4AAXA

Cpgh89cbm32-5, from clostridium perfringens, in complex with n- acetylgalactosamine
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
140
structure length
140
Chain Sequence
b'ASALPQGNMKATATSEHPDVGNEGLAKFAIDGKENTIWHTKYNPVEELPQSITLELGGSYEINKFTYLPRSGAKNGNITKYELHVSEDGNNFRKISEGNWDDSGSLKTLKFNSTKATHVKLVALEGVGGFASAAELNVFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-N-ACETYLGLUCOSAMINIDASE
molecule tags Hydrolase
source organism Clostridium perfringens
publication title Carbohydrate Recognition by an Architecturally Complex Alpha-N-Acetylglucosaminidase from Clostridium Perfringens.
pubmed doi rcsb
total genus 32
structure length 140
sequence length 140
ec nomenclature ec 3.2.1.50: Alpha-N-acetylglucosaminidase.
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4aaxA00
2HYXA 4A45A 2WO2A 1PMJX 2HLEA 4HG6B 2W5FA 1NUKA 3VDBA 3WQBA 4QPWA 3HPNA 4OMCA 3VDCA 4ZXEA 1JZ3A 1JHJA 3CKHA 2W46A 3HNMA 1L7RA 2VL4A 3VD3A 2W1WA 3W5NA 3UESA 3HOBA 2Y6HA 1UYXA 3LEKA 2VZSA 5C71A 3J7HA 3GDBA 2JE8A 2WUHA 2XQXA 2J7MA 3VD4A 1CIYA 2QQKA 3K75B 4JKKA 4P02B 4QDRA 3MBWA 3NNGA 4OMDA 2ZEWA 2VCAA 3E1F1 2WO1A 2BZDA 3MV01 3P1IA 1UY3A 2VZPA 2VZOA 1SDDB 2J1TA 1OF4A 1JYXA 5JXIA 5EJ1B 4TTGA 4DUWA 3VD7A 3PUIA 4PQQA 4XUQA 2CDPA 1XPWA 1DLCA 1ULPA 3WF4A 3WEZA 3SEPA 3HN3A 1H6YA 2B9VA 3I2GA 2C26A 1O8SA 2VQUA 2BGOA 1W9SA 5DPNA 3I2KA 5A1AA 2CDOA 3NJVA 4MO3M 1UMIA 2J22A 4QX3A 4BK5A 3WNOA 2RVAA 1XC6A 4QDSA 3ACGA 1W99A 4CUCA 3ACIA 5EJZB 4DEVA 1O59A 2EIDA 1JZ5A 1F4HA 2Y6JA 1K45A 1GNYA 4DUXA 1K42A 1XNAA 2EIBA 2VZ3A 4GWJA 3I2JA 5JXHA 3A23A 2C4XA 3T09A 4DXTA 3EB7A 3CMGA 1W8NA 1JU3A 2VMEA 3OGSA 4MGQA 2QBXA 4QX1A 2VZRA 5C70A 2WYSA 4LPLA 3MUZ1 3SKVA 2VO5A 4E8CA 1P8JA 2WABA 4CUBA 3HNBM 1PMHX 1CZVA 2Y6LA 3LE0A 1UY1A 1GOFA 2VZUA 3BGAA 3I2HA 2ID4A 2LS6A 3DECA 3T0AA 4LHSA 4D8MA 1PX3A 4Z2AA 1W9WA 2YB7A 2W94A 3UNPA 3ABZA 4UI9L 1JZ8A 2VZQA 3I2IA 2QQJA 2VJXA 5CZKA 2XHNA 3IDAA 3C8XA 2WZEA 2EICA 1DYOA 4A3ZA 2WN2A 3IAPA 4DEQA 4QX2A 1JZ2A 4KMQA 5G05L 3A22A 4GZ9A 4W8JA 2W92A 4JX0A 2DCKA 1GQPA 4XVHA 2B4KA 1OD3A 2X10A 3U37A 4ARXA 3LEIA 1KEXA 5JXJA 1JZ7A 3MO4A 1JZ6A 5HPOA 1BHGA 2Y64A 3K46A 1SHWB 3I3BA 3CZUA 4DXSA 4A6OA 3K4DA 2DDUA 3T2PA 1UY4A 3DYOA 3WNLA 4CU9A 3MV11 2VOTA 3I2FA 1WKYA 3ACFA 1NKGA 4XURA 4JKLA 1UY0A 2VMFA 2RV9A 2W3JA 1HN1A 4CUAA 4ZY9A 2W47A 2J1VA 1J84A 3OGRA 3MUY1 5CYYA 3VD5A 5LA0A 2ORXA 3A21A 3K4AA 4P00B 5IJRA 3HNYM 1UZ0A 3LPFA 3VDAA 2Z4FA 2WN3A 3I97A 4E8DA 4GWIA 4KI5M 2C9KA 4P5YA 2Y8KA 3DYPA 3WF0A 5IFPA 4XUNA 2X09A 4BXSV 1TG7A 3ZM8A 3GM8A 2ZEXA 2WZ8A 2VR4A 1IQDC 5DN2A 4M4PA 3C7HA 5FUIA 2VZVA 4FI9A 1H6XA 3WF2A 4YPJA 2WQ8A 3C7EA 3SKJE 1UMHA 2XOMA 2W1UA 1US2A 5IFTA 1NX9A 1JZ4A 4QAWA 4XUOA 2J1EA 5JMOA 4PF1A 2VM9A 3NJXA 3WSOA 3NRUA 1CZSA 5DQ0A 2YG0A 2WBKA 2QQIA 5G04L 4ARYA 2WAAA 1UYYA 2YFZA 4A41A 5LCWL 4A44A 2BERA 2W1QA 3WNKA 1OF3A 2R7EB 1JI6A 3FHAA 3DYMA 2E32A 5B4XA 5JUVA 2VQTA 1US3A 2E33A 1KGYA 1UYZA 4L0PA 3K77A 1UX7A 4AAXA 4ZZ5A 4QX0A 1NAEA 2JD9A 4XUPA 2Y6GA 3T2QA 1OH4A 4OZOA 5JXGA 3LPGA 2VMCA 1GU3A 3FL7A 3OEBA 2ZEZA 3HJRA 2Y6KA 2J1RA 1T2XA 3NQHA 1OT5A 5EIYB 3IB3A 3WF3A 1CZTA 1J83A 2W1SA 3FN9A 4A4AA 1RYYA 1W9TA 3ACHA 3EYPA 4W50A 4JKMA 3I3EA 2QQMA 5LA2A 3OBAA 3OG2A 3THDA 4KWUA 1JYNA 2VC9A 3F2ZA 1R64A 3A7QA 3WNNA 2VCCA 1YQ2A 5IHRA 2DCJA 1D7PM 2LW8A 1L7QA 4BJ0A 4JHZA 2W9XA 2VCBA 3T2OA 3WNMA 1JU4A 4LKSA 4AG4A 4ET7A 5J1XA 4LQRA 3THCA 3C7OA 1O8PA 3W5MA 3T08A 2J1UA 3AC0A 1UWWA 2WAOA 5LA1A 5JR2A 1F4AA 1K12A 1JYWA 1PX4A 2PQSA 2V5DA 4OYUA 3WNPA 3C7GA 2VMDA 5IYYA 1ULOA 2QQOA 1JYVA 2QQLA 1W8OA 5HXMA 4MADA 2BBAA 2OKXA 2VZTA 5I0DA 2YC4A 5B4NA 3CIHA 4IUGA 5F7UA 1GUIA 4XUTA 1EUUA 3ETPA 2W87A 2EIEA 1I5PA 2JDAA 2WO3A 1EUTA 1TVGA 2YC2A 3FHQA 4QB2A 3HEIA 1MPXA 3GXUA 2V4VA 1WCQA 3VD9A 4RN5A 3D3AA 2YFUA 3OB8A 2ZXQA 2XONA 2BGPA 1DP0A 1CX1A 1W0NA 4XZUG 4D0QA 3K4ZA 4QB6A 4BDVB 2E26A 4CU7A 3C7FA 4CVUA 3CDZB 4MOAA 4DXRA 3P6BA 4ZZ8A 5DMYA 1GOHA 1GOGA 3WF1A 4TXWA 4OUEA 1UY2A 2VZ1A 2J1AA 4W4ZA 2VTFA 2RJ2A 2ZEYA 4UOJA 4A42A 4CU6A 4DUVA 4MGSA 3UETA 2W95A 4M4RA 2JKXA 3CZJA 4QB1A 2ORZA 4UAPA 2L9LA 3SEEA 2W91A 3BN6A 3ECQA 1SG3A 2KD7A 2WDBA 5C7GA 2QQNA 4RYDA 3IAQA 3LQCA 1XNTA 1K3IA 1UXXX 2J1SA 3GGLA 1GMMA 3T0DA 4BK4A 4P08A 4PT6A 1UXZA 3I3DA 4QDQA 4CU8A 3IIIA 3T0BA 3JXSA 3CQOA 3PUHA 3OGVA 1LNSA 2X05A 3OEAA 3LEGA 2E31A 2V72A
chains in the Genus database with same CATH superfamily
2AZ5A 3AKSA 2RM22 3VV1A 3B3QE 4MH0E 4UWDA 3DKQA 3ZYIB 1NCRA 2B42B 1BYHA 3RYRA 1NUKA 1Q56A 2D6PA 2W08A 4IV3C 4QPWA 4R52A 4OMCA 1RUE1 4F8AA 1ST8A 1FOD1 2NM1A 4XJZA 5I0SA 1QJU3 2LROA 3UV9A 3J7MA 1LB2A 1U5YA 2ZKLA 2MNGA 5SV5A 5T54A 4EN9B 2W46A 1G9DA 3VZJA 1L7RA 3DF0A 2ARAA 1WBFA 3VD3A 3QCWA 3DCQA 2W1WA 3HMYA 3ASIA 3EBRA 4QXCA 4UF0A 3H1YA 2PLV1 1UYXA 5FZHA 1UKRA 2VZSA 4Y20A 1QOTA 1MEC3 1RHI1 2ATFA 2RE9A 4GMP0 4QPIC 5C8CB 1AJOA 4Q4W1 4ES8A 5T5OA 2PQQA 1ENSA 2XQXA 1UIJA 2GSYA 2QQKA 5C3QA 2J42A 4UW3A 3VD4A 3KM5A 2XG3A 4COVA 5FY5A 5CIRA 1REEA 2VW2A 5ABJB 3MBWA 4K8RB 5DAPA 5KXBA 3OBRA 3ZO0B 1ULCA 1XXNA 3B94A 4P5HA 4INDA 3R05A 3P1IA 2UY8A 1JYTA 1UY3A 5FYHA 2VZOA 1AJKA 4L99A 4AHYA 1CD3G 4UT5A 4Y1XA 1OF4A 1JYXA 1JHNA 5A3NA 2FDGA 2YV8A 1MACA 3UJOA 3PUIA 3ST7A 4PQQA 4Z2WA 4N53A 1HB2A 5A32A 1O4YA 1LHWA 5F7UA 1HQNA 4XUQA 2B8MA 3ZIWA 1H0BA 1LULA 4LHLA 1ULPA 3WF4A 1QNWA 1NCRB 1V6IA 1Y9QA 2JG8B 3ON7A 5SV8A 5IVFA 4M3CE 1RC6A 4RL7A 4B4RA 4CXYA 4FTSA 4QKFA 1AX0A 2P3JA 4YGEA 5L7OC 2YBPA 2C26A 1O8SA 2F6BA 2R071 1LGBA 1D0HA 1ND2A 2EXIA 3RRDA 4C1WA 2VG9A 3I2KA 1Q8VA 4LA3A 4LUMA 4URAA 5E16A 4L11A 3K3OA 2I45A 3N3HA 1B35C 5GZEA 5FLJA 5FAXA 2JECA 1YC61 3WINE 1UMIA 2J22A 1MQTC 4QX3A 3VKLA 4BK5A 1X82A 2QKDA 4XABA 3AM2A 4Q0SA 2RVAA 4IV3A 4URTA 2HEWF 2WNUA 4XHBA 4LBLA 3ZXLA 1RIRA 4ZPIA 4DY5A 1LOEA 4FTBA 4D6QA 3O1RA 1XBFA 2YROA 1H8TB 1IS5A 4FO9A 4GA9A 4OI4A 3VZNA 1NCQC 1WCDJ 2UWBA 4LITA 5DUXA 2XBO1 3AZZA 4DEVA 5DG1A 5T5PA 1UYPA 5J98B 3ENRA 4CDXB 1DQ5A 2D7FA 2OQ6A 2XL7A 3WXPA 3ZXEA 1SLLA 1XNAA 5FP7A 4IQPA 5BNQA 4BZ4A 2VZ3A 1R1ZA 4K1YA 5JDBA 4FQ4A 2DU1A 4GWJA 4NHLA 3B7MA 3BU7A 1A8MA 2C4XA 3A23A 2XR4A 1CJDA 5T50A 3T09A 1R1A2 4DXTA 1QQP1 2DVFA 3BOWA 1W8NA 3B9CA 4JV4A 1Q5OA 3IKWA 3VBUB 2CV6A 3OGSA 4JRAA 1W8ZA 2P6CA 5CFDC 2ZGOA 1I9RA 4M3CB 1DDLA 1VMHA 2NMOA 1S2BA 2QBXA 5BNOC 3OSDA 1BKZA 1C57A 2VZRA 3GYDA 4GKYA 2A75A 2ZCWA 1PZ7A 2MEV1 1XU2A 3MICA 2VVFA 4MVTA 4MXVA 1W05A 1YRZA 4GH4B 1Q8SA 4V2VA 3TAYA 1P8JA 2PHLA 2WABA 4WM8C 2JDMA 3ZLIA 4CUBA 3PVNA 2OQ7A 5DAQA 2AEZA 1VE0A 3BALA 3HNBM 2GP3A 2NPIA 3DKWA 3OD0A 4AFDA 5C3PA 1VBD2 3B02A 1POV3 3DECA 3LE0A 5FY7A 2ID4A 2QNKA 1C8M2 1FV2A 1PK6C 1SLBA 1IPJA 1OC1A 3I49A 4I30A 3UGHA 2R16A 5ACA1 3OPZA 4D8MA 4Z2AA 2WZR2 4J25A 3RZLA 5J96B 5HV4A 1W9WA 1J58A 4UI9L 2D3RA 4NROA 3GALA 3I2IA 4Z92B 1GYKA 1N3OA 3EQEA 2IXCA 1PM4A 2HWD3 3J7LA 5CZKA 2EAAA 4UFJA 2HWF1 5FPUA 4ITCA 2ZPXA 4YG3A 4BE3A 2DFBA 5AC93 4IXLA 4WM7C 3FLTA 1HXS1 5H9QA 2ZMLA 3IDAA 3ZFEC 1KXGA 1UMZA 1UN1A 2JX9A 2K2SA 3E5QA 1HV0A 3MHZA 4Y4RA 2EICA 5FZAA 5FZ9A 2WN2A 5FWEA 4AW7A 2QQUA 4JGYB 4MHUA 4KMQA 4XFGA 1ODMA 5LY1A 2O8OA 3A22A 1AR61 1QJEA 4RSUA 1FMD3 5FYCA 3AXEA 1ZA4A 1W2NA 4WM8B 5HXVA 1NA1C 3U07A 4D6RA 3AFKA 3TEWA 1IKPA 1LOFA 3HN1A 4BHPA 1XNCA 2DCKA 1CVNA 1GQPA 3WDYA 1E5SA 1LRHA 3O1MA 4TWTA 1OD3A 4ISRA 3E6BA 3U37A 1ULDA 4ARXA 1UPSA 4YM1A 2ARBA 4Q0UA 5H9PA 4Q4Y2 5FREA 4AGGA 4Z8BA 3WG1A 4YNIA 5LEJA 3HD8B 1BHGA 2Y64A 3Q8AA 5HPOA 3K46A 3I3BA 4HPKB 2ZGTA 1CPNA 1W9YA 1YNAA 2WS91 3VZKA 2DDUA 1BEV1 4X8NA 4P9JA 5EV7A 3T2PA 5I93A 3DYOA 1KDMA 1AHSA 3V65A 2JG9C 3MPPG 5CFDA 4YVSC 1BLZA 2VOTA 3EMRA 4WVVA 1LOCA 4ZU7A 3O1VA 3WLUA 1O6UA 3LDBA 1V6MA 4HFSA 1OOPA 1WKYA 4Q1PA 3ACFA 5E1RA 4E4HA 1OLQA 1QJU1 2QQVA 4B1LA 1UY0A 2X5IC 1ENRA 3BB6A 1L7LA 2W3JA 3CJIB 5LWBA 2VW1A 1AR83 1W0OA 1ALYA 4YW4A 3O0XA 2W47A 4Q4Y1 1GWKA 1ZZ8A 4XYXA 1X36A 4NJ4A 5FKBA 5A3PA 4XIKA 4YW6A 3U78A 4EQVA 1GWMA 1J84A 4N9IA 1Y3TA 2ZHKA 5CYYA 4Q4W3 4B1MA 1EY2A 1K5MA 3CNAA 4XAAA 3A21A 5JOWA 4P00B 2Z79A 1DLLA 4XQDA 3RDIA 3PMEA 1C8M1 3WDTA 1GWLA 3GZAA 3ZFGB 1AXKA 2BFUS 2WC2A 4PBOA 1LOAA 1CAVA 1ZM1A 5GLZA 3VDAA 5EWSA 3ZN6B 4S2FA 4KH9A 4FOQA 1WLDA 4B7KA 1GZWA 1VRH2 4MGIE 4LBNA 4CCOA 2AUYA 3ELNA 5HCFA 2PHDA 2Y8KA 2BVBA 1NE6A 2RMU3 2X09A 3MIDA 3JU9A 1TG7A 4CEWB 2BW8A 5ISLA 4AE2A 2WZ8A 3A0KA 2RS31 4M4PA 4Q0VA 4QX8A 3ZXGA 1NZIA 3AVRA 3OUIA 3W21A 1DQ6A 4FBFA 5ACA2 3ZSEA 5FO7B 3NJYA 3WF2A 4YPJA 5FR3A 1OKQA 3B69A 2ENRA 1FI2A 2FMDA 3VBOC 1ODNA 2OX0A 3APBA 4XXPA 5FZKA 2XOMA 4LHNA 2WNEA 3ZOIA 4NRQA 3ZSKA 5IFTA 3TB0A 3G7DA 1JZ4A 4QAWA 1N1YA 1CR7A 1KFXL 1M06G 5A7OA 2VMHA 1Q8PA 2OA2A 5LBCA 3AMPA 2VAUA 1Y9MA 2VM9A 3NAPB 3QD6A 3AX4A 4IESA 3ZIXA 2JD4A 1MS1A 3RZZA 3E97A 2QQIA 2VNVA 3PVOA 4BU2A 3EO6A 2ZTNA 2ARXA 1UYYA 1W06A 1E5RA 1XYOA 2WAAA 4LBMA 5GLVA 1V9U2 4AVBA 1OA3A 5J37A 3LA7A 3OBTA 2RS12 2G9ZA 4HETA 4CEYA 1OF3A 5DDJ2 3RS6A 3D4KA 1ZRRA 2VPVA 1YQ6A 1HRV3 1N47A 1NXD1 2WA4A 2Q8DA 4CP0A 3TEXA 2BQPA 1E57A 2VTXA 1SFPA 1W6NA 2VQTA 3O1SA 4PF5A 5L7OB 4I3PA 1C1LA 4XHXA 2Y6FA 3K77A 5F3IA 1UX7A 4AAXA 1VBB3 4F83A 2A6WA 1TMF1 2WRAA 1RJ8A 2GNDA 2Y6GA 4AQSA 3T2QA 2O14A 1W6MB 3IDCB 2GNBA 1LJ7A 3LPGA 1Q8QA 3ZDSA 4NPRA 3PU3A 3OEBA 1VAVA 4DIQA 3BPSA 2AR6A 2IXHA 1V9U1 1FT9A 2WO7A 2WQ4A 2XB6C 3I2DA 3J9SA 4B3NA 5HV0A 1F31A 3ZXAC 2QZ3A 4XCAA 3SISA 4LBOA 1JOJA 2H6BA 3AMQA 1CZTA 2GALA 3UKTA 1Z0HA 2W1SA 4QX5A 2HEVF 3IBMA 2QQPA 2LM3A 1DZTA 1RYYA 5HCBA 5A7SA 2VOXA 2ZA9A 5C33A 2ZX2A 2KXLA 4C91A 1LENA 5CISA 3GJBA 4IW3A 3WVJA 4ZONA 4U36A 1OKOA 2WFF1 3ATGA 1JH5A 3OBAA 3THDA 1JYNA 4KWUA 2VC9A 4JGZB 1R64A 3WUCA 1LESA 3PMSA 1YQ2A 2DFCA 2DCJA 1PIV1 4UW5A 5DAVA 5LRSA 4S2GA 4FVVA 5DZEA 4XTPA 1A78A 2VD7A 2WFPA 3S57A 2SLIA 4QPGC 3SNMA 1PGSA 1ZX5A 1MZ5A 2XJTA 4OULA 4A7YA 5CADA 1WCKA 1KD7A 1RUG1 1W03A 2Q5TA 2WSVA 2Y34A 3MLLA 4EN6B 5AC91 2D93A 3IMNA 3WV6A 2IWGB 4BM8A 1WMEA 2RR12 2HWB2 5JVVA 1R081 3AC0A 2QCSB 1PZ8A 3C3VA 1YFUA 3KB5A 1UX6A 1VAKA 2WNOA 1PO13 4AFAA 2P37A 3URFA 1F4AA 4BIFA 3BYWA 4YW1A 5T55A 1BBT2 3RG0A 1XU1A 2DVDA 4OYUA 1AL23 1GZ9A 2JXAA 3FFQA 2C5DA 2VMDA 1LTEA 3WCRA 1ND3A 2PFWA 1CAUB 2QQOA 4Q4X2 1COV3 4BB3A 3M7AA 5E89A 2IFWA 1LGCA 5GALA 5A6QA 2BBAA 2OKXA 2VZTA 5I0DA 2YC4A 3CIHA 1GUIA 5I0UA 1POQA 4HVOA 2W87A 4Y1YA 4AZZA 4DMIA 2JDAA 4S2HA 1FYUA 3D6EA 2VUDA 2GDFA 1EUTA 1SFYA 1AYN3 2EXJA 4XQ4A 4IE7A 1YEWA 1R091 2D6LX 2RDRA 1SPPB 3FHQA 3HEIA 1DZQA 1CAXA 3R0RA 5FK7A 3JBG1 4P9IA 3KT7A 1G9BA 1NLSA 4IV1C 3VD9A 2YFUA 3VBRC 1NE4A 1PZ9A 2PHWA 2ZXQA 5JOYA 3ZPOA 4LBQB 3AB0A 2VVDA 4OZXA 2I2SA 1NT0A 3O7OA 4XUTA 3FWEA 4LIUA 2DU0A 4Q4X1 2G1MA 3U0ZA 4GALA 4D0QA 3BTYA 3K4ZA 4HT1T 2E6VA 1UAIA 4CU7A 4XETA 4CVUA 1HN0A 3RZMA 3WW2A 5CBLA 5LA9A 4BQWA 3WW1A 4ZZ8A 1BK0A 4TXWA 1VB4A 4J6GA 3NNLA 4IL7A 3CU7A 4K8FA 3TEZA 4CDWC 1R092 2NN8A 4MGZE 3T30A 1H1IA 5CG9A 4MGSA 4HK8A 1HV1A 1RUJ3 2WZR1 1KRIA 3KV9A 1IKQA 2RM21 4K9SA 4DFSA 1E5HA 5ANNA 3RVHA 4AGRA 3FBYA 4QB1A 1VBA1 2L9LA 4OI2A 4RGKA 1EV13 3RSJA 4P14A 1DIWA 1TEIA 1X8EA 1H8VA 3VBFC 5F2SA 1XSRA 2B39A 2D6NA 3V0BA 1FATA 3TEYA 3H8XA 5GZGA 3LQCA 1ZBE2 4ASLA 4Y5SA 3T0DA 3ZXDA 4BK4A 2WKKA 1CGPA 3E6DA 5KR7A 1BCXA 3WY6A 4RR3C 1FXZA 2GC2A 4EROA 5KC5A 4YGBA 2CHHA 3AP9A 2ILMA 4CSWA 5JPMB 3L2HA 3T0BA 4YARA 1CAXB 4LO8A 1UL9A 3JQWA 1ZBA2 1RUI3 2BNOA 4NIDA 3OGVA 3B01A 1LNSA 4I01A 1GLHA 4Y26A 2YY1A 2YU1A 2LTNA 1DF0A 2V72A 3T1LA 1HRI3 5IK5A 4NUBA 4A45A 2WO2A 2Q8CA 3KWVA 3SQOA 1PK6B 1DBNA 3HR9A 3MLJA 3ALQA 3NJZA 4C90A 2D6OX 2VBBA 4CDWB 3VDCA 4J1XA 2QTWB 1CWPA 2FDJA 1AXZA 2WA3A 1I3HA 1MQTB 3PTRB 4GH4A 4Q4V3 1CAUA 5CA6A 1OPMA 3WZ1A 4META 5IVVA 1ZBE1 2AENA 5C3OA 2R49A 3CKHA 5GLTA 5JIUA 3VKFC 4TSVA 3TN93 5CFCC 3N36A 1SEFA 2UU8A 4IEVA 4LR4A 4AEJA 2Y6HA 3BPZA 1UZVA 5LB6A 1DYKA 3IDEA 3NKGA 3HVDA 4M0HA 1BQPA 5A32B 5FYSA 3IIAA 1QU0A 4BOWA 4N7UA 1RUF2 4QDRA 3WP4A 4AEKA 4AVTA 3FZ3A 4FAHA 4YVWA 1H1AA 1AYM2 2ZEWA 1TNFA 2ZHNA 2C6SA 3S5AA 1HB3A 1WW7A 3VL9A 4LMFA 2VNGA 4KL1A 4CZSA 4ONUA 2A6ZA 1AR73 4LLFA 3MV01 2BBVA 2IC1A 3UK9A 1TMF3 1F5JA 1WMXA 1VAMA 1SDDB 1RUNA 5GKAC 3MIFA 5C4WA 4RFT0 4ZU5A 3B9IA 1UOFA 3UGGA 1Y43B 4FPGA 3SMHA 1GZCA 2KR2A 5K4LA 1WD3A 1V00A 3FE5A 3A0NA 1YQCA 3AYCA 2HWC1 4YW3A 2WT0A 3JZVA 4R9BA 1DQ4A 5DZFA 2JKBA 1FOD3 3DN7A 5A3TA 3WEZA 3RFRA 3W20A 3HN3A 1NY71 2UWCA 2B9VA 1WW5A 3ZSMA 1MS3A 4BH9A 5CVRA 4LK7A 2FDHA 3EHKA 3ILFA 1Z7S3 3TWIA 4IEYA 2G19A 5EZWA 1W9SA 5DPNA 2VXJA 2ZX3A 5KXDA 4FFGA 2CDOA 1FV3A 2WYFA 4FP3A 4MO3M 1ZBA1 4N53B 2A6YA 2RDNA 1LODA 5JR7B 2FCVA 1NQJA 1VBE2 2BVVA 2GC1A 3CF6E 3QBQA 4CP9B 5I8YA 4GKXA 4XFBA 2RJLA 1XC6A 4QDSA 4ATFA 4DB5A 4UFHA 5FZMA 4AI9A 4HMZA 4OHWA 2XUMA 1W99A 4FFFA 2X53S 4LE3A 4JTNA 3ACIA 5JMCA 2A3XA 4NHXA 3DXTA 2EIDA 3SH3A 3NV2A 3WR0A 3USUA 2IXJA 1JS9A 2WSUA 4OCTA 1PO23 1NA1B 1PGW2 1QJX3 2WWJA 4CDXC 1WWYA 2R073 1K42A 5A33B 1KDKA 1LHVA 3WOGA 4FPEA 2ZX0A 4R4ZA 2UWAA 3A4UA 4BMBA 3LWCA 2VBPA 2R061 5JI9A 3CLPA 5JZGB 1QJY3 3N35A 1F35A 5FPAA 4N90A 3BKZA 4CCNA 5C8CA 1VBA2 4JHTA 2JWPA 3O0VA 4GMP3 4Y20B 5EHDA 1REDA 1MS0A 1W8FA 2Q30A 5L19A 1X33A 1AR92 1HB4A 1O5UA 4YVWB 5FLIA 3THPA 3VZMA 4MGQA 4LO4B 4XBLA 2E51A 4QD2A 3M2MA 1V0AA 4YZ1A 4R9AA 4WZCA 4G3YC 4GAZA 3LA3A 3MUZ1 4FPLA 4PIZA 1UCXA 2VO5A 3GZEA 1DQ0A 4UBGA 2A3WA 3JBG3 3ZN5A 4AI0A 3EJKA 3BGAA 3I2HA 5C5UA 1C4RA 1S2EA 4AEDC 2QDNA 3GZUC 4JZRA 1GKBA 5KXCA 3N7JA 1AL0G 4MSVA 1GV9A 4YZ5A 4LHSA 4CEWA 4Z82A 1I6XA 3AXDA 1WLCA 2YB7A 5IT6A 3MPBA 3PJYA 4YM2A 2FDIA 3GBWA 5LASA 1JZ8A 4HANA 3RWKX 3SITA 1DGRN 2QQJA 1IPKA 3KV6A 4K21A 2XBO3 4W6WA 4Q26A 3D0JA 4C8DA 2FDKA 3N9NA 4B4PA 1S0IA 1PVXA 4PHZA 3VB9A 3LKJA 1HX6A 3FFZA 4JRLA 4O9EA 4FPHA 2Q4SA 5FOJB 3C8XA 2OT7A 2CWSA 2VY0A 2A1XA 1DYOA 1QY4A 1TME1 1S0GA 4EJRA 2O0OA 4EZ4A 5CFCA 4DEQA 3IAPA 4N7IA 4QX2A 5T52A 4EN8B 1JZ2A 3WP3A 5G05L 1QQP3 3S0MA 3CJIA 1UZWA 2W92A 5BYNA 4LO6B 4RHV1 5CNAA 3VDDC 4XW3A 4XVHA 5IK8A 3ZYRA 2GNMA 3N9LA 2JDNA 1OMIA 2X10A 4BLIA 1J59A 2AC1A 2FZ2A 4FPOB 1JZ7A 3MO4A 1W8HA 2LRPA 4ISQA 5FTTC 1UOJA 4IEZA 2BYVE 4TZDA 3OUHA 1D4M2 3VBOB 2XJSA 1DZRA 1RUH2 1RUI1 4XJAA 1POV1 4KGQA 4PJYA 3VZLA 4A6OA 2BPA2 1WD4A 3U75A 1GICA 4B8EA 1RUOA 5CAZA 3WNLA 2PLV3 4LKEA 3S30A 3VBSB 4D6SA 1RHI3 3D82A 3HT2A 3NAPC 3ZFFC 3ITQA 1DGRA 1JOPA 5DUVA 3I2FA 4E27A 1SBDA 3H9AA 2HWE3 4XURA 3QH6A 4KWKA 5IVEA 4QXKA 2AH2A 2LALA 2XGXA 3VHNA 2RV9A 3I59B 3ACLA 3PTYA 5FZCA 5JIAA 5IK7A 1MS5A 2BV4A 3KMHA 4JGYA 3OY8B 4FPFA 4LXLA 1A6CA 3AP6A 2OPKA 2R32A 4YLZA 4IEOA 1QH6A 3MUY1 1IG3A 3OGRA 2E7QA 5I8TA 3VD5A 5JPNB 1AR63 2WS93 1AUYA 1FMD1 1QXRA 2JB8A 2ZMNA 3CO2A 4LBKA 3K4AA 4QU2A 5IJRA 1W28A 4V2WA 4W6XA 2IZWA 2PHUA 1UZ0A 2CYFA 4NVPA 1NOVA 4CA9A 3U1XA 3LPFA 2VBDA 2GN7A 1DHKB 3P5BA 4I0WB 3K48A 4OHXA 5FZDA 3BODA 2PA7A 3I97A 4CE8A 3J8F2 2W0XA 4E8DA 2WLPA 4KI5M 1LEDA 1W3XA 5IFPA 3DYPA 5FPLA 5CG8A 3WQ0A 3PU8A 3MYXA 4TLGA 3Q8BA 1FPN2 5A7WB 3ZFFB 3NVCA 4BLJA 1AR81 2ZEXA 1YUDA 2VR4A 1CN1A 5FXXA 2ZX1A 5FUIA 4GWMA 1W6PA 2VZVA 4IE4A 3RZGA 2HJIA 4JVAA 1G7YA 2DUQA 3FJSA 1O91A 3POFA 1H6XA 4FI9A 2RS11 4HVRA 4LKFA 5CKMA 3SCFA 5GZCA 1K5JA 4RGGA 3C7EA 1ZZ7A 3SKJE 4DINB 1UMHA 3NNFA 5FKCA 4CPBA 1WW6A 3U14A 2ZHLA 4LHKA 3H7YA 4NHMA 3RWNA 4D7TA 1US2A 1DU3D 4AFMA 4DS0A 1NQDA 3VKOA 4AI1A 5B2GB 3I4IA 4XDQA 5IVJA 3PUSA 2HWF2 4NO4A 3UL2A 3VHRA 4DZGA 4PF1A 5I0TA 2FDFA 4XMAA 4BISA 4AGVA 2JIGA 3OJBA 1WGPA 3KS7A 2ET1A 5AVPA 1MS9A 5G04L 5A6XA 1C8M3 5FY1A 2GH2A 4X6RB 1ULFA 1OFSA 4N43A 1X7NA 2RDSA 4HK9A 5GLWA 3HWJA 4A44A 1OI6A 2BERA 5F3EA 2CAUA 4AEDA 2W1QA 3WNKA 5E8AA 4W6YA 2P4EA 3KVBA 2R7EB 3LAGA 5A6ZA 4E4SA 2IUWA 2OPWA 1GP5A 1GBGA 3KF3A 3H1MA 5FMOL 2YU2A 1WZXA 2B9UA 2RMU1 2HWD2 2E33A 1CAWA 1PO21 1QJX1 5FXVA 4L0PA 2YBKA 4IV3B 2I74A 2Q1MA 2QE3A 2X29A 3MI8A 4YG6A 2OS2A 2GP5A 1UO9A 1NAEA 2DTYA 3OF1A 4AHWA 5JCTA 1TQ5A 4HKWA 3VUOA 1S55A 1J3PA 2CL2A 3NWKA 4GMP1 3LDRA 2BNMA 3FL7A 4MUVA 5L7OA 1D2SA 1CX4A 3HJRA 4L9BA 5C8CC 5IVCA 1DGWA 2J1RA 1T2XA 3VHPA 2YGLA 3MW3A 4B4QA 2C9AA 4CDQB 3IB3A 4EYUA 3WW4A 4ZHNA 1QJU2 1J83A 1IPSA 3IPVB 4Y33A 5FWJA 2CWMA 1W9TA 3RYPA 3ACHA 1O3QA 1DFQA 1CESA 3HBZA 4QKDA 4W50A 4Y22B 5C3SA 5FLHA 1F5FA 2EIGA 3AL5A 1XNBA 5LA2A 5DG2A 3OG2A 5FO9B 2IXLA 3F2ZA 3HQRA 4AXOA 3A7QA 3WNNA 3E5XA 2YBSA 4A6SA 3WUDA 5IHRA 3BTZA 4NOTA 2LW8A 4E2QA 1KITA 1UU5A 2XJQA 4QHZA 2JEMA 4Y24A 5JSPA 1LOGA 1RVF2 2FHRA 2W9XA 4YSFA 2WNVC 1JU4A 4IDZA 5L9RA 3TNQA 4AG4A 3ZYFA 5FY9A 1E5IA 2JJ6A 4YGCA 4IEQA 2HKXA 3C7OA 2XKOA 5FYTA 1ACCA 1AR82 3NV4A 4C0HA 3W5MA 4AYUA 5FZLA 1VMJA 2BP6A 4HKOA 2BJSA 1PGW1 1QXJA 2WWSA 3P3PA 1O3RA 3MGUA 1JOBA 2VULA 1JYIA 3ZFEA 1JYWA 3E6CC 4HKLA 4CDQC 2TEPA 1VPHA 2WFF3 4HN0A 4OUSA 5C8WA 4QPIB 4MG2A 1QNYA 4CP9A 5FY4A 4Y4YA 1HQWA 1UQXA 2WNVA 3H8RA 5I0RA 5IYYA 4LJHA 3GCXA 1LU2A 5APAA 1QGLA 1A3KA 4JDMA 4EWDA 3J8F1 5HXMA 2MHFA 1VB2A 3MEPA 1CAVB 4D7YA 3UJQA 2ZGSA 3ZFGA 2GH8A 1ND2C 2RS52 2E63A 3DPRC 3KV5A 3ETPA 4GIQA 3N9PA 3POEA 2TUNA 2RMU2 1UIKA 2AEYA 1EAH2 1G9CA 4XFCA 3MW4A 2EIEA 1ZRFA 3MLKA 1LGNA 2RS32 1B35A 3ORJA 5FQ0B 4HVQA 1TVGA 5FY0A 4Y5Z0 4BPZA 5A70A 4H7LA 4PDWA 4K7JA 3QLQA 1PIV3 2ADDA 2F4LA 4AVSA 3GXUA 4FOYA 1ZZ6A 4IV1B 4N43B 5FFOC 4OHZA 2EALA 2EXHA 4RN5A 4KGGA 3OB8A 4CXXA 3WX5A 3GHNA 2VOVA 4PI0A 2V5YA 1OLMA 5I91A 2GMMA 1DP0A 5FZIA 2QDRA 1OOPB 1YI7A 4XF0A 2MEV2 4XZUG 1IHMA 4JTOA 2HBUA 4QB6A 3RQ0A 3HBKA 4E4DX 5A6YA 3PLQA 2P34A 1RUE2 4GULA 5CFDB 5EQUA 5FPXA 5J36A 4MOAA 4PBPA 1QH7A 5DMYA 4OVEA 3I54A 4X6QB 1PO11 1GOGA 3WF1A 3T3YA 3RPQA 1S0EA 3GHMA 4PIYA 1UY2A 1HXS2 1XE0A 5CKQA 5F5IA 2XKPA 4I02A 4W4ZA 3KVAA 2XVLA 5F6KA 2BWCA 5FK8A 4RS5A 3VBRA 1W3VA 2JDZA 3KCXA 3R4SA 3T4HB 5C4WC 3UETA 1PMIA 1NXMA 1IS6A 4Y1ZA 5ANQA 1KJRA 1CJPA 2CSGA 3LZZA 4M4RA 1IS3A 4E2GA 3AP7A 1W6OB 5DDJ3 1AZDA 1O5LA 3BTXA 1MS4A 1S0JA 4RQPA 3AMMA 5A3OA 1Q43A 1NCQB 1RITA 3JQXA 4HLTA 3GGLA 1K3IA 4WM8A 2J1SA 5KHHA 2PYTA 4QGLA 4PT6A 4CCKA 1YHFA 2A6VA 4QDQA 1QXPA 4IE5A 4CU8A 1WLWA 5K0UA 1RUC2 3ZN4A 1R082 2YYOA 3FLPA 3KCYA 4XCBA 3CQOA 4CEWC 2HYKA 3PUHA 2AACA 4GJZA 2ZABA 4K6BA 5FZ6A 4QT6A 1RMU2 2Q8EA 1V6KA 1ZZ9A 3AFGA 4QXHA 1YFWA 2YUEA 2E31A 3JUUA 1TE1B 5CEHA 2WLQA 1QOSA 1RUJ1 2WZR3 4JQRA 2HYXA 3VBHC 3NNMA 2ZKNA 4UYBA 2R043 2HLEA 3DGTA 1HLCA 4NHYA 4LE4A 4AI8A 3O1PA 2E9QA 4XZPA 4EWAA 1CONA 1SBFA 2CGPA 5F1RA 1JZ3A 1AVBA 3I59A 3OYWA 4MYEA 1JHJA 3K3NA 5AC92 4ZU4A 2XLGA 4M00A 3ZYBA 4ASKA 5BY5A 3QOPA 1XQNA 4QXBA 3RNSA 3V0BB 1IZ3A 4ZXKA 1F9KA 1W8UA 2VOWA 3UESA 4BQ1A 3W5NA 2A71A 4QHBA 4AFBA 4CDUB 2JICA 5K0UB 2LUWA 1QDOA 3GDBA 3J7HA 4PLOA 4XBNA 1S0DA 1OA2A 1QWRA 1EV11 1MZFA 5GZDA 4M0NA 3H3UA 1CIYA 1W6QA 2F4PA 1MVQA 3LA2A 4P9XA 4RFRB 3VKMA 4OFGA 3WF3A 2DUOA 3NNGA 4FAGA 1YXWA 2VCAA 3E1F1 3LSDA 3VBUA 4COZA 4DOUA 4R8HA 4YZ3A 2BZDA 3GZTB 4O61A 4J1WA 1GQHA 2B7YA 2VZPA 4IEUA 5FYBA 4KWJA 2J1TA 3TNPB 2FQPA 5AVAA 4CRQA 1GP6A 1OUSA 1PO12 2ZMKA 2WIIB 2ZGRA 3BIWE 4DUWA 4CCMA 2JG9A 3X29B 3VD7A 2DCZA 3PUQA 4GXLA 3MDPA 1C5HA 1OVSA 1VBE1 3AYAA 3CL1A 5KXEA 4LBQA 1S0BA 1S0CA 1XNDA 3C2UA 1RUD2 2H0VA 3MFCA 2CDPA 1H8TA 5C9AC 1GFF2 2Y26A 4A3XA 1DLCA 1H4GA 1GZTA 2FD8A 3GF6A 2OUHA 1HJFA 1EAH1 4OHVA 2WJSA 4HZFA 5IWFA 3L9JT 3I2GA 3Q8FA 3RI8A 3PHMA 3WHTA 5FBZA 1ZRIA 2VQUA 3JD73 1AYN2 1Y9GA 2Z2SB 4OI1A 3T1MA 3ILRA 1WMFA 5A1AA 5FP4A 5C6CA 1VBC3 2QUOA 2OUJA 4LORA 3DXUA 1RTVA 1T6GC 5F5QA 1VBD1 3VBHA 1H2LA 3UYJA 3WNOA 1BMV1 3LB9A 1B09A 2Q1FA 2ZZJA 3ES1A 2DBIA 3M1HA 1ASJ2 2R6QA 3J4UH 2XWBB 2HWC3 1XE7A 4RQPB 3WHUA 3RZJA 1POV0 2UY9A 4G9SB 5A80A 4CUCA 4D94A 1VRH3 3PDQA 4TN7A 2PXJA 4ZS3A 1XYPA 1O59A 2ZGQA 3M3OA 4H55A 4O7XA 1YYNA 1L3JA 2ETEA 3PURA 1QKQA 5C9AB 4KWLA 4RS5B 4JAAA 1C1FA 2DVGA 2EIBA 2Q0AA 3FX3A 5JI7A 1AYN1 1H2NA 1AX2A 1NLQA 1R093 3ZR6A 2YPJA 4AAPA 5FPVA 4DXZA 4XFIA 5K9YA 5JSRA 1O3TA 3I2JA 5JZGA 1XSQA 3CMGA 2D5HA 2VMEA 1OUXA 2VQAA 3AKTA 3AKPA 2ZAAA 5FMDA 2ZGUA 3BVCA 4DO0A 1MZEA 1O3SA 3S6PA 2BRTA 4QX1A 5C70A 2AGSA 3K2OA 4CP2A 1JN2P 2PHRA 5L36A 1PVC1 3SKVA 2CGOA 4E8CA 2GC3A 4XFAA 1YJKA 1TME2 4A7ZA 1LEMA 2RJKA 4HSLA 4WM7A 1RUH1 1WCSA 1CZVA 1DGWX 1ZBA3 2D40A 2G9GA 1SBEA 1UY1A 2RG4A 4MV2A 5LBFA 3SXWA 4ASMB 2LS6A 1VLNA 2D5FA 2NZ9A 5T3NA 2R063 4XDOA 4FT8A 4G4FA 3T0AA 2DURA 5KHIA 1PX3A 3H1WA 2ET7A 2RM23 2WWUA 2H0BA 2PAMA 2GMPA 3PJQA 3UNPA 3ABZA 4FTEA 2C0ZA 2VZQA 1KS4A 5F2WA 4FQZA 2NLRA 3AK0A 1HW5A 4YW5A 3V0AA 2VJXA 4K40A 1AYM1 4B29A 4YFZA 4IEWA 1RUG2 3KD4A 2JENA 1NY72 2EF6A 1FAYA 1YWKA 4GB31 4I3GA 1PVC2 2WZEA 3O14A 2Y0IA 3ZYGA 4JCKA 4FXKB 3VL8A 3ZYHA 4A3ZA 5D1IA 2PHFA 1W2OA 2Q1ZB 4QU1A 1KQRA 1RUD1 4CCDA 2O1QA 4QKBA 4GZ9A 3MW2A 5DABA 4W8JA 4FOVA 4JX0A 1CAWB 1BMV2 2DBNA 2YPDA 1G8WA 2I07B 4NIGA 2B4KA 1A34A 4QM8A 1C28A 3LEIA 1KEXA 4P9YA 5A7PA 5JXJA 5L9BA 4QPGB 4RD7A 1VJ2A 3MZHA 1AR72 1BK1A 2EA7A 2D6MA 3SCHA 1TMF2 1JZ6A 5FYMA 3MF6A 1IGOA 3NMBA 1JUHA 1SHWB 5IVYA 1HKDA 1CIWA 2ARCA 2R30A 4GB32 4DXSA 4AQ2A 5FJHA 2XVKA 1XJAA 4FP2A 3AMHA 2PAEA 2FMYA 1UY4A 3M70A 3LDKA 2A6XA 1EPZA 3Q8EA 2P1BA 3IPVA 3W58A 3MV11 3BCWA 4X8PA 2D3SA 4AHXA 3T2TA 4XQWA 2XPJA 3POJA 1BVVA 1V6LA 1FOD2 4RHV3 1OLRA 3WDXA 2DF7A 4JKLA 1U0AA 3M3EA 1H8TC 4CCCA 2CAVA 2VMFA 3Q8CA 3PVEA 5DAWA 3WG4A 5ABJC 1HN1A 2RR13 1LCLA 4IGQA 4QQOA 2HWB3 1EYBA 2OZJA 2PHTA 1AR71 3KV4A 3IM0A 3H8OA 1OQDA 3UT0A 3ZKYA 4CDWA 3OEAA 1S4CA 3ZN6A 1PK6A 1XB9A 5TSWA 2A73B 3ZX7A 4PIXA 5H9RA 3AYDA 4B7EA 3WP6A 1BBT3 3IDBB 2ORXA 4DRRA 1ND3C 1HQLA 3ZFFA 4Q5OA 1AL22 4AI2A 3HNYM 4NPMA 4XDPA 4XF4A 2OW4A 2WT2A 4QM9A 5BNNB 4P9GA 3H42B 5LW9A 2R1BA 4QMAA 1VIWB 2Z4FA 4IGOA 1GSLA 3VZOA 4R9DA 5BNOB 3POWA 4GWIA 4XPVA 2R1DA 1N3PA 2C9KA 2D97A 4P5YA 3WF0A 4BXSV 2JG8C 1VRBA 4ES9A 2NP0A 3ZM8A 4S2DA 2DYCA 3GM8A 5FYVA 5FO8B 1K5MC 5E6HA 3WNXA 1XOYA 1Z7S1 5DN2A 2C24A 4WV8A 4D7SA 5BNPA 3OY8A 3I3MA 3LSEA 5FZ4A 3OD4A 3AZVA 1LOFC 3VBFB 1N1VA 3WG2A 4ATEA 1R1A3 1DGLA 3VDDA 2WQ8A 5A1LA 1G9AA 1UW8A 1STMA 2HWE1 3AZWA 1AR93 2A5ZA 2VU9A 4N43C 3LEMA 3S7EA 5T5LA 1I5ZA 5CU1A 2GU9A 4BQ2A 1NX9A 2E7AA 2VTXJ 2R0HA 3M3QA 4XUOA 2J1EA 2Z5WA 2HH9A 2K0GA 3QH7A 4I0BA 3VBSA 1JW6A 3NJXA 5DUWA 3NRUA 2IXKA 3GBFA 5EJ3A 1D4M1 5DQ0A 1FX5A 5FY8A 1VBD3 5T5JA 3ZXKA 2WBKA 2XXZA 3AZYA 4YVSA 3AL6A 5F3CA 1LHOA 1XYNA 2JIJA 5F3GA 1YLLA 4A41A 1W9FA 2DCYA 4AR2A 5BNPC 1GNHA 3W59A 3VBFA 2XWJB 2R0FA 1DG6A 4MZUA 2XMLA 1RVF1 3FHAA 3ZVXA 1RXFA 3FC0A 2B45X 5JUVA 2E32A 5B4XA 2VMGA 1JTZX 1US3A 2VUAA 3CEWA 4NRMA 4TLFA 1KGYA 2HBTA 5FZOB 4DQAA 3U4XA 5GLUA 3OUJA 4CUGA 1S2KA 5J3UA 1OA4A 3Q9OA 4QX0A 4XEZA 2JD9A 4XUPA 2BUKA 1OH4A 2ZS6B 3KZ4C 4NIAA 1MEC1 1RUI2 2YMZA 4OZOA 4QQPA 1DQ1A 1GNZA 3POIA 2XHKA 1SQ4A 5BNNA 3DPRB 1QQP2 5BPXA 1BEV2 3WD5A 1GU3A 1NCRC 3NNJA 2NQYA 4LBQD 2UYBA 4YVSB 2W39A 5JZGC 5LY2A 5FZBA 3RI9A 1N1SA 5FRAA 2YZ4A 3NQHA 5A3WA 2XDVA 1CPMA 4M01A 4V1PA 3FBMA 2X5IB 3MIEA 2GN3A 4KNCA 5FPZA 3PL0A 4BQXA 3T4VA 3FN9A 3ZDVA 4XJ8A 3POSA 3LOIA 2IFRA 1RUH3 3DEMA 3GBGA 5FYIA 5IW0A 4XBQA 4IEPA 1FPN1 3HIFA 3LD8A 3BU0A 2JDYA 4H2AA 3H0OA 1W2UA 4AEMA 1F15A 4W65A 2VH9A 2GNTA 2VCCA 5FUPA 1MEC2 1W04A 2PTMA 1L7QA 3KGZA 4NN0A 1BXHA 2E53A 3CJXA 2W68A 1MZ6A 3T2OA 4AI3A 3THTA 3L2YA 1RUF3 4A7KA 4IEXA 5FZGA 4NMIA 1VR3A 2XJRA 2UURA 2IVJA 3CHXA 1AYM3 3DV8A 3TRSB 5EP9A 1ULGA 4ET7A 3LF7A 4HSJA 2ZGMA 3AP5A 1O8PA 4E2SA 3G6JB 3DUIA 2VQ0A 3RMXA 3T08A 1ZVFA 1UWWA 4RA0A 2WAOA 1OD5A 5CFCB 3SCGA 5CB7A 1K12A 5J48A 5A33A 2WNUB 4Q4W2 4YYOA 1H2KA 2FZ1A 1W90A 5DXDA 3UKVA 3M4FA 3R4UA 5L73A 2Y33A 3GJAA 3C7GA 3N9QA 3USUB 5JWPA 3FUOA 3WQ1A 1C3HA 1ULOA 3VN4A 4EV0A 2Z69A 1W8OA 5A3LA 3CJIC 4MADA 4PLMA 5BV6A 1H2MA 3D0SA 4L8QA 1ND2B 1W0PA 2AYHA 5D8AC 2FBEA 3UGFA 1NG0A 3K51A 4BQ4A 3NV3A 3AKRA 4SBVA 1I5PA 2WO3A 3FLRA 3KQRA 3INAA 2BOJA 1LHNA 3FMGA 1IQAA 1UD1A 3WG3A 2H6CA 2D3PA 3POBA 2JG8A 1WMDA 2QJVA 2YC2A 4XJ9A 3MFAA 4H7MA 4YFWA 1RUC1 5IUQA 5DAXA 1QF3A 4U2AA 1GP4A 1LECA 4UFIA 1U5XA 2XONA 4L92A 4XC9A 2ZAHA 4XTMA 3TBDA 2VMIA 4EN7B 1CX1A 3VKNA 5BUVA 1MS8A 4WM7B 3ZYPA 3NAPA 5FZEA 3ZKUA 1W0NA 1HJGA 3NV1A 3PUAA 2V4AA 4BDVB 2E26A 4YVWC 2UYAA 3C7FA 3HQUA 3I7DA 4MX3A 4RQPC 5LEKA 4DXRA 3O1OA 3BUCA 3PNAA 1YIPA 2R072 3KSCA 4OUEA 3HAGA 2ZZQA 4WVWA 5D21A 4SLIA 2J1AA 1BBT1 3B5LB 4XIOA 2XUEA 2DV9A 2ZEYA 5C4WB 4WVMA 2DUPA 4QX7A 1NA1A 2N7GA 1TZOA 1S0FA 3RZKA 5LZ6A 2VNRA 3AP4A 2W95A 2BOIA 3H3ZA 3OOXA 2BTVC 2ORZA 2RS13 1C5IA 3AYEA 3I3QA 3BN6A 4KG0A 2GMEA 1HRV2 2KD7A 2WDBA 5C7GA 4COWA 3KGLA 4RYDA 2E7TA 3IAQA 2ZBJA 4E4ZA 4P08A 2EVXA 2VOKA 4Z07A 1UXZA 5FCCA 1GZWB 1VBB2 5ERLA 1U12A 3JXSA 2TBVA 3JBG2 3KT1A 3NW4A 3I8TA 3BTAA 3D8CA 4YWAA 1R1A1 2OZ6A 2X05A 1AF9A 2VECA 1Y4WA 4AFCA 5KBFA 1QDCA 2CNAA 1AR91 1RXGA 3VBHB 1VMFA 1MQTA 3AJYA 1SLAA 1PMJX 2ZX4A 3VDBA 4HG6B 2W5FA 1W8WA 3KLSA 2FCUA 2XH6A 4Q2FA 4XILA 1S1AA 4FPJA 2BFUL 3HPNA 5DDJ1 3WQBA 4BXFA 1F2NA 2BGCA 4Q1RA 4Y3OA 4ZXEA 4Q27A 4AF9A 4PCRA 1QJFA 5K7PA 2ZGNA 4QQLA 3KT4A 2TNFA 2VVEA 2JE9A 5FXWA 3HNMA 2G4IA 3F95A 4QGMA 2VL4A 3P3NA 5C3RA 4FPCA 4EZHA 3N7LA 4IE0A 5C5TA 3VBSC 2C1FA 2V73A 4O9GA 3HOBA 3LEKA 1UZYA 5C71A 1N3QA 4Q0PA 4UBHA 4BWOA 1UNBA 1GR3A 2JE8A 4QWNA 4XFHA 5IVBA 1T6BX 1W2TA 2WUHA 1FMD2 2J7MA 4AL9A 2VE1A 3K75B 1RVF3 4JKKA 2WINB 4P02B 4LLOA 3WT3A 5A3UA 3FHIB 2R041 4OMDA 4F7ZA 5C9AA 4EN0A 1H9PA 2WO1A 5DZGA 4QGNA 5A7QA 3BI3A 1NLRA 4Q4Y3 5FZ0A 5KHJA 3IT8A 1ENXA 4WBBA 1ZYBA 5FYYA 1JBCA 1OQEA 1QEXA 4H14A 2GC0A 4IERA 4NHKA 5FZ8A 2A7AA 1RINA 5JXIA 4K1ZA 1YQ8A 4FFHA 3GNEA 5LRRA 5EJ1B 1Y7BA 4CCLA 4H3WA 4P9WA 4TTGA 5A7NA 2WFF2 3ILNA 3WQ7A 3LOBA 2PLV2 4XJUA 1BVP1 5EYXA 1OSGA 1RHI2 5F8PA 1COV2 1XPWA 2X5IA 1APNA 1OBNA 3RMYA 2HWE2 1OPOA 5GZFA 4M3CF 3SEPA 5CKNA 4UFMA 4NR1A 1H6YA 3LFMA 2RS53 3S7IA 1H30A 3HQXA 1IOAA 1V70A 1LR5A 3H7JA 2YHJA 4JC1A 1ONAA 1V6OA 3KHCA 3PVBB 5D8AA 2BGOA 2RS33 3AJZA 3DPRA 3MF9A 5FP8A 5KHKA 4KG8A 2OXBA 2ZACA 4C0BA 1OHFA 4UFKA 3AKQA 2Y38A 3NJVA 1PIV2 4CCEA 1YFYA 1JMUB 4E9KA 1AR62 4OLLA 4XFFA 3ETQA 2DVAA 3SLIA 3VGIA 1RUF1 5FZOA 4DNYA 2CU5A 1J3QA 4FFIA 3LIHA 4YW2A 2SBAA 3ACGA 4NE9A 2MEV3 2MPFA 2A70A 3J8F3 2ZGPA 5EJZB 1UZZA 1J1TA 1F4HA 1JZ5A 2P2KA 4LUKA 2Y6JA 1PM7A 1K45A 2BDRA 2RDQA 2VCMA 4LTAA 4PQ9A 2WZPP 1URXA 4AWDA 3O1UA 2XQRA 4M3CA 4DUXA 4OI0A 1HXS3 3JD71 1W6QB 4FOWA 3MIHA 1SDWA 4NWWA 3TYJA 4BMEA 5ACA3 1F8VA 3ME2A 1RUJ2 2ZGKA 1IG0A 1HIXA 5JXHA 2BU9A 4LEJA 1LKNA 2WR9A 1RMU1 2EAKA 3EB7A 5FBJA 1SACA 4CDUA 4LT5A 4BIOA 1JU3A 1XNKA 2XJUA 1EV12 3VBUC 1YIFA 3RYKA 2DVBA 3VBRB 1OXCA 4HOOA 1BZWA 5FXZA 4LA2A 4XJWA 4CYDA 3JB8A 1WW4A 4CDXA 5EXOA 1H9WA 3WDWA 2WYSA 4LPLA 4PLNA 1VBB1 1QOOA 4UFLA 4LULA 3NSTA 3J26N 4DY3A 3LGRA 5FPBA 2XLAA 2P6HA 1BJQA 1FNYA 1PNGA 2D6KA 4QPYA 1RUC3 4K3UA 3KHBA 4XAEA 1PMHX 1SPPA 2OYZA 4AQTA 5BNPB 4OHYA 2VUJA 4N8MA 5FMCA 2Y6LA 3OTFA 2VZUA 1GOFA 2DTWA 3H50A 1X9PA 4KQ7A 2K9ZA 3KCCA 4CEYC 5JOXA 4I09A 1V9U3 1OURA 1HRI2 2PHXA 4XF9A 4WVZA 4IV1A 2W94A 2QZ2A 1YI9A 2R042 4N9HA 4CP1A 3PIJA 2VGDA 1VRH1 1ZZBA 4EE2A 1LOBA 4MLOA 3VHOA 1B35B 1ND3B 5M0TA 1QIQA 4Q4V2 3NKTA 3IMMA 4NAMA 4XOGA 5FP9A 2B46X 2XHNA 1OH3A 5GJ6A 4Q0QA 3TN92 2QFEA 4IE6A 3LFIA 4OQ8A 3CBNA 1W6MA 3ZSLA 1W6OA 5J09A 1DCSA 4FCAA 1MR5A 4JDNA 5L9VA 1C8NA 5H9SA 1H4HA 2WNVB 4QQ2A 3SH5A 5FJKA 1UOGA 1XE8A 2XJVA 4QPIA 1REFA 3ZXFA 4BQ3A 4ZKTB 4MHRA 5J7MA 3H3LA 4BQ5A 3DL3A 2G9FA 4CEYB 3M3CA 2ADEA 4XF3A 4KU8A 3N7KA 4C1XA 4WVMB 1RJ7A 4JGZA 5ABJA 3ZYJB 2W52A 1PNFA 2VUCA 3CZUA 1OLME 1WLTA 2WT1A 2D98A 1HB1A 3B93A 3K4DA 4YG0A 5FMOS 4NIIA 1RB8G 3GCWA 3N9OA 4JDOA 1IS4A 3IN9A 4FPKA 4L2NA 4CU9A 1H1MA 3SHRA 3WCSA 2BEOA 1JUIA 4D3WA 1COV1 1NYWA 1RUD3 4YZ2A 2KM2A 4PDWB 5K8SA 1LHUA 3AVSA 1NKGA 1ASJ1 3U10A 4Z1VA 3S5QA 3ZMNA 5KHGA 3OBZA 4LOSA 4Y22A 4YM0A 2NMNA 2JDUA 4FPYA 4CUAA 4UXAA 4ZY9A 2ES3A 2BWAA 2J1VA 4CDQA 3VLBB 1D4VB 1TNRA 1RGSA 4NPLA 1M4WA 4R9CA 4Y1UA 5BXXA 4LK6A 3KQ4B 5F6LB 5IK4A 4GJYA 1KS5A 2YDEA 1SLTA 2K46A 4QHOA 1OVPA 1XRUA 2YGMA 4LO7A 5FP3A 3V64A 5LA0A 1EP0A 2OVUA 4HBNA 1OOPC 1VBE3 4MGYE 5BNNC 1W6NB 4MGKE 1WBLA 3D5OA 4Q4X3 3ZFEB 4CTEA 2XLFA 1RL3A 4Y5TA 1UOBA 1ZNPA 3V0AB 2WN3A 3OPWA 5FZFA 4RR3A 2YXSA 1HRV1 5FMBA 1PGL1 4JGYC 1QHDA 4YGDA 3M3IA 2IVIB 3ES4A 4XUNA 5FUNA 3ZMOA 2ZOEB 1EAH3 5AFBA 1PO22 1QJX2 2P3KA 1GQGA 3BOPA 4I0AA 4PDWC 4GQ7A 4NRPA 4AHZA 1G9FA 1K5MB 2HWB1 1ULEA 4I2OA 1IQDC 2D44A 2JDHA 2Q8OA 2QVSB 3C7HA 5F5AA 2IXIA 2P17A 4COYA 5FZ3A 4Q8KA 1QJY2 1VBC1 3IZOA 4AEDB 3LCPA 1O4TA 1VBA3 2ZGLA 3O5SA 4LNVA 5LBEA 5JSOA 4N53C 4GWNA 1UKGA 3MIGA 4MXWB 4GH4C 1AXYA 3U4SA 3AZXA 1WA4A 2RS51 2W1UA 5AFEA 2BNNA 4AVCA 3QACA 4AVVA 2JDPA 1RUE3 1YJLA 4TYSA 5JMOA 3EXUA 5I8SA 1O7FA 3JB4C 3OCPA 4XMIA 4AQ6A 3WSOA 2Y0OA 2Y60A 3IWZA 5FZ1A 3ZR5A 4Q8LA 4XE9A 1CZSA 2YG0A 4BQYA 1U5IA 1UU4A 3SH4A 4LO5B 1Q8OA 1A8DA 4HPKA 3SC7X 2YFZA 4HXCA 5EFUA 1W8TA 2R062 5LCWL 5FZ7A 5F5CA 2AREA 1VALA 5IAXA 1WUVA 1W6PB 4PI2A 1J3RA 1JI6A 3TOJA 1UPIA 2QQWA 2ZJCA 5FYUA 3USSA 4DPNA 1JXNA 2Z42A 1SLCA 2WNUC 2XBO2 3DYMA 2P3IA 5FYZA 1ZBE3 3ZSJA 4BYYA 5HCAA 1RUG3 1FNZA 1UYZA 4ZZ5A 1X9TA 1JYCA 3PIGA 3ZFGC 1PVC3 5LATA 1J1LA 4KU7A 5IATA 4ZS2A 2B5HA 5GM0A 1D0GA 1R083 3ZPYA 3BIEA 4XXAA 5JXGA 1DYPA 3JCIA 1RMU3 1ENQA 2VMCA 3KF5A 2X8KA 4AOCA 3OPTA 4ORFA 4QQHA 1QMJA 3N9MA 2ZEZA 1G86A 5FV3A 1AL21 1Z78A 3WDVA 2FCTA 1AX1A 2PAKA 3RZHA 2Y6KA 2P5BA 4AK3A 4A2UA 1OT5A 5EIYB 1QJZA 2PELA 1SMVA 3N7MA 3RJ2X 4WZFA 4NWVA 1U5ZA 2ZHMA 4A4AA 2WQZC 4OUMA 5F9TA 3EYPA 1PGL2 2CTVA 1ZRCA 4JKMA 1D4M3 2W2IA 4JQTA 5EYYA 2PN5A 4NAOA 1EPWA 3I3EA 4GB33 2JG9B 2QQMA 5A3MA 5HI0A 1YQ5A 1V6NA 1YFXA 4JGZC 4P9LA 4DRVA 5HBAA 1D7PM 3H8UA 3MIBA 1OFNA 4BJ0A 3W9AA 2F17A 4JHZA 2VW0A 2VCBA 3WNMA 2PMWB 4COUA 1PHMA 4RHV2 4LKSA 5A7WA 4XF1A 3N4MA 3FUQA 5J1XA 1MVEA 4LQRA 3THCA 1ZRDA 1Q3EA 1VP6A 1G6NA 3VDDB 1OQ1A 5JOZA 1JODA 1X50A 2J1UA 1SFNA 1WA6X 4LIVA 2CY6A 4FXGB 5KC6A 5LA1A 4YRDA 3LIGA 1NZCA 5JR2A 1PX4A 4LBJA 4CDUC 5K0UC 1LU1A 2PQSA 2V5DA 2WS92 4R4XA 2CGNA 2ERFA 1W2AX 3WNPA 3RGBA 3E5UA 1YCIA 4Q29A 3OGJA 3OYWB 5BNOA 5JLVA 1JYVA 1HDKA 2QQLA 3O0WA 4EWEA 2JDKA 3M8LA 5F37A 1D2QA 3WDUA 1WCUA 1SCRA 5D8AB 5LK5A 4IUGA 4D69A 5B4NA 1ZREA 2KA3A 1EUUA 1UF2C 2GZWA 3POYA 1FPN3 5JAXA 2RR11 1Z7S2 4CPBD 3JD72 2VXRA 3V56A 1ZZCA 4O65A 4QB2A 4QKNA 1QJY1 1VBC2 4NIHA 3RJRA 1MPXA 4HONA 2V4VA 1WCQA 2XVGA 3NL1A 3U11A 3WP5A 3D3AA 2P3YA 2RHPA 2A3YA 2DWRA 3OGGA 5KWRA 4L97A 1SLIA 2NYYA 3R6SA 2BGPA 1ASJ3 2HWC2 1NCQA 4OQ9A 5A1FA 2HEYF 2EXKA 3O12A 4BCUA 1O4ZA 1V6JA 3VBOA 1N1TA 1SZBA 5HCHA 4MGTA 2V09A 3CDZB 5LK7B 3P6BA 2HWD1 1SCSA 4HN1A 2HWF3 4Q4V1 5FOBB 1GOHA 3ZXJA 1LAJA 3WW3A 3R4DB 5E88A 5DUUA 5F39A 4MXWA 2VZ1A 2VTFA 5D2AA 3J7NA 2RJ2A 1GANA 2XL9A 4UW4A 4IETA 4UOJA 4BA6A 4A42A 1CQ9A 4CU6A 4DUVA 4YZ4A 1HRI1 2GAUA 2WL1A 4YM3A 3I2OA 4LKDA 4K20A 4QPGA 4Y1VA 5IAVA 4AVAA 2O8QA 3SEEA 2JKXA 3CZJA 4UAPA 1KFUL 2W91A 4LOTA 4GD4A 4F3JA 1KJLA 5F32A 1UU6A 3ECQA 1SG3A 1DQ2A 1ZA7A 2QQNA 1W39A 2JE7A 4RGAA 2OIIA 3UKNA 1XNTA 1UXXX 1GMMA 2YC0A 4IGPA 2DCTA 4FSJA 4UW6A 3TN91 3I3DA 4RR3B 2D43A 3B00A 1I1EA 2JB4A 4HL0A 4RS5C 4CXWA 5FDBA 1TME3 1YO8A 3AMNA 3IIIA 2VNOA 4KBZA 5EPAA 5LBBA 3NO8A 5FIXA 1X8MA 4UF0B 3ROUA 3POGA 3O1TA 2XJPA 4CCJA 5FQ0A 4YW7A 3HT1A 1GNYA 1BEV3 3LEGA 4ARYA 4KBBA 4XACA
chains in the Genus database with same CATH topology
2HYXA 4A45A 2WO2A 1PMJX 2HLEA 4HG6B 2W5FA 1NUKA 3VDBA 3WQBA 4QPWA 3HPNA 4OMCA 3VDCA 4ZXEA 1JZ3A 1JHJA 3CKHA 2W46A 3HNMA 1L7RA 2VL4A 3VD3A 2W1WA 3W5NA 3UESA 3HOBA 2Y6HA 1UYXA 3LEKA 2VZSA 5C71A 3J7HA 3GDBA 2JE8A 2WUHA 2XQXA 2J7MA 3VD4A 1CIYA 2QQKA 3K75B 4JKKA 4P02B 4QDRA 3MBWA 3NNGA 4OMDA 2ZEWA 2VCAA 3E1F1 2WO1A 2BZDA 3MV01 3P1IA 1UY3A 2VZPA 2VZOA 1SDDB 2J1TA 1OF4A 1JYXA 5JXIA 5EJ1B 4TTGA 4DUWA 3VD7A 3PUIA 4PQQA 4XUQA 2CDPA 1XPWA 1DLCA 1ULPA 3WF4A 3WEZA 3SEPA 3HN3A 1H6YA 2B9VA 3I2GA 2C26A 1O8SA 2VQUA 2BGOA 1W9SA 5DPNA 3I2KA 5A1AA 2CDOA 3NJVA 4MO3M 1UMIA 2J22A 4QX3A 4BK5A 3WNOA 2RVAA 1XC6A 4QDSA 3ACGA 1W99A 4CUCA 3ACIA 5EJZB 4DEVA 1O59A 2EIDA 1JZ5A 1F4HA 2Y6JA 1K45A 1GNYA 4DUXA 1K42A 1XNAA 2EIBA 2VZ3A 4GWJA 3I2JA 5JXHA 3A23A 2C4XA 3T09A 4DXTA 3EB7A 3CMGA 1W8NA 1JU3A 2VMEA 3OGSA 4MGQA 2QBXA 4QX1A 2VZRA 5C70A 2WYSA 4LPLA 3MUZ1 3SKVA 2VO5A 4E8CA 1P8JA 2WABA 4CUBA 3HNBM 1PMHX 1CZVA 2Y6LA 3LE0A 1UY1A 1GOFA 2VZUA 3BGAA 3I2HA 2ID4A 2LS6A 3DECA 3T0AA 4LHSA 4D8MA 1PX3A 4Z2AA 1W9WA 2YB7A 2W94A 3UNPA 3ABZA 4UI9L 1JZ8A 2VZQA 3I2IA 2QQJA 2VJXA 5CZKA 2XHNA 3IDAA 3C8XA 2WZEA 2EICA 1DYOA 4A3ZA 2WN2A 3IAPA 4DEQA 4QX2A 1JZ2A 4KMQA 5G05L 3A22A 4GZ9A 4W8JA 2W92A 4JX0A 2DCKA 1GQPA 4XVHA 2B4KA 1OD3A 2X10A 3U37A 4ARXA 3LEIA 1KEXA 5JXJA 1JZ7A 3MO4A 1JZ6A 5HPOA 1BHGA 2Y64A 3K46A 1SHWB 3I3BA 3CZUA 4DXSA 4A6OA 3K4DA 2DDUA 3T2PA 1UY4A 3DYOA 3WNLA 4CU9A 3MV11 2VOTA 3I2FA 1WKYA 3ACFA 1NKGA 4XURA 4JKLA 1UY0A 2VMFA 2RV9A 2W3JA 1HN1A 4CUAA 4ZY9A 2W47A 2J1VA 1J84A 3OGRA 3MUY1 5CYYA 3VD5A 5LA0A 2ORXA 3A21A 3K4AA 4P00B 5IJRA 3HNYM 1UZ0A 3LPFA 3VDAA 2Z4FA 2WN3A 3I97A 4E8DA 4GWIA 4KI5M 2C9KA 4P5YA 2Y8KA 3DYPA 3WF0A 5IFPA 4XUNA 2X09A 4BXSV 1TG7A 3ZM8A 3GM8A 2ZEXA 2WZ8A 2VR4A 1IQDC 5DN2A 4M4PA 3C7HA 5FUIA 2VZVA 4FI9A 1H6XA 3WF2A 4YPJA 2WQ8A 3C7EA 3SKJE 1UMHA 2XOMA 2W1UA 1US2A 5IFTA 1NX9A 1JZ4A 4QAWA 4XUOA 2J1EA 5JMOA 4PF1A 2VM9A 3NJXA 3WSOA 3NRUA 1CZSA 5DQ0A 2YG0A 2WBKA 2QQIA 5G04L 4ARYA 2WAAA 1UYYA 2YFZA 4A41A 5LCWL 4A44A 2BERA 2W1QA 3WNKA 1OF3A 2R7EB 1JI6A 3FHAA 3DYMA 2E32A 5B4XA 5JUVA 2VQTA 1US3A 2E33A 1KGYA 1UYZA 4L0PA 3K77A 1UX7A 4AAXA 4ZZ5A 4QX0A 1NAEA 2JD9A 4XUPA 2Y6GA 3T2QA 1OH4A 4OZOA 5JXGA 3LPGA 2VMCA 1GU3A 3FL7A 3OEBA 2ZEZA 3HJRA 2Y6KA 2J1RA 1T2XA 3NQHA 1OT5A 5EIYB 3IB3A 3WF3A 1CZTA 1J83A 2W1SA 3FN9A 4A4AA 1RYYA 1W9TA 3ACHA 3EYPA 4W50A 4JKMA 3I3EA 2QQMA 5LA2A 3OBAA 3OG2A 3THDA 4KWUA 1JYNA 2VC9A 3F2ZA 1R64A 3A7QA 3WNNA 2VCCA 1YQ2A 5IHRA 2DCJA 1D7PM 2LW8A 1L7QA 4BJ0A 4JHZA 2W9XA 2VCBA 3T2OA 3WNMA 1JU4A 4LKSA 4AG4A 4ET7A 5J1XA 4LQRA 3THCA 3C7OA 1O8PA 3W5MA 3T08A 2J1UA 3AC0A 1UWWA 2WAOA 5LA1A 5JR2A 1F4AA 1K12A 1JYWA 1PX4A 2PQSA 2V5DA 4OYUA 3WNPA 3C7GA 2VMDA 5IYYA 1ULOA 2QQOA 1JYVA 2QQLA 1W8OA 5HXMA 4MADA 2BBAA 2OKXA 2VZTA 5I0DA 2YC4A 5B4NA 3CIHA 4IUGA 5F7UA 1GUIA 4XUTA 1EUUA 3ETPA 2W87A 2EIEA 1I5PA 2JDAA 2WO3A 1EUTA 1TVGA 2YC2A 3FHQA 4QB2A 3HEIA 1MPXA 3GXUA 2V4VA 1WCQA 3VD9A 4RN5A 3D3AA 2YFUA 3OB8A 2ZXQA 2XONA 2BGPA 1DP0A 1CX1A 1W0NA 4XZUG 4D0QA 3K4ZA 4QB6A 4BDVB 2E26A 4CU7A 3C7FA 4CVUA 3CDZB 4MOAA 4DXRA 3P6BA 4ZZ8A 5DMYA 1GOHA 1GOGA 3WF1A 4TXWA 4OUEA 1UY2A 2VZ1A 2J1AA 4W4ZA 2VTFA 2RJ2A 2ZEYA 4UOJA 4A42A 4CU6A 4DUVA 4MGSA 3UETA 2W95A 4M4RA 2JKXA 3CZJA 4QB1A 2ORZA 4UAPA 2L9LA 3SEEA 2W91A 3BN6A 3ECQA 1SG3A 2KD7A 2WDBA 5C7GA 2QQNA 4RYDA 3IAQA 3LQCA 1XNTA 1K3IA 1UXXX 2J1SA 3GGLA 1GMMA 3T0DA 4BK4A 4P08A 4PT6A 1UXZA 3I3DA 4QDQA 4CU8A 3IIIA 3T0BA 3JXSA 3CQOA 3PUHA 3OGVA 1LNSA 2X05A 3OEAA 3LEGA 2E31A 2V72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HYX A;  4A45 A;  2WO2 A;  1PMJ X;  2HLE A;  4HG6 B;  2W5F A;  1NUK A;  3VDB A;  3WQB A;  4QPW A;  3HPN A;  4OMC A;  3VDC A;  4ZXE A;  1JZ3 A;  1JHJ A;  3CKH A;  2W46 A;  3HNM A;  1L7R A;  2VL4 A;  3VD3 A;  2W1W A;  3W5N A;  3UES A;  3HOB A;  2Y6H A;  1UYX A;  3LEK A;  2VZS A;  5C71 A;  3J7H A;  3GDB A;  2JE8 A;  2WUH A;  2XQX A;  2J7M A;  3VD4 A;  1CIY A;  2QQK A;  3K75 B;  4JKK A;  4P02 B;  4QDR A;  3MBW A;  3NNG A;  4OMD A;  2ZEW A;  2VCA A;  3E1F 1;  2WO1 A;  2BZD A;  3MV0 1;  3P1I A;  1UY3 A;  2VZP A;  2VZO A;  1SDD B;  2J1T A;  1OF4 A;  1JYX A;  5JXI A;  5EJ1 B;  4TTG A;  4DUW A;  3VD7 A;  3PUI A;  4PQQ A;  4XUQ A;  2CDP A;  1XPW A;  1DLC A;  1ULP A;  3WF4 A;  3WEZ A;  3SEP A;  3HN3 A;  1H6Y A;  2B9V A;  3I2G A;  2C26 A;  1O8S A;  2VQU A;  2BGO A;  1W9S A;  5DPN A;  3I2K A;  5A1A A;  2CDO A;  3NJV A;  4MO3 M;  1UMI A;  2J22 A;  4QX3 A;  4BK5 A;  3WNO A;  2RVA A;  1XC6 A;  4QDS A;  3ACG A;  1W99 A;  4CUC A;  3ACI A;  5EJZ B;  4DEV A;  1O59 A;  2EID A;  1JZ5 A;  1F4H A;  2Y6J A;  1K45 A;  1GNY A;  4DUX A;  1K42 A;  1XNA A;  2EIB A;  2VZ3 A;  4GWJ A;  3I2J A;  5JXH A;  3A23 A;  2C4X A;  3T09 A;  4DXT A;  3EB7 A;  3CMG A;  1W8N A;  1JU3 A;  2VME A;  3OGS A;  4MGQ A;  2QBX A;  4QX1 A;  2VZR A;  5C70 A;  2WYS A;  4LPL A;  3MUZ 1;  3SKV A;  2VO5 A;  4E8C A;  1P8J A;  2WAB A;  4CUB A;  3HNB M;  1PMH X;  1CZV A;  2Y6L A;  3LE0 A;  1UY1 A;  1GOF A;  2VZU A;  3BGA A;  3I2H A;  2ID4 A;  2LS6 A;  3DEC A;  3T0A A;  4LHS A;  4D8M A;  1PX3 A;  4Z2A A;  1W9W A;  2YB7 A;  2W94 A;  3UNP A;  3ABZ A;  4UI9 L;  1JZ8 A;  2VZQ A;  3I2I A;  2QQJ A;  2VJX A;  5CZK A;  2XHN A;  3IDA A;  3C8X A;  2WZE A;  2EIC A;  1DYO A;  4A3Z A;  2WN2 A;  3IAP A;  4DEQ A;  4QX2 A;  1JZ2 A;  4KMQ A;  5G05 L;  3A22 A;  4GZ9 A;  4W8J A;  2W92 A;  4JX0 A;  2DCK A;  1GQP A;  4XVH A;  2B4K A;  1OD3 A;  2X10 A;  3U37 A;  4ARX A;  3LEI A;  1KEX A;  5JXJ A;  1JZ7 A;  3MO4 A;  1JZ6 A;  5HPO A;  1BHG A;  2Y64 A;  3K46 A;  1SHW B;  3I3B A;  3CZU A;  4DXS A;  4A6O A;  3K4D A;  2DDU A;  3T2P A;  1UY4 A;  3DYO A;  3WNL A;  4CU9 A;  3MV1 1;  2VOT A;  3I2F A;  1WKY A;  3ACF A;  1NKG A;  4XUR A;  4JKL A;  1UY0 A;  2VMF A;  2RV9 A;  2W3J A;  1HN1 A;  4CUA A;  4ZY9 A;  2W47 A;  2J1V A;  1J84 A;  3OGR A;  3MUY 1;  5CYY A;  3VD5 A;  5LA0 A;  2ORX A;  3A21 A;  3K4A A;  4P00 B;  5IJR A;  3HNY M;  1UZ0 A;  3LPF A;  3VDA A;  2Z4F A;  2WN3 A;  3I97 A;  4E8D A;  4GWI A;  4KI5 M;  2C9K A;  4P5Y A;  2Y8K A;  3DYP A;  3WF0 A;  5IFP A;  4XUN A;  2X09 A;  4BXS V;  1TG7 A;  3ZM8 A;  3GM8 A;  2ZEX A;  2WZ8 A;  2VR4 A;  1IQD C;  5DN2 A;  4M4P A;  3C7H A;  5FUI A;  2VZV A;  4FI9 A;  1H6X A;  3WF2 A;  4YPJ A;  2WQ8 A;  3C7E A;  3SKJ E;  1UMH A;  2XOM A;  2W1U A;  1US2 A;  5IFT A;  1NX9 A;  1JZ4 A;  4QAW A;  4XUO A;  2J1E A;  5JMO A;  4PF1 A;  2VM9 A;  3NJX A;  3WSO A;  3NRU A;  1CZS A;  5DQ0 A;  2YG0 A;  2WBK A;  2QQI A;  5G04 L;  4ARY A;  2WAA A;  1UYY A;  2YFZ A;  4A41 A;  5LCW L;  4A44 A;  2BER A;  2W1Q A;  3WNK A;  1OF3 A;  2R7E B;  1JI6 A;  3FHA A;  3DYM A;  2E32 A;  5B4X A;  5JUV A;  2VQT A;  1US3 A;  2E33 A;  1KGY A;  1UYZ A;  4L0P A;  3K77 A;  1UX7 A;  4AAX A;  4ZZ5 A;  4QX0 A;  1NAE A;  2JD9 A;  4XUP A;  2Y6G A;  3T2Q A;  1OH4 A;  4OZO A;  5JXG A;  3LPG A;  2VMC A;  1GU3 A;  3FL7 A;  3OEB A;  2ZEZ A;  3HJR A;  2Y6K A;  2J1R A;  1T2X A;  3NQH A;  1OT5 A;  5EIY B;  3IB3 A;  3WF3 A;  1CZT A;  1J83 A;  2W1S A;  3FN9 A;  4A4A A;  1RYY A;  1W9T A;  3ACH A;  3EYP A;  4W50 A;  4JKM A;  3I3E A;  2QQM A;  5LA2 A;  3OBA A;  3OG2 A;  3THD A;  4KWU A;  1JYN A;  2VC9 A;  3F2Z A;  1R64 A;  3A7Q A;  3WNN A;  2VCC A;  1YQ2 A;  5IHR A;  2DCJ A;  1D7P M;  2LW8 A;  1L7Q A;  4BJ0 A;  4JHZ A;  2W9X A;  2VCB A;  3T2O A;  3WNM A;  1JU4 A;  4LKS A;  4AG4 A;  4ET7 A;  5J1X A;  4LQR A;  3THC A;  3C7O A;  1O8P A;  3W5M A;  3T08 A;  2J1U A;  3AC0 A;  1UWW A;  2WAO A;  5LA1 A;  5JR2 A;  1F4A A;  1K12 A;  1JYW A;  1PX4 A;  2PQS A;  2V5D A;  4OYU A;  3WNP A;  3C7G A;  2VMD A;  5IYY A;  1ULO A;  2QQO A;  1JYV A;  2QQL A;  1W8O A;  5HXM A;  4MAD A;  2BBA A;  2OKX A;  2VZT A;  5I0D A;  2YC4 A;  5B4N A;  3CIH A;  4IUG A;  5F7U A;  1GUI A;  4XUT A;  1EUU A;  3ETP A;  2W87 A;  2EIE A;  1I5P A;  2JDA A;  2WO3 A;  1EUT A;  1TVG A;  2YC2 A;  3FHQ A;  4QB2 A;  3HEI A;  1MPX A;  3GXU A;  2V4V A;  1WCQ A;  3VD9 A;  4RN5 A;  3D3A A;  2YFU A;  3OB8 A;  2ZXQ A;  2XON A;  2BGP A;  1DP0 A;  1CX1 A;  1W0N A;  4XZU G;  4D0Q A;  3K4Z A;  4QB6 A;  4BDV B;  2E26 A;  4CU7 A;  3C7F A;  4CVU A;  3CDZ B;  4MOA A;  4DXR A;  3P6B A;  4ZZ8 A;  5DMY A;  1GOH A;  1GOG A;  3WF1 A;  4TXW A;  4OUE A;  1UY2 A;  2VZ1 A;  2J1A A;  4W4Z A;  2VTF A;  2RJ2 A;  2ZEY A;  4UOJ A;  4A42 A;  4CU6 A;  4DUV A;  4MGS A;  3UET A;  2W95 A;  4M4R A;  2JKX A;  3CZJ A;  4QB1 A;  2ORZ A;  4UAP A;  2L9L A;  3SEE A;  2W91 A;  3BN6 A;  3ECQ A;  1SG3 A;  2KD7 A;  2WDB A;  5C7G A;  2QQN A;  4RYD A;  3IAQ A;  3LQC A;  1XNT A;  1K3I A;  1UXX X;  2J1S A;  3GGL A;  1GMM A;  3T0D A;  4BK4 A;  4P08 A;  4PT6 A;  1UXZ A;  3I3D A;  4QDQ A;  4CU8 A;  3III A;  3T0B A;  3JXS A;  3CQO A;  3PUH A;  3OGV A;  1LNS A;  2X05 A;  3OEA A;  3LEG A;  2E31 A;  2V72 A; 
#chains in the Genus database with same CATH topology
 2AZ5 A;  3AKS A;  2RM2 2;  3VV1 A;  3B3Q E;  4MH0 E;  4UWD A;  3DKQ A;  3ZYI B;  1NCR A;  2B42 B;  1BYH A;  3RYR A;  1NUK A;  1Q56 A;  2D6P A;  2W08 A;  4IV3 C;  4QPW A;  4R52 A;  4OMC A;  1RUE 1;  4F8A A;  1ST8 A;  1FOD 1;  2NM1 A;  4XJZ A;  5I0S A;  1QJU 3;  2LRO A;  3UV9 A;  3J7M A;  1LB2 A;  1U5Y A;  2ZKL A;  2MNG A;  5SV5 A;  5T54 A;  4EN9 B;  2W46 A;  1G9D A;  3VZJ A;  1L7R A;  3DF0 A;  2ARA A;  1WBF A;  3VD3 A;  3QCW A;  3DCQ A;  2W1W A;  3HMY A;  3ASI A;  3EBR A;  4QXC A;  4UF0 A;  3H1Y A;  2PLV 1;  1UYX A;  5FZH A;  1UKR A;  2VZS A;  4Y20 A;  1QOT A;  1MEC 3;  1RHI 1;  2ATF A;  2RE9 A;  4GMP 0;  4QPI C;  5C8C B;  1AJO A;  4Q4W 1;  4ES8 A;  5T5O A;  2PQQ A;  1ENS A;  2XQX A;  1UIJ A;  2GSY A;  2QQK A;  5C3Q A;  2J42 A;  4UW3 A;  3VD4 A;  3KM5 A;  2XG3 A;  4COV A;  5FY5 A;  5CIR A;  1REE A;  2VW2 A;  5ABJ B;  3MBW A;  4K8R B;  5DAP A;  5KXB A;  3OBR A;  3ZO0 B;  1ULC A;  1XXN A;  3B94 A;  4P5H A;  4IND A;  3R05 A;  3P1I A;  2UY8 A;  1JYT A;  1UY3 A;  5FYH A;  2VZO A;  1AJK A;  4L99 A;  4AHY A;  1CD3 G;  4UT5 A;  4Y1X A;  1OF4 A;  1JYX A;  1JHN A;  5A3N A;  2FDG A;  2YV8 A;  1MAC A;  3UJO A;  3PUI A;  3ST7 A;  4PQQ A;  4Z2W A;  4N53 A;  1HB2 A;  5A32 A;  1O4Y A;  1LHW A;  5F7U A;  1HQN A;  4XUQ A;  2B8M A;  3ZIW A;  1H0B A;  1LUL A;  4LHL A;  1ULP A;  3WF4 A;  1QNW A;  1NCR B;  1V6I A;  1Y9Q A;  2JG8 B;  3ON7 A;  5SV8 A;  5IVF A;  4M3C E;  1RC6 A;  4RL7 A;  4B4R A;  4CXY A;  4FTS A;  4QKF A;  1AX0 A;  2P3J A;  4YGE A;  5L7O C;  2YBP A;  2C26 A;  1O8S A;  2F6B A;  2R07 1;  1LGB A;  1D0H A;  1ND2 A;  2EXI A;  3RRD A;  4C1W A;  2VG9 A;  3I2K A;  1Q8V A;  4LA3 A;  4LUM A;  4URA A;  5E16 A;  4L11 A;  3K3O A;  2I45 A;  3N3H A;  1B35 C;  5GZE A;  5FLJ A;  5FAX A;  2JEC A;  1YC6 1;  3WIN E;  1UMI A;  2J22 A;  1MQT C;  4QX3 A;  3VKL A;  4BK5 A;  1X82 A;  2QKD A;  4XAB A;  3AM2 A;  4Q0S A;  2RVA A;  4IV3 A;  4URT A;  2HEW F;  2WNU A;  4XHB A;  4LBL A;  3ZXL A;  1RIR A;  4ZPI A;  4DY5 A;  1LOE A;  4FTB A;  4D6Q A;  3O1R A;  1XBF A;  2YRO A;  1H8T B;  1IS5 A;  4FO9 A;  4GA9 A;  4OI4 A;  3VZN A;  1NCQ C;  1WCD J;  2UWB A;  4LIT A;  5DUX A;  2XBO 1;  3AZZ A;  4DEV A;  5DG1 A;  5T5P A;  1UYP A;  5J98 B;  3ENR A;  4CDX B;  1DQ5 A;  2D7F A;  2OQ6 A;  2XL7 A;  3WXP A;  3ZXE A;  1SLL A;  1XNA A;  5FP7 A;  4IQP A;  5BNQ A;  4BZ4 A;  2VZ3 A;  1R1Z A;  4K1Y A;  5JDB A;  4FQ4 A;  2DU1 A;  4GWJ A;  4NHL A;  3B7M A;  3BU7 A;  1A8M A;  2C4X A;  3A23 A;  2XR4 A;  1CJD A;  5T50 A;  3T09 A;  1R1A 2;  4DXT A;  1QQP 1;  2DVF A;  3BOW A;  1W8N A;  3B9C A;  4JV4 A;  1Q5O A;  3IKW A;  3VBU B;  2CV6 A;  3OGS A;  4JRA A;  1W8Z A;  2P6C A;  5CFD C;  2ZGO A;  1I9R A;  4M3C B;  1DDL A;  1VMH A;  2NMO A;  1S2B A;  2QBX A;  5BNO C;  3OSD A;  1BKZ A;  1C57 A;  2VZR A;  3GYD A;  4GKY A;  2A75 A;  2ZCW A;  1PZ7 A;  2MEV 1;  1XU2 A;  3MIC A;  2VVF A;  4MVT A;  4MXV A;  1W05 A;  1YRZ A;  4GH4 B;  1Q8S A;  4V2V A;  3TAY A;  1P8J A;  2PHL A;  2WAB A;  4WM8 C;  2JDM A;  3ZLI A;  4CUB A;  3PVN A;  2OQ7 A;  5DAQ A;  2AEZ A;  1VE0 A;  3BAL A;  3HNB M;  2GP3 A;  2NPI A;  3DKW A;  3OD0 A;  4AFD A;  5C3P A;  1VBD 2;  3B02 A;  1POV 3;  3DEC A;  3LE0 A;  5FY7 A;  2ID4 A;  2QNK A;  1C8M 2;  1FV2 A;  1PK6 C;  1SLB A;  1IPJ A;  1OC1 A;  3I49 A;  4I30 A;  3UGH A;  2R16 A;  5ACA 1;  3OPZ A;  4D8M A;  4Z2A A;  2WZR 2;  4J25 A;  3RZL A;  5J96 B;  5HV4 A;  1W9W A;  1J58 A;  4UI9 L;  2D3R A;  4NRO A;  3GAL A;  3I2I A;  4Z92 B;  1GYK A;  1N3O A;  3EQE A;  2IXC A;  1PM4 A;  2HWD 3;  3J7L A;  5CZK A;  2EAA A;  4UFJ A;  2HWF 1;  5FPU A;  4ITC A;  2ZPX A;  4YG3 A;  4BE3 A;  2DFB A;  5AC9 3;  4IXL A;  4WM7 C;  3FLT A;  1HXS 1;  5H9Q A;  2ZML A;  3IDA A;  3ZFE C;  1KXG A;  1UMZ A;  1UN1 A;  2JX9 A;  2K2S A;  3E5Q A;  1HV0 A;  3MHZ A;  4Y4R A;  2EIC A;  5FZA A;  5FZ9 A;  2WN2 A;  5FWE A;  4AW7 A;  2QQU A;  4JGY B;  4MHU A;  4KMQ A;  4XFG A;  1ODM A;  5LY1 A;  2O8O A;  3A22 A;  1AR6 1;  1QJE A;  4RSU A;  1FMD 3;  5FYC A;  3AXE A;  1ZA4 A;  1W2N A;  4WM8 B;  5HXV A;  1NA1 C;  3U07 A;  4D6R A;  3AFK A;  3TEW A;  1IKP A;  1LOF A;  3HN1 A;  4BHP A;  1XNC A;  2DCK A;  1CVN A;  1GQP A;  3WDY A;  1E5S A;  1LRH A;  3O1M A;  4TWT A;  1OD3 A;  4ISR A;  3E6B A;  3U37 A;  1ULD A;  4ARX A;  1UPS A;  4YM1 A;  2ARB A;  4Q0U A;  5H9P A;  4Q4Y 2;  5FRE A;  4AGG A;  4Z8B A;  3WG1 A;  4YNI A;  5LEJ A;  3HD8 B;  1BHG A;  2Y64 A;  3Q8A A;  5HPO A;  3K46 A;  3I3B A;  4HPK B;  2ZGT A;  1CPN A;  1W9Y A;  1YNA A;  2WS9 1;  3VZK A;  2DDU A;  1BEV 1;  4X8N A;  4P9J A;  5EV7 A;  3T2P A;  5I93 A;  3DYO A;  1KDM A;  1AHS A;  3V65 A;  2JG9 C;  3MPP G;  5CFD A;  4YVS C;  1BLZ A;  2VOT A;  3EMR A;  4WVV A;  1LOC A;  4ZU7 A;  3O1V A;  3WLU A;  1O6U A;  3LDB A;  1V6M A;  4HFS A;  1OOP A;  1WKY A;  4Q1P A;  3ACF A;  5E1R A;  4E4H A;  1OLQ A;  1QJU 1;  2QQV A;  4B1L A;  1UY0 A;  2X5I C;  1ENR A;  3BB6 A;  1L7L A;  2W3J A;  3CJI B;  5LWB A;  2VW1 A;  1AR8 3;  1W0O A;  1ALY A;  4YW4 A;  3O0X A;  2W47 A;  4Q4Y 1;  1GWK A;  1ZZ8 A;  4XYX A;  1X36 A;  4NJ4 A;  5FKB A;  5A3P A;  4XIK A;  4YW6 A;  3U78 A;  4EQV A;  1GWM A;  1J84 A;  4N9I A;  1Y3T A;  2ZHK A;  5CYY A;  4Q4W 3;  4B1M A;  1EY2 A;  1K5M A;  3CNA A;  4XAA A;  3A21 A;  5JOW A;  4P00 B;  2Z79 A;  1DLL A;  4XQD A;  3RDI A;  3PME A;  1C8M 1;  3WDT A;  1GWL A;  3GZA A;  3ZFG B;  1AXK A;  2BFU S;  2WC2 A;  4PBO A;  1LOA A;  1CAV A;  1ZM1 A;  5GLZ A;  3VDA A;  5EWS A;  3ZN6 B;  4S2F A;  4KH9 A;  4FOQ A;  1WLD A;  4B7K A;  1GZW A;  1VRH 2;  4MGI E;  4LBN A;  4CCO A;  2AUY A;  3ELN A;  5HCF A;  2PHD A;  2Y8K A;  2BVB A;  1NE6 A;  2RMU 3;  2X09 A;  3MID A;  3JU9 A;  1TG7 A;  4CEW B;  2BW8 A;  5ISL A;  4AE2 A;  2WZ8 A;  3A0K A;  2RS3 1;  4M4P A;  4Q0V A;  4QX8 A;  3ZXG A;  1NZI A;  3AVR A;  3OUI A;  3W21 A;  1DQ6 A;  4FBF A;  5ACA 2;  3ZSE A;  5FO7 B;  3NJY A;  3WF2 A;  4YPJ A;  5FR3 A;  1OKQ A;  3B69 A;  2ENR A;  1FI2 A;  2FMD A;  3VBO C;  1ODN A;  2OX0 A;  3APB A;  4XXP A;  5FZK A;  2XOM A;  4LHN A;  2WNE A;  3ZOI A;  4NRQ A;  3ZSK A;  5IFT A;  3TB0 A;  3G7D A;  1JZ4 A;  4QAW A;  1N1Y A;  1CR7 A;  1KFX L;  1M06 G;  5A7O A;  2VMH A;  1Q8P A;  2OA2 A;  5LBC A;  3AMP A;  2VAU A;  1Y9M A;  2VM9 A;  3NAP B;  3QD6 A;  3AX4 A;  4IES A;  3ZIX A;  2JD4 A;  1MS1 A;  3RZZ A;  3E97 A;  2QQI A;  2VNV A;  3PVO A;  4BU2 A;  3EO6 A;  2ZTN A;  2ARX A;  1UYY A;  1W06 A;  1E5R A;  1XYO A;  2WAA A;  4LBM A;  5GLV A;  1V9U 2;  4AVB A;  1OA3 A;  5J37 A;  3LA7 A;  3OBT A;  2RS1 2;  2G9Z A;  4HET A;  4CEY A;  1OF3 A;  5DDJ 2;  3RS6 A;  3D4K A;  1ZRR A;  2VPV A;  1YQ6 A;  1HRV 3;  1N47 A;  1NXD 1;  2WA4 A;  2Q8D A;  4CP0 A;  3TEX A;  2BQP A;  1E57 A;  2VTX A;  1SFP A;  1W6N A;  2VQT A;  3O1S A;  4PF5 A;  5L7O B;  4I3P A;  1C1L A;  4XHX A;  2Y6F A;  3K77 A;  5F3I A;  1UX7 A;  4AAX A;  1VBB 3;  4F83 A;  2A6W A;  1TMF 1;  2WRA A;  1RJ8 A;  2GND A;  2Y6G A;  4AQS A;  3T2Q A;  2O14 A;  1W6M B;  3IDC B;  2GNB A;  1LJ7 A;  3LPG A;  1Q8Q A;  3ZDS A;  4NPR A;  3PU3 A;  3OEB A;  1VAV A;  4DIQ A;  3BPS A;  2AR6 A;  2IXH A;  1V9U 1;  1FT9 A;  2WO7 A;  2WQ4 A;  2XB6 C;  3I2D A;  3J9S A;  4B3N A;  5HV0 A;  1F31 A;  3ZXA C;  2QZ3 A;  4XCA A;  3SIS A;  4LBO A;  1JOJ A;  2H6B A;  3AMQ A;  1CZT A;  2GAL A;  3UKT A;  1Z0H A;  2W1S A;  4QX5 A;  2HEV F;  3IBM A;  2QQP A;  2LM3 A;  1DZT A;  1RYY A;  5HCB A;  5A7S A;  2VOX A;  2ZA9 A;  5C33 A;  2ZX2 A;  2KXL A;  4C91 A;  1LEN A;  5CIS A;  3GJB A;  4IW3 A;  3WVJ A;  4ZON A;  4U36 A;  1OKO A;  2WFF 1;  3ATG A;  1JH5 A;  3OBA A;  3THD A;  1JYN A;  4KWU A;  2VC9 A;  4JGZ B;  1R64 A;  3WUC A;  1LES A;  3PMS A;  1YQ2 A;  2DFC A;  2DCJ A;  1PIV 1;  4UW5 A;  5DAV A;  5LRS A;  4S2G A;  4FVV A;  5DZE A;  4XTP A;  1A78 A;  2VD7 A;  2WFP A;  3S57 A;  2SLI A;  4QPG C;  3SNM A;  1PGS A;  1ZX5 A;  1MZ5 A;  2XJT A;  4OUL A;  4A7Y A;  5CAD A;  1WCK A;  1KD7 A;  1RUG 1;  1W03 A;  2Q5T A;  2WSV A;  2Y34 A;  3MLL A;  4EN6 B;  5AC9 1;  2D93 A;  3IMN A;  3WV6 A;  2IWG B;  4BM8 A;  1WME A;  2RR1 2;  2HWB 2;  5JVV A;  1R08 1;  3AC0 A;  2QCS B;  1PZ8 A;  3C3V A;  1YFU A;  3KB5 A;  1UX6 A;  1VAK A;  2WNO A;  1PO1 3;  4AFA A;  2P37 A;  3URF A;  1F4A A;  4BIF A;  3BYW A;  4YW1 A;  5T55 A;  1BBT 2;  3RG0 A;  1XU1 A;  2DVD A;  4OYU A;  1AL2 3;  1GZ9 A;  2JXA A;  3FFQ A;  2C5D A;  2VMD A;  1LTE A;  3WCR A;  1ND3 A;  2PFW A;  1CAU B;  2QQO A;  4Q4X 2;  1COV 3;  4BB3 A;  3M7A A;  5E89 A;  2IFW A;  1LGC A;  5GAL A;  5A6Q A;  2BBA A;  2OKX A;  2VZT A;  5I0D A;  2YC4 A;  3CIH A;  1GUI A;  5I0U A;  1POQ A;  4HVO A;  2W87 A;  4Y1Y A;  4AZZ A;  4DMI A;  2JDA A;  4S2H A;  1FYU A;  3D6E A;  2VUD A;  2GDF A;  1EUT A;  1SFY A;  1AYN 3;  2EXJ A;  4XQ4 A;  4IE7 A;  1YEW A;  1R09 1;  2D6L X;  2RDR A;  1SPP B;  3FHQ A;  3HEI A;  1DZQ A;  1CAX A;  3R0R A;  5FK7 A;  3JBG 1;  4P9I A;  3KT7 A;  1G9B A;  1NLS A;  4IV1 C;  3VD9 A;  2YFU A;  3VBR C;  1NE4 A;  1PZ9 A;  2PHW A;  2ZXQ A;  5JOY A;  3ZPO A;  4LBQ B;  3AB0 A;  2VVD A;  4OZX A;  2I2S A;  1NT0 A;  3O7O A;  4XUT A;  3FWE A;  4LIU A;  2DU0 A;  4Q4X 1;  2G1M A;  3U0Z A;  4GAL A;  4D0Q A;  3BTY A;  3K4Z A;  4HT1 T;  2E6V A;  1UAI A;  4CU7 A;  4XET A;  4CVU A;  1HN0 A;  3RZM A;  3WW2 A;  5CBL A;  5LA9 A;  4BQW A;  3WW1 A;  4ZZ8 A;  1BK0 A;  4TXW A;  1VB4 A;  4J6G A;  3NNL A;  4IL7 A;  3CU7 A;  4K8F A;  3TEZ A;  4CDW C;  1R09 2;  2NN8 A;  4MGZ E;  3T30 A;  1H1I A;  5CG9 A;  4MGS A;  4HK8 A;  1HV1 A;  1RUJ 3;  2WZR 1;  1KRI A;  3KV9 A;  1IKQ A;  2RM2 1;  4K9S A;  4DFS A;  1E5H A;  5ANN A;  3RVH A;  4AGR A;  3FBY A;  4QB1 A;  1VBA 1;  2L9L A;  4OI2 A;  4RGK A;  1EV1 3;  3RSJ A;  4P14 A;  1DIW A;  1TEI A;  1X8E A;  1H8V A;  3VBF C;  5F2S A;  1XSR A;  2B39 A;  2D6N A;  3V0B A;  1FAT A;  3TEY A;  3H8X A;  5GZG A;  3LQC A;  1ZBE 2;  4ASL A;  4Y5S A;  3T0D A;  3ZXD A;  4BK4 A;  2WKK A;  1CGP A;  3E6D A;  5KR7 A;  1BCX A;  3WY6 A;  4RR3 C;  1FXZ A;  2GC2 A;  4ERO A;  5KC5 A;  4YGB A;  2CHH A;  3AP9 A;  2ILM A;  4CSW A;  5JPM B;  3L2H A;  3T0B A;  4YAR A;  1CAX B;  4LO8 A;  1UL9 A;  3JQW A;  1ZBA 2;  1RUI 3;  2BNO A;  4NID A;  3OGV A;  3B01 A;  1LNS A;  4I01 A;  1GLH A;  4Y26 A;  2YY1 A;  2YU1 A;  2LTN A;  1DF0 A;  2V72 A;  3T1L A;  1HRI 3;  5IK5 A;  4NUB A;  4A45 A;  2WO2 A;  2Q8C A;  3KWV A;  3SQO A;  1PK6 B;  1DBN A;  3HR9 A;  3MLJ A;  3ALQ A;  3NJZ A;  4C90 A;  2D6O X;  2VBB A;  4CDW B;  3VDC A;  4J1X A;  2QTW B;  1CWP A;  2FDJ A;  1AXZ A;  2WA3 A;  1I3H A;  1MQT B;  3PTR B;  4GH4 A;  4Q4V 3;  1CAU A;  5CA6 A;  1OPM A;  3WZ1 A;  4MET A;  5IVV A;  1ZBE 1;  2AEN A;  5C3O A;  2R49 A;  3CKH A;  5GLT A;  5JIU A;  3VKF C;  4TSV A;  3TN9 3;  5CFC C;  3N36 A;  1SEF A;  2UU8 A;  4IEV A;  4LR4 A;  4AEJ A;  2Y6H A;  3BPZ A;  1UZV A;  5LB6 A;  1DYK A;  3IDE A;  3NKG A;  3HVD A;  4M0H A;  1BQP A;  5A32 B;  5FYS A;  3IIA A;  1QU0 A;  4BOW A;  4N7U A;  1RUF 2;  4QDR A;  3WP4 A;  4AEK A;  4AVT A;  3FZ3 A;  4FAH A;  4YVW A;  1H1A A;  1AYM 2;  2ZEW A;  1TNF A;  2ZHN A;  2C6S A;  3S5A A;  1HB3 A;  1WW7 A;  3VL9 A;  4LMF A;  2VNG A;  4KL1 A;  4CZS A;  4ONU A;  2A6Z A;  1AR7 3;  4LLF A;  3MV0 1;  2BBV A;  2IC1 A;  3UK9 A;  1TMF 3;  1F5J A;  1WMX A;  1VAM A;  1SDD B;  1RUN A;  5GKA C;  3MIF A;  5C4W A;  4RFT 0;  4ZU5 A;  3B9I A;  1UOF A;  3UGG A;  1Y43 B;  4FPG A;  3SMH A;  1GZC A;  2KR2 A;  5K4L A;  1WD3 A;  1V00 A;  3FE5 A;  3A0N A;  1YQC A;  3AYC A;  2HWC 1;  4YW3 A;  2WT0 A;  3JZV A;  4R9B A;  1DQ4 A;  5DZF A;  2JKB A;  1FOD 3;  3DN7 A;  5A3T A;  3WEZ A;  3RFR A;  3W20 A;  3HN3 A;  1NY7 1;  2UWC A;  2B9V A;  1WW5 A;  3ZSM A;  1MS3 A;  4BH9 A;  5CVR A;  4LK7 A;  2FDH A;  3EHK A;  3ILF A;  1Z7S 3;  3TWI A;  4IEY A;  2G19 A;  5EZW A;  1W9S A;  5DPN A;  2VXJ A;  2ZX3 A;  5KXD A;  4FFG A;  2CDO A;  1FV3 A;  2WYF A;  4FP3 A;  4MO3 M;  1ZBA 1;  4N53 B;  2A6Y A;  2RDN A;  1LOD A;  5JR7 B;  2FCV A;  1NQJ A;  1VBE 2;  2BVV A;  2GC1 A;  3CF6 E;  3QBQ A;  4CP9 B;  5I8Y A;  4GKX A;  4XFB A;  2RJL A;  1XC6 A;  4QDS A;  4ATF A;  4DB5 A;  4UFH A;  5FZM A;  4AI9 A;  4HMZ A;  4OHW A;  2XUM A;  1W99 A;  4FFF A;  2X53 S;  4LE3 A;  4JTN A;  3ACI A;  5JMC A;  2A3X A;  4NHX A;  3DXT A;  2EID A;  3SH3 A;  3NV2 A;  3WR0 A;  3USU A;  2IXJ A;  1JS9 A;  2WSU A;  4OCT A;  1PO2 3;  1NA1 B;  1PGW 2;  1QJX 3;  2WWJ A;  4CDX C;  1WWY A;  2R07 3;  1K42 A;  5A33 B;  1KDK A;  1LHV A;  3WOG A;  4FPE A;  2ZX0 A;  4R4Z A;  2UWA A;  3A4U A;  4BMB A;  3LWC A;  2VBP A;  2R06 1;  5JI9 A;  3CLP A;  5JZG B;  1QJY 3;  3N35 A;  1F35 A;  5FPA A;  4N90 A;  3BKZ A;  4CCN A;  5C8C A;  1VBA 2;  4JHT A;  2JWP A;  3O0V A;  4GMP 3;  4Y20 B;  5EHD A;  1RED A;  1MS0 A;  1W8F A;  2Q30 A;  5L19 A;  1X33 A;  1AR9 2;  1HB4 A;  1O5U A;  4YVW B;  5FLI A;  3THP A;  3VZM A;  4MGQ A;  4LO4 B;  4XBL A;  2E51 A;  4QD2 A;  3M2M A;  1V0A A;  4YZ1 A;  4R9A A;  4WZC A;  4G3Y C;  4GAZ A;  3LA3 A;  3MUZ 1;  4FPL A;  4PIZ A;  1UCX A;  2VO5 A;  3GZE A;  1DQ0 A;  4UBG A;  2A3W A;  3JBG 3;  3ZN5 A;  4AI0 A;  3EJK A;  3BGA A;  3I2H A;  5C5U A;  1C4R A;  1S2E A;  4AED C;  2QDN A;  3GZU C;  4JZR A;  1GKB A;  5KXC A;  3N7J A;  1AL0 G;  4MSV A;  1GV9 A;  4YZ5 A;  4LHS A;  4CEW A;  4Z82 A;  1I6X A;  3AXD A;  1WLC A;  2YB7 A;  5IT6 A;  3MPB A;  3PJY A;  4YM2 A;  2FDI A;  3GBW A;  5LAS A;  1JZ8 A;  4HAN A;  3RWK X;  3SIT A;  1DGR N;  2QQJ A;  1IPK A;  3KV6 A;  4K21 A;  2XBO 3;  4W6W A;  4Q26 A;  3D0J A;  4C8D A;  2FDK A;  3N9N A;  4B4P A;  1S0I A;  1PVX A;  4PHZ A;  3VB9 A;  3LKJ A;  1HX6 A;  3FFZ A;  4JRL A;  4O9E A;  4FPH A;  2Q4S A;  5FOJ B;  3C8X A;  2OT7 A;  2CWS A;  2VY0 A;  2A1X A;  1DYO A;  1QY4 A;  1TME 1;  1S0G A;  4EJR A;  2O0O A;  4EZ4 A;  5CFC A;  4DEQ A;  3IAP A;  4N7I A;  4QX2 A;  5T52 A;  4EN8 B;  1JZ2 A;  3WP3 A;  5G05 L;  1QQP 3;  3S0M A;  3CJI A;  1UZW A;  2W92 A;  5BYN A;  4LO6 B;  4RHV 1;  5CNA A;  3VDD C;  4XW3 A;  4XVH A;  5IK8 A;  3ZYR A;  2GNM A;  3N9L A;  2JDN A;  1OMI A;  2X10 A;  4BLI A;  1J59 A;  2AC1 A;  2FZ2 A;  4FPO B;  1JZ7 A;  3MO4 A;  1W8H A;  2LRP A;  4ISQ A;  5FTT C;  1UOJ A;  4IEZ A;  2BYV E;  4TZD A;  3OUH A;  1D4M 2;  3VBO B;  2XJS A;  1DZR A;  1RUH 2;  1RUI 1;  4XJA A;  1POV 1;  4KGQ A;  4PJY A;  3VZL A;  4A6O A;  2BPA 2;  1WD4 A;  3U75 A;  1GIC A;  4B8E A;  1RUO A;  5CAZ A;  3WNL A;  2PLV 3;  4LKE A;  3S30 A;  3VBS B;  4D6S A;  1RHI 3;  3D82 A;  3HT2 A;  3NAP C;  3ZFF C;  3ITQ A;  1DGR A;  1JOP A;  5DUV A;  3I2F A;  4E27 A;  1SBD A;  3H9A A;  2HWE 3;  4XUR A;  3QH6 A;  4KWK A;  5IVE A;  4QXK A;  2AH2 A;  2LAL A;  2XGX A;  3VHN A;  2RV9 A;  3I59 B;  3ACL A;  3PTY A;  5FZC A;  5JIA A;  5IK7 A;  1MS5 A;  2BV4 A;  3KMH A;  4JGY A;  3OY8 B;  4FPF A;  4LXL A;  1A6C A;  3AP6 A;  2OPK A;  2R32 A;  4YLZ A;  4IEO A;  1QH6 A;  3MUY 1;  1IG3 A;  3OGR A;  2E7Q A;  5I8T A;  3VD5 A;  5JPN B;  1AR6 3;  2WS9 3;  1AUY A;  1FMD 1;  1QXR A;  2JB8 A;  2ZMN A;  3CO2 A;  4LBK A;  3K4A A;  4QU2 A;  5IJR A;  1W28 A;  4V2W A;  4W6X A;  2IZW A;  2PHU A;  1UZ0 A;  2CYF A;  4NVP A;  1NOV A;  4CA9 A;  3U1X A;  3LPF A;  2VBD A;  2GN7 A;  1DHK B;  3P5B A;  4I0W B;  3K48 A;  4OHX A;  5FZD A;  3BOD A;  2PA7 A;  3I97 A;  4CE8 A;  3J8F 2;  2W0X A;  4E8D A;  2WLP A;  4KI5 M;  1LED A;  1W3X A;  5IFP A;  3DYP A;  5FPL A;  5CG8 A;  3WQ0 A;  3PU8 A;  3MYX A;  4TLG A;  3Q8B A;  1FPN 2;  5A7W B;  3ZFF B;  3NVC A;  4BLJ A;  1AR8 1;  2ZEX A;  1YUD A;  2VR4 A;  1CN1 A;  5FXX A;  2ZX1 A;  5FUI A;  4GWM A;  1W6P A;  2VZV A;  4IE4 A;  3RZG A;  2HJI A;  4JVA A;  1G7Y A;  2DUQ A;  3FJS A;  1O91 A;  3POF A;  1H6X A;  4FI9 A;  2RS1 1;  4HVR A;  4LKF A;  5CKM A;  3SCF A;  5GZC A;  1K5J A;  4RGG A;  3C7E A;  1ZZ7 A;  3SKJ E;  4DIN B;  1UMH A;  3NNF A;  5FKC A;  4CPB A;  1WW6 A;  3U14 A;  2ZHL A;  4LHK A;  3H7Y A;  4NHM A;  3RWN A;  4D7T A;  1US2 A;  1DU3 D;  4AFM A;  4DS0 A;  1NQD A;  3VKO A;  4AI1 A;  5B2G B;  3I4I A;  4XDQ A;  5IVJ A;  3PUS A;  2HWF 2;  4NO4 A;  3UL2 A;  3VHR A;  4DZG A;  4PF1 A;  5I0T A;  2FDF A;  4XMA A;  4BIS A;  4AGV A;  2JIG A;  3OJB A;  1WGP A;  3KS7 A;  2ET1 A;  5AVP A;  1MS9 A;  5G04 L;  5A6X A;  1C8M 3;  5FY1 A;  2GH2 A;  4X6R B;  1ULF A;  1OFS A;  4N43 A;  1X7N A;  2RDS A;  4HK9 A;  5GLW A;  3HWJ A;  4A44 A;  1OI6 A;  2BER A;  5F3E A;  2CAU A;  4AED A;  2W1Q A;  3WNK A;  5E8A A;  4W6Y A;  2P4E A;  3KVB A;  2R7E B;  3LAG A;  5A6Z A;  4E4S A;  2IUW A;  2OPW A;  1GP5 A;  1GBG A;  3KF3 A;  3H1M A;  5FMO L;  2YU2 A;  1WZX A;  2B9U A;  2RMU 1;  2HWD 2;  2E33 A;  1CAW A;  1PO2 1;  1QJX 1;  5FXV A;  4L0P A;  2YBK A;  4IV3 B;  2I74 A;  2Q1M A;  2QE3 A;  2X29 A;  3MI8 A;  4YG6 A;  2OS2 A;  2GP5 A;  1UO9 A;  1NAE A;  2DTY A;  3OF1 A;  4AHW A;  5JCT A;  1TQ5 A;  4HKW A;  3VUO A;  1S55 A;  1J3P A;  2CL2 A;  3NWK A;  4GMP 1;  3LDR A;  2BNM A;  3FL7 A;  4MUV A;  5L7O A;  1D2S A;  1CX4 A;  3HJR A;  4L9B A;  5C8C C;  5IVC A;  1DGW A;  2J1R A;  1T2X A;  3VHP A;  2YGL A;  3MW3 A;  4B4Q A;  2C9A A;  4CDQ B;  3IB3 A;  4EYU A;  3WW4 A;  4ZHN A;  1QJU 2;  1J83 A;  1IPS A;  3IPV B;  4Y33 A;  5FWJ A;  2CWM A;  1W9T A;  3RYP A;  3ACH A;  1O3Q A;  1DFQ A;  1CES A;  3HBZ A;  4QKD A;  4W50 A;  4Y22 B;  5C3S A;  5FLH A;  1F5F A;  2EIG A;  3AL5 A;  1XNB A;  5LA2 A;  5DG2 A;  3OG2 A;  5FO9 B;  2IXL A;  3F2Z A;  3HQR A;  4AXO A;  3A7Q A;  3WNN A;  3E5X A;  2YBS A;  4A6S A;  3WUD A;  5IHR A;  3BTZ A;  4NOT A;  2LW8 A;  4E2Q A;  1KIT A;  1UU5 A;  2XJQ A;  4QHZ A;  2JEM A;  4Y24 A;  5JSP A;  1LOG A;  1RVF 2;  2FHR A;  2W9X A;  4YSF A;  2WNV C;  1JU4 A;  4IDZ A;  5L9R A;  3TNQ A;  4AG4 A;  3ZYF A;  5FY9 A;  1E5I A;  2JJ6 A;  4YGC A;  4IEQ A;  2HKX A;  3C7O A;  2XKO A;  5FYT A;  1ACC A;  1AR8 2;  3NV4 A;  4C0H A;  3W5M A;  4AYU A;  5FZL A;  1VMJ A;  2BP6 A;  4HKO A;  2BJS A;  1PGW 1;  1QXJ A;  2WWS A;  3P3P A;  1O3R A;  3MGU A;  1JOB A;  2VUL A;  1JYI A;  3ZFE A;  1JYW A;  3E6C C;  4HKL A;  4CDQ C;  2TEP A;  1VPH A;  2WFF 3;  4HN0 A;  4OUS A;  5C8W A;  4QPI B;  4MG2 A;  1QNY A;  4CP9 A;  5FY4 A;  4Y4Y A;  1HQW A;  1UQX A;  2WNV A;  3H8R A;  5I0R A;  5IYY A;  4LJH A;  3GCX A;  1LU2 A;  5APA A;  1QGL A;  1A3K A;  4JDM A;  4EWD A;  3J8F 1;  5HXM A;  2MHF A;  1VB2 A;  3MEP A;  1CAV B;  4D7Y A;  3UJQ A;  2ZGS A;  3ZFG A;  2GH8 A;  1ND2 C;  2RS5 2;  2E63 A;  3DPR C;  3KV5 A;  3ETP A;  4GIQ A;  3N9P A;  3POE A;  2TUN A;  2RMU 2;  1UIK A;  2AEY A;  1EAH 2;  1G9C A;  4XFC A;  3MW4 A;  2EIE A;  1ZRF A;  3MLK A;  1LGN A;  2RS3 2;  1B35 A;  3ORJ A;  5FQ0 B;  4HVQ A;  1TVG A;  5FY0 A;  4Y5Z 0;  4BPZ A;  5A70 A;  4H7L A;  4PDW A;  4K7J A;  3QLQ A;  1PIV 3;  2ADD A;  2F4L A;  4AVS A;  3GXU A;  4FOY A;  1ZZ6 A;  4IV1 B;  4N43 B;  5FFO C;  4OHZ A;  2EAL A;  2EXH A;  4RN5 A;  4KGG A;  3OB8 A;  4CXX A;  3WX5 A;  3GHN A;  2VOV A;  4PI0 A;  2V5Y A;  1OLM A;  5I91 A;  2GMM A;  1DP0 A;  5FZI A;  2QDR A;  1OOP B;  1YI7 A;  4XF0 A;  2MEV 2;  4XZU G;  1IHM A;  4JTO A;  2HBU A;  4QB6 A;  3RQ0 A;  3HBK A;  4E4D X;  5A6Y A;  3PLQ A;  2P34 A;  1RUE 2;  4GUL A;  5CFD B;  5EQU A;  5FPX A;  5J36 A;  4MOA A;  4PBP A;  1QH7 A;  5DMY A;  4OVE A;  3I54 A;  4X6Q B;  1PO1 1;  1GOG A;  3WF1 A;  3T3Y A;  3RPQ A;  1S0E A;  3GHM A;  4PIY A;  1UY2 A;  1HXS 2;  1XE0 A;  5CKQ A;  5F5I A;  2XKP A;  4I02 A;  4W4Z A;  3KVA A;  2XVL A;  5F6K A;  2BWC A;  5FK8 A;  4RS5 A;  3VBR A;  1W3V A;  2JDZ A;  3KCX A;  3R4S A;  3T4H B;  5C4W C;  3UET A;  1PMI A;  1NXM A;  1IS6 A;  4Y1Z A;  5ANQ A;  1KJR A;  1CJP A;  2CSG A;  3LZZ A;  4M4R A;  1IS3 A;  4E2G A;  3AP7 A;  1W6O B;  5DDJ 3;  1AZD A;  1O5L A;  3BTX A;  1MS4 A;  1S0J A;  4RQP A;  3AMM A;  5A3O A;  1Q43 A;  1NCQ B;  1RIT A;  3JQX A;  4HLT A;  3GGL A;  1K3I A;  4WM8 A;  2J1S A;  5KHH A;  2PYT A;  4QGL A;  4PT6 A;  4CCK A;  1YHF A;  2A6V A;  4QDQ A;  1QXP A;  4IE5 A;  4CU8 A;  1WLW A;  5K0U A;  1RUC 2;  3ZN4 A;  1R08 2;  2YYO A;  3FLP A;  3KCY A;  4XCB A;  3CQO A;  4CEW C;  2HYK A;  3PUH A;  2AAC A;  4GJZ A;  2ZAB A;  4K6B A;  5FZ6 A;  4QT6 A;  1RMU 2;  2Q8E A;  1V6K A;  1ZZ9 A;  3AFG A;  4QXH A;  1YFW A;  2YUE A;  2E31 A;  3JUU A;  1TE1 B;  5CEH A;  2WLQ A;  1QOS A;  1RUJ 1;  2WZR 3;  4JQR A;  2HYX A;  3VBH C;  3NNM A;  2ZKN A;  4UYB A;  2R04 3;  2HLE A;  3DGT A;  1HLC A;  4NHY A;  4LE4 A;  4AI8 A;  3O1P A;  2E9Q A;  4XZP A;  4EWA A;  1CON A;  1SBF A;  2CGP A;  5F1R A;  1JZ3 A;  1AVB A;  3I59 A;  3OYW A;  4MYE A;  1JHJ A;  3K3N A;  5AC9 2;  4ZU4 A;  2XLG A;  4M00 A;  3ZYB A;  4ASK A;  5BY5 A;  3QOP A;  1XQN A;  4QXB A;  3RNS A;  3V0B B;  1IZ3 A;  4ZXK A;  1F9K A;  1W8U A;  2VOW A;  3UES A;  4BQ1 A;  3W5N A;  2A71 A;  4QHB A;  4AFB A;  4CDU B;  2JIC A;  5K0U B;  2LUW A;  1QDO A;  3GDB A;  3J7H A;  4PLO A;  4XBN A;  1S0D A;  1OA2 A;  1QWR A;  1EV1 1;  1MZF A;  5GZD A;  4M0N A;  3H3U A;  1CIY A;  1W6Q A;  2F4P A;  1MVQ A;  3LA2 A;  4P9X A;  4RFR B;  3VKM A;  4OFG A;  3WF3 A;  2DUO A;  3NNG A;  4FAG A;  1YXW A;  2VCA A;  3E1F 1;  3LSD A;  3VBU A;  4COZ A;  4DOU A;  4R8H A;  4YZ3 A;  2BZD A;  3GZT B;  4O61 A;  4J1W A;  1GQH A;  2B7Y A;  2VZP A;  4IEU A;  5FYB A;  4KWJ A;  2J1T A;  3TNP B;  2FQP A;  5AVA A;  4CRQ A;  1GP6 A;  1OUS A;  1PO1 2;  2ZMK A;  2WII B;  2ZGR A;  3BIW E;  4DUW A;  4CCM A;  2JG9 A;  3X29 B;  3VD7 A;  2DCZ A;  3PUQ A;  4GXL A;  3MDP A;  1C5H A;  1OVS A;  1VBE 1;  3AYA A;  3CL1 A;  5KXE A;  4LBQ A;  1S0B A;  1S0C A;  1XND A;  3C2U A;  1RUD 2;  2H0V A;  3MFC A;  2CDP A;  1H8T A;  5C9A C;  1GFF 2;  2Y26 A;  4A3X A;  1DLC A;  1H4G A;  1GZT A;  2FD8 A;  3GF6 A;  2OUH A;  1HJF A;  1EAH 1;  4OHV A;  2WJS A;  4HZF A;  5IWF A;  3L9J T;  3I2G A;  3Q8F A;  3RI8 A;  3PHM A;  3WHT A;  5FBZ A;  1ZRI A;  2VQU A;  3JD7 3;  1AYN 2;  1Y9G A;  2Z2S B;  4OI1 A;  3T1M A;  3ILR A;  1WMF A;  5A1A A;  5FP4 A;  5C6C A;  1VBC 3;  2QUO A;  2OUJ A;  4LOR A;  3DXU A;  1RTV A;  1T6G C;  5F5Q A;  1VBD 1;  3VBH A;  1H2L A;  3UYJ A;  3WNO A;  1BMV 1;  3LB9 A;  1B09 A;  2Q1F A;  2ZZJ A;  3ES1 A;  2DBI A;  3M1H A;  1ASJ 2;  2R6Q A;  3J4U H;  2XWB B;  2HWC 3;  1XE7 A;  4RQP B;  3WHU A;  3RZJ A;  1POV 0;  2UY9 A;  4G9S B;  5A80 A;  4CUC A;  4D94 A;  1VRH 3;  3PDQ A;  4TN7 A;  2PXJ A;  4ZS3 A;  1XYP A;  1O59 A;  2ZGQ A;  3M3O A;  4H55 A;  4O7X A;  1YYN A;  1L3J A;  2ETE A;  3PUR A;  1QKQ A;  5C9A B;  4KWL A;  4RS5 B;  4JAA A;  1C1F A;  2DVG A;  2EIB A;  2Q0A A;  3FX3 A;  5JI7 A;  1AYN 1;  1H2N A;  1AX2 A;  1NLQ A;  1R09 3;  3ZR6 A;  2YPJ A;  4AAP A;  5FPV A;  4DXZ A;  4XFI A;  5K9Y A;  5JSR A;  1O3T A;  3I2J A;  5JZG A;  1XSQ A;  3CMG A;  2D5H A;  2VME A;  1OUX A;  2VQA A;  3AKT A;  3AKP A;  2ZAA A;  5FMD A;  2ZGU A;  3BVC A;  4DO0 A;  1MZE A;  1O3S A;  3S6P A;  2BRT A;  4QX1 A;  5C70 A;  2AGS A;  3K2O A;  4CP2 A;  1JN2 P;  2PHR A;  5L36 A;  1PVC 1;  3SKV A;  2CGO A;  4E8C A;  2GC3 A;  4XFA A;  1YJK A;  1TME 2;  4A7Z A;  1LEM A;  2RJK A;  4HSL A;  4WM7 A;  1RUH 1;  1WCS A;  1CZV A;  1DGW X;  1ZBA 3;  2D40 A;  2G9G A;  1SBE A;  1UY1 A;  2RG4 A;  4MV2 A;  5LBF A;  3SXW A;  4ASM B;  2LS6 A;  1VLN A;  2D5F A;  2NZ9 A;  5T3N A;  2R06 3;  4XDO A;  4FT8 A;  4G4F A;  3T0A A;  2DUR A;  5KHI A;  1PX3 A;  3H1W A;  2ET7 A;  2RM2 3;  2WWU A;  2H0B A;  2PAM A;  2GMP A;  3PJQ A;  3UNP A;  3ABZ A;  4FTE A;  2C0Z A;  2VZQ A;  1KS4 A;  5F2W A;  4FQZ A;  2NLR A;  3AK0 A;  1HW5 A;  4YW5 A;  3V0A A;  2VJX A;  4K40 A;  1AYM 1;  4B29 A;  4YFZ A;  4IEW A;  1RUG 2;  3KD4 A;  2JEN A;  1NY7 2;  2EF6 A;  1FAY A;  1YWK A;  4GB3 1;  4I3G A;  1PVC 2;  2WZE A;  3O14 A;  2Y0I A;  3ZYG A;  4JCK A;  4FXK B;  3VL8 A;  3ZYH A;  4A3Z A;  5D1I A;  2PHF A;  1W2O A;  2Q1Z B;  4QU1 A;  1KQR A;  1RUD 1;  4CCD A;  2O1Q A;  4QKB A;  4GZ9 A;  3MW2 A;  5DAB A;  4W8J A;  4FOV A;  4JX0 A;  1CAW B;  1BMV 2;  2DBN A;  2YPD A;  1G8W A;  2I07 B;  4NIG A;  2B4K A;  1A34 A;  4QM8 A;  1C28 A;  3LEI A;  1KEX A;  4P9Y A;  5A7P A;  5JXJ A;  5L9B A;  4QPG B;  4RD7 A;  1VJ2 A;  3MZH A;  1AR7 2;  1BK1 A;  2EA7 A;  2D6M A;  3SCH A;  1TMF 2;  1JZ6 A;  5FYM A;  3MF6 A;  1IGO A;  3NMB A;  1JUH A;  1SHW B;  5IVY A;  1HKD A;  1CIW A;  2ARC A;  2R30 A;  4GB3 2;  4DXS A;  4AQ2 A;  5FJH A;  2XVK A;  1XJA A;  4FP2 A;  3AMH A;  2PAE A;  2FMY A;  1UY4 A;  3M70 A;  3LDK A;  2A6X A;  1EPZ A;  3Q8E A;  2P1B A;  3IPV A;  3W58 A;  3MV1 1;  3BCW A;  4X8P A;  2D3S A;  4AHX A;  3T2T A;  4XQW A;  2XPJ A;  3POJ A;  1BVV A;  1V6L A;  1FOD 2;  4RHV 3;  1OLR A;  3WDX A;  2DF7 A;  4JKL A;  1U0A A;  3M3E A;  1H8T C;  4CCC A;  2CAV A;  2VMF A;  3Q8C A;  3PVE A;  5DAW A;  3WG4 A;  5ABJ C;  1HN1 A;  2RR1 3;  1LCL A;  4IGQ A;  4QQO A;  2HWB 3;  1EYB A;  2OZJ A;  2PHT A;  1AR7 1;  3KV4 A;  3IM0 A;  3H8O A;  1OQD A;  3UT0 A;  3ZKY A;  4CDW A;  3OEA A;  1S4C A;  3ZN6 A;  1PK6 A;  1XB9 A;  5TSW A;  2A73 B;  3ZX7 A;  4PIX A;  5H9R A;  3AYD A;  4B7E A;  3WP6 A;  1BBT 3;  3IDB B;  2ORX A;  4DRR A;  1ND3 C;  1HQL A;  3ZFF A;  4Q5O A;  1AL2 2;  4AI2 A;  3HNY M;  4NPM A;  4XDP A;  4XF4 A;  2OW4 A;  2WT2 A;  4QM9 A;  5BNN B;  4P9G A;  3H42 B;  5LW9 A;  2R1B A;  4QMA A;  1VIW B;  2Z4F A;  4IGO A;  1GSL A;  3VZO A;  4R9D A;  5BNO B;  3POW A;  4GWI A;  4XPV A;  2R1D A;  1N3P A;  2C9K A;  2D97 A;  4P5Y A;  3WF0 A;  4BXS V;  2JG8 C;  1VRB A;  4ES9 A;  2NP0 A;  3ZM8 A;  4S2D A;  2DYC A;  3GM8 A;  5FYV A;  5FO8 B;  1K5M C;  5E6H A;  3WNX A;  1XOY A;  1Z7S 1;  5DN2 A;  2C24 A;  4WV8 A;  4D7S A;  5BNP A;  3OY8 A;  3I3M A;  3LSE A;  5FZ4 A;  3OD4 A;  3AZV A;  1LOF C;  3VBF B;  1N1V A;  3WG2 A;  4ATE A;  1R1A 3;  1DGL A;  3VDD A;  2WQ8 A;  5A1L A;  1G9A A;  1UW8 A;  1STM A;  2HWE 1;  3AZW A;  1AR9 3;  2A5Z A;  2VU9 A;  4N43 C;  3LEM A;  3S7E A;  5T5L A;  1I5Z A;  5CU1 A;  2GU9 A;  4BQ2 A;  1NX9 A;  2E7A A;  2VTX J;  2R0H A;  3M3Q A;  4XUO A;  2J1E A;  2Z5W A;  2HH9 A;  2K0G A;  3QH7 A;  4I0B A;  3VBS A;  1JW6 A;  3NJX A;  5DUW A;  3NRU A;  2IXK A;  3GBF A;  5EJ3 A;  1D4M 1;  5DQ0 A;  1FX5 A;  5FY8 A;  1VBD 3;  5T5J A;  3ZXK A;  2WBK A;  2XXZ A;  3AZY A;  4YVS A;  3AL6 A;  5F3C A;  1LHO A;  1XYN A;  2JIJ A;  5F3G A;  1YLL A;  4A41 A;  1W9F A;  2DCY A;  4AR2 A;  5BNP C;  1GNH A;  3W59 A;  3VBF A;  2XWJ B;  2R0F A;  1DG6 A;  4MZU A;  2XML A;  1RVF 1;  3FHA A;  3ZVX A;  1RXF A;  3FC0 A;  2B45 X;  5JUV A;  2E32 A;  5B4X A;  2VMG A;  1JTZ X;  1US3 A;  2VUA A;  3CEW A;  4NRM A;  4TLF A;  1KGY A;  2HBT A;  5FZO B;  4DQA A;  3U4X A;  5GLU A;  3OUJ A;  4CUG A;  1S2K A;  5J3U A;  1OA4 A;  3Q9O A;  4QX0 A;  4XEZ A;  2JD9 A;  4XUP A;  2BUK A;  1OH4 A;  2ZS6 B;  3KZ4 C;  4NIA A;  1MEC 1;  1RUI 2;  2YMZ A;  4OZO A;  4QQP A;  1DQ1 A;  1GNZ A;  3POI A;  2XHK A;  1SQ4 A;  5BNN A;  3DPR B;  1QQP 2;  5BPX A;  1BEV 2;  3WD5 A;  1GU3 A;  1NCR C;  3NNJ A;  2NQY A;  4LBQ D;  2UYB A;  4YVS B;  2W39 A;  5JZG C;  5LY2 A;  5FZB A;  3RI9 A;  1N1S A;  5FRA A;  2YZ4 A;  3NQH A;  5A3W A;  2XDV A;  1CPM A;  4M01 A;  4V1P A;  3FBM A;  2X5I B;  3MIE A;  2GN3 A;  4KNC A;  5FPZ A;  3PL0 A;  4BQX A;  3T4V A;  3FN9 A;  3ZDV A;  4XJ8 A;  3POS A;  3LOI A;  2IFR A;  1RUH 3;  3DEM A;  3GBG A;  5FYI A;  5IW0 A;  4XBQ A;  4IEP A;  1FPN 1;  3HIF A;  3LD8 A;  3BU0 A;  2JDY A;  4H2A A;  3H0O A;  1W2U A;  4AEM A;  1F15 A;  4W65 A;  2VH9 A;  2GNT A;  2VCC A;  5FUP A;  1MEC 2;  1W04 A;  2PTM A;  1L7Q A;  3KGZ A;  4NN0 A;  1BXH A;  2E53 A;  3CJX A;  2W68 A;  1MZ6 A;  3T2O A;  4AI3 A;  3THT A;  3L2Y A;  1RUF 3;  4A7K A;  4IEX A;  5FZG A;  4NMI A;  1VR3 A;  2XJR A;  2UUR A;  2IVJ A;  3CHX A;  1AYM 3;  3DV8 A;  3TRS B;  5EP9 A;  1ULG A;  4ET7 A;  3LF7 A;  4HSJ A;  2ZGM A;  3AP5 A;  1O8P A;  4E2S A;  3G6J B;  3DUI A;  2VQ0 A;  3RMX A;  3T08 A;  1ZVF A;  1UWW A;  4RA0 A;  2WAO A;  1OD5 A;  5CFC B;  3SCG A;  5CB7 A;  1K12 A;  5J48 A;  5A33 A;  2WNU B;  4Q4W 2;  4YYO A;  1H2K A;  2FZ1 A;  1W90 A;  5DXD A;  3UKV A;  3M4F A;  3R4U A;  5L73 A;  2Y33 A;  3GJA A;  3C7G A;  3N9Q A;  3USU B;  5JWP A;  3FUO A;  3WQ1 A;  1C3H A;  1ULO A;  3VN4 A;  4EV0 A;  2Z69 A;  1W8O A;  5A3L A;  3CJI C;  4MAD A;  4PLM A;  5BV6 A;  1H2M A;  3D0S A;  4L8Q A;  1ND2 B;  1W0P A;  2AYH A;  5D8A C;  2FBE A;  3UGF A;  1NG0 A;  3K51 A;  4BQ4 A;  3NV3 A;  3AKR A;  4SBV A;  1I5P A;  2WO3 A;  3FLR A;  3KQR A;  3INA A;  2BOJ A;  1LHN A;  3FMG A;  1IQA A;  1UD1 A;  3WG3 A;  2H6C A;  2D3P A;  3POB A;  2JG8 A;  1WMD A;  2QJV A;  2YC2 A;  4XJ9 A;  3MFA A;  4H7M A;  4YFW A;  1RUC 1;  5IUQ A;  5DAX A;  1QF3 A;  4U2A A;  1GP4 A;  1LEC A;  4UFI A;  1U5X A;  2XON A;  4L92 A;  4XC9 A;  2ZAH A;  4XTM A;  3TBD A;  2VMI A;  4EN7 B;  1CX1 A;  3VKN A;  5BUV A;  1MS8 A;  4WM7 B;  3ZYP A;  3NAP A;  5FZE A;  3ZKU A;  1W0N A;  1HJG A;  3NV1 A;  3PUA A;  2V4A A;  4BDV B;  2E26 A;  4YVW C;  2UYA A;  3C7F A;  3HQU A;  3I7D A;  4MX3 A;  4RQP C;  5LEK A;  4DXR A;  3O1O A;  3BUC A;  3PNA A;  1YIP A;  2R07 2;  3KSC A;  4OUE A;  3HAG A;  2ZZQ A;  4WVW A;  5D21 A;  4SLI A;  2J1A A;  1BBT 1;  3B5L B;  4XIO A;  2XUE A;  2DV9 A;  2ZEY A;  5C4W B;  4WVM A;  2DUP A;  4QX7 A;  1NA1 A;  2N7G A;  1TZO A;  1S0F A;  3RZK A;  5LZ6 A;  2VNR A;  3AP4 A;  2W95 A;  2BOI A;  3H3Z A;  3OOX A;  2BTV C;  2ORZ A;  2RS1 3;  1C5I A;  3AYE A;  3I3Q A;  3BN6 A;  4KG0 A;  2GME A;  1HRV 2;  2KD7 A;  2WDB A;  5C7G A;  4COW A;  3KGL A;  4RYD A;  2E7T A;  3IAQ A;  2ZBJ A;  4E4Z A;  4P08 A;  2EVX A;  2VOK A;  4Z07 A;  1UXZ A;  5FCC A;  1GZW B;  1VBB 2;  5ERL A;  1U12 A;  3JXS A;  2TBV A;  3JBG 2;  3KT1 A;  3NW4 A;  3I8T A;  3BTA A;  3D8C A;  4YWA A;  1R1A 1;  2OZ6 A;  2X05 A;  1AF9 A;  2VEC A;  1Y4W A;  4AFC A;  5KBF A;  1QDC A;  2CNA A;  1AR9 1;  1RXG A;  3VBH B;  1VMF A;  1MQT A;  3AJY A;  1SLA A;  1PMJ X;  2ZX4 A;  3VDB A;  4HG6 B;  2W5F A;  1W8W A;  3KLS A;  2FCU A;  2XH6 A;  4Q2F A;  4XIL A;  1S1A A;  4FPJ A;  2BFU L;  3HPN A;  5DDJ 1;  3WQB A;  4BXF A;  1F2N A;  2BGC A;  4Q1R A;  4Y3O A;  4ZXE A;  4Q27 A;  4AF9 A;  4PCR A;  1QJF A;  5K7P A;  2ZGN A;  4QQL A;  3KT4 A;  2TNF A;  2VVE A;  2JE9 A;  5FXW A;  3HNM A;  2G4I A;  3F95 A;  4QGM A;  2VL4 A;  3P3N A;  5C3R A;  4FPC A;  4EZH A;  3N7L A;  4IE0 A;  5C5T A;  3VBS C;  2C1F A;  2V73 A;  4O9G A;  3HOB A;  3LEK A;  1UZY A;  5C71 A;  1N3Q A;  4Q0P A;  4UBH A;  4BWO A;  1UNB A;  1GR3 A;  2JE8 A;  4QWN A;  4XFH A;  5IVB A;  1T6B X;  1W2T A;  2WUH A;  1FMD 2;  2J7M A;  4AL9 A;  2VE1 A;  3K75 B;  1RVF 3;  4JKK A;  2WIN B;  4P02 B;  4LLO A;  3WT3 A;  5A3U A;  3FHI B;  2R04 1;  4OMD A;  4F7Z A;  5C9A A;  4EN0 A;  1H9P A;  2WO1 A;  5DZG A;  4QGN A;  5A7Q A;  3BI3 A;  1NLR A;  4Q4Y 3;  5FZ0 A;  5KHJ A;  3IT8 A;  1ENX A;  4WBB A;  1ZYB A;  5FYY A;  1JBC A;  1OQE A;  1QEX A;  4H14 A;  2GC0 A;  4IER A;  4NHK A;  5FZ8 A;  2A7A A;  1RIN A;  5JXI A;  4K1Z A;  1YQ8 A;  4FFH A;  3GNE A;  5LRR A;  5EJ1 B;  1Y7B A;  4CCL A;  4H3W A;  4P9W A;  4TTG A;  5A7N A;  2WFF 2;  3ILN A;  3WQ7 A;  3LOB A;  2PLV 2;  4XJU A;  1BVP 1;  5EYX A;  1OSG A;  1RHI 2;  5F8P A;  1COV 2;  1XPW A;  2X5I A;  1APN A;  1OBN A;  3RMY A;  2HWE 2;  1OPO A;  5GZF A;  4M3C F;  3SEP A;  5CKN A;  4UFM A;  4NR1 A;  1H6Y A;  3LFM A;  2RS5 3;  3S7I A;  1H30 A;  3HQX A;  1IOA A;  1V70 A;  1LR5 A;  3H7J A;  2YHJ A;  4JC1 A;  1ONA A;  1V6O A;  3KHC A;  3PVB B;  5D8A A;  2BGO A;  2RS3 3;  3AJZ A;  3DPR A;  3MF9 A;  5FP8 A;  5KHK A;  4KG8 A;  2OXB A;  2ZAC A;  4C0B A;  1OHF A;  4UFK A;  3AKQ A;  2Y38 A;  3NJV A;  1PIV 2;  4CCE A;  1YFY A;  1JMU B;  4E9K A;  1AR6 2;  4OLL A;  4XFF A;  3ETQ A;  2DVA A;  3SLI A;  3VGI A;  1RUF 1;  5FZO A;  4DNY A;  2CU5 A;  1J3Q A;  4FFI A;  3LIH A;  4YW2 A;  2SBA A;  3ACG A;  4NE9 A;  2MEV 3;  2MPF A;  2A70 A;  3J8F 3;  2ZGP A;  5EJZ B;  1UZZ A;  1J1T A;  1F4H A;  1JZ5 A;  2P2K A;  4LUK A;  2Y6J A;  1PM7 A;  1K45 A;  2BDR A;  2RDQ A;  2VCM A;  4LTA A;  4PQ9 A;  2WZP P;  1URX A;  4AWD A;  3O1U A;  2XQR A;  4M3C A;  4DUX A;  4OI0 A;  1HXS 3;  3JD7 1;  1W6Q B;  4FOW A;  3MIH A;  1SDW A;  4NWW A;  3TYJ A;  4BME A;  5ACA 3;  1F8V A;  3ME2 A;  1RUJ 2;  2ZGK A;  1IG0 A;  1HIX A;  5JXH A;  2BU9 A;  4LEJ A;  1LKN A;  2WR9 A;  1RMU 1;  2EAK A;  3EB7 A;  5FBJ A;  1SAC A;  4CDU A;  4LT5 A;  4BIO A;  1JU3 A;  1XNK A;  2XJU A;  1EV1 2;  3VBU C;  1YIF A;  3RYK A;  2DVB A;  3VBR B;  1OXC A;  4HOO A;  1BZW A;  5FXZ A;  4LA2 A;  4XJW A;  4CYD A;  3JB8 A;  1WW4 A;  4CDX A;  5EXO A;  1H9W A;  3WDW A;  2WYS A;  4LPL A;  4PLN A;  1VBB 1;  1QOO A;  4UFL A;  4LUL A;  3NST A;  3J26 N;  4DY3 A;  3LGR A;  5FPB A;  2XLA A;  2P6H A;  1BJQ A;  1FNY A;  1PNG A;  2D6K A;  4QPY A;  1RUC 3;  4K3U A;  3KHB A;  4XAE A;  1PMH X;  1SPP A;  2OYZ A;  4AQT A;  5BNP B;  4OHY A;  2VUJ A;  4N8M A;  5FMC A;  2Y6L A;  3OTF A;  2VZU A;  1GOF A;  2DTW A;  3H50 A;  1X9P A;  4KQ7 A;  2K9Z A;  3KCC A;  4CEY C;  5JOX A;  4I09 A;  1V9U 3;  1OUR A;  1HRI 2;  2PHX A;  4XF9 A;  4WVZ A;  4IV1 A;  2W94 A;  2QZ2 A;  1YI9 A;  2R04 2;  4N9H A;  4CP1 A;  3PIJ A;  2VGD A;  1VRH 1;  1ZZB A;  4EE2 A;  1LOB A;  4MLO A;  3VHO A;  1B35 B;  1ND3 B;  5M0T A;  1QIQ A;  4Q4V 2;  3NKT A;  3IMM A;  4NAM A;  4XOG A;  5FP9 A;  2B46 X;  2XHN A;  1OH3 A;  5GJ6 A;  4Q0Q A;  3TN9 2;  2QFE A;  4IE6 A;  3LFI A;  4OQ8 A;  3CBN A;  1W6M A;  3ZSL A;  1W6O A;  5J09 A;  1DCS A;  4FCA A;  1MR5 A;  4JDN A;  5L9V A;  1C8N A;  5H9S A;  1H4H A;  2WNV B;  4QQ2 A;  3SH5 A;  5FJK A;  1UOG A;  1XE8 A;  2XJV A;  4QPI A;  1REF A;  3ZXF A;  4BQ3 A;  4ZKT B;  4MHR A;  5J7M A;  3H3L A;  4BQ5 A;  3DL3 A;  2G9F A;  4CEY B;  3M3C A;  2ADE A;  4XF3 A;  4KU8 A;  3N7K A;  4C1X A;  4WVM B;  1RJ7 A;  4JGZ A;  5ABJ A;  3ZYJ B;  2W52 A;  1PNF A;  2VUC A;  3CZU A;  1OLM E;  1WLT A;  2WT1 A;  2D98 A;  1HB1 A;  3B93 A;  3K4D A;  4YG0 A;  5FMO S;  4NII A;  1RB8 G;  3GCW A;  3N9O A;  4JDO A;  1IS4 A;  3IN9 A;  4FPK A;  4L2N A;  4CU9 A;  1H1M A;  3SHR A;  3WCS A;  2BEO A;  1JUI A;  4D3W A;  1COV 1;  1NYW A;  1RUD 3;  4YZ2 A;  2KM2 A;  4PDW B;  5K8S A;  1LHU A;  3AVS A;  1NKG A;  1ASJ 1;  3U10 A;  4Z1V A;  3S5Q A;  3ZMN A;  5KHG A;  3OBZ A;  4LOS A;  4Y22 A;  4YM0 A;  2NMN A;  2JDU A;  4FPY A;  4CUA A;  4UXA A;  4ZY9 A;  2ES3 A;  2BWA A;  2J1V A;  4CDQ A;  3VLB B;  1D4V B;  1TNR A;  1RGS A;  4NPL A;  1M4W A;  4R9C A;  4Y1U A;  5BXX A;  4LK6 A;  3KQ4 B;  5F6L B;  5IK4 A;  4GJY A;  1KS5 A;  2YDE A;  1SLT A;  2K46 A;  4QHO A;  1OVP A;  1XRU A;  2YGM A;  4LO7 A;  5FP3 A;  3V64 A;  5LA0 A;  1EP0 A;  2OVU A;  4HBN A;  1OOP C;  1VBE 3;  4MGY E;  5BNN C;  1W6N B;  4MGK E;  1WBL A;  3D5O A;  4Q4X 3;  3ZFE B;  4CTE A;  2XLF A;  1RL3 A;  4Y5T A;  1UOB A;  1ZNP A;  3V0A B;  2WN3 A;  3OPW A;  5FZF A;  4RR3 A;  2YXS A;  1HRV 1;  5FMB A;  1PGL 1;  4JGY C;  1QHD A;  4YGD A;  3M3I A;  2IVI B;  3ES4 A;  4XUN A;  5FUN A;  3ZMO A;  2ZOE B;  1EAH 3;  5AFB A;  1PO2 2;  1QJX 2;  2P3K A;  1GQG A;  3BOP A;  4I0A A;  4PDW C;  4GQ7 A;  4NRP A;  4AHZ A;  1G9F A;  1K5M B;  2HWB 1;  1ULE A;  4I2O A;  1IQD C;  2D44 A;  2JDH A;  2Q8O A;  2QVS B;  3C7H A;  5F5A A;  2IXI A;  2P17 A;  4COY A;  5FZ3 A;  4Q8K A;  1QJY 2;  1VBC 1;  3IZO A;  4AED B;  3LCP A;  1O4T A;  1VBA 3;  2ZGL A;  3O5S A;  4LNV A;  5LBE A;  5JSO A;  4N53 C;  4GWN A;  1UKG A;  3MIG A;  4MXW B;  4GH4 C;  1AXY A;  3U4S A;  3AZX A;  1WA4 A;  2RS5 1;  2W1U A;  5AFE A;  2BNN A;  4AVC A;  3QAC A;  4AVV A;  2JDP A;  1RUE 3;  1YJL A;  4TYS A;  5JMO A;  3EXU A;  5I8S A;  1O7F A;  3JB4 C;  3OCP A;  4XMI A;  4AQ6 A;  3WSO A;  2Y0O A;  2Y60 A;  3IWZ A;  5FZ1 A;  3ZR5 A;  4Q8L A;  4XE9 A;  1CZS A;  2YG0 A;  4BQY A;  1U5I A;  1UU4 A;  3SH4 A;  4LO5 B;  1Q8O A;  1A8D A;  4HPK A;  3SC7 X;  2YFZ A;  4HXC A;  5EFU A;  1W8T A;  2R06 2;  5LCW L;  5FZ7 A;  5F5C A;  2ARE A;  1VAL A;  5IAX A;  1WUV A;  1W6P B;  4PI2 A;  1J3R A;  1JI6 A;  3TOJ A;  1UPI A;  2QQW A;  2ZJC A;  5FYU A;  3USS A;  4DPN A;  1JXN A;  2Z42 A;  1SLC A;  2WNU C;  2XBO 2;  3DYM A;  2P3I A;  5FYZ A;  1ZBE 3;  3ZSJ A;  4BYY A;  5HCA A;  1RUG 3;  1FNZ A;  1UYZ A;  4ZZ5 A;  1X9T A;  1JYC A;  3PIG A;  3ZFG C;  1PVC 3;  5LAT A;  1J1L A;  4KU7 A;  5IAT A;  4ZS2 A;  2B5H A;  5GM0 A;  1D0G A;  1R08 3;  3ZPY A;  3BIE A;  4XXA A;  5JXG A;  1DYP A;  3JCI A;  1RMU 3;  1ENQ A;  2VMC A;  3KF5 A;  2X8K A;  4AOC A;  3OPT A;  4ORF A;  4QQH A;  1QMJ A;  3N9M A;  2ZEZ A;  1G86 A;  5FV3 A;  1AL2 1;  1Z78 A;  3WDV A;  2FCT A;  1AX1 A;  2PAK A;  3RZH A;  2Y6K A;  2P5B A;  4AK3 A;  4A2U A;  1OT5 A;  5EIY B;  1QJZ A;  2PEL A;  1SMV A;  3N7M A;  3RJ2 X;  4WZF A;  4NWV A;  1U5Z A;  2ZHM A;  4A4A A;  2WQZ C;  4OUM A;  5F9T A;  3EYP A;  1PGL 2;  2CTV A;  1ZRC A;  4JKM A;  1D4M 3;  2W2I A;  4JQT A;  5EYY A;  2PN5 A;  4NAO A;  1EPW A;  3I3E A;  4GB3 3;  2JG9 B;  2QQM A;  5A3M A;  5HI0 A;  1YQ5 A;  1V6N A;  1YFX A;  4JGZ C;  4P9L A;  4DRV A;  5HBA A;  1D7P M;  3H8U A;  3MIB A;  1OFN A;  4BJ0 A;  3W9A A;  2F17 A;  4JHZ A;  2VW0 A;  2VCB A;  3WNM A;  2PMW B;  4COU A;  1PHM A;  4RHV 2;  4LKS A;  5A7W A;  4XF1 A;  3N4M A;  3FUQ A;  5J1X A;  1MVE A;  4LQR A;  3THC A;  1ZRD A;  1Q3E A;  1VP6 A;  1G6N A;  3VDD B;  1OQ1 A;  5JOZ A;  1JOD A;  1X50 A;  2J1U A;  1SFN A;  1WA6 X;  4LIV A;  2CY6 A;  4FXG B;  5KC6 A;  5LA1 A;  4YRD A;  3LIG A;  1NZC A;  5JR2 A;  1PX4 A;  4LBJ A;  4CDU C;  5K0U C;  1LU1 A;  2PQS A;  2V5D A;  2WS9 2;  4R4X A;  2CGN A;  2ERF A;  1W2A X;  3WNP A;  3RGB A;  3E5U A;  1YCI A;  4Q29 A;  3OGJ A;  3OYW B;  5BNO A;  5JLV A;  1JYV A;  1HDK A;  2QQL A;  3O0W A;  4EWE A;  2JDK A;  3M8L A;  5F37 A;  1D2Q A;  3WDU A;  1WCU A;  1SCR A;  5D8A B;  5LK5 A;  4IUG A;  4D69 A;  5B4N A;  1ZRE A;  2KA3 A;  1EUU A;  1UF2 C;  2GZW A;  3POY A;  1FPN 3;  5JAX A;  2RR1 1;  1Z7S 2;  4CPB D;  3JD7 2;  2VXR A;  3V56 A;  1ZZC A;  4O65 A;  4QB2 A;  4QKN A;  1QJY 1;  1VBC 2;  4NIH A;  3RJR A;  1MPX A;  4HON A;  2V4V A;  1WCQ A;  2XVG A;  3NL1 A;  3U11 A;  3WP5 A;  3D3A A;  2P3Y A;  2RHP A;  2A3Y A;  2DWR A;  3OGG A;  5KWR A;  4L97 A;  1SLI A;  2NYY A;  3R6S A;  2BGP A;  1ASJ 3;  2HWC 2;  1NCQ A;  4OQ9 A;  5A1F A;  2HEY F;  2EXK A;  3O12 A;  4BCU A;  1O4Z A;  1V6J A;  3VBO A;  1N1T A;  1SZB A;  5HCH A;  4MGT A;  2V09 A;  3CDZ B;  5LK7 B;  3P6B A;  2HWD 1;  1SCS A;  4HN1 A;  2HWF 3;  4Q4V 1;  5FOB B;  1GOH A;  3ZXJ A;  1LAJ A;  3WW3 A;  3R4D B;  5E88 A;  5DUU A;  5F39 A;  4MXW A;  2VZ1 A;  2VTF A;  5D2A A;  3J7N A;  2RJ2 A;  1GAN A;  2XL9 A;  4UW4 A;  4IET A;  4UOJ A;  4BA6 A;  4A42 A;  1CQ9 A;  4CU6 A;  4DUV A;  4YZ4 A;  1HRI 1;  2GAU A;  2WL1 A;  4YM3 A;  3I2O A;  4LKD A;  4K20 A;  4QPG A;  4Y1V A;  5IAV A;  4AVA A;  2O8Q A;  3SEE A;  2JKX A;  3CZJ A;  4UAP A;  1KFU L;  2W91 A;  4LOT A;  4GD4 A;  4F3J A;  1KJL A;  5F32 A;  1UU6 A;  3ECQ A;  1SG3 A;  1DQ2 A;  1ZA7 A;  2QQN A;  1W39 A;  2JE7 A;  4RGA A;  2OII A;  3UKN A;  1XNT A;  1UXX X;  1GMM A;  2YC0 A;  4IGP A;  2DCT A;  4FSJ A;  4UW6 A;  3TN9 1;  3I3D A;  4RR3 B;  2D43 A;  3B00 A;  1I1E A;  2JB4 A;  4HL0 A;  4RS5 C;  4CXW A;  5FDB A;  1TME 3;  1YO8 A;  3AMN A;  3III A;  2VNO A;  4KBZ A;  5EPA A;  5LBB A;  3NO8 A;  5FIX A;  1X8M A;  4UF0 B;  3ROU A;  3POG A;  3O1T A;  2XJP A;  4CCJ A;  5FQ0 A;  4YW7 A;  3HT1 A;  1GNY A;  1BEV 3;  3LEG A;  4ARY A;  4KBB A;  4XAC A; 
#chains in the Genus database with same CATH homology
 2HYX A;  4A45 A;  2WO2 A;  1PMJ X;  2HLE A;  4HG6 B;  2W5F A;  1NUK A;  3VDB A;  3WQB A;  4QPW A;  3HPN A;  4OMC A;  3VDC A;  4ZXE A;  1JZ3 A;  1JHJ A;  3CKH A;  2W46 A;  3HNM A;  1L7R A;  2VL4 A;  3VD3 A;  2W1W A;  3W5N A;  3UES A;  3HOB A;  2Y6H A;  1UYX A;  3LEK A;  2VZS A;  5C71 A;  3J7H A;  3GDB A;  2JE8 A;  2WUH A;  2XQX A;  2J7M A;  3VD4 A;  1CIY A;  2QQK A;  3K75 B;  4JKK A;  4P02 B;  4QDR A;  3MBW A;  3NNG A;  4OMD A;  2ZEW A;  2VCA A;  3E1F 1;  2WO1 A;  2BZD A;  3MV0 1;  3P1I A;  1UY3 A;  2VZP A;  2VZO A;  1SDD B;  2J1T A;  1OF4 A;  1JYX A;  5JXI A;  5EJ1 B;  4TTG A;  4DUW A;  3VD7 A;  3PUI A;  4PQQ A;  4XUQ A;  2CDP A;  1XPW A;  1DLC A;  1ULP A;  3WF4 A;  3WEZ A;  3SEP A;  3HN3 A;  1H6Y A;  2B9V A;  3I2G A;  2C26 A;  1O8S A;  2VQU A;  2BGO A;  1W9S A;  5DPN A;  3I2K A;  5A1A A;  2CDO A;  3NJV A;  4MO3 M;  1UMI A;  2J22 A;  4QX3 A;  4BK5 A;  3WNO A;  2RVA A;  1XC6 A;  4QDS A;  3ACG A;  1W99 A;  4CUC A;  3ACI A;  5EJZ B;  4DEV A;  1O59 A;  2EID A;  1JZ5 A;  1F4H A;  2Y6J A;  1K45 A;  1GNY A;  4DUX A;  1K42 A;  1XNA A;  2EIB A;  2VZ3 A;  4GWJ A;  3I2J A;  5JXH A;  3A23 A;  2C4X A;  3T09 A;  4DXT A;  3EB7 A;  3CMG A;  1W8N A;  1JU3 A;  2VME A;  3OGS A;  4MGQ A;  2QBX A;  4QX1 A;  2VZR A;  5C70 A;  2WYS A;  4LPL A;  3MUZ 1;  3SKV A;  2VO5 A;  4E8C A;  1P8J A;  2WAB A;  4CUB A;  3HNB M;  1PMH X;  1CZV A;  2Y6L A;  3LE0 A;  1UY1 A;  1GOF A;  2VZU A;  3BGA A;  3I2H A;  2ID4 A;  2LS6 A;  3DEC A;  3T0A A;  4LHS A;  4D8M A;  1PX3 A;  4Z2A A;  1W9W A;  2YB7 A;  2W94 A;  3UNP A;  3ABZ A;  4UI9 L;  1JZ8 A;  2VZQ A;  3I2I A;  2QQJ A;  2VJX A;  5CZK A;  2XHN A;  3IDA A;  3C8X A;  2WZE A;  2EIC A;  1DYO A;  4A3Z A;  2WN2 A;  3IAP A;  4DEQ A;  4QX2 A;  1JZ2 A;  4KMQ A;  5G05 L;  3A22 A;  4GZ9 A;  4W8J A;  2W92 A;  4JX0 A;  2DCK A;  1GQP A;  4XVH A;  2B4K A;  1OD3 A;  2X10 A;  3U37 A;  4ARX A;  3LEI A;  1KEX A;  5JXJ A;  1JZ7 A;  3MO4 A;  1JZ6 A;  5HPO A;  1BHG A;  2Y64 A;  3K46 A;  1SHW B;  3I3B A;  3CZU A;  4DXS A;  4A6O A;  3K4D A;  2DDU A;  3T2P A;  1UY4 A;  3DYO A;  3WNL A;  4CU9 A;  3MV1 1;  2VOT A;  3I2F A;  1WKY A;  3ACF A;  1NKG A;  4XUR A;  4JKL A;  1UY0 A;  2VMF A;  2RV9 A;  2W3J A;  1HN1 A;  4CUA A;  4ZY9 A;  2W47 A;  2J1V A;  1J84 A;  3OGR A;  3MUY 1;  5CYY A;  3VD5 A;  5LA0 A;  2ORX A;  3A21 A;  3K4A A;  4P00 B;  5IJR A;  3HNY M;  1UZ0 A;  3LPF A;  3VDA A;  2Z4F A;  2WN3 A;  3I97 A;  4E8D A;  4GWI A;  4KI5 M;  2C9K A;  4P5Y A;  2Y8K A;  3DYP A;  3WF0 A;  5IFP A;  4XUN A;  2X09 A;  4BXS V;  1TG7 A;  3ZM8 A;  3GM8 A;  2ZEX A;  2WZ8 A;  2VR4 A;  1IQD C;  5DN2 A;  4M4P A;  3C7H A;  5FUI A;  2VZV A;  4FI9 A;  1H6X A;  3WF2 A;  4YPJ A;  2WQ8 A;  3C7E A;  3SKJ E;  1UMH A;  2XOM A;  2W1U A;  1US2 A;  5IFT A;  1NX9 A;  1JZ4 A;  4QAW A;  4XUO A;  2J1E A;  5JMO A;  4PF1 A;  2VM9 A;  3NJX A;  3WSO A;  3NRU A;  1CZS A;  5DQ0 A;  2YG0 A;  2WBK A;  2QQI A;  5G04 L;  4ARY A;  2WAA A;  1UYY A;  2YFZ A;  4A41 A;  5LCW L;  4A44 A;  2BER A;  2W1Q A;  3WNK A;  1OF3 A;  2R7E B;  1JI6 A;  3FHA A;  3DYM A;  2E32 A;  5B4X A;  5JUV A;  2VQT A;  1US3 A;  2E33 A;  1KGY A;  1UYZ A;  4L0P A;  3K77 A;  1UX7 A;  4AAX A;  4ZZ5 A;  4QX0 A;  1NAE A;  2JD9 A;  4XUP A;  2Y6G A;  3T2Q A;  1OH4 A;  4OZO A;  5JXG A;  3LPG A;  2VMC A;  1GU3 A;  3FL7 A;  3OEB A;  2ZEZ A;  3HJR A;  2Y6K A;  2J1R A;  1T2X A;  3NQH A;  1OT5 A;  5EIY B;  3IB3 A;  3WF3 A;  1CZT A;  1J83 A;  2W1S A;  3FN9 A;  4A4A A;  1RYY A;  1W9T A;  3ACH A;  3EYP A;  4W50 A;  4JKM A;  3I3E A;  2QQM A;  5LA2 A;  3OBA A;  3OG2 A;  3THD A;  4KWU A;  1JYN A;  2VC9 A;  3F2Z A;  1R64 A;  3A7Q A;  3WNN A;  2VCC A;  1YQ2 A;  5IHR A;  2DCJ A;  1D7P M;  2LW8 A;  1L7Q A;  4BJ0 A;  4JHZ A;  2W9X A;  2VCB A;  3T2O A;  3WNM A;  1JU4 A;  4LKS A;  4AG4 A;  4ET7 A;  5J1X A;  4LQR A;  3THC A;  3C7O A;  1O8P A;  3W5M A;  3T08 A;  2J1U A;  3AC0 A;  1UWW A;  2WAO A;  5LA1 A;  5JR2 A;  1F4A A;  1K12 A;  1JYW A;  1PX4 A;  2PQS A;  2V5D A;  4OYU A;  3WNP A;  3C7G A;  2VMD A;  5IYY A;  1ULO A;  2QQO A;  1JYV A;  2QQL A;  1W8O A;  5HXM A;  4MAD A;  2BBA A;  2OKX A;  2VZT A;  5I0D A;  2YC4 A;  5B4N A;  3CIH A;  4IUG A;  5F7U A;  1GUI A;  4XUT A;  1EUU A;  3ETP A;  2W87 A;  2EIE A;  1I5P A;  2JDA A;  2WO3 A;  1EUT A;  1TVG A;  2YC2 A;  3FHQ A;  4QB2 A;  3HEI A;  1MPX A;  3GXU A;  2V4V A;  1WCQ A;  3VD9 A;  4RN5 A;  3D3A A;  2YFU A;  3OB8 A;  2ZXQ A;  2XON A;  2BGP A;  1DP0 A;  1CX1 A;  1W0N A;  4XZU G;  4D0Q A;  3K4Z A;  4QB6 A;  4BDV B;  2E26 A;  4CU7 A;  3C7F A;  4CVU A;  3CDZ B;  4MOA A;  4DXR A;  3P6B A;  4ZZ8 A;  5DMY A;  1GOH A;  1GOG A;  3WF1 A;  4TXW A;  4OUE A;  1UY2 A;  2VZ1 A;  2J1A A;  4W4Z A;  2VTF A;  2RJ2 A;  2ZEY A;  4UOJ A;  4A42 A;  4CU6 A;  4DUV A;  4MGS A;  3UET A;  2W95 A;  4M4R A;  2JKX A;  3CZJ A;  4QB1 A;  2ORZ A;  4UAP A;  2L9L A;  3SEE A;  2W91 A;  3BN6 A;  3ECQ A;  1SG3 A;  2KD7 A;  2WDB A;  5C7G A;  2QQN A;  4RYD A;  3IAQ A;  3LQC A;  1XNT A;  1K3I A;  1UXX X;  2J1S A;  3GGL A;  1GMM A;  3T0D A;  4BK4 A;  4P08 A;  4PT6 A;  1UXZ A;  3I3D A;  4QDQ A;  4CU8 A;  3III A;  3T0B A;  3JXS A;  3CQO A;  3PUH A;  3OGV A;  1LNS A;  2X05 A;  3OEA A;  3LEG A;  2E31 A;  2V72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...