73 from a Hyperthermophilic Archaeal Virus Identify the "Rh3" Domain, an Elaborated Ribbon-Helix- Helix Motif Involved in DNA Recognition.
pubmed doi rcsb
source organism Sulfolobus virus ragged hills
molecule tags Viral protein
molecule keywords ORF E73
total genus 16
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.150 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 4aaiA01
4AAIA
chains in the Genus database with same CATH superfamily
4LQ9A 4D8JA 2K6LA 2K5JA 1ARRA 3G5OA 3LGHA 3BSOA 4QPXA 1MNTA 2HZVA 2KELA 2WVBA 3VEAA 1X93A 1B01A 2BNZA 3H5YA 3QOQA 3SFUA 1B28A 4NRTA 1BDVA 3FMTA 2RBFA 1SH2A 1IRQA 2K1OA 2JXGA 1OG7A 2KKEA 2BJ7A 1U9PA 2H3AA 3NO7A 2WVCA 3UR0A 2CAJA 3UPFA 2UUTA 2WVDA 2JBVA 1SH0A 1ARQA 2K9IA 1SH3A 2UUWA 1P94A 2K29A 3QIDA 3FT7A 2GPEA 4AAIA 4MJWA 2A2BA 2BNWA 1BAZA 1QTGA 3LJPA 1Q5VA 1NLAA 3SFGA 2JXIA 4HV0A 4FXEA 1MYLA 2BJ9A 4ME7E 1MYKA 2ADLA 2BJ8A 2HZAA 3OD2A 2AY0A 1BDTA 3BSNA 4LQ3A 2WVEA 3GXQA 1Q16A 2BSQE 2WVFA 2Q2KA 2BA3A 3NAHA 2CAXA 2B43A 2WK4A 3H87C 1SIWA 2AN7A 2JXHA 2KOEA 2CKWA 3VW4A 1OHNA 3NNEA 1PARA 3IR7A 4LRVA 1EA4A 3VEBA 4NRUA 3NAIA 3UQSA 2CPGA 4O4RA 2BJ3A 2BJ1A 2H1OE 3H5XA 2CA9A 2CADA
chains in the Genus database with same CATH topology
4LQ9A 4AAIA 2B43A 1SH2A 2WK4A 4MJWA 2A2BA 3G5OA 1OG7A 2KKEA 3LJPA 1SIWA 2AN7A 2H3AA 3BSOA 2KOEA 3SFGA 3NO7A 4QPXA 2CKWA 1OHNA 3NNEA 3UR0A 3UPFA 2UUTA 2ADLA 3IR7A 4LRVA 2JBVA 3H5YA 3BSNA 3SFUA 4LQ3A 4NRUA 1SH0A 3NAIA 4NRTA 3UQSA 4O4RA 1SH3A 1Q16A 2UUWA 3H5XA 2Q2KA 3QIDA 3NAHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AAI A; 
#chains in the Genus database with same CATH topology
 4LQ9 A;  4D8J A;  2K6L A;  2K5J A;  1ARR A;  3G5O A;  3LGH A;  3BSO A;  4QPX A;  1MNT A;  2HZV A;  2KEL A;  2WVB A;  3VEA A;  1X93 A;  1B01 A;  2BNZ A;  3H5Y A;  3QOQ A;  3SFU A;  1B28 A;  4NRT A;  1BDV A;  3FMT A;  2RBF A;  1SH2 A;  1IRQ A;  2K1O A;  2JXG A;  1OG7 A;  2KKE A;  2BJ7 A;  1U9P A;  2H3A A;  3NO7 A;  2WVC A;  3UR0 A;  2CAJ A;  3UPF A;  2UUT A;  2WVD A;  2JBV A;  1SH0 A;  1ARQ A;  2K9I A;  1SH3 A;  2UUW A;  1P94 A;  2K29 A;  3QID A;  3FT7 A;  2GPE A;  4AAI A;  4MJW A;  2A2B A;  2BNW A;  1BAZ A;  1QTG A;  3LJP A;  1Q5V A;  1NLA A;  3SFG A;  2JXI A;  4HV0 A;  4FXE A;  1MYL A;  2BJ9 A;  4ME7 E;  1MYK A;  2ADL A;  2BJ8 A;  2HZA A;  3OD2 A;  2AY0 A;  1BDT A;  3BSN A;  4LQ3 A;  2WVE A;  3GXQ A;  1Q16 A;  2BSQ E;  2WVF A;  2Q2K A;  2BA3 A;  3NAH A;  2CAX A;  2B43 A;  2WK4 A;  3H87 C;  1SIW A;  2AN7 A;  2JXH A;  2KOE A;  2CKW A;  3VW4 A;  1OHN A;  3NNE A;  1PAR A;  3IR7 A;  4LRV A;  1EA4 A;  3VEB A;  4NRU A;  3NAI A;  3UQS A;  2CPG A;  4O4R A;  2BJ3 A;  2BJ1 A;  2H1O E;  3H5X A;  2CA9 A;  2CAD A; 
#chains in the Genus database with same CATH homology
 4LQ9 A;  4AAI A;  2B43 A;  1SH2 A;  2WK4 A;  4MJW A;  2A2B A;  3G5O A;  1OG7 A;  2KKE A;  3LJP A;  1SIW A;  2AN7 A;  2H3A A;  3BSO A;  2KOE A;  3SFG A;  3NO7 A;  4QPX A;  2CKW A;  1OHN A;  3NNE A;  3UR0 A;  3UPF A;  2UUT A;  2ADL A;  3IR7 A;  4LRV A;  2JBV A;  3H5Y A;  3BSN A;  3SFU A;  4LQ3 A;  4NRU A;  1SH0 A;  3NAI A;  4NRT A;  3UQS A;  4O4R A;  1SH3 A;  1Q16 A;  2UUW A;  3H5X A;  2Q2K A;  3QID A;  3NAH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...