4AALA

Maca wild-type oxidized
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
324
structure length
320
Chain Sequence
EDVMKRAQGLFKPIPAKPPVMKDNPASPSRVELGRMLFFDPRLSASHLISCNTCHNVGLGGTDILETSIGHGWQKGPRNSPTVLNAVYNIAQFWDGRAEDLAAQAKGPVQASVEMNNKPENLVATLKSIPGYPPLFRKAFPGQGDPVTFDNVAKAIEVFEATLVTPDAPFDKYLKGNRKAISSTAEQGLALFLDKGCAACHSGVNMGGTGYFPFGVREDPGPVDDTGRYKVTSTAADKYVFRSPSLRNVAITMPYFHSGKVWKLKDAVKIMGSAQLGISITDADADKIVTFLNTLTGAQPKVMHPVLPPNSDDTPRPVSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C551 PEROXIDASE
publication title Maca is a Second Cytochrome C Peroxidase of Geobacter Sulfurreducens.
pubmed doi rcsb
source organism Geobacter sulfurreducens
molecule tags Oxidoreductase
total genus 94
structure length 320
sequence length 324
chains with identical sequence B
ec nomenclature ec 1.11.1.5: Cytochrome-c peroxidase.
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00034 Cytochrom_C Cytochrome c
A PF03150 CCP_MauG Di-haem cytochrome c peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 4aalA01
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 4aalA02
3X39A 1HJ5A 4KMGA 1CSWA 4K3IA 5KAIV 1SQVD 4AX3A 3CYTI 3PXSA 2ZXYA 1DIQC 1ZRTD 1VYDA 2CE0A 3L75D 3H1JD 1SQPD 2GC4D 2JTIB 1E29A 2A06D 1CNOA 1KB0A 5B5EV 1HRCA 5CIFB 5AURA 1N15A 1CIGA 1KV9A 4FAVA 1U75B 4L3GA 2B4ZA 4RSZA 1LMSA 4EIFA 3M97X 1EZVD 1CHHA 2JQRA 2B12B 2PCBB 1DW2A 3O1YA 4WQAA 3L70D 2OZ1A 1H31A 2YIUB 1NMLA 4AANA 1JDLA 3ZBMA 5C0ZA 1I6DA 4H0JA 1CO6A 4L3HA 1B7VA 1DIIC 1I55A 1K3HA 3WFCC 1H33A 2MTAC 4UB8V 4YE1A 1LS9A 3RMZA 3WFDC 3HQ6A 1J3SA 5DJQB 1BCCD 1GDVA 2BCNB 1CYCA 1CXCA 2C9XB 1YEBA 2GIWA 1MG2D 1C6OA 3H1ID 351CA 1DW3A 3CX5D 5GTHV 3HQ8A 1H9YA 1QYZA 4UB6V 5H2FV 1E8EA 1IO3A 3BCCD 1AKKA 3O5CA 1IRWA 1CTYA 1H31B 3ZOWA 1HJ3A 2BLFB 1NIRA 3L72D 4GEDB 1W2LA 1CYIA 3OA8A 3NWVA 3CXHD 4PW9B 1HJ4A 2DVHA 3O20A 4PD4D 5EXQA 1QKSA 3PXWA 2FYUD 2CE1A 1CSVA 4WQDA 1BGYD 1H33B 2V07A 2B11B 1CYJA 1LFMA 1LC2A 1GKSA 1C6SA 1L0ND 3O0RC 3WFEC 1COTA 1M60A 1P84D 1C2NA 1DW0A 1NTMD 4FA9A 1OAEA 1CC5A 5KLIB 1YEAA 1FJ0A 1CRCA 1KYOD 2ORLA 3PH2B 3RN0A 4DY9A 2ZBOA 4H0KA 3OA8B 1N9CA 1CIEA 2EXVA 1SQBD 1HH7A 1FCDC 4AAOA 1CRHA 1CRYA 1H1OA 1MG3D 3L4OA 1GQ1A 1AOFA 1CIHA 2VHDA 3VNWA 3ZIYA 2XTSB 3DR0A 3C2CA 5TISV 1DT1A 5IY51 2DGEA 2FRCA 2N18B 1KIBA 3ZOOA 5CIHB 4XYDB 3RN1A 4FA5A 1DW1A 1GU2A 3L71D 4PJ0V 3CU4A 1I8PA 5CYTR 3SLEA 2C1UA 1YIQA 5CICB 1DVVA 2C8SA 4WQ8A 1N90A 1PP9D 4U3FD 1YTCA 4Y5RA 1A56A 3WC8A 1A8CA 3NBSA 4WQ7A 4WQBA 3CP5A 2GC7D 3ZCFA 3H1LD 3NBTA 2PACA 3L73D 3RLMA 4WQEA 1L9JC 1GJQA 5DF5A 1SQXD 5KLVD 1CCRA 3WUIA 2CXBA 2QJKB 1NU1D 1CTZA 1DVHA 3JBTB 1CSUA 2CA3B 3SXTA 3ORVA 2ZOOA 4LJIA 2N3YA 2IBZD 2MHMA 2QJYB 4L1QA 2HV4A 5E79V 1I8OA 1H32A 3VRDA 3WU2V 2I8FA 4GYDA 1WEJF 1CORA 3SJLA 3L74D 2LIRA 1CXAA 3DP5A 5B66V 1S5LV 2CA4B 1F1FA 4MU8A 4JCGA 4AALA 2BPBB 1E2RA 2AI5A 1CCHA 1NMIA 1OCDA 1L0LD 1A2SA 1CRJA 4XXLA 1RAPA 1NNOA 2QJPB 1CTJA 1BE3D 1C2RA 5B6QA 1GIWA 2FYNB 2PCCB 3A9FA 3L4MA 2C1VA 3H1HD 2N9IA 3ZOXA 3HQ9A 5KAFV 1CSXA 1KYOW 2LITA 1QL3A 1WVEC 4FA4A 1C75A 3A0BV 2C1DA 2N3BA 1N50A 1AOQA 2N9JA 1H32B 1AYGA 1CIFA 5DJQC 1I54A 4QAOA 3WFBC 4NFGB 1H9XA 2V08A 1FHBA 4FA1A 4AAMA 1U74B 1CEDA 3MK7C 1HROA 1CHJA 4P4QB 2B0ZB 1RAQA 3TGUD 1KX7A 1FOCA 1SQQD 3HQ7A 1HZVA 4EIEA 4WQCA 1IZL0 5CIEB 3PXTA 5CIGB 2B10B 2AIUA 3DMIA 1MZ4A 4FB1A 2YQBA 1FI9A 1ETPA 1C7MA 5KKZB 1F1CA 5DFSA 4FANA 1LC1A 451CA 1RZ5A 4O1QA 1C6RA 2C1DB 2D0SA 4Q5PA 2YCCA 2YK3A 1CHIA 4PWAA 4O1WA 5CIBB 2D0WA 3KZIV 2BH5X 1PPJD 2BGVX 4IL6V 4EIDA 3CX5W 1YNRA 1YFCA 1KX2A 3H1KD 1YICA 1M6ZA 2C2CA 3TYIA 1BL9A 1NTZD 1I6EA 3OCDA 3CWBD 1K3GA 1NTKD 1FI7A 5C9MA 155CA 1C52A 3MK7B 4EICA 4WQ9A 4D6TD 3CXHW 4V2KA 1KB9D 1M70A 1S6VB 1HCMA 1IRVA 1RZ6A 2L4DA 2BCCD 2OZ1B 1CRIA 1CRGA 2BH4X 3A0HV 3SWSA 2GB8B 1QL4A 3VYMA 4J20A 2AXTV 1FI3A 5GTIV 2N18C 3SVWA 1EB7A 1ZZHA 4N0KA 1W5CT 1YCCA 2ZONG 1L9BC 5CIDB 3ZOYA 1I5TA 2FWLA 1QN2A 1HZUA 2ZZS1 3OCDB 1R0QA 1IQCA
chains in the Genus database with same CATH superfamily
3X39A 1HJ5A 4KMGA 1CSWA 4K3IA 5KAIV 1SQVD 4AX3A 3CYTI 3PXSA 2ZXYA 1DIQC 1ZRTD 1VYDA 2CE0A 3L75D 3H1JD 1SQPD 2GC4D 2JTIB 1E29A 2A06D 1CNOA 1KB0A 5B5EV 1HRCA 5CIFB 5AURA 1N15A 1CIGA 1KV9A 4FAVA 1U75B 4L3GA 2B4ZA 4RSZA 1LMSA 4EIFA 3M97X 1EZVD 1CHHA 2JQRA 2B12B 2PCBB 1DW2A 3O1YA 4WQAA 3L70D 2OZ1A 1H31A 2YIUB 1NMLA 4AANA 1JDLA 3ZBMA 5C0ZA 1I6DA 4H0JA 1CO6A 4L3HA 1B7VA 1DIIC 1I55A 1K3HA 3WFCC 1H33A 2MTAC 4UB8V 4YE1A 1LS9A 3RMZA 3WFDC 3HQ6A 1J3SA 5DJQB 1BCCD 1GDVA 2BCNB 1CYCA 1CXCA 2C9XB 1YEBA 2GIWA 1MG2D 1C6OA 3H1ID 351CA 1DW3A 3CX5D 5GTHV 3HQ8A 1H9YA 1QYZA 4UB6V 5H2FV 1E8EA 1IO3A 3BCCD 1AKKA 3O5CA 1IRWA 1CTYA 1H31B 3ZOWA 1HJ3A 2BLFB 1NIRA 3L72D 4GEDB 1W2LA 1CYIA 3OA8A 3NWVA 3CXHD 4PW9B 1HJ4A 2DVHA 3O20A 4PD4D 5EXQA 1QKSA 3PXWA 2FYUD 2CE1A 1CSVA 4WQDA 1BGYD 1H33B 2V07A 2B11B 1CYJA 1LFMA 1LC2A 1GKSA 1C6SA 1L0ND 3O0RC 3WFEC 1COTA 1M60A 1P84D 1C2NA 1DW0A 1NTMD 3D0WA 4FA9A 1OAEA 1CC5A 5KLIB 1YEAA 1FJ0A 1CRCA 1KYOD 2ORLA 3PH2B 3RN0A 4DY9A 2ZBOA 4H0KA 3OA8B 1N9CA 1CIEA 2EXVA 1SQBD 1HH7A 1FCDC 4AAOA 1CRHA 1CRYA 1H1OA 1MG3D 3L4OA 1GQ1A 1AOFA 1CIHA 2VHDA 3VNWA 3ZIYA 2XTSB 3DR0A 3C2CA 5TISV 1DT1A 5IY51 2DGEA 2FRCA 2N18B 1KIBA 3ZOOA 5CIHB 4XYDB 3RN1A 4FA5A 1DW1A 1GU2A 3L71D 4PJ0V 3CU4A 1I8PA 5CYTR 3SLEA 2C1UA 1YIQA 5CICB 1DVVA 2C8SA 4WQ8A 1N90A 1PP9D 4U3FD 1YTCA 4Y5RA 1A56A 3WC8A 1A8CA 3NBSA 4WQ7A 4WQBA 3CP5A 2GC7D 3ZCFA 3H1LD 3NBTA 2PACA 3L73D 3RLMA 4WQEA 1L9JC 1GJQA 5DF5A 1SQXD 5KLVD 1CCRA 3WUIA 2CXBA 2QJKB 1NU1D 1CTZA 1DVHA 3JBTB 1CSUA 2CA3B 3SXTA 3ORVA 2ZOOA 4LJIA 2N3YA 2IBZD 2MHMA 2QJYB 4L1QA 2HV4A 5E79V 1I8OA 1H32A 3VRDA 3WU2V 2I8FA 4GYDA 1WEJF 1CORA 3SJLA 3L74D 2LIRA 1CXAA 3DP5A 5B66V 1S5LV 2CA4B 1F1FA 4MU8A 4JCGA 4AALA 2BPBB 1E2RA 2AI5A 1CCHA 1NMIA 1OCDA 1L0LD 1A2SA 1CRJA 4XXLA 1RAPA 1NNOA 2QJPB 1CTJA 1BE3D 1C2RA 5B6QA 1GIWA 2FYNB 2PCCB 3A9FA 3L4MA 2C1VA 3H1HD 2N9IA 3ZOXA 3HQ9A 5KAFV 1CSXA 1KYOW 2LITA 1QL3A 1WVEC 4FA4A 1C75A 3A0BV 2C1DA 2N3BA 1N50A 1AOQA 2N9JA 1H32B 1AYGA 1CIFA 5DJQC 1I54A 4QAOA 3WFBC 4NFGB 1H9XA 2V08A 1FHBA 4FA1A 4AAMA 1U74B 1CEDA 3MK7C 1HROA 1CHJA 4P4QB 2B0ZB 1RAQA 3TGUD 1KX7A 1FOCA 1SQQD 3HQ7A 1HZVA 4EIEA 4WQCA 1IZL0 5CIEB 3PXTA 5CIGB 2B10B 2AIUA 3DMIA 1MZ4A 4FB1A 2YQBA 1FI9A 1ETPA 1C7MA 5KKZB 1F1CA 5DFSA 4FANA 1LC1A 451CA 1RZ5A 4O1QA 1C6RA 2C1DB 2D0SA 4Q5PA 2YCCA 2YK3A 1CHIA 4PWAA 4O1WA 5CIBB 2D0WA 3KZIV 2BH5X 1PPJD 2BGVX 4IL6V 4EIDA 3CX5W 1YNRA 1YFCA 1KX2A 3H1KD 1YICA 1M6ZA 2C2CA 3TYIA 1BL9A 1NTZD 1I6EA 3OCDA 3CWBD 1K3GA 1NTKD 1FI7A 5C9MA 155CA 1C52A 3MK7B 4EICA 4WQ9A 4D6TD 3CXHW 4V2KA 1KB9D 1M70A 1S6VB 1HCMA 1IRVA 1RZ6A 2L4DA 2BCCD 2OZ1B 1CRIA 1CRGA 2BH4X 3A0HV 3SWSA 2GB8B 1QL4A 3VYMA 4J20A 2AXTV 1FI3A 5GTIV 2N18C 3SVWA 1EB7A 1ZZHA 4N0KA 1W5CT 1YCCA 2ZONG 1L9BC 5CIDB 3ZOYA 1I5TA 2FWLA 1QN2A 1HZUA 2ZZS1 3OCDB 1R0QA 1IQCA
chains in the Genus database with same CATH topology
3X39A 1HJ5A 4KMGA 1CSWA 4K3IA 5KAIV 1SQVD 4AX3A 3CYTI 3PXSA 2ZXYA 1DIQC 1ZRTD 1VYDA 2CE0A 3L75D 3H1JD 1SQPD 2GC4D 2JTIB 1E29A 2A06D 1CNOA 1KB0A 5B5EV 1HRCA 5CIFB 5AURA 1N15A 1CIGA 1KV9A 4FAVA 1U75B 4L3GA 2B4ZA 4RSZA 1LMSA 4EIFA 3M97X 1EZVD 1CHHA 2JQRA 2B12B 2PCBB 1DW2A 3O1YA 4WQAA 3L70D 2OZ1A 1H31A 2YIUB 1NMLA 4AANA 1JDLA 3ZBMA 5C0ZA 1I6DA 4H0JA 1CO6A 4L3HA 1B7VA 1DIIC 1I55A 1K3HA 3WFCC 1H33A 2MTAC 4UB8V 4YE1A 1LS9A 3RMZA 3WFDC 3HQ6A 1J3SA 5DJQB 1BCCD 1GDVA 2BCNB 1CYCA 1CXCA 2C9XB 1YEBA 2GIWA 1MG2D 1C6OA 3H1ID 351CA 1DW3A 3CX5D 5GTHV 3HQ8A 1H9YA 1QYZA 4UB6V 5H2FV 1E8EA 1IO3A 3BCCD 1AKKA 3O5CA 1IRWA 1CTYA 1H31B 3ZOWA 1HJ3A 2BLFB 1NIRA 3L72D 4GEDB 1W2LA 1CYIA 3OA8A 3NWVA 3CXHD 4PW9B 1HJ4A 2DVHA 3O20A 4PD4D 5EXQA 1QKSA 3PXWA 2FYUD 2CE1A 1CSVA 4WQDA 1BGYD 1H33B 2V07A 2B11B 1CYJA 1LFMA 1LC2A 1GKSA 1C6SA 1L0ND 3O0RC 3WFEC 1COTA 1M60A 1P84D 1C2NA 1DW0A 1NTMD 4FA9A 1OAEA 1CC5A 5KLIB 1YEAA 1FJ0A 1CRCA 1KYOD 2ORLA 3PH2B 3RN0A 4DY9A 2ZBOA 4H0KA 3OA8B 1N9CA 1CIEA 2EXVA 1SQBD 1HH7A 1FCDC 4AAOA 1CRHA 1CRYA 1H1OA 1MG3D 3L4OA 1GQ1A 1AOFA 1CIHA 2VHDA 3VNWA 3ZIYA 2XTSB 3DR0A 3C2CA 5TISV 1DT1A 5IY51 2DGEA 2FRCA 2N18B 1KIBA 3ZOOA 5CIHB 4XYDB 3RN1A 4FA5A 1DW1A 1GU2A 3L71D 4PJ0V 3CU4A 1I8PA 5CYTR 3SLEA 2C1UA 1YIQA 5CICB 1DVVA 2C8SA 4WQ8A 1N90A 1PP9D 4U3FD 1YTCA 4Y5RA 1A56A 3WC8A 1A8CA 3NBSA 4WQ7A 4WQBA 3CP5A 2GC7D 3ZCFA 3H1LD 3NBTA 2PACA 3L73D 3RLMA 4WQEA 1L9JC 1GJQA 5DF5A 1SQXD 5KLVD 1CCRA 3WUIA 2CXBA 2QJKB 1NU1D 1CTZA 1DVHA 3JBTB 1CSUA 2CA3B 3SXTA 3ORVA 2ZOOA 4LJIA 2N3YA 2IBZD 2MHMA 2QJYB 4L1QA 2HV4A 5E79V 1I8OA 1H32A 3VRDA 3WU2V 2I8FA 4GYDA 1WEJF 1CORA 3SJLA 3L74D 2LIRA 1CXAA 3DP5A 5B66V 1S5LV 2CA4B 1F1FA 4MU8A 4JCGA 4AALA 2BPBB 1E2RA 2AI5A 1CCHA 1NMIA 1OCDA 1L0LD 1A2SA 1CRJA 4XXLA 1RAPA 1NNOA 2QJPB 1CTJA 1BE3D 1C2RA 5B6QA 1GIWA 2FYNB 2PCCB 3A9FA 3L4MA 2C1VA 3H1HD 2N9IA 3ZOXA 3HQ9A 5KAFV 1CSXA 1KYOW 2LITA 1QL3A 1WVEC 4FA4A 1C75A 3A0BV 2C1DA 2N3BA 1N50A 1AOQA 2N9JA 1H32B 1AYGA 1CIFA 5DJQC 1I54A 4QAOA 3WFBC 4NFGB 1H9XA 2V08A 1FHBA 4FA1A 4AAMA 1U74B 1CEDA 3MK7C 1HROA 1CHJA 4P4QB 2B0ZB 1RAQA 3TGUD 1KX7A 1FOCA 1SQQD 3HQ7A 1HZVA 4EIEA 4WQCA 1IZL0 5CIEB 3PXTA 5CIGB 2B10B 2AIUA 3DMIA 1MZ4A 4FB1A 2YQBA 1FI9A 1ETPA 1C7MA 5KKZB 1F1CA 5DFSA 4FANA 1LC1A 451CA 1RZ5A 4O1QA 1C6RA 2C1DB 2D0SA 4Q5PA 2YCCA 2YK3A 1CHIA 4PWAA 4O1WA 5CIBB 2D0WA 3KZIV 2BH5X 1PPJD 2BGVX 4IL6V 4EIDA 3CX5W 1YNRA 1YFCA 1KX2A 3H1KD 1YICA 1M6ZA 2C2CA 3TYIA 1BL9A 1NTZD 1I6EA 3OCDA 3CWBD 1K3GA 1NTKD 1FI7A 5C9MA 155CA 1C52A 3MK7B 4EICA 4WQ9A 4D6TD 3CXHW 4V2KA 1KB9D 1M70A 1S6VB 1HCMA 1IRVA 1RZ6A 2L4DA 2BCCD 2OZ1B 1CRIA 1CRGA 2BH4X 3A0HV 3SWSA 2GB8B 1QL4A 3VYMA 4J20A 2AXTV 1FI3A 5GTIV 2N18C 3SVWA 1EB7A 1ZZHA 4N0KA 1W5CT 1YCCA 2ZONG 1L9BC 5CIDB 3ZOYA 1I5TA 2FWLA 1QN2A 1HZUA 2ZZS1 3OCDB 1R0QA 1IQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X39 A;  1HJ5 A;  4KMG A;  1CSW A;  4K3I A;  5KAI V;  1SQV D;  4AX3 A;  3CYT I;  3PXS A;  2ZXY A;  1DIQ C;  1ZRT D;  1VYD A;  2CE0 A;  3L75 D;  3H1J D;  1SQP D;  2GC4 D;  2JTI B;  1E29 A;  2A06 D;  1CNO A;  1KB0 A;  5B5E V;  1HRC A;  5CIF B;  5AUR A;  1N15 A;  1CIG A;  1KV9 A;  4FAV A;  1U75 B;  4L3G A;  2B4Z A;  4RSZ A;  1LMS A;  4EIF A;  3M97 X;  1EZV D;  1CHH A;  2JQR A;  2B12 B;  2PCB B;  1DW2 A;  3O1Y A;  4WQA A;  3L70 D;  2OZ1 A;  1H31 A;  2YIU B;  1NML A;  4AAN A;  1JDL A;  3ZBM A;  5C0Z A;  1I6D A;  4H0J A;  1CO6 A;  4L3H A;  1B7V A;  1DII C;  1I55 A;  1K3H A;  3WFC C;  1H33 A;  2MTA C;  4UB8 V;  4YE1 A;  1LS9 A;  3RMZ A;  3WFD C;  3HQ6 A;  1J3S A;  5DJQ B;  1BCC D;  1GDV A;  2BCN B;  1CYC A;  1CXC A;  2C9X B;  1YEB A;  2GIW A;  1MG2 D;  1C6O A;  3H1I D;  351C A;  1DW3 A;  3CX5 D;  5GTH V;  3HQ8 A;  1H9Y A;  1QYZ A;  4UB6 V;  5H2F V;  1E8E A;  1IO3 A;  3BCC D;  1AKK A;  3O5C A;  1IRW A;  1CTY A;  1H31 B;  3ZOW A;  1HJ3 A;  2BLF B;  1NIR A;  3L72 D;  4GED B;  1W2L A;  1CYI A;  3OA8 A;  3NWV A;  3CXH D;  4PW9 B;  1HJ4 A;  2DVH A;  3O20 A;  4PD4 D;  5EXQ A;  1QKS A;  3PXW A;  2FYU D;  2CE1 A;  1CSV A;  4WQD A;  1BGY D;  1H33 B;  2V07 A;  2B11 B;  1CYJ A;  1LFM A;  1LC2 A;  1GKS A;  1C6S A;  1L0N D;  3O0R C;  3WFE C;  1COT A;  1M60 A;  1P84 D;  1C2N A;  1DW0 A;  1NTM D;  4FA9 A;  1OAE A;  1CC5 A;  5KLI B;  1YEA A;  1FJ0 A;  1CRC A;  1KYO D;  2ORL A;  3PH2 B;  3RN0 A;  4DY9 A;  2ZBO A;  4H0K A;  3OA8 B;  1N9C A;  1CIE A;  2EXV A;  1SQB D;  1HH7 A;  1FCD C;  4AAO A;  1CRH A;  1CRY A;  1H1O A;  1MG3 D;  3L4O A;  1GQ1 A;  1AOF A;  1CIH A;  2VHD A;  3VNW A;  3ZIY A;  2XTS B;  3DR0 A;  3C2C A;  5TIS V;  1DT1 A;  5IY5 1;  2DGE A;  2FRC A;  2N18 B;  1KIB A;  3ZOO A;  5CIH B;  4XYD B;  3RN1 A;  4FA5 A;  1DW1 A;  1GU2 A;  3L71 D;  4PJ0 V;  3CU4 A;  1I8P A;  5CYT R;  3SLE A;  2C1U A;  1YIQ A;  5CIC B;  1DVV A;  2C8S A;  4WQ8 A;  1N90 A;  1PP9 D;  4U3F D;  1YTC A;  4Y5R A;  1A56 A;  3WC8 A;  1A8C A;  3NBS A;  4WQ7 A;  4WQB A;  3CP5 A;  2GC7 D;  3ZCF A;  3H1L D;  3NBT A;  2PAC A;  3L73 D;  3RLM A;  4WQE A;  1L9J C;  1GJQ A;  5DF5 A;  1SQX D;  5KLV D;  1CCR A;  3WUI A;  2CXB A;  2QJK B;  1NU1 D;  1CTZ A;  1DVH A;  3JBT B;  1CSU A;  2CA3 B;  3SXT A;  3ORV A;  2ZOO A;  4LJI A;  2N3Y A;  2IBZ D;  2MHM A;  2QJY B;  4L1Q A;  2HV4 A;  5E79 V;  1I8O A;  1H32 A;  3VRD A;  3WU2 V;  2I8F A;  4GYD A;  1WEJ F;  1COR A;  3SJL A;  3L74 D;  2LIR A;  1CXA A;  3DP5 A;  5B66 V;  1S5L V;  2CA4 B;  1F1F A;  4MU8 A;  4JCG A;  4AAL A;  2BPB B;  1E2R A;  2AI5 A;  1CCH A;  1NMI A;  1OCD A;  1L0L D;  1A2S A;  1CRJ A;  4XXL A;  1RAP A;  1NNO A;  2QJP B;  1CTJ A;  1BE3 D;  1C2R A;  5B6Q A;  1GIW A;  2FYN B;  2PCC B;  3A9F A;  3L4M A;  2C1V A;  3H1H D;  2N9I A;  3ZOX A;  3HQ9 A;  5KAF V;  1CSX A;  1KYO W;  2LIT A;  1QL3 A;  1WVE C;  4FA4 A;  1C75 A;  3A0B V;  2C1D A;  2N3B A;  1N50 A;  1AOQ A;  2N9J A;  1H32 B;  1AYG A;  1CIF A;  5DJQ C;  1I54 A;  4QAO A;  3WFB C;  4NFG B;  1H9X A;  2V08 A;  1FHB A;  4FA1 A;  4AAM A;  1U74 B;  1CED A;  3MK7 C;  1HRO A;  1CHJ A;  4P4Q B;  2B0Z B;  1RAQ A;  3TGU D;  1KX7 A;  1FOC A;  1SQQ D;  3HQ7 A;  1HZV A;  4EIE A;  4WQC A;  1IZL 0;  5CIE B;  3PXT A;  5CIG B;  2B10 B;  2AIU A;  3DMI A;  1MZ4 A;  4FB1 A;  2YQB A;  1FI9 A;  1ETP A;  1C7M A;  5KKZ B;  1F1C A;  5DFS A;  4FAN A;  1LC1 A;  451C A;  1RZ5 A;  4O1Q A;  1C6R A;  2C1D B;  2D0S A;  4Q5P A;  2YCC A;  2YK3 A;  1CHI A;  4PWA A;  4O1W A;  5CIB B;  2D0W A;  3KZI V;  2BH5 X;  1PPJ D;  2BGV X;  4IL6 V;  4EID A;  3CX5 W;  1YNR A;  1YFC A;  1KX2 A;  3H1K D;  1YIC A;  1M6Z A;  2C2C A;  3TYI A;  1BL9 A;  1NTZ D;  1I6E A;  3OCD A;  3CWB D;  1K3G A;  1NTK D;  1FI7 A;  5C9M A;  155C A;  1C52 A;  3MK7 B;  4EIC A;  4WQ9 A;  4D6T D;  3CXH W;  4V2K A;  1KB9 D;  1M70 A;  1S6V B;  1HCM A;  1IRV A;  1RZ6 A;  2L4D A;  2BCC D;  2OZ1 B;  1CRI A;  1CRG A;  2BH4 X;  3A0H V;  3SWS A;  2GB8 B;  1QL4 A;  3VYM A;  4J20 A;  2AXT V;  1FI3 A;  5GTI V;  2N18 C;  3SVW A;  1EB7 A;  1ZZH A;  4N0K A;  1W5C T;  1YCC A;  2ZON G;  1L9B C;  5CID B;  3ZOY A;  1I5T A;  2FWL A;  1QN2 A;  1HZU A;  2ZZS 1;  3OCD B;  1R0Q A;  1IQC A; 
#chains in the Genus database with same CATH topology
 3X39 A;  1HJ5 A;  4KMG A;  1CSW A;  4K3I A;  5KAI V;  1SQV D;  4AX3 A;  3CYT I;  3PXS A;  2ZXY A;  1DIQ C;  1ZRT D;  1VYD A;  2CE0 A;  3L75 D;  3H1J D;  1SQP D;  2GC4 D;  2JTI B;  1E29 A;  2A06 D;  1CNO A;  1KB0 A;  5B5E V;  1HRC A;  5CIF B;  5AUR A;  1N15 A;  1CIG A;  1KV9 A;  4FAV A;  1U75 B;  4L3G A;  2B4Z A;  4RSZ A;  1LMS A;  4EIF A;  3M97 X;  1EZV D;  1CHH A;  2JQR A;  2B12 B;  2PCB B;  1DW2 A;  3O1Y A;  4WQA A;  3L70 D;  2OZ1 A;  1H31 A;  2YIU B;  1NML A;  4AAN A;  1JDL A;  3ZBM A;  5C0Z A;  1I6D A;  4H0J A;  1CO6 A;  4L3H A;  1B7V A;  1DII C;  1I55 A;  1K3H A;  3WFC C;  1H33 A;  2MTA C;  4UB8 V;  4YE1 A;  1LS9 A;  3RMZ A;  3WFD C;  3HQ6 A;  1J3S A;  5DJQ B;  1BCC D;  1GDV A;  2BCN B;  1CYC A;  1CXC A;  2C9X B;  1YEB A;  2GIW A;  1MG2 D;  1C6O A;  3H1I D;  351C A;  1DW3 A;  3CX5 D;  5GTH V;  3HQ8 A;  1H9Y A;  1QYZ A;  4UB6 V;  5H2F V;  1E8E A;  1IO3 A;  3BCC D;  1AKK A;  3O5C A;  1IRW A;  1CTY A;  1H31 B;  3ZOW A;  1HJ3 A;  2BLF B;  1NIR A;  3L72 D;  4GED B;  1W2L A;  1CYI A;  3OA8 A;  3NWV A;  3CXH D;  4PW9 B;  1HJ4 A;  2DVH A;  3O20 A;  4PD4 D;  5EXQ A;  1QKS A;  3PXW A;  2FYU D;  2CE1 A;  1CSV A;  4WQD A;  1BGY D;  1H33 B;  2V07 A;  2B11 B;  1CYJ A;  1LFM A;  1LC2 A;  1GKS A;  1C6S A;  1L0N D;  3O0R C;  3WFE C;  1COT A;  1M60 A;  1P84 D;  1C2N A;  1DW0 A;  1NTM D;  3D0W A;  4FA9 A;  1OAE A;  1CC5 A;  5KLI B;  1YEA A;  1FJ0 A;  1CRC A;  1KYO D;  2ORL A;  3PH2 B;  3RN0 A;  4DY9 A;  2ZBO A;  4H0K A;  3OA8 B;  1N9C A;  1CIE A;  2EXV A;  1SQB D;  1HH7 A;  1FCD C;  4AAO A;  1CRH A;  1CRY A;  1H1O A;  1MG3 D;  3L4O A;  1GQ1 A;  1AOF A;  1CIH A;  2VHD A;  3VNW A;  3ZIY A;  2XTS B;  3DR0 A;  3C2C A;  5TIS V;  1DT1 A;  5IY5 1;  2DGE A;  2FRC A;  2N18 B;  1KIB A;  3ZOO A;  5CIH B;  4XYD B;  3RN1 A;  4FA5 A;  1DW1 A;  1GU2 A;  3L71 D;  4PJ0 V;  3CU4 A;  1I8P A;  5CYT R;  3SLE A;  2C1U A;  1YIQ A;  5CIC B;  1DVV A;  2C8S A;  4WQ8 A;  1N90 A;  1PP9 D;  4U3F D;  1YTC A;  4Y5R A;  1A56 A;  3WC8 A;  1A8C A;  3NBS A;  4WQ7 A;  4WQB A;  3CP5 A;  2GC7 D;  3ZCF A;  3H1L D;  3NBT A;  2PAC A;  3L73 D;  3RLM A;  4WQE A;  1L9J C;  1GJQ A;  5DF5 A;  1SQX D;  5KLV D;  1CCR A;  3WUI A;  2CXB A;  2QJK B;  1NU1 D;  1CTZ A;  1DVH A;  3JBT B;  1CSU A;  2CA3 B;  3SXT A;  3ORV A;  2ZOO A;  4LJI A;  2N3Y A;  2IBZ D;  2MHM A;  2QJY B;  4L1Q A;  2HV4 A;  5E79 V;  1I8O A;  1H32 A;  3VRD A;  3WU2 V;  2I8F A;  4GYD A;  1WEJ F;  1COR A;  3SJL A;  3L74 D;  2LIR A;  1CXA A;  3DP5 A;  5B66 V;  1S5L V;  2CA4 B;  1F1F A;  4MU8 A;  4JCG A;  4AAL A;  2BPB B;  1E2R A;  2AI5 A;  1CCH A;  1NMI A;  1OCD A;  1L0L D;  1A2S A;  1CRJ A;  4XXL A;  1RAP A;  1NNO A;  2QJP B;  1CTJ A;  1BE3 D;  1C2R A;  5B6Q A;  1GIW A;  2FYN B;  2PCC B;  3A9F A;  3L4M A;  2C1V A;  3H1H D;  2N9I A;  3ZOX A;  3HQ9 A;  5KAF V;  1CSX A;  1KYO W;  2LIT A;  1QL3 A;  1WVE C;  4FA4 A;  1C75 A;  3A0B V;  2C1D A;  2N3B A;  1N50 A;  1AOQ A;  2N9J A;  1H32 B;  1AYG A;  1CIF A;  5DJQ C;  1I54 A;  4QAO A;  3WFB C;  4NFG B;  1H9X A;  2V08 A;  1FHB A;  4FA1 A;  4AAM A;  1U74 B;  1CED A;  3MK7 C;  1HRO A;  1CHJ A;  4P4Q B;  2B0Z B;  1RAQ A;  3TGU D;  1KX7 A;  1FOC A;  1SQQ D;  3HQ7 A;  1HZV A;  4EIE A;  4WQC A;  1IZL 0;  5CIE B;  3PXT A;  5CIG B;  2B10 B;  2AIU A;  3DMI A;  1MZ4 A;  4FB1 A;  2YQB A;  1FI9 A;  1ETP A;  1C7M A;  5KKZ B;  1F1C A;  5DFS A;  4FAN A;  1LC1 A;  451C A;  1RZ5 A;  4O1Q A;  1C6R A;  2C1D B;  2D0S A;  4Q5P A;  2YCC A;  2YK3 A;  1CHI A;  4PWA A;  4O1W A;  5CIB B;  2D0W A;  3KZI V;  2BH5 X;  1PPJ D;  2BGV X;  4IL6 V;  4EID A;  3CX5 W;  1YNR A;  1YFC A;  1KX2 A;  3H1K D;  1YIC A;  1M6Z A;  2C2C A;  3TYI A;  1BL9 A;  1NTZ D;  1I6E A;  3OCD A;  3CWB D;  1K3G A;  1NTK D;  1FI7 A;  5C9M A;  155C A;  1C52 A;  3MK7 B;  4EIC A;  4WQ9 A;  4D6T D;  3CXH W;  4V2K A;  1KB9 D;  1M70 A;  1S6V B;  1HCM A;  1IRV A;  1RZ6 A;  2L4D A;  2BCC D;  2OZ1 B;  1CRI A;  1CRG A;  2BH4 X;  3A0H V;  3SWS A;  2GB8 B;  1QL4 A;  3VYM A;  4J20 A;  2AXT V;  1FI3 A;  5GTI V;  2N18 C;  3SVW A;  1EB7 A;  1ZZH A;  4N0K A;  1W5C T;  1YCC A;  2ZON G;  1L9B C;  5CID B;  3ZOY A;  1I5T A;  2FWL A;  1QN2 A;  1HZU A;  2ZZS 1;  3OCD B;  1R0Q A;  1IQC A; 
#chains in the Genus database with same CATH homology
 3X39 A;  1HJ5 A;  4KMG A;  1CSW A;  4K3I A;  5KAI V;  1SQV D;  4AX3 A;  3CYT I;  3PXS A;  2ZXY A;  1DIQ C;  1ZRT D;  1VYD A;  2CE0 A;  3L75 D;  3H1J D;  1SQP D;  2GC4 D;  2JTI B;  1E29 A;  2A06 D;  1CNO A;  1KB0 A;  5B5E V;  1HRC A;  5CIF B;  5AUR A;  1N15 A;  1CIG A;  1KV9 A;  4FAV A;  1U75 B;  4L3G A;  2B4Z A;  4RSZ A;  1LMS A;  4EIF A;  3M97 X;  1EZV D;  1CHH A;  2JQR A;  2B12 B;  2PCB B;  1DW2 A;  3O1Y A;  4WQA A;  3L70 D;  2OZ1 A;  1H31 A;  2YIU B;  1NML A;  4AAN A;  1JDL A;  3ZBM A;  5C0Z A;  1I6D A;  4H0J A;  1CO6 A;  4L3H A;  1B7V A;  1DII C;  1I55 A;  1K3H A;  3WFC C;  1H33 A;  2MTA C;  4UB8 V;  4YE1 A;  1LS9 A;  3RMZ A;  3WFD C;  3HQ6 A;  1J3S A;  5DJQ B;  1BCC D;  1GDV A;  2BCN B;  1CYC A;  1CXC A;  2C9X B;  1YEB A;  2GIW A;  1MG2 D;  1C6O A;  3H1I D;  351C A;  1DW3 A;  3CX5 D;  5GTH V;  3HQ8 A;  1H9Y A;  1QYZ A;  4UB6 V;  5H2F V;  1E8E A;  1IO3 A;  3BCC D;  1AKK A;  3O5C A;  1IRW A;  1CTY A;  1H31 B;  3ZOW A;  1HJ3 A;  2BLF B;  1NIR A;  3L72 D;  4GED B;  1W2L A;  1CYI A;  3OA8 A;  3NWV A;  3CXH D;  4PW9 B;  1HJ4 A;  2DVH A;  3O20 A;  4PD4 D;  5EXQ A;  1QKS A;  3PXW A;  2FYU D;  2CE1 A;  1CSV A;  4WQD A;  1BGY D;  1H33 B;  2V07 A;  2B11 B;  1CYJ A;  1LFM A;  1LC2 A;  1GKS A;  1C6S A;  1L0N D;  3O0R C;  3WFE C;  1COT A;  1M60 A;  1P84 D;  1C2N A;  1DW0 A;  1NTM D;  4FA9 A;  1OAE A;  1CC5 A;  5KLI B;  1YEA A;  1FJ0 A;  1CRC A;  1KYO D;  2ORL A;  3PH2 B;  3RN0 A;  4DY9 A;  2ZBO A;  4H0K A;  3OA8 B;  1N9C A;  1CIE A;  2EXV A;  1SQB D;  1HH7 A;  1FCD C;  4AAO A;  1CRH A;  1CRY A;  1H1O A;  1MG3 D;  3L4O A;  1GQ1 A;  1AOF A;  1CIH A;  2VHD A;  3VNW A;  3ZIY A;  2XTS B;  3DR0 A;  3C2C A;  5TIS V;  1DT1 A;  5IY5 1;  2DGE A;  2FRC A;  2N18 B;  1KIB A;  3ZOO A;  5CIH B;  4XYD B;  3RN1 A;  4FA5 A;  1DW1 A;  1GU2 A;  3L71 D;  4PJ0 V;  3CU4 A;  1I8P A;  5CYT R;  3SLE A;  2C1U A;  1YIQ A;  5CIC B;  1DVV A;  2C8S A;  4WQ8 A;  1N90 A;  1PP9 D;  4U3F D;  1YTC A;  4Y5R A;  1A56 A;  3WC8 A;  1A8C A;  3NBS A;  4WQ7 A;  4WQB A;  3CP5 A;  2GC7 D;  3ZCF A;  3H1L D;  3NBT A;  2PAC A;  3L73 D;  3RLM A;  4WQE A;  1L9J C;  1GJQ A;  5DF5 A;  1SQX D;  5KLV D;  1CCR A;  3WUI A;  2CXB A;  2QJK B;  1NU1 D;  1CTZ A;  1DVH A;  3JBT B;  1CSU A;  2CA3 B;  3SXT A;  3ORV A;  2ZOO A;  4LJI A;  2N3Y A;  2IBZ D;  2MHM A;  2QJY B;  4L1Q A;  2HV4 A;  5E79 V;  1I8O A;  1H32 A;  3VRD A;  3WU2 V;  2I8F A;  4GYD A;  1WEJ F;  1COR A;  3SJL A;  3L74 D;  2LIR A;  1CXA A;  3DP5 A;  5B66 V;  1S5L V;  2CA4 B;  1F1F A;  4MU8 A;  4JCG A;  4AAL A;  2BPB B;  1E2R A;  2AI5 A;  1CCH A;  1NMI A;  1OCD A;  1L0L D;  1A2S A;  1CRJ A;  4XXL A;  1RAP A;  1NNO A;  2QJP B;  1CTJ A;  1BE3 D;  1C2R A;  5B6Q A;  1GIW A;  2FYN B;  2PCC B;  3A9F A;  3L4M A;  2C1V A;  3H1H D;  2N9I A;  3ZOX A;  3HQ9 A;  5KAF V;  1CSX A;  1KYO W;  2LIT A;  1QL3 A;  1WVE C;  4FA4 A;  1C75 A;  3A0B V;  2C1D A;  2N3B A;  1N50 A;  1AOQ A;  2N9J A;  1H32 B;  1AYG A;  1CIF A;  5DJQ C;  1I54 A;  4QAO A;  3WFB C;  4NFG B;  1H9X A;  2V08 A;  1FHB A;  4FA1 A;  4AAM A;  1U74 B;  1CED A;  3MK7 C;  1HRO A;  1CHJ A;  4P4Q B;  2B0Z B;  1RAQ A;  3TGU D;  1KX7 A;  1FOC A;  1SQQ D;  3HQ7 A;  1HZV A;  4EIE A;  4WQC A;  1IZL 0;  5CIE B;  3PXT A;  5CIG B;  2B10 B;  2AIU A;  3DMI A;  1MZ4 A;  4FB1 A;  2YQB A;  1FI9 A;  1ETP A;  1C7M A;  5KKZ B;  1F1C A;  5DFS A;  4FAN A;  1LC1 A;  451C A;  1RZ5 A;  4O1Q A;  1C6R A;  2C1D B;  2D0S A;  4Q5P A;  2YCC A;  2YK3 A;  1CHI A;  4PWA A;  4O1W A;  5CIB B;  2D0W A;  3KZI V;  2BH5 X;  1PPJ D;  2BGV X;  4IL6 V;  4EID A;  3CX5 W;  1YNR A;  1YFC A;  1KX2 A;  3H1K D;  1YIC A;  1M6Z A;  2C2C A;  3TYI A;  1BL9 A;  1NTZ D;  1I6E A;  3OCD A;  3CWB D;  1K3G A;  1NTK D;  1FI7 A;  5C9M A;  155C A;  1C52 A;  3MK7 B;  4EIC A;  4WQ9 A;  4D6T D;  3CXH W;  4V2K A;  1KB9 D;  1M70 A;  1S6V B;  1HCM A;  1IRV A;  1RZ6 A;  2L4D A;  2BCC D;  2OZ1 B;  1CRI A;  1CRG A;  2BH4 X;  3A0H V;  3SWS A;  2GB8 B;  1QL4 A;  3VYM A;  4J20 A;  2AXT V;  1FI3 A;  5GTI V;  2N18 C;  3SVW A;  1EB7 A;  1ZZH A;  4N0K A;  1W5C T;  1YCC A;  2ZON G;  1L9B C;  5CID B;  3ZOY A;  1I5T A;  2FWL A;  1QN2 A;  1HZU A;  2ZZS 1;  3OCD B;  1R0Q A;  1IQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...