4AAXA

Cpgh89cbm32-5, from clostridium perfringens, in complex with n- acetylgalactosamine
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
140
structure length
140
Chain Sequence
ASALPQGNMKATATSEHPDVGNEGLAKFAIDGKENTIWHTKYNPVEELPQSITLELGGSYEINKFTYLPRSGAKNGNITKYELHVSEDGNNFRKISEGNWDDSGSLKTLKFNSTKATHVKLVALEGVGGFASAAELNVFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Carbohydrate Recognition by an Architecturally Complex Alpha-N-Acetylglucosaminidase from Clostridium Perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
molecule keywords ALPHA-N-ACETYLGLUCOSAMINIDASE
total genus 32
structure length 140
sequence length 140
ec nomenclature ec 3.2.1.50: Alpha-N-acetylglucosaminidase.
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4aaxA00
4OYUA 2VZQA 3OGVA 2W87A 2YFUA 3HNBM 4CU6A 2RJ2A 2RVAA 4M4RA 2WN3A 2ZXQA 4QX1A 1DYOA 3I97A 3K75B 4CUBA 2W94A 2JDAA 1GOGA 4JHZA 2VMCA 4P00B 2QQNA 5FUIA 4TTGA 1NUKA 3IIIA 1UWWA 2EIDA 3BGAA 2VJXA 4CUCA 4E8CA 4BJ0A 2W46A 3MV11 4W4ZA 2W1UA 2W47A 4ZZ5A 3T2PA 2BGOA 3NNGA 3LE0A 3OGRA 3UNPA 1F4AA 4RN5A 5JXJA 4JKKA 4DUXA 4XZUG 1EUUA 4OZOA 4UAPA 3SEPA 3VDCA 4ARXA 2VZ3A 2X05A 3DYOA 3GGLA 4RYDA 1UYYA 4KMQA 4UI9L 1WKYA 1PX4A 3A23A 2XONA 3HOBA 1PX3A 3U37A 4LHSA 1ULOA 5JXIA 4DXRA 2VZOA 3MO4A 5EJ1B 3P6BA 2WAAA 2EIEA 1JZ4A 3CZJA 3OEBA 4L0PA 4JKMA 2V5DA 1H6XA 2QQIA 1UY0A 3I2KA 1SDDB 1D7PM 2X09A 1K45A 1TG7A 3ACIA 1JYWA 2VQUA 3LEGA 2C4XA 5J1XA 4MADA 3HJRA 3T0BA 5C70A 3K4ZA 4MGQA 3WNLA 4E8DA 5A1AA 3VD3A 3WEZA 2VTFA 1J83A 3VD4A 3DECA 1JI6A 3SKJE 3CKHA 3FHAA 3FHQA 3ACGA 2W1QA 4CUAA 3I3BA 1CIYA 4AAXA 3WNOA 1UMHA 5IYYA 1CZTA 1IQDC 3MV01 5IFTA 2VZTA 4BK5A 3A21A 3E1F1 1GQPA 5DN2A 3WNKA 1US3A 4HG6B 1JU3A 1JZ6A 2PQSA 2YC4A 2VMFA 3GM8A 3UETA 2WBKA 3HEIA 3C7OA 3WF3A 2WQ8A 3VD5A 2QQMA 2WN2A 5LCWL 3CIHA 3NJVA 1W99A 5C7GA 4ZXEA 2WYSA 2DDUA 5LA0A 5JMOA 3I3EA 1TVGA 1JZ7A 3THCA 2Y6GA 4MOAA 1UZ0A 3P1IA 1L7RA 4GZ9A 1HN1A 3T09A 2VR4A 4PQQA 1RYYA 2BGPA 3DYPA 2BERA 4M4PA 4OMCA 3LEIA 3VD7A 1SHWB 1OT5A 3OG2A 4CU9A 3A7QA 2BZDA 4LPLA 2DCKA 2EIBA 3IB3A 3VDAA 4PT6A 4QB6A 2J22A 2J1RA 1XPWA 5EIYB 4CU8A 1W9SA 4A42A 3MUZ1 2CDOA 3HNMA 1YQ2A 4JX0A 4Z2AA 4QX0A 1BHGA 3GDBA 4ET7A 2QQOA 5IFPA 2LS6A 1H6YA 3PUIA 4DXTA 2E26A 3WNMA 5JUVA 4TXWA 3NQHA 3CQOA 2WDBA 4D8MA 2Y6HA 3K4DA 5IJRA 1JU4A 2VMEA 1OF4A 2VCBA 1GUIA 4D0QA 4GWJA 3D3AA 4QX2A 3C7EA 5DMYA 5B4NA 4BDVB 1KEXA 3T0AA 5IHRA 3PUHA 3MUY1 4XUNA 2J1VA 3C7HA 1NAEA 1GOHA 2CDPA 1O8SA 4YPJA 4PF1A 1UXXX 1EUTA 4W8JA 2XQXA 3ACHA 2VO5A 4A41A 3A22A 4IUGA 1UMIA 3C7GA 2ZEXA 3CDZB 1WCQA 1ULPA 4JKLA 2VZ1A 1SG3A 3CMGA 4P08A 5C71A 1CX1A 4A44A 4QDQA 3WF2A 4XUOA 3I2GA 3I2JA 2ZEYA 2Y8KA 4BK4A 2W9XA 2VZVA 3HNYM 4QB1A 2Z4FA 3HPNA 2Y6LA 2QQJA 2YFZA 4XUPA 3W5NA 2WUHA 2VOTA 2W1SA 2VCAA 4KI5M 4XVHA 3THDA 4DEQA 1XNTA 3EYPA 1JYXA 1P8JA 4UOJA 1DP0A 1LNSA 1NX9A 2B9VA 2ZEZA 3ETPA 2YB7A 3SKVA 4QDRA 3IAQA 4LKSA 1F4HA 1PMHX 2J1AA 2KD7A 1W9WA 3LEKA 3WF1A 3WSOA 2ORXA 5G05L 3C7FA 2LW8A 3ACFA 4DUWA 1JZ2A 2VCCA 1UY1A 1OH4A 2E31A 3MBWA 1K12A 1PMJX 3FN9A 3NJXA 2Y64A 2E32A 1K42A 1DLCA 5LA1A 3J7HA 4MO3M 2VZSA 3LPGA 4CU7A 5HPOA 3C8XA 2W1WA 4FI9A 1KGYA 4DXSA 4A3ZA 1CZVA 3VDBA 2VMDA 1O59A 1JYVA 2R7EB 2VL4A 3ABZA 1GNYA 5F7UA 3SEEA 2QQKA 3W5MA 3T08A 3I3DA 3K77A 2VZRA 4OMDA 3OBAA 3IDAA 3LPFA 2V72A 3WNNA 4W50A 2DCJA 3ECQA 2J7MA 2WO3A 2VZPA 1L7QA 1GOFA 1J84A 2Y6KA 4MGSA 5I0DA 1W9TA 4XUQA 2VM9A 2WZ8A 4ZY9A 2HLEA 4QB2A 3T2OA 3I2IA 3NRUA 2X10A 2JD9A 4QAWA 3T2QA 2QBXA 2JKXA 2XHNA 2C26A 1JZ5A 2EICA 5HXMA 4AG4A 4QDSA 5DQ0A 3VD9A 3WNPA 2J1SA 3GXUA 1UYXA 4P02B 4XURA 1W0NA 3F2ZA 5JXGA 1GU3A 1UY4A 2OKXA 4DEVA 3UESA 3I2FA 3IAPA 3AC0A 4QPWA 3LQCA 1O8PA 4KWUA 5G04L 1OF3A 5CZKA 3HN3A 2Y6JA 3OGSA 3ZM8A 5JR2A 1W8NA 2C9KA 1XC6A 4CVUA 1W8OA 2WO1A 1OD3A 1UX7A 1JZ3A 4OUEA 3WQBA 2ZEWA 2VQTA 4XUTA 4ARYA 2ORZA 3JXSA 1US2A 2WAOA 2RV9A 1UY3A 1R64A 2YG0A 3K46A 3FL7A 1JZ8A 2XOMA 3WF4A 3T0DA 2W95A 2BBAA 5LA2A 2W91A 3DYMA 1UY2A 3CZUA 2VC9A 2WZEA 3OEAA 1JHJA 2ID4A 1GMMA 2VZUA 1UXZA 2L9LA 2YC2A 5CYYA 1K3IA 2B4KA 2W5FA 1CZSA 3OB8A 4A45A 4ZZ8A 2J1UA 4QX3A 2W92A 2V4VA 4BXSV 1UYZA 1I5PA 1XNAA 2JE8A 5JXHA 5EJZB 4DUVA 3K4AA 1JYNA 2W3JA 2QQLA 2J1TA 1T2XA 2J1EA 3BN6A 4A6OA 1MPXA 3I2HA 2HYXA 4P5YA 1NKGA 4A4AA 4GWIA 3WF0A 2E33A 4LQRA 3EB7A 5DPNA 2WABA 5B4XA 2WO2A
chains in the Genus database with same CATH superfamily
2HWC3 3MIDA 5C9AA 1UYPA 3Q9OA 5A7OA 1JYTA 3VZOA 2W87A 1KFUL 2RG4A 4C0BA 2D3PA 3HNBM 1AR63 1BEV3 3JZVA 3Q8BA 2R043 4SLIA 2XBO1 2YHJA 4S2HA 4XF9A 2D6KA 4D3WA 3T4VA 1DQ1A 1DZQA 1JBCA 4YG3A 2QNKA 4D7YA 3WY6A 2W94A 4FPJA 1YFUA 3ZXLA 3MIEA 4K6BA 2VMCA 2OUHA 1SLBA 4DMIA 3TNPB 1ULFA 5FZOB 4R9BA 3UL2A 4PJYA 4CYDA 2XJSA 1N1YA 4TTGA 3IIIA 2RS53 4GIQA 4N9HA 3ZFFA 2EIDA 3O0WA 4RL7A 3BGAA 4CCKA 3AFGA 5B2GB 2IXLA 5KHHA 2ZX0A 3MV11 4RGKA 3IMNA 1WD4A 2VG9A 4ZZ5A 1AR73 2WWJA 3LFIA 3SITA 3T2PA 1XNCA 3B94A 1NLSA 1AR61 3LD8A 4JGYC 2VMIA 4HK9A 4YW3A 1T6BX 3V64A 4LTAA 4JKKA 4XZUG 2VW1A 1WCUA 5EXOA 2RDSA 2XBO3 4OZOA 4UAPA 5FZIA 4ARXA 5FWJA 2D6NA 3KB5A 2X05A 2NLRA 4NIDA 1CAUA 1PO12 5FJKA 1A8DA 2X5IC 3U4SA 2FDKA 4A7ZA 5IT6A 5FZBA 2FDGA 2IXJA 1YEWA 2NMOA 4IV3B 5EPAA 1MZFA 3A0KA 3PVEA 4XXPA 5DZGA 3VKFC 3A23A 4U36A 3HOBA 3RRDA 1PX3A 4DRVA 5GLWA 3WDUA 2DU0A 3U37A 4FTBA 4A7YA 3WW3A 4DXRA 1APNA 1AL21 2ZZQA 4OHVA 1QQP2 3MO4A 3POSA 1DQ4A 4Y1UA 4RHV2 5FLIA 1ULDA 2WAAA 3DGTA 4GWMA 4W6XA 4Q4V2 2E6VA 4N7IA 5JZGA 3VL9A 4JKMA 4CPBA 4CCEA 4RD7A 3WCRA 1VLNA 2JEMA 1I1EA 1OURA 3CJXA 2X5IA 3E6BA 5A7SA 2VPVA 3OD0A 3GALA 1D7PM 1H1MA 5FMBA 4E2QA 2B5HA 5A80A 1O4ZA 1BXHA 2WS92 5FYSA 5JPNB 3ZXFA 1ENQA 4CDUA 4EN7B 1U5YA 5FZLA 1SFPA 1ZYBA 5JOWA 2DFCA 3FLPA 3AP6A 3PU8A 3HVDA 3JU9A 2JG9B 2JX9A 2C4XA 2VD7A 4AFCA 4EZ4A 5C70A 3NL1A 2CAVA 3WNLA 3KT1A 2AR6A 1C1FA 1PZ9A 4K3UA 3N4MA 1J83A 1WLCA 4YWAA 2H0BA 4GXLA 1OQDA 3CKHA 2GZWA 1MZ6A 1UF2C 3R0RA 2RDQA 3FJSA 5CU1A 5I0RA 3ACGA 2W1QA 2YPJA 5FMDA 4AF9A 4CUAA 4CEYA 1VBE3 2PAEA 2VBDA 1GBGA 5KC5A 1UMHA 5FIXA 4UFHA 1CZTA 2GAUA 5LEKA 2VOVA 3R05A 1XE7A 3WZ1A 5IFTA 1PK6B 4BK5A 1AZDA 1R081 1SBEA 1ULGA 2WNEA 2WNUA 1H30A 1US3A 3A21A 3IM0A 4DY3A 1RIRA 3UKNA 4HT1T 4ZS3A 4M01A 2YC4A 3T2TA 5JI7A 3E5XA 3GZAA 1XSRA 3OGJA 3OUIA 3GM8A 4ZONA 2FCTA 1QJFA 3LDRA 2QZ2A 3RPQA 3S30A 4AEJA 4B1LA 4N9IA 4K20A 3OPTA 1IGOA 3ZPYA 5F3CA 1Y9QA 4GJZA 1IS4A 4TN7A 3LDBA 3WQ0A 4C0HA 1X9PA 2P17A 1H8TB 1RUH2 2ZAHA 4MX3A 1TMF1 1V00A 4XBLA 4QQOA 3CIHA 5L9VA 4JC1A 5FO7B 1MQTC 2QQPA 4D7SA 1UX6A 1JN2P 5C7GA 1CAVA 1CIWA 1POV3 3PVNA 5FOBB 2DVBA 4HN0A 5FY0A 2UY9A 2OUJA 5FYYA 5J98B 1JZ7A 2R30A 3FZ3A 5F3GA 1UO9A 2XHKA 1OH3A 3K48A 2OZJA 3P1IA 2G9GA 1OBNA 2WFPA 1LTEA 2WSVA 3B9CA 5DAQA 1HXS1 2AYHA 1Q43A 1RUE1 1HRI1 4XCBA 4EE2A 2YU2A 4LK7A 4PQQA 2JB8A 2WRAA 2QDRA 1QH7A 3VUOA 2BFUL 5JSOA 4BA6A 3LOIA 4HETA 5ERLA 1HW5A 4CRQA 4QWNA 2DUPA 3HQRA 1SHWB 4FPKA 1W3XA 1RUG1 3POGA 2A3WA 4YFZA 2BZDA 3RZGA 5KWRA 2VNGA 4IE7A 4R4ZA 5FAXA 2EIBA 3Q8EA 4D7TA 5FBJA 4CCNA 2IXHA 2GC1A 1TME3 1MACA 2PHLA 3LGRA 5FZAA 3BPZA 2WNUC 1NA1C 4M3CF 3O1VA 3WOGA 1V0AA 2XVKA 4XQDA 1PM7A 2LS6A 1H6YA 1BYHA 2XWJB 3CO2A 3PUIA 4NPLA 4DXTA 4H55A 3TEZA 2KR2A 1PNGA 2D44A 5JUVA 3FE5A 4TXWA 3RI9A 2IXIA 5FCCA 2ZCWA 3ZFGA 3WHUA 4XFGA 2VOXA 5JSPA 5IJRA 4DINB 2D3SA 1MS5A 1OF4A 1PVC2 1OKOA 3PUAA 4I0WB 3SC7X 3SHRA 3W21A 4O9GA 2D40A 4H7LA 2WLPA 3AL5A 4QKBA 3D3AA 3BALA 4HVQA 1QNWA 4GJYA 4CXYA 3LEMA 5DMYA 2FCUA 5GM0A 3KMHA 5I8SA 2WFF2 3DPRB 3B5LB 3MUY1 4FSJA 3KM5A 4LIUA 5T55A 5FQ0A 2XH6A 1Y4WA 2J1VA 1LGNA 3WP5A 4JDOA 1BMV2 1RVF1 3C7HA 3R4SA 2ERFA 1POV1 3DCQA 2CDPA 4KGQA 4PBOA 5BNNA 1IS6A 5F32A 2X53S 1UXXX 5CVRA 1BEV1 4ZKTB 2RDRA 1VBA3 5FP9A 1OSGA 1VMJA 2YPDA 5FTTC 3RJ2X 4RFRB 1PO23 1NCQA 2FDIA 2VO5A 4N7UA 2ADEA 3ZYRA 3N7KA 1WGPA 2LTNA 4K21A 3RJRA 1LOGA 5KHGA 5DDJ2 5IVJA 1FNZA 3CU7A 3IPVA 4MXWB 4HSLA 4JKLA 1URXA 2VZ1A 3AMPA 1SG3A 3CMGA 3J8F2 2EXIA 4ASMB 1JW6A 5GKAC 5C71A 3SMHA 3GCWA 2Q30A 4HMZA 4A7KA 1SEFA 2BEOA 1OA4A 3I2GA 4EWDA 2VVFA 2ZEYA 1HRI2 1MZEA 1NLRA 4GQ7A 4BK4A 3H8XA 4YRDA 5CAZA 1ZREA 3AYDA 4OI1A 1Q8VA 3NV3A 1ONAA 2RJKA 4HSJA 2XJUA 3HPNA 2WJSA 4FFFA 4O7XA 1CESA 4AR2A 1GR3A 2VTXJ 2FZ1A 1H2NA 2A6VA 5DAWA 4MSVA 2CTVA 3W5NA 1XQNA 2VCAA 3AFKA 1ZBA2 4KI5M 4XVHA 2WA3A 1TQ5A 1XNTA 3EYPA 2A1XA 4YZ1A 5EYYA 2EXJA 5LY2A 4OZXA 1DGWX 1DP0A 5C5TA 1LNSA 3RDIA 2B9VA 4XMAA 4PLNA 3U14A 4DNYA 4QXHA 1AF9A 1VRH3 2X8KA 2J1AA 2KD7A 1YJKA 3CJIA 3OBTA 2CSGA 2AACA 3AP7A 1V6JA 1ZA4A 2HBUA 2JDUA 2ZABA 3H42B 2IFWA 1FAYA 3QCWA 4ZU5A 3WSOA 4YW1A 3VBFB 5F8PA 3LSEA 1YXWA 1VBB3 1JZ2A 4BXFA 1RVF3 4CDXA 2JE9A 1GZ9A 1WW7A 2E31A 3HT1A 5FPZA 2DYCA 1NY71 1XE0A 1VBE1 2HH9A 4NOTA 1PMJX 5FZMA 3SCGA 1YIFA 4AEDA 1ALYA 3H7JA 1TNFA 4WM8B 3H8RA 2WQ4A 1FXZA 5A7QA 2WNVB 3GJAA 4GB31 4CU7A 1F8VA 2IUWA 4D6RA 3KHCA 3HQUA 4MYEA 2D5HA 1KGYA 3I59B 4DXSA 4RR3B 5C9AC 1CZVA 3NMBA 1VRBA 1ZVFA 2VMDA 3UYJA 1RVF2 4OUSA 1V9U3 1GP6A 3G7DA 5DAVA 4S2GA 3SEEA 2YC0A 4HVOA 2QQKA 1RUOA 2YV8A 4PDWC 3U75A 3K77A 5LZ6A 1BQPA 1H4GA 4LO6B 1V6IA 1RJ8A 1WA6X 1ZRIA 2VZRA 3MW3A 1RJ7A 5A3WA 1I3HA 2Q8CA 1CAXA 1TME1 2OW4A 4N43A 4AI8A 4CP2A 1BKZA 3BIWE 5BYNA 2R071 5J36A 3OOXA 2JG8C 5FK7A 1LU1A 4AQ6A 1WW4A 4CEWA 1D4M2 4YVSA 5FKCA 2WO3A 2G9FA 3SISA 3DEMA 1L7QA 3VBSC 3WQ1A 3AVRA 4UBGA 2XWBB 1WMXA 4IEZA 2D6PA 3L9JT 4HPKB 5DXDA 2P34A 4HLTA 1TZOA 1YC61 1J84A 2OPKA 4XJZA 3T1LA 3MEPA 4ASKA 1X36A 4JQTA 1GWKA 2VBPA 1AYM3 1FT9A 5FY8A 5KHKA 1IZ3A 3OD4A 1PGL2 2GN7A 3TN93 4GAZA 4LBMA 3DPRA 5FDBA 1KFXL 3IIAA 2A73B 2BQPA 2CGNA 3J8F3 3V65A 1QJX3 4LK6A 3P5BA 2ARBA 1PK6A 4CP9B 4PI2A 2ARAA 5JMCA 2JKXA 4YVWA 4L8QA 1YNAA 4HKLA 2F17A 5A6YA 4OFGA 3ZDVA 4YVSC 4GH4B 3THPA 3NKTA 1JZ5A 1OVPA 3EO6A 4A2UA 2GH8A 1HX6A 1W6MA 2V4AA 3M3OA 2XJVA 3GXUA 1W0NA 4WM8A 3AP9A 5HCFA 2XGXA 1XB9A 1ULEA 4I09A 4C91A 3ZXEA 2BNMA 2JDPA 5FZ0A 3WXPA 4HL0A 4IE6A 4U2AA 3VHPA 2LRPA 1OKQA 3HN3A 5JR2A 4LHLA 4YW5A 5HI0A 5C3OA 1O3TA 1XC6A 1A8MA 1RUF1 1PO13 3VBHB 5CISA 1AR81 3D5OA 2R0HA 2WO1A 3OY8B 5J09A 2VUJA 1RHI1 3M3IA 5FYBA 4PIZA 3S5AA 4D69A 4FPFA 4NAOA 1OD3A 1TMF2 4I0AA 2PYTA 2XLFA 4WM7A 1FOD1 2VQTA 4E4DX 1MEC3 4ARYA 1R082 4AVAA 1US2A 4WM7B 1YQ5A 4I3PA 3WP3A 4L9BA 5A1LA 3EHKA 2R49A 1W03A 3A0NA 5FOJB 1SFYA 3LOBA 3ZR6A 2ZPXA 3ZN6B 4AE2A 4B8EA 3T0DA 2FD8A 4P9YA 3DYMA 3KV6A 1I6XA 3IT8A 2WZEA 4YM2A 3ZXGA 2ID4A 4QQHA 2OT7A 3MIGA 3NNMA 4DXZA 4FFIA 2UY8A 3ROUA 1TME2 2B45X 4AVBA 5JPMB 1XE8A 2AUYA 2W5FA 2ET7A 3OSDA 2R072 1W9YA 1XU1A 1RHI3 4KWLA 3OB8A 1ODNA 4AI3A 1LULA 4P14A 4A45A 5JZGC 3T1MA 3RZLA 1GV9A 4UYBA 5JIUA 1LHUA 4M00A 2J1UA 3WDTA 3V0AA 3GBWA 4QX3A 4C1WA 2V4VA 4PLMA 4BXSV 1I5PA 1DGLA 4R52A 4KNCA 4BQWA 3LKJA 4DUVA 1HXS2 5FK8A 2O8QA 1GZCA 2ZGOA 3CL1A 4KGGA 3J7LA 1T2XA 2J1EA 3BN6A 3HMYA 3WP6A 4CCMA 5KC6A 4URAA 1D2QA 1MPXA 2PMWB 5LK5A 1NKGA 5GJ6A 4GWIA 1W06A 2ZGNA 2A70A 3RG0A 4XOGA 4AW7A 1G9CA 5KXBA 3KF3A 1Y43B 5DZFA 4LQRA 4MGIE 5LY1A 2ZKLA 4MH0E 3ZFFC 4IETA 3E5QA 2W08A 1J58A 4Q27A 5FYZA 2UU8A 5DUXA 1DGRN 4HXCA 4J6GA 4COWA 4J1XA 2XDVA 1HB1A 3FFZA 3N7JA 4Y5SA 3THTA 2E7QA 3AZZA 4H3WA 2VZQA 4OYUA 3WX5A 3FC0A 4OI0A 3IBMA 1Y9MA 1K5JA 2DU1A 4RS5A 1EPZA 1HB4A 5ANQA 1AR93 2ZMKA 2WN3A 3KQRA 4QPGC 4X8NA 4QQ2A 1BEV2 3MF9A 4FQZA 1DYOA 4QX1A 4GA9A 5E8AA 2VGDA 3U4XA 1ZBA1 4BLIA 3K75B 1MS1A 4J1WA 1UOGA 4HBNA 1GOGA 1RUF2 5A7NA 3LA7A 4GB33 1UL9A 4P00B 4V2VA 2QQNA 5F2SA 3O5SA 5CG8A 5FUIA 1NUKA 1KDKA 2CWMA 4EWEA 2RS11 5J3UA 1WCDJ 4RA0A 2W39A 3PLQA 3DF0A 4NE9A 4BQ5A 4CUCA 4QGLA 3J7NA 4E8CA 5E89A 1KJRA 1RMU2 3RNSA 3J8F1 4GMP0 5GZDA 5A3MA 3L2YA 3NNGA 3LE0A 2UWAA 3PMEA 3OGRA 5LASA 3UNPA 1LHNA 4UFJA 4BQ4A 1G86A 4RN5A 1LGBA 4LT5A 1M06G 2O14A 5C6CA 3VBFA 2QKDA 2WR9A 3POFA 1W6QB 1I5ZA 3QH6A 4TSVA 5JXJA 5FYCA 3VDCA 5C8CA 1JS9A 2JWPA 2VZ3A 2CGOA 3KWVA 3USSA 4IDZA 1QH6A 1XSQA 1YFWA 4KG0A 3RWNA 1MS0A 3GGLA 5JCTA 4FT8A 1D4M3 4IXLA 5JOXA 1QWRA 3SNMA 3VBRC 4UFLA 1K5MA 1QEXA 1WKYA 1H2MA 1JH5A 1PIV1 4XDOA 4LE3A 3RYRA 3WHTA 3OBZA 4NN0A 1N1TA 2AREA 2BWCA 1NCRA 2ZX1A 3POYA 4L11A 5T54A 4Q4V3 1IOAA 3DKQA 2VZOA 3APBA 1V6OA 4XJ8A 2LALA 5C3PA 2F4PA 5FYVA 4PIYA 3OEBA 5FUNA 1VBB1 1QOTA 2RHPA 1H6XA 2BV4A 3AMMA 1UY0A 2HWC1 3ZXJA 1SCRA 4H7MA 4EN8B 3H3LA 1OA3A 5A3LA 1V6KA 3GZUC 3OGGA 2X09A 1C3HA 5C8CC 1K45A 3VBRA 4LLOA 2BOJA 3ZYBA 4CP9A 2GMEA 4AEDC 2FDHA 3P3PA 3RI8A 4LIVA 1JYWA 1R1A2 2VQUA 3LEGA 2DVDA 1YFXA 3MLKA 3W59A 4F7ZA 1LOEA 1QXPA 2D6OX 5C4WA 4GKXA 4CZSA 4FOYA 4LORA 4CXWA 4UT5A 5FPXA 4XJWA 4OQ9A 2WS93 5A1AA 1O5LA 3WEZA 2VTFA 2ATFA 3PVOA 1JI6A 1D4VB 3WG2A 2XL9A 1UOBA 3INAA 5HCAA 4AEKA 1EV11 3FHAA 1UD1A 1VBC2 1QJX1 1OD5A 5F3EA 1FATA 3V56A 1CIYA 4LO7A 3AKSA 1FMD3 1UKRA 2HWF3 1W8HA 5JSRA 1YLLA 3MV01 1ZZBA 2IFRA 3KCYA 5FPAA 1PVC3 4LEJA 4ORFA 3ZKUA 4LOTA 4HG6B 5CFDB 1KITA 4AI0A 1AYN2 5F5AA 1H1AA 2VE1A 5EZWA 1YWKA 2PQSA 2BNNA 3KQ4B 3B02A 3RMXA 1ENXA 5CEHA 1W04A 4XFBA 2XJPA 4P9LA 4CPBD 2PLV1 5A32B 2A5ZA 4QX7A 4CEYC 1YFYA 1IPJA 4WZFA 3C7OA 1AR62 3ON7A 3TOJA 3WF3A 2MEV1 2D6LX 2WQ8A 1UZVA 3LF7A 3MIHA 3VD5A 4COZA 2QQMA 3VKOA 2ZMLA 4FXGB 2WN2A 5E6HA 3M8LA 5A3OA 3ZDSA 1RUNA 5H9SA 4ZXEA 5T5PA 2DDUA 5LA0A 2ET1A 3B93A 3IZOA 3VV1A 3ZMOA 4BH9A 1VRH2 3KGZA 1TVGA 5JMOA 1W8ZA 4INDA 3IKWA 1XYPA 1HLCA 2EVXA 2RDNA 2Y6GA 4MOAA 5AC91 3R4DB 4V2WA 5SV5A 1ZBE2 2BWAA 5BXXA 3KSCA 1TNRA 2YY1A 3H1WA 4FOVA 4FAGA 3AZXA 4GZ9A 5A6XA 5I91A 3T09A 2DWRA 3ASIA 5FZ1A 1AL22 2WIIB 2VR4A 1QU0A 1C1LA 5FZOA 2Q1FA 4UFIA 4D94A 3ILNA 1S0CA 1HB2A 4JRLA 5JDBA 4ASLA 2WNVA 4OMCA 5C5UA 3VD7A 3M70A 5JZGB 5F37A 1OT5A 3ZYGA 3POJA 4Q4X3 2TBVA 1NCRB 4COUA 4LPLA 1OI6A 3I3QA 1CJPA 2NM1A 3QD6A 3IB3A 2JDKA 4PT6A 2Y26A 5FLHA 3TEWA 2P6HA 2V73A 2J22A 4TWTA 1J3PA 1QOSA 1AR71 2XXZA 3PIGA 4Y24A 4WBBA 4QPIB 4CDXB 5EIYB 1C8M2 2PXJA 3SH5A 3LIHA 5FMOS 2CDOA 4CEYB 3HNMA 2FDJA 3BVCA 1D2SA 2Y60A 4Y20B 4QX0A 4TYSA 5IFPA 1ASJ3 1NCQB 4B29A 5CFCC 4LNVA 2H0VA 2E26A 3RYPA 2ZTNA 1W6QA 5IVFA 2B42B 1OQEA 3QBQA 5IAVA 2QCSB 5FWEA 2WDBA 2Y38A 5GALA 4CEWB 3BKZA 4Y4RA 4E4HA 2Y6HA 3I4IA 3K4DA 2BPA2 1AR92 5JWPA 2VMEA 3IWZA 4LBKA 2VCBA 2VNRA 1Q8OA 5FY7A 4UW3A 2P1BA 4NAMA 2DF7A 5FZGA 1C8M3 2NN8A 5FJHA 1LKNA 3FMGA 1NA1A 1AR83 1JUHA 5B4NA 1KEXA 2CYFA 2MEV3 3PUHA 4NHKA 4Q4W2 4XACA 3VZNA 1WW6A 4AYUA 3I49A 2DCYA 1EV13 3AVSA 2GNDA 1W2TA 2N7GA 4QM8A 1F5FA 1GOHA 1EPWA 5T5LA 1JYIA 1BK0A 1WWYA 3LCPA 4YPJA 3ST7A 2VQ0A 5GZCA 4CXXA 5J96B 4MUVA 5FO8B 1Z0HA 4IGQA 4P5HA 1SLLA 4AVTA 3M4FA 4NRPA 5FPVA 3ACHA 4KBZA 1V9U2 1UIJA 1DIWA 1U0AA 4XXAA 4C90A 2D98A 5LBBA 2BRTA 5CFDC 4JHTA 4IUGA 4MHUA 5JR7B 5AVPA 3CBNA 3RZZA 4Y26A 1ENRA 1O4YA 3ALQA 4IEVA 4AQSA 5C3RA 2JXAA 1F15A 4AVCA 1MR5A 3DPRC 2ZGKA 5FREA 3BTZA 4CSWA 2OQ7A 3VBUC 1A3KA 3HN1A 4G3YC 4Q8LA 3PUQA 1GP5A 2ILMA 3HBZA 2OYZA 1WA4A 5AC92 5LRSA 4QU2A 4F83A 2K9ZA 5F6KA 3RMYA 2Y8KA 1Q8PA 1SACA 2D5FA 4PCRA 5HCHA 3PVBB 4BU2A 3FLRA 4QB1A 5BNPB 5K0UB 5KBFA 1O91A 1RUJ3 1LB2A 3B01A 3R6SA 3KV5A 2Y6LA 3OF1A 4KL1A 2EF6A 2UWCA 4MV2A 2WNUB 2YFZA 2R16A 4FPEA 1JOPA 4MGZE 2VOTA 2W1SA 2WWSA 3PTYA 3RWKX 1JYXA 4H2AA 2GALA 4ISQA 4JGZA 4UOJA 4QXBA 4FPCA 4XAAA 2ZEZA 2QJVA 3IAQA 5FZKA 1FYUA 4Q4Y2 2BU9A 1C8M1 4LKSA 5FR3A 2JDZA 1SZBA 2DVAA 3I2OA 1LOBA 4Q4X1 3RYKA 3WDVA 3PMSA 3ILFA 4PDWA 5I0SA 5LA9A 4PI0A 3C7FA 3ACFA 3ME2A 4XCAA 1UU5A 3ZYIB 4DUWA 2VW2A 5JOYA 1LEMA 4N43B 4R9CA 1UY1A 5A6QA 1NZCA 3C3VA 2JE7A 5LWBA 2YU1A 4IV3C 4CDUC 3LSDA 2CY6A 2Y64A 4JCKA 5KR7A 5HV0A 3O1UA 1HJGA 3VGIA 3N9LA 2HEVF 1Y9GA 2E32A 2BBVA 1W2NA 3VHNA 1REDA 3VBSA 1RUE3 1LOFA 4MO3M 2XJQA 4UWDA 1YJLA 2PELA 1HKDA 3C8XA 2Q8EA 4ZPIA 4GD4A 5FPLA 3AK0A 4HK8A 4Y1YA 5A70A 3GF6A 1U5IA 1WBLA 1O59A 3VZMA 1JYVA 4CDXC 2YROA 1H9WA 4YGCA 3H7YA 3ZXAC 1X8EA 1MEC2 2WYFA 2XUEA 5F1RA 2RJLA 4NHMA 4MLOA 4OMDA 5FUPA 1TMF3 3OBAA 4MGYE 2A6YA 3IDAA 3D4KA 4JDNA 4W50A 1RUC3 2DCJA 2QFEA 1F35A 1AHSA 4FPHA 1U5XA 1B09A 3AMNA 4IGOA 1ZRDA 4UW4A 5F2WA 3BODA 3WD5A 1DQ2A 3E6CC 4E4SA 1EAH3 1T6GC 2VNVA 2I2SA 3C2UA 1JODA 2WC2A 1MS4A 3CF6E 4LO5B 1Q3EA 3E6DA 5FP4A 4ZHNA 2YUEA 4HKOA 1S0EA 1HRI3 1JTZX 1EY2A 3VBOC 1Q8SA 3UGHA 4M3CE 1DZRA 3W9AA 1GP4A 1ZBE3 2Y6KA 3I8TA 5I0DA 4AFDA 1PVXA 4XF1A 4ITCA 4XUQA 3PHMA 4BYYA 2P3YA 5IVYA 4CCOA 1WMEA 3GHMA 2BYVE 2ZKNA 1S0BA 2HLEA 4AHYA 1XRUA 4Q4V1 1ST8A 3T2OA 4OHYA 1H8TC 4K40A 1RUF3 3BB6A 3ZFFB 3WG4A 1H1IA 3KVAA 3CHXA 3NRUA 1GWLA 1QJX2 3T2QA 2JDYA 1B35A 2XHNA 4ONUA 4WZCA 5BY5A 2C26A 3JUUA 5DDJ3 2R6QA 5CKNA 1FPN1 1W3VA 4Z2WA 1PVC1 5IK4A 1NXD1 4NHYA 3UKTA 1O3SA 4Y1XA 1ULCA 2SBAA 1W8TA 1QOOA 4AG4A 2BFUS 4WV8A 5EJ3A 3WNPA 4OCTA 4P02B 3RZJA 4L99A 3JD72 1DHKB 3S7IA 2P5BA 5JXGA 4FO9A 4Y20A 1UY4A 4B3NA 1DYKA 4JGZB 3LQCA 3AMHA 4XFIA 3PNAA 4KWUA 1O7FA 1XJAA 2R062 1PGW1 2FBEA 1OF3A 3IDEA 2A3XA 3HR9A 2Y6JA 3KCCA 3OGSA 1AX1A 3ACLA 3ZM8A 5L7OB 4JGYA 1W28A 3V0BB 2C9KA 3RZKA 1OQ1A 5BNOC 5I0UA 1C4RA 2C0ZA 1AR72 4FP2A 4W65A 4XMIA 4JGZC 1QJZA 5FXZA 4IEXA 5EP9A 4FP3A 1UMZA 4CDWC 2RM23 1JZ3A 1NE4A 4Z82A 1SDWA 2ZEWA 4K1ZA 4LBNA 1YO8A 4XUTA 3PL0A 1NE6A 5D8AA 3JXSA 2E53A 5BNQA 2YG0A 5DDJ1 4G9SB 1AYN1 1GWMA 1JZ8A 4YGDA 1ZBA3 2A6XA 2OZ6A 2ETEA 2XLGA 3GBFA 3WF4A 5K7PA 5LA2A 2BBAA 3ZSMA 3O1RA 3UJOA 3CZUA 4COVA 3OEAA 4Y5TA 3TB0A 1QJU2 1GMMA 3LFMA 3OUHA 1PMIA 3NV2A 4XW3A 2YC2A 5FYTA 2VVDA 4JDMA 1K3IA 5FP8A 4Q4W1 3T30A 1GQGA 1BVVA 2NYYA 2PAKA 1CZSA 2PHFA 2A6ZA 1DZTA 3OYWB 3ZSEA 4RQPB 2BNOA 4ZZ8A 5HXVA 3VZJA 1ND2C 1QQP3 3JBG3 3ATGA 4QMAA 2PAMA 1CAWB 1BVP1 1FV2A 2WZR2 1W8UA 1CWPA 3TNQA 1W6NB 4XDPA 1UN1A 2CAUA 4QPGB 4E9KA 4YZ5A 1JYNA 1VAKA 1IG0A 2JDMA 4QPGA 1AX2A 1VAVA 2W3JA 5JLVA 1PO22 2GNMA 1W6NA 1UQXA 5AFEA 3VLBB 3FUQA 5BNPA 2JG8A 3I2HA 2HYXA 4A4AA 1G7YA 2VUCA 4KG8A 4C1XA 1H8VA 2VMGA 2HWE2 3VKNA 4BE3A 1IPSA 4Q4W3 1Z7S1 2PTMA 3ILRA 1JHNA 2BUKA 2E33A 2VXJA 4ATEA 4Q0PA 4AWDA 5BNOA 4MXVA 2VUDA 1NY72 1X82A 1GANA 1RUI2 3JCIA 3AZVA 2ARXA 5DPNA 4EN0A 3VKMA 4NO4A 2TUNA 4FTSA 2HWD2 3E97A 2RS33 4L97A 3OGVA 4WVZA 4GB32 2YFUA 1U12A 1CAWA 5J48A 1C28A 4M4RA 1E5IA 1WCKA 2AZ5A 2P3KA 3PJQA 3I54A 2ZXQA 4I01A 3O1PA 3NNJA 4Z8BA 1AXKA 4NWVA 5FP3A 2DTYA 4XC9A 5FYIA 1O5UA 1POQA 4CUBA 5FV3A 2JDAA 3IN9A 4QKNA 3X29B 4E27A 5BNNB 3N9OA 1F9KA 2GU9A 1IS5A 2JG8B 3FLTA 3U10A 4NIHA 1XNDA 2P2KA 1V6MA 3HWJA 2ZGUA 5A32A 3CJIC 1UWWA 4BCUA 2DBIA 2G1MA 5LRRA 1WLTA 2CV6A 3MICA 4Q0VA 4RGAA 2VJXA 4X6QB 1RC6A 4DRRA 3NAPA 3V0BA 3AYAA 4LE4A 2W46A 5L7OA 3NAPB 1KS5A 4W4ZA 2P4EA 2BGCA 4XFHA 4YM1A 5IVCA 3MYXA 5F9TA 3GHNA 1F4AA 3ZFGB 2E7AA 5GZGA 3EQEA 2YGMA 5TSWA 1FPN3 4DUXA 2PHTA 1W6OB 3KF5A 3SEPA 5FZ7A 1HXS3 1GYKA 2RM22 1GLHA 4LBQB 5FXWA 4YARA 1AUYA 3DYOA 3AJYA 2ZGLA 1O4TA 2Q5TA 4JRAA 1UYYA 4L2NA 4KMQA 5LBEA 1JXNA 1PX4A 2XONA 3POWA 4F3JA 2XJTA 1NG0A 4GKYA 3EJKA 1YIPA 2B8MA 1OMIA 3AMQA 5JXIA 3HQXA 1G8WA 2DVFA 1OOPB 5EHDA 3WLUA 1YUDA 4GMP3 3TBDA 2EIEA 2IXCA 3FFQA 2ZHKA 3CZJA 4BOWA 3GJBA 1RUD3 5GLTA 4AHWA 2NPIA 3VBRB 3BTYA 4MG2A 4NVPA 1H2LA 1O3QA 2O0OA 3U1XA 1ASJ1 2AEYA 4K8FA 2HWB3 2VY0A 3BOPA 3H3UA 5K4LA 5C8WA 4Y3OA 4LO4B 2EIGA 1QNYA 2YBKA 1TG7A 1ZZ8A 3W20A 2VNOA 4IE4A 2R32A 1DBNA 3ACIA 3GCXA 4QHBA 1MZ5A 3VDDA 4AI9A 2PHXA 1N3PA 1IPKA 1RUI1 1VBC3 2LM3A 2ZX4A 5T52A 1CJDA 1Q5OA 4WM7C 4HKWA 5CNAA 4YW7A 4UF0A 3HJRA 1W6PA 1S1AA 4AI2A 3K4ZA 2ZBJA 2G19A 1F5JA 1DCSA 4UBHA 4E8DA 3VD3A 2JENA 4IEOA 4R9DA 3DECA 2XUMA 3VD4A 3Q8CA 3SKJE 4CUGA 3FHQA 1VMHA 4UFKA 1DF0A 5F39A 4N90A 4HVRA 5IHRA 4YGEA 2ZACA 5DAPA 1DGRA 5A3UA 3I3MA 3I3BA 5T50A 3ENRA 4NPRA 2EXKA 3T4HB 1VJ2A 5IUQA 2PHWA 4P9JA 3WNOA 1GFF2 5IYYA 5F3IA 4LMFA 4XDQA 3WT3A 4XTPA 1EAH1 3ZSJA 1AYN3 2DUOA 4PLOA 1NCQC 2OVUA 2VVEA 4O65A 2RS12 5DN2A 1JU3A 5AC93 4FFHA 4IEUA 5FZ8A 1CD3G 3Q8AA 3S0MA 2VMFA 2EAAA 1AXYA 3UETA 1AJKA 3PIJA 2R042 4BPZA 4XFCA 4LBOA 2IZWA 2R061 3MW2A 1IQAA 4FBFA 2WBKA 2EAKA 1OUXA 4PDWB 4NPMA 2UYBA 1NCRC 2CHHA 2KXLA 1VBD2 3WDWA 3ZSLA 1QJY3 2FCVA 2VTXA 3NAPC 3NJVA 4Z1VA 1STMA 5D2AA 5ABJB 4X6RB 1HB3A 1YHFA 3NJZA 3ELNA 4IGPA 5C3SA 4AOCA 3M1HA 4WVWA 2RMU2 3H9AA 5FLJA 3K3OA 3U0ZA 1FPN2 3G6JB 1WZXA 4IEYA 1SPPA 4KH9A 4N53B 5D21A 3FUOA 4XYXA 1HN1A 1CGPA 1CONA 2P37A 3I7DA 4FPGA 4N43C 4XF3A 5IVVA 1RMU3 1PHMA 3L2HA 4LKEA 1UPIA 5FYHA 4HFSA 3ZXDA 4IEWA 1W9FA 1RYYA 2IWGB 3VBFC 2BERA 4M4PA 1H2KA 3JQXA 1E57A 1PGL1 2XVGA 1WMDA 4ISRA 1RL3A 1PGW2 1ASJ2 2VU9A 3A7QA 2WWUA 2GC2A 3KD4A 3RS6A 1QJY2 1W8WA 1WLDA 3VBUA 4AK3A 5F5CA 1LESA 2J1RA 2BJSA 1W05A 1XPWA 4IERA 4BHPA 3NV1A 4CU8A 2FDFA 1W9SA 1WD3A 2C9AA 3MUZ1 4KU8A 4Q8KA 1LJ7A 1H9PA 2Q8OA 2ENRA 1NQJA 1YQ2A 4JX0A 3KV4A 3GDBA 1EP0A 1RUJ1 1IKPA 2HWB2 2DVGA 5ANNA 1AJOA 1DLLA 1PO21 2PHUA 3MHZA 3WNMA 3JD71 4QKDA 1VBA2 4IW3A 4Q29A 1H0BA 3NQHA 4Q4Y3 1ENSA 5C8CB 2ZX3A 4D8MA 1NQDA 3M3CA 2GN3A 3KGLA 1JU4A 1EV12 2AENA 4JAAA 2Q1ZB 4M0NA 3LA3A 1BBT2 5A1FA 1HQWA 5FZ6A 2Q1MA 3IDCB 4YZ3A 3KLSA 2W0XA 3IDBB 2Q0AA 3VHOA 4XBNA 3UJQA 1S0GA 3T0AA 4DPNA 3WNXA 3RGBA 5DG1A 3POIA 3H1MA 4P9XA 2JD4A 1LU2A 4UW6A 3ZFEC 4IV1A 1O8SA 5KHJA 1BJQA 1DQ0A 4FVVA 4HPKA 4OI4A 3PJYA 1OHFA 4FXKB 2WL1A 5LBFA 1EUTA 4ES8A 2JG9C 5DZEA 4BQ2A 2H6BA 1W39A 2E63A 1FOD2 3VBOA 1GICA 4A41A 1SPPB 3JB4C 5ACA3 3SH3A 2B7YA 2CWSA 1UMIA 3C7GA 1DG6A 1ZRRA 5BV6A 2VBBA 3IPVB 3QLQA 4MXWA 4YG6A 3MGUA 4XJAA 2D3RA 2GH2A 3T3YA 5C4WB 4D6SA 1OLMA 2RS13 3R4UA 5F5IA 5A7PA 4YNIA 2VECA 4FQ4A 2D7FA 4LLFA 1GQHA 4FPLA 4XJUA 1D0GA 3WV6A 4P08A 3U78A 1CX1A 4A44A 2E51A 4QDQA 4XPVA 1ACCA 3FBYA 3SXWA 3N9MA 5KXEA 5IW0A 3S57A 3I2JA 2CU5A 3MIFA 2VZVA 1OLQA 1ZA7A 2ZJCA 1J3RA 4R4XA 3CEWA 2YBPA 3CLPA 4GULA 4IQPA 1N3QA 2WO7A 3KHBA 2QQJA 4FTEA 2NMNA 3RQ0A 2WUHA 4AEDB 3THDA 4G4FA 1P8JA 2WA4A 3URFA 4CE8A 3O1SA 5A7WB 3BTXA 1ZZ6A 2P3JA 2XLAA 1WW5A 4I0BA 3O12A 4KQ7A 4CP1A 1NX9A 3U11A 1RXFA 2WNOA 3ETPA 5FBZA 3DXTA 4M0HA 4QKFA 1W9WA 2MPFA 2IC1A 4Y4YA 2JDHA 4AXOA 1X9TA 3CJIB 4W6YA 5A3NA 5I93A 2JIGA 4YW2A 2Z2SB 2LW8A 4FCAA 4QPIA 2VCCA 1OH4A 2XR4A 1QDOA 5AVAA 1DDLA 2GNTA 4YFWA 1PM4A 3N9PA 1AR91 3FN9A 2JG9A 4DIQA 4IL7A 3WCSA 3BIEA 4R9AA 4LXLA 1REEA 3VZKA 2XMLA 2XKPA 1C57A 4HONA 3VDDB 1DLCA 1W6MB 1K42A 2GSYA 2I74A 4AHZA 5FY9A 3LPGA 3NV4A 5HPOA 3ZN5A 2GMPA 1VMFA 1MQTB 3K51A 2W1WA 4LO8A 4DY5A 4PHZA 2QQUA 4A3ZA 1S2BA 3VDBA 4Q0UA 3ES4A 3N9QA 4MVTA 3I59A 2VL4A 1MVEA 3NWKA 3VKLA 5F7UA 3BPSA 4CCDA 5C3QA 3DXUA 1A78A 3JB8A 5AFBA 1VRH1 1X50A 3T08A 4AHXA 3I3DA 4RHV3 5FRAA 2FZ2A 2FQPA 1MS9A 3WVJA 4B1MA 1RUD1 2X29A 3ETQA 3B69A 1K5MC 3BU7A 5FYMA 4BQ1A 3EMRA 2QDNA 1EAH2 1PZ8A 2CNAA 2PQQA 3DL3A 1ND3B 4Y22B 2WT0A 1SFNA 3ECQA 4MHRA 4QQPA 4YW6A 4LBQD 4ES9A 1G9FA 4QXCA 2ZAAA 1LHWA 4URTA 4LA3A 1FMD2 1JOBA 4LOSA 5L19A 1S0JA 2ADDA 3HBKA 1YI9A 3LA2A 1CAUB 1RUG2 5BNPC 3ZYPA 1LOAA 2XVLA 3B9IA 1W6OA 1RTVA 1UOJA 1YQCA 1BZWA 1MQTA 3KS7A 2QE3A 1D0HA 4GWNA 2VM9A 2WKKA 5LATA 5I8TA 1QIQA 2IXKA 1PO11 2ZGSA 2DV9A 4LJHA 5GZFA 4IE0A 4ZY9A 4O9EA 3WW1A 3WDXA 3SQOA 4QX5A 4BQYA 1LOCA 4IEQA 1XNKA 2GC3A 3O1TA 2ES3A 2X10A 2JD9A 2E7TA 2TNFA 3EBRA 4LBLA 5L9RA 1F31A 2RS52 2WZPP 3VN4A 4QPYA 3RZHA 2NP0A 4PQ9A 5EQUA 1R092 4D6QA 5A3PA 4AVVA 5DQ0A 1R1A1 4FFGA 3ZYHA 1UYXA 2BTVC 4XURA 3S5QA 4OULA 2WFF1 2OKXA 2Y0IA 4CDWB 3UESA 4EN9B 3I2FA 3IAPA 1UU4A 4NJ4A 1J3QA 3AC0A 4PIXA 4Q0QA 2PLV3 1O8PA 4PBPA 3MF6A 5K0UC 5G04L 1BMV1 2W68A 4XETA 1QHDA 1C5HA 4BM8A 5E88A 3UT0A 3M7AA 1AL23 1W8NA 1HN0A 4E2GA 4OUMA 1W8OA 4X8PA 3NVCA 1UU6A 2RMU3 2HEYF 2PN5A 4FPYA 4NMIA 3H8UA 2ZGRA 4KBBA 3AKRA 1G9BA 4FOWA 1YQ6A 3WQBA 4XTMA 2JDNA 4AGGA 1PZ7A 3AKQA 1RUJ2 1NXMA 2HWB1 3JBG1 4UFMA 3WG3A 4YZ2A 2ORZA 5APAA 1HDKA 2R073 1SQ4A 2RE9A 4EQVA 1UY3A 1R64A 3K46A 3AYEA 2VQAA 3FL7A 3M3QA 1YQ8A 4P9WA 2R0FA 1UZWA 5IVBA 1UCXA 2WT2A 4OHWA 4BWOA 5FPUA 2W95A 4RS5B 1YRZA 2Y33A 2HYKA 1HIXA 2VC9A 3WQ7A 1JHJA 4QQLA 1MS8A 4FOQA 1Z7S3 2AEZA 1J1TA 2VZUA 1UXZA 5JVVA 4XQWA 4CDWA 5DUUA 2XKOA 4AEMA 1IS3A 4DOUA 1DU3D 1N1SA 3WINE 4XAEA 1E5HA 1EYBA 1H8TA 5GLVA 3MLLA 1S2EA 3TYJA 4RQPA 3UV9A 3TRSB 4CP0A 1OPOA 2GP5A 1QJY1 3SCHA 3DKWA 4GH4A 4HANA 4KWJA 2ZGTA 1TE1B 2QUOA 2YMZA 3BCWA 3J7MA 1UYZA 1QF3A 1XNAA 2MEV2 3MZHA 4FAHA 5JXHA 5EJZB 1REFA 1E5SA 1V70A 2Z69A 1KJLA 3K4AA 4MGKE 4QXKA 2JKBA 2BW8A 3LB9A 1DQ6A 2QQLA 1BBT3 1WMFA 4XJ9A 4Q5OA 1OVSA 1CVNA 4Q4X2 4NIGA 2WFF3 4P5YA 4JQRA 2VOKA 2WQZC 2OQ6A 1PIV3 3PURA 2WS91 3WF0A 1ZBE1 4EV0A 1TEIA 5T5JA 1JMUB 2DTWA 4JVAA 2RS51 4V1PA 4YM0A 1UAIA 2B39A 3AKTA 2YYOA 1QMJA 3EB7A 5GLUA 1KXGA 3ZIXA 4B7KA 2WO2A 3AXDA 4AL9A 1NYWA 3JQWA 1ODMA 4ZXKA 3AYCA 5FXXA 1CAXB 3VZLA 3O1MA 3QACA 3RFRA 4CU6A 2YGLA 2RJ2A 4I3GA 2RVAA 1LRHA 4RR3C 5C9AB 1VBA1 5BNNC 5KXCA 4CDUB 2RR11 2V5YA 3D0SA 3I97A 4NRMA 5L9BA 5A6ZA 1S55A 2QVSB 4W6WA 3H8OA 4WVMB 2ZGMA 1YI7A 3H3ZA 1BBT1 2Z79A 4JHZA 4QU1A 4WM8C 4O61A 1LGCA 1V6LA 3EXUA 4GALA 4WVVA 1LODA 1WUVA 4NROA 1AYM1 4J25A 3VHRA 4DB5A 1ZRFA 3ZOIA 4I30A 4XE9A 3GZEA 5A3TA 5IWFA 3WG1A 5FQ0B 3K3NA 1QJU3 2QQWA 4Y1VA 4BJ0A 3BUCA 5IATA 4TLFA 2W1UA 2W47A 2QZ3A 5EV7A 4QX8A 3RVHA 1RXGA 5CKQA 2V09A 2BGOA 1BLZA 1RINA 3RSJA 1RGSA 1X8MA 2JB4A 1JOJA 1RUC1 2RS31 1ZZ9A 2ZMNA 1R083 3NJYA 3ZMNA 3GBGA 3OJBA 4LBQA 1EUUA 4LULA 5FY5A 2PHRA 1GKBA 1XU2A 3PTRB 4XZPA 5HV4A 4C8DA 1ND3A 5E16A 4COYA 3ZLIA 3ZFEB 1KD7A 4RYDA 2R063 2YDEA 2K0GA 2I45A 2NQYA 4UI9L 5CBLA 1PK6C 1UKGA 5CADA 3OPWA 2XJRA 3M2MA 3ZN6A 3ZIWA 1V9U1 4LHSA 2VW0A 1ULOA 3H1YA 4OHZA 5EJ1B 5H9PA 1RUH3 2DCTA 3P6BA 1RUD2 4LHKA 1Z78A 4BQ3A 5LK7B 1WLWA 3W58A 1JZ4A 5J37A 4L0PA 3QH7A 1HJFA 2V5DA 3FWEA 2QQIA 1DGWA 3I2KA 3WDYA 3ZN4A 1SDDB 1ZX5A 3J26N 4CCJA 4OI2A 3OY8A 1KS4A 3ZPOA 1FMD1 2X5IB 1IKQA 4I02A 2UWBA 2HBTA 2HWE1 3TWIA 3AP4A 3FBMA 4RS5C 4YVSB 4JV4A 5KHIA 3UKVA 1M4WA 4Y22A 3NSTA 1O6UA 1XYNA 4AAPA 4UF0B 1QKQA 4DO0A 5J1XA 4MADA 3T0BA 2HKXA 4MGQA 3KV9A 5GZEA 5CA6A 4NUBA 3ORJA 4XQ4A 5D8AC 4XIKA 4E4ZA 1V6NA 4EWAA 5FKBA 3KCXA 1NOVA 5CIRA 4OHXA 4AQ2A 3OUJA 5FZ3A 1GZWA 3MW4A 3Q8FA 4NHXA 1XOYA 3J4UH 5EWSA 1HQLA 3SCFA 4CDQA 1AR82 1SLAA 4YVWB 4AAXA 4H14A 3O0XA 2R1DA 2OX0A 2DCZA 1B35B 1IQDC 4B7EA 3N7LA 2VZTA 1JUIA 4N53C 4F8AA 1OXCA 3E1F1 1GQPA 5E1RA 4LR4A 3WNKA 2B46X 2F6BA 3K2OA 3KZ4C 4LA2A 5SV8A 1JZ6A 3HAGA 4XFFA 1AYM2 2Y34A 1HV0A 3A4UA 5FZDA 1UZYA 3KT7A 4P9IA 4EZHA 1VBE2 2JIJA 3ES1A 5I8YA 3LDKA 1HQNA 4GH4C 1N1VA 1G9AA 5EFUA 4RR3A 3HEIA 2LUWA 2OIIA 2C24A 4XBQA 3WUDA 2RS32 2WZR1 2GC0A 5DG2A 4AQTA 5DUVA 4I2OA 5D1IA 1KDMA 3PDQA 4YYOA 5LCWL 1I9RA 3DN7A 2WT1A 1W99A 1WBFA 2Q4SA 2ZX2A 3PU3A 1SLIA 2RM21 2HWF1 2HJIA 4Y33A 2WYSA 2WNVC 4YG0A 1ZM1A 1A6CA 2A3YA 1CAVB 3I3EA 1MEC1 2H6CA 2VH9A 2KA3A 4Z07A 3THCA 1UPSA 1UZ0A 3VBOB 1R091 1G6NA 1J59A 1C5IA 3ZR5A 3BI3A 2A71A 3I2DA 1L7RA 3WP4A 3ZKYA 1X33A 2DUQA 4YM3A 2YXSA 1OFNA 4Q26A 3O7OA 2VCMA 3ZSKA 1B35C 3HT2A 2ARCA 4YLZA 5LEJA 3BU0A 5FZFA 2BGPA 1DYPA 4XABA 1D4M1 3ZYFA 1A34A 2UURA 3DYPA 1AVBA 3LEIA 1GNZA 3OTFA 4BLJA 5A7WA 3TN91 5J7MA 2VMHA 3OG2A 1KQRA 4CU9A 4EYUA 2XPJA 4XHXA 4OLLA 2DCKA 1NLQA 2YBSA 4Z92B 3VDAA 4QB6A 1CPMA 5JI9A 1CQ9A 1W0PA 3NW4A 2A7AA 3S6PA 4A42A 5JAXA 2J42A 4NR1A 3V0AB 3MFAA 1LOFC 4BMBA 1RITA 4Z2AA 1OUSA 1OLRA 1BHGA 5F5QA 4ET7A 2QQOA 3O1OA 3JBG2 1GNHA 3MPBA 3OCPA 5IAXA 5FP7A 4B4RA 2XL7A 3O0VA 1VAMA 2GDFA 2GMMA 2Y6FA 4DFSA 2MNGA 2RR13 3CQOA 1E5RA 5ACA1 4LUMA 1SLTA 1NZIA 1LHVA 4AGRA 4N8MA 4IV1C 1RMU1 1QY4A 1W2OA 1GUIA 3USUB 4HN1A 2ZOEB 3OBRA 4D0QA 3WUCA 1LAJA 2K2SA 1WCSA 4GWJA 1RUG3 4PF5A 4B4PA 1UNBA 4QX2A 5LW9A 1GZTA 1MVQA 3VBUB 4AFBA 3C7EA 1G9DA 3POBA 4BDVB 4EJRA 1FNYA 1HRV2 2NZ9A 3ZXKA 4XUNA 1YYNA 1CR7A 3HD8B 3ZYJB 5C4WC 2LROA 4YZ4A 4RQPC 2O8OA 2VOWA 2PFWA 4ZS2A 4NIAA 3N3HA 1NAEA 2E9QA 4QHOA 1PNFA 4R8HA 2WINB 3AXEA 5DABA 5CB7A 1VIWB 5I0TA 3P3NA 4PF1A 1OA2A 4WVMA 5IK7A 3OYWA 2C6SA 1LR5A 4DS0A 4W8JA 1PIV2 2XQXA 1R093 1VE0A 1QDCA 4XF4A 1S4CA 3KVBA 4OVEA 5A33A 5K8SA 2OPWA 3A22A 2EXHA 5FY4A 2Q8DA 4JGYB 2ZEXA 5ISLA 1OLME 4MZUA 2EA7A 3SLIA 1W6PB 2ZHNA 4SBVA 1COV2 3QOPA 3CDZB 1GSLA 1WCQA 1ULPA 4YVWC 5DAXA 4E2SA 4CA9A 3F95A 1SLCA 5L73A 2RMU1 1QJU1 1W2UA 3AKPA 4NRQA 3VL8A 3M3EA 5IVEA 3WF2A 1QQP1 4XUOA 4IV1B 2W52A 3N7MA 5FZHA 3MLJA 2W9XA 2HEWF 2JECA 3AX4A 3HNYM 2JICA 4EN6B 1JYCA 2CL2A 1COV3 2W2IA 2Z4FA 2VXRA 2XBO2 5LBCA 1N47A 2HWE3 2SLIA 3GZTB 4XFAA 4XUPA 4ZU4A 4BB3A 5JOZA 4K1YA 4S2FA 4DEQA 2EALA 2VUAA 2F4LA 4QPIC 5DUWA 4AFMA 4LBJA 1RUI3 1VBC1 4DQAA 1OFSA 2P3IA 4CCLA 1KRIA 3USUA 4Q0SA 2XB6C 2YB7A 1QXRA 2AGSA 2BVBA 4QDRA 3SKVA 2P6CA 2O1QA 1F4HA 1U5ZA 1PMHX 1VBD3 3MPPG 4QHZA 1MS3A 4RHV1 4XHBA 2MHFA 4BQXA 5L36A 3HIFA 3LEKA 3WF1A 5C33A 5T5OA 5IK5A 2YZ4A 3AL6A 3D82A 1AXZA 1VALA 2ORXA 2GP3A 2ZHLA 5G05L 3NNFA 1Z7S2 2C5DA 3B3QE 3SH4A 4XILA 1W8FA 3BYWA 5K9YA 3GNEA 3H50A 4KU7A 1RB8G 3MBWA 1LECA 4JTOA 3TEXA 2DFBA 1RUC2 1K12A 1Q56A 2G4IA 1QGLA 2R041 2RR12 3NJXA 5IK8A 3VDDC 3MDPA 2WSUA 3NNLA 1RHI2 2HWD1 2PLV2 2TEPA 3AP5A 3B7MA 4MGTA 5CFCA 1CX4A 1LEDA 1AL0G 2WLQA 3S7EA 1SBDA 5LA1A 3J7HA 4UXAA 1ZZ7A 2B9UA 2G9ZA 2VZSA 1Q8QA 2XG3A 4A6SA 4M3CB 1IHMA 4FI9A 1QJEA 3U07A 4EROA 2AH2A 1ND2B 5GLZA 4YGBA 4AVSA 2R7EB 3ABZA 2JJ6A 1PGSA 1GNYA 4M3CA 3O14A 1OOPA 3TEYA 3N35A 1ZNPA 1LENA 1XBFA 4FPOB 3W5MA 4Y1ZA 1VP6A 2XQRA 2VULA 1SBFA 4HOOA 2ZGQA 2BVVA 4BISA 3KT4A 4IESA 4B4QA 2Y0OA 3AJZA 3LPFA 2V72A 5ABJA 3WNNA 1L7LA 3D6EA 4AFAA 2D6MA 2I07B 4Q1RA 3BOWA 3AM2A 1VPHA 2D97A 1VB2A 2J7MA 1POV0 1O3RA 1DQ5A 1UOFA 1SMVA 1COV1 3DV8A 4CTEA 3NKGA 2AC1A 1L3JA 4K9SA 2VZPA 4JZRA 4HZFA 3J9SA 4BIFA 1R1A3 1GOFA 2BOIA 4S2DA 3ZVXA 4ATFA 4CCCA 4KWKA 4MGSA 5T3NA 4BIOA 3FHIB 5FZ9A 3D0JA 3LWCA 1AX0A 1W9TA 4IE5A 4XEZA 1Y3TA 4TLGA 4A3XA 4ZU7A 2CGPA 1OPMA 5M0TA 5ABJC 2WZ8A 1VR3A 2OS2A 1FX5A 4BZ4A 1HV1A 1RUH1 4RSUA 2ZA9A 3E5UA 4QB2A 5H9QA 1R1ZA 4GMP1 5CKMA 3I2IA 3GYDA 2HWF2 3LIGA 2D43A 4Q2FA 1CPNA 4QAWA 4RGGA 2QBXA 5K0UA 5HCBA 4OQ8A 2Z42A 1XYOA 5FPBA 1ZRCA 1FOD3 1SCSA 2A75A 1FI2A 2UYAA 1NT0A 3LZZA 2EICA 1X7NA 3WW4A 3B00A 4DZGA 4CDQB 5HXMA 5BUVA 2PA7A 5CG9A 4QDSA 4N53A 3VD9A 1VBB2 4JTNA 3UGGA 2J1SA 4NHLA 2QQVA 3TAYA 3IMMA 1N3OA 3F2ZA 5FYUA 5FZCA 1S0FA 1GU3A 2BDRA 4DEVA 3CNAA 4QPWA 4K8RB 2KM2A 5F6LB 1OOPC 1BK1A 2K46A 3MFCA 3RZMA 3POEA 4LKFA 3UGFA 5CZKA 3ITQA 2FHRA 4AI1A 2GNBA 2Z5WA 5L7OC 1S0IA 3AB0A 1UIKA 4CVUA 1LCLA 1VB4A 2IVIB 3FX3A 1CN1A 3VBHC 1UX7A 5D8AB 4NIIA 2OXBA 4OUEA 1QXJA 5FXVA 1IG3A 5H9RA 2FMYA 5LB6A 2FMDA 2WAOA 4AZZA 2RV9A 4UW5A 1F2NA 4META 1YCIA 4BMEA 2DURA 3VBSB 5JIAA 4K7JA 2XOMA 1Y7BA 3MIBA 4LKDA 3JD73 4XF0A 3ZFGC 1XNBA 1DFQA 2ZGPA 5CFCB 2W91A 3LAGA 4YSFA 1UY2A 3UK9A 2IVJA 3WW2A 3ZO0B 1S0DA 1XXNA 1NA1B 1W90A 2OA2A 1RUE2 3OPZA 4RFT0 4IV3A 5HBAA 1BCXA 2ZS6B 4YW4A 4CDQC 3BTAA 3PUSA 1K5MB 2DBNA 5FZEA 2L9LA 5FO9B 5FFOC 4Q1PA 3ZFEA 5CYYA 4QD2A 4QT6A 3ZX7A 2BP6A 5A33B 1HRV1 4LITA 2B4KA 1VBD1 3TN92 1J1LA 1UZZA 2QTWB 1UW8A 2VAUA 4P9GA 5BNOB 3AZWA 1OC1A 2A6WA 3NO8A 4LHNA 1H4HA 5EYXA 5FMOL 2W92A 2ZZJA 2JE8A 4NWWA 4AGVA 3N9NA 5BPXA 2HWD3 1S2KA 2PHDA 4TZDA 5CFDA 1ND3C 4Q4Y1 2HWC2 2J1TA 3H0OA 4LUKA 4L92A 5FY1A 4CEWC 3D8CA 5ACA2 3WR0A 3AZYA 4A6OA 3MI8A 5KXDA 3DUIA 4QGNA 5FMCA 2R1BA 3N36A 1ND2A 1ZZCA 4IEPA 5FZ4A 2C1FA 4XIOA 1HRV3 4Y5Z0 1LHOA 2WZR3 1W0OA 4QGMA 1C8NA 1FV3A 1GZWB 4QM9A 1W2AX 2D93A 3VB9A 2WABA 5B4XA 2ZHMA 3VBHA
chains in the Genus database with same CATH topology
4OYUA 2VZQA 3OGVA 2W87A 2YFUA 3HNBM 4CU6A 2RJ2A 2RVAA 4M4RA 2WN3A 2ZXQA 4QX1A 1DYOA 3I97A 3K75B 4CUBA 2W94A 2JDAA 1GOGA 4JHZA 2VMCA 4P00B 2QQNA 5FUIA 4TTGA 1NUKA 3IIIA 1UWWA 2EIDA 3BGAA 2VJXA 4CUCA 4E8CA 4BJ0A 2W46A 3MV11 4W4ZA 2W1UA 2W47A 4ZZ5A 3T2PA 2BGOA 3NNGA 3LE0A 3OGRA 3UNPA 1F4AA 4RN5A 5JXJA 4JKKA 4DUXA 4XZUG 1EUUA 4OZOA 4UAPA 3SEPA 3VDCA 4ARXA 2VZ3A 2X05A 3DYOA 3GGLA 4RYDA 1UYYA 4KMQA 4UI9L 1WKYA 1PX4A 3A23A 2XONA 3HOBA 1PX3A 3U37A 4LHSA 1ULOA 5JXIA 4DXRA 2VZOA 3MO4A 5EJ1B 3P6BA 2WAAA 2EIEA 1JZ4A 3CZJA 3OEBA 4L0PA 4JKMA 2V5DA 1H6XA 2QQIA 1UY0A 3I2KA 1SDDB 1D7PM 2X09A 1K45A 1TG7A 3ACIA 1JYWA 2VQUA 3LEGA 2C4XA 5J1XA 4MADA 3HJRA 3T0BA 5C70A 3K4ZA 4MGQA 3WNLA 4E8DA 5A1AA 3VD3A 3WEZA 2VTFA 1J83A 3VD4A 3DECA 1JI6A 3SKJE 3CKHA 3FHAA 3FHQA 3ACGA 2W1QA 4CUAA 3I3BA 1CIYA 4AAXA 3WNOA 1UMHA 5IYYA 1CZTA 1IQDC 3MV01 5IFTA 2VZTA 4BK5A 3A21A 3E1F1 1GQPA 5DN2A 3WNKA 1US3A 4HG6B 1JU3A 1JZ6A 2PQSA 2YC4A 2VMFA 3GM8A 3UETA 2WBKA 3HEIA 3C7OA 3WF3A 2WQ8A 3VD5A 2QQMA 2WN2A 5LCWL 3CIHA 3NJVA 1W99A 5C7GA 4ZXEA 2WYSA 2DDUA 5LA0A 5JMOA 3I3EA 1TVGA 1JZ7A 3THCA 2Y6GA 4MOAA 1UZ0A 3P1IA 1L7RA 4GZ9A 1HN1A 3T09A 2VR4A 4PQQA 1RYYA 2BGPA 3DYPA 2BERA 4M4PA 4OMCA 3LEIA 3VD7A 1SHWB 1OT5A 3OG2A 4CU9A 3A7QA 2BZDA 4LPLA 2DCKA 2EIBA 3IB3A 3VDAA 4PT6A 4QB6A 2J22A 2J1RA 1XPWA 5EIYB 4CU8A 1W9SA 4A42A 3MUZ1 2CDOA 3HNMA 1YQ2A 4JX0A 4Z2AA 4QX0A 1BHGA 3GDBA 4ET7A 2QQOA 5IFPA 2LS6A 1H6YA 3PUIA 4DXTA 2E26A 3WNMA 5JUVA 4TXWA 3NQHA 3CQOA 2WDBA 4D8MA 2Y6HA 3K4DA 5IJRA 1JU4A 2VMEA 1OF4A 2VCBA 1GUIA 4D0QA 4GWJA 3D3AA 4QX2A 3C7EA 5DMYA 5B4NA 4BDVB 1KEXA 3T0AA 5IHRA 3PUHA 3MUY1 4XUNA 2J1VA 3C7HA 1NAEA 1GOHA 2CDPA 1O8SA 4YPJA 4PF1A 1UXXX 1EUTA 4W8JA 2XQXA 3ACHA 2VO5A 4A41A 3A22A 4IUGA 1UMIA 3C7GA 2ZEXA 3CDZB 1WCQA 1ULPA 4JKLA 2VZ1A 1SG3A 3CMGA 4P08A 5C71A 1CX1A 4A44A 4QDQA 3WF2A 4XUOA 3I2GA 3I2JA 2ZEYA 2Y8KA 4BK4A 2W9XA 2VZVA 3HNYM 4QB1A 2Z4FA 3HPNA 2Y6LA 2QQJA 2YFZA 4XUPA 3W5NA 2WUHA 2VOTA 2W1SA 2VCAA 4KI5M 4XVHA 3THDA 4DEQA 1XNTA 3EYPA 1JYXA 1P8JA 4UOJA 1DP0A 1LNSA 1NX9A 2B9VA 2ZEZA 3ETPA 2YB7A 3SKVA 4QDRA 3IAQA 4LKSA 1F4HA 1PMHX 2J1AA 2KD7A 1W9WA 3LEKA 3WF1A 3WSOA 2ORXA 5G05L 3C7FA 2LW8A 3ACFA 4DUWA 1JZ2A 2VCCA 1UY1A 1OH4A 2E31A 3MBWA 1K12A 1PMJX 3FN9A 3NJXA 2Y64A 2E32A 1K42A 1DLCA 5LA1A 3J7HA 4MO3M 2VZSA 3LPGA 4CU7A 5HPOA 3C8XA 2W1WA 4FI9A 1KGYA 4DXSA 4A3ZA 1CZVA 3VDBA 2VMDA 1O59A 1JYVA 2R7EB 2VL4A 3ABZA 1GNYA 5F7UA 3SEEA 2QQKA 3W5MA 3T08A 3I3DA 3K77A 2VZRA 4OMDA 3OBAA 3IDAA 3LPFA 2V72A 3WNNA 4W50A 2DCJA 3ECQA 2J7MA 2WO3A 2VZPA 1L7QA 1GOFA 1J84A 2Y6KA 4MGSA 5I0DA 1W9TA 4XUQA 2VM9A 2WZ8A 4ZY9A 2HLEA 4QB2A 3T2OA 3I2IA 3NRUA 2X10A 2JD9A 4QAWA 3T2QA 2QBXA 2JKXA 2XHNA 2C26A 1JZ5A 2EICA 5HXMA 4AG4A 4QDSA 5DQ0A 3VD9A 3WNPA 2J1SA 3GXUA 1UYXA 4P02B 4XURA 1W0NA 3F2ZA 5JXGA 1GU3A 1UY4A 2OKXA 4DEVA 3UESA 3I2FA 3IAPA 3AC0A 4QPWA 3LQCA 1O8PA 4KWUA 5G04L 1OF3A 5CZKA 3HN3A 2Y6JA 3OGSA 3ZM8A 5JR2A 1W8NA 2C9KA 1XC6A 4CVUA 1W8OA 2WO1A 1OD3A 1UX7A 1JZ3A 4OUEA 3WQBA 2ZEWA 2VQTA 4XUTA 4ARYA 2ORZA 3JXSA 1US2A 2WAOA 2RV9A 1UY3A 1R64A 2YG0A 3K46A 3FL7A 1JZ8A 2XOMA 3WF4A 3T0DA 2W95A 2BBAA 5LA2A 2W91A 3DYMA 1UY2A 3CZUA 2VC9A 2WZEA 3OEAA 1JHJA 2ID4A 1GMMA 2VZUA 1UXZA 2L9LA 2YC2A 5CYYA 1K3IA 2B4KA 2W5FA 1CZSA 3OB8A 4A45A 4ZZ8A 2J1UA 4QX3A 2W92A 2V4VA 4BXSV 1UYZA 1I5PA 1XNAA 2JE8A 5JXHA 5EJZB 4DUVA 3K4AA 1JYNA 2W3JA 2QQLA 2J1TA 1T2XA 2J1EA 3BN6A 4A6OA 1MPXA 3I2HA 2HYXA 4P5YA 1NKGA 4A4AA 4GWIA 3WF0A 2E33A 4LQRA 3EB7A 5DPNA 2WABA 5B4XA 2WO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OYU A;  2VZQ A;  3OGV A;  2W87 A;  2YFU A;  3HNB M;  4CU6 A;  2RJ2 A;  2RVA A;  4M4R A;  2WN3 A;  2ZXQ A;  4QX1 A;  1DYO A;  3I97 A;  3K75 B;  4CUB A;  2W94 A;  2JDA A;  1GOG A;  4JHZ A;  2VMC A;  4P00 B;  2QQN A;  5FUI A;  4TTG A;  1NUK A;  3III A;  1UWW A;  2EID A;  3BGA A;  2VJX A;  4CUC A;  4E8C A;  4BJ0 A;  2W46 A;  3MV1 1;  4W4Z A;  2W1U A;  2W47 A;  4ZZ5 A;  3T2P A;  2BGO A;  3NNG A;  3LE0 A;  3OGR A;  3UNP A;  1F4A A;  4RN5 A;  5JXJ A;  4JKK A;  4DUX A;  4XZU G;  1EUU A;  4OZO A;  4UAP A;  3SEP A;  3VDC A;  4ARX A;  2VZ3 A;  2X05 A;  3DYO A;  3GGL A;  4RYD A;  1UYY A;  4KMQ A;  4UI9 L;  1WKY A;  1PX4 A;  3A23 A;  2XON A;  3HOB A;  1PX3 A;  3U37 A;  4LHS A;  1ULO A;  5JXI A;  4DXR A;  2VZO A;  3MO4 A;  5EJ1 B;  3P6B A;  2WAA A;  2EIE A;  1JZ4 A;  3CZJ A;  3OEB A;  4L0P A;  4JKM A;  2V5D A;  1H6X A;  2QQI A;  1UY0 A;  3I2K A;  1SDD B;  1D7P M;  2X09 A;  1K45 A;  1TG7 A;  3ACI A;  1JYW A;  2VQU A;  3LEG A;  2C4X A;  5J1X A;  4MAD A;  3HJR A;  3T0B A;  5C70 A;  3K4Z A;  4MGQ A;  3WNL A;  4E8D A;  5A1A A;  3VD3 A;  3WEZ A;  2VTF A;  1J83 A;  3VD4 A;  3DEC A;  1JI6 A;  3SKJ E;  3CKH A;  3FHA A;  3FHQ A;  3ACG A;  2W1Q A;  4CUA A;  3I3B A;  1CIY A;  4AAX A;  3WNO A;  1UMH A;  5IYY A;  1CZT A;  1IQD C;  3MV0 1;  5IFT A;  2VZT A;  4BK5 A;  3A21 A;  3E1F 1;  1GQP A;  5DN2 A;  3WNK A;  1US3 A;  4HG6 B;  1JU3 A;  1JZ6 A;  2PQS A;  2YC4 A;  2VMF A;  3GM8 A;  3UET A;  2WBK A;  3HEI A;  3C7O A;  3WF3 A;  2WQ8 A;  3VD5 A;  2QQM A;  2WN2 A;  5LCW L;  3CIH A;  3NJV A;  1W99 A;  5C7G A;  4ZXE A;  2WYS A;  2DDU A;  5LA0 A;  5JMO A;  3I3E A;  1TVG A;  1JZ7 A;  3THC A;  2Y6G A;  4MOA A;  1UZ0 A;  3P1I A;  1L7R A;  4GZ9 A;  1HN1 A;  3T09 A;  2VR4 A;  4PQQ A;  1RYY A;  2BGP A;  3DYP A;  2BER A;  4M4P A;  4OMC A;  3LEI A;  3VD7 A;  1SHW B;  1OT5 A;  3OG2 A;  4CU9 A;  3A7Q A;  2BZD A;  4LPL A;  2DCK A;  2EIB A;  3IB3 A;  3VDA A;  4PT6 A;  4QB6 A;  2J22 A;  2J1R A;  1XPW A;  5EIY B;  4CU8 A;  1W9S A;  4A42 A;  3MUZ 1;  2CDO A;  3HNM A;  1YQ2 A;  4JX0 A;  4Z2A A;  4QX0 A;  1BHG A;  3GDB A;  4ET7 A;  2QQO A;  5IFP A;  2LS6 A;  1H6Y A;  3PUI A;  4DXT A;  2E26 A;  3WNM A;  5JUV A;  4TXW A;  3NQH A;  3CQO A;  2WDB A;  4D8M A;  2Y6H A;  3K4D A;  5IJR A;  1JU4 A;  2VME A;  1OF4 A;  2VCB A;  1GUI A;  4D0Q A;  4GWJ A;  3D3A A;  4QX2 A;  3C7E A;  5DMY A;  5B4N A;  4BDV B;  1KEX A;  3T0A A;  5IHR A;  3PUH A;  3MUY 1;  4XUN A;  2J1V A;  3C7H A;  1NAE A;  1GOH A;  2CDP A;  1O8S A;  4YPJ A;  4PF1 A;  1UXX X;  1EUT A;  4W8J A;  2XQX A;  3ACH A;  2VO5 A;  4A41 A;  3A22 A;  4IUG A;  1UMI A;  3C7G A;  2ZEX A;  3CDZ B;  1WCQ A;  1ULP A;  4JKL A;  2VZ1 A;  1SG3 A;  3CMG A;  4P08 A;  5C71 A;  1CX1 A;  4A44 A;  4QDQ A;  3WF2 A;  4XUO A;  3I2G A;  3I2J A;  2ZEY A;  2Y8K A;  4BK4 A;  2W9X A;  2VZV A;  3HNY M;  4QB1 A;  2Z4F A;  3HPN A;  2Y6L A;  2QQJ A;  2YFZ A;  4XUP A;  3W5N A;  2WUH A;  2VOT A;  2W1S A;  2VCA A;  4KI5 M;  4XVH A;  3THD A;  4DEQ A;  1XNT A;  3EYP A;  1JYX A;  1P8J A;  4UOJ A;  1DP0 A;  1LNS A;  1NX9 A;  2B9V A;  2ZEZ A;  3ETP A;  2YB7 A;  3SKV A;  4QDR A;  3IAQ A;  4LKS A;  1F4H A;  1PMH X;  2J1A A;  2KD7 A;  1W9W A;  3LEK A;  3WF1 A;  3WSO A;  2ORX A;  5G05 L;  3C7F A;  2LW8 A;  3ACF A;  4DUW A;  1JZ2 A;  2VCC A;  1UY1 A;  1OH4 A;  2E31 A;  3MBW A;  1K12 A;  1PMJ X;  3FN9 A;  3NJX A;  2Y64 A;  2E32 A;  1K42 A;  1DLC A;  5LA1 A;  3J7H A;  4MO3 M;  2VZS A;  3LPG A;  4CU7 A;  5HPO A;  3C8X A;  2W1W A;  4FI9 A;  1KGY A;  4DXS A;  4A3Z A;  1CZV A;  3VDB A;  2VMD A;  1O59 A;  1JYV A;  2R7E B;  2VL4 A;  3ABZ A;  1GNY A;  5F7U A;  3SEE A;  2QQK A;  3W5M A;  3T08 A;  3I3D A;  3K77 A;  2VZR A;  4OMD A;  3OBA A;  3IDA A;  3LPF A;  2V72 A;  3WNN A;  4W50 A;  2DCJ A;  3ECQ A;  2J7M A;  2WO3 A;  2VZP A;  1L7Q A;  1GOF A;  1J84 A;  2Y6K A;  4MGS A;  5I0D A;  1W9T A;  4XUQ A;  2VM9 A;  2WZ8 A;  4ZY9 A;  2HLE A;  4QB2 A;  3T2O A;  3I2I A;  3NRU A;  2X10 A;  2JD9 A;  4QAW A;  3T2Q A;  2QBX A;  2JKX A;  2XHN A;  2C26 A;  1JZ5 A;  2EIC A;  5HXM A;  4AG4 A;  4QDS A;  5DQ0 A;  3VD9 A;  3WNP A;  2J1S A;  3GXU A;  1UYX A;  4P02 B;  4XUR A;  1W0N A;  3F2Z A;  5JXG A;  1GU3 A;  1UY4 A;  2OKX A;  4DEV A;  3UES A;  3I2F A;  3IAP A;  3AC0 A;  4QPW A;  3LQC A;  1O8P A;  4KWU A;  5G04 L;  1OF3 A;  5CZK A;  3HN3 A;  2Y6J A;  3OGS A;  3ZM8 A;  5JR2 A;  1W8N A;  2C9K A;  1XC6 A;  4CVU A;  1W8O A;  2WO1 A;  1OD3 A;  1UX7 A;  1JZ3 A;  4OUE A;  3WQB A;  2ZEW A;  2VQT A;  4XUT A;  4ARY A;  2ORZ A;  3JXS A;  1US2 A;  2WAO A;  2RV9 A;  1UY3 A;  1R64 A;  2YG0 A;  3K46 A;  3FL7 A;  1JZ8 A;  2XOM A;  3WF4 A;  3T0D A;  2W95 A;  2BBA A;  5LA2 A;  2W91 A;  3DYM A;  1UY2 A;  3CZU A;  2VC9 A;  2WZE A;  3OEA A;  1JHJ A;  2ID4 A;  1GMM A;  2VZU A;  1UXZ A;  2L9L A;  2YC2 A;  5CYY A;  1K3I A;  2B4K A;  2W5F A;  1CZS A;  3OB8 A;  4A45 A;  4ZZ8 A;  2J1U A;  4QX3 A;  2W92 A;  2V4V A;  4BXS V;  1UYZ A;  1I5P A;  1XNA A;  2JE8 A;  5JXH A;  5EJZ B;  4DUV A;  3K4A A;  1JYN A;  2W3J A;  2QQL A;  2J1T A;  1T2X A;  2J1E A;  3BN6 A;  4A6O A;  1MPX A;  3I2H A;  2HYX A;  4P5Y A;  1NKG A;  4A4A A;  4GWI A;  3WF0 A;  2E33 A;  4LQR A;  3EB7 A;  5DPN A;  2WAB A;  5B4X A;  2WO2 A; 
#chains in the Genus database with same CATH topology
 2HWC 3;  3MID A;  5C9A A;  1UYP A;  3Q9O A;  5A7O A;  1JYT A;  3VZO A;  2W87 A;  1KFU L;  2RG4 A;  4C0B A;  2D3P A;  3HNB M;  1AR6 3;  1BEV 3;  3JZV A;  3Q8B A;  2R04 3;  4SLI A;  2XBO 1;  2YHJ A;  4S2H A;  4XF9 A;  2D6K A;  4D3W A;  3T4V A;  1DQ1 A;  1DZQ A;  1JBC A;  4YG3 A;  2QNK A;  4D7Y A;  3WY6 A;  2W94 A;  4FPJ A;  1YFU A;  3ZXL A;  3MIE A;  4K6B A;  2VMC A;  2OUH A;  1SLB A;  4DMI A;  3TNP B;  1ULF A;  5FZO B;  4R9B A;  3UL2 A;  4PJY A;  4CYD A;  2XJS A;  1N1Y A;  4TTG A;  3III A;  2RS5 3;  4GIQ A;  4N9H A;  3ZFF A;  2EID A;  3O0W A;  4RL7 A;  3BGA A;  4CCK A;  3AFG A;  5B2G B;  2IXL A;  5KHH A;  2ZX0 A;  3MV1 1;  4RGK A;  3IMN A;  1WD4 A;  2VG9 A;  4ZZ5 A;  1AR7 3;  2WWJ A;  3LFI A;  3SIT A;  3T2P A;  1XNC A;  3B94 A;  1NLS A;  1AR6 1;  3LD8 A;  4JGY C;  2VMI A;  4HK9 A;  4YW3 A;  1T6B X;  3V64 A;  4LTA A;  4JKK A;  4XZU G;  2VW1 A;  1WCU A;  5EXO A;  2RDS A;  2XBO 3;  4OZO A;  4UAP A;  5FZI A;  4ARX A;  5FWJ A;  2D6N A;  3KB5 A;  2X05 A;  2NLR A;  4NID A;  1CAU A;  1PO1 2;  5FJK A;  1A8D A;  2X5I C;  3U4S A;  2FDK A;  4A7Z A;  5IT6 A;  5FZB A;  2FDG A;  2IXJ A;  1YEW A;  2NMO A;  4IV3 B;  5EPA A;  1MZF A;  3A0K A;  3PVE A;  4XXP A;  5DZG A;  3VKF C;  3A23 A;  4U36 A;  3HOB A;  3RRD A;  1PX3 A;  4DRV A;  5GLW A;  3WDU A;  2DU0 A;  3U37 A;  4FTB A;  4A7Y A;  3WW3 A;  4DXR A;  1APN A;  1AL2 1;  2ZZQ A;  4OHV A;  1QQP 2;  3MO4 A;  3POS A;  1DQ4 A;  4Y1U A;  4RHV 2;  5FLI A;  1ULD A;  2WAA A;  3DGT A;  4GWM A;  4W6X A;  4Q4V 2;  2E6V A;  4N7I A;  5JZG A;  3VL9 A;  4JKM A;  4CPB A;  4CCE A;  4RD7 A;  3WCR A;  1VLN A;  2JEM A;  1I1E A;  1OUR A;  3CJX A;  2X5I A;  3E6B A;  5A7S A;  2VPV A;  3OD0 A;  3GAL A;  1D7P M;  1H1M A;  5FMB A;  4E2Q A;  2B5H A;  5A80 A;  1O4Z A;  1BXH A;  2WS9 2;  5FYS A;  5JPN B;  3ZXF A;  1ENQ A;  4CDU A;  4EN7 B;  1U5Y A;  5FZL A;  1SFP A;  1ZYB A;  5JOW A;  2DFC A;  3FLP A;  3AP6 A;  3PU8 A;  3HVD A;  3JU9 A;  2JG9 B;  2JX9 A;  2C4X A;  2VD7 A;  4AFC A;  4EZ4 A;  5C70 A;  3NL1 A;  2CAV A;  3WNL A;  3KT1 A;  2AR6 A;  1C1F A;  1PZ9 A;  4K3U A;  3N4M A;  1J83 A;  1WLC A;  4YWA A;  2H0B A;  4GXL A;  1OQD A;  3CKH A;  2GZW A;  1MZ6 A;  1UF2 C;  3R0R A;  2RDQ A;  3FJS A;  5CU1 A;  5I0R A;  3ACG A;  2W1Q A;  2YPJ A;  5FMD A;  4AF9 A;  4CUA A;  4CEY A;  1VBE 3;  2PAE A;  2VBD A;  1GBG A;  5KC5 A;  1UMH A;  5FIX A;  4UFH A;  1CZT A;  2GAU A;  5LEK A;  2VOV A;  3R05 A;  1XE7 A;  3WZ1 A;  5IFT A;  1PK6 B;  4BK5 A;  1AZD A;  1R08 1;  1SBE A;  1ULG A;  2WNE A;  2WNU A;  1H30 A;  1US3 A;  3A21 A;  3IM0 A;  4DY3 A;  1RIR A;  3UKN A;  4HT1 T;  4ZS3 A;  4M01 A;  2YC4 A;  3T2T A;  5JI7 A;  3E5X A;  3GZA A;  1XSR A;  3OGJ A;  3OUI A;  3GM8 A;  4ZON A;  2FCT A;  1QJF A;  3LDR A;  2QZ2 A;  3RPQ A;  3S30 A;  4AEJ A;  4B1L A;  4N9I A;  4K20 A;  3OPT A;  1IGO A;  3ZPY A;  5F3C A;  1Y9Q A;  4GJZ A;  1IS4 A;  4TN7 A;  3LDB A;  3WQ0 A;  4C0H A;  1X9P A;  2P17 A;  1H8T B;  1RUH 2;  2ZAH A;  4MX3 A;  1TMF 1;  1V00 A;  4XBL A;  4QQO A;  3CIH A;  5L9V A;  4JC1 A;  5FO7 B;  1MQT C;  2QQP A;  4D7S A;  1UX6 A;  1JN2 P;  5C7G A;  1CAV A;  1CIW A;  1POV 3;  3PVN A;  5FOB B;  2DVB A;  4HN0 A;  5FY0 A;  2UY9 A;  2OUJ A;  5FYY A;  5J98 B;  1JZ7 A;  2R30 A;  3FZ3 A;  5F3G A;  1UO9 A;  2XHK A;  1OH3 A;  3K48 A;  2OZJ A;  3P1I A;  2G9G A;  1OBN A;  2WFP A;  1LTE A;  2WSV A;  3B9C A;  5DAQ A;  1HXS 1;  2AYH A;  1Q43 A;  1RUE 1;  1HRI 1;  4XCB A;  4EE2 A;  2YU2 A;  4LK7 A;  4PQQ A;  2JB8 A;  2WRA A;  2QDR A;  1QH7 A;  3VUO A;  2BFU L;  5JSO A;  4BA6 A;  3LOI A;  4HET A;  5ERL A;  1HW5 A;  4CRQ A;  4QWN A;  2DUP A;  3HQR A;  1SHW B;  4FPK A;  1W3X A;  1RUG 1;  3POG A;  2A3W A;  4YFZ A;  2BZD A;  3RZG A;  5KWR A;  2VNG A;  4IE7 A;  4R4Z A;  5FAX A;  2EIB A;  3Q8E A;  4D7T A;  5FBJ A;  4CCN A;  2IXH A;  2GC1 A;  1TME 3;  1MAC A;  2PHL A;  3LGR A;  5FZA A;  3BPZ A;  2WNU C;  1NA1 C;  4M3C F;  3O1V A;  3WOG A;  1V0A A;  2XVK A;  4XQD A;  1PM7 A;  2LS6 A;  1H6Y A;  1BYH A;  2XWJ B;  3CO2 A;  3PUI A;  4NPL A;  4DXT A;  4H55 A;  3TEZ A;  2KR2 A;  1PNG A;  2D44 A;  5JUV A;  3FE5 A;  4TXW A;  3RI9 A;  2IXI A;  5FCC A;  2ZCW A;  3ZFG A;  3WHU A;  4XFG A;  2VOX A;  5JSP A;  5IJR A;  4DIN B;  2D3S A;  1MS5 A;  1OF4 A;  1PVC 2;  1OKO A;  3PUA A;  4I0W B;  3SC7 X;  3SHR A;  3W21 A;  4O9G A;  2D40 A;  4H7L A;  2WLP A;  3AL5 A;  4QKB A;  3D3A A;  3BAL A;  4HVQ A;  1QNW A;  4GJY A;  4CXY A;  3LEM A;  5DMY A;  2FCU A;  5GM0 A;  3KMH A;  5I8S A;  2WFF 2;  3DPR B;  3B5L B;  3MUY 1;  4FSJ A;  3KM5 A;  4LIU A;  5T55 A;  5FQ0 A;  2XH6 A;  1Y4W A;  2J1V A;  1LGN A;  3WP5 A;  4JDO A;  1BMV 2;  1RVF 1;  3C7H A;  3R4S A;  2ERF A;  1POV 1;  3DCQ A;  2CDP A;  4KGQ A;  4PBO A;  5BNN A;  1IS6 A;  5F32 A;  2X53 S;  1UXX X;  5CVR A;  1BEV 1;  4ZKT B;  2RDR A;  1VBA 3;  5FP9 A;  1OSG A;  1VMJ A;  2YPD A;  5FTT C;  3RJ2 X;  4RFR B;  1PO2 3;  1NCQ A;  2FDI A;  2VO5 A;  4N7U A;  2ADE A;  3ZYR A;  3N7K A;  1WGP A;  2LTN A;  4K21 A;  3RJR A;  1LOG A;  5KHG A;  5DDJ 2;  5IVJ A;  1FNZ A;  3CU7 A;  3IPV A;  4MXW B;  4HSL A;  4JKL A;  1URX A;  2VZ1 A;  3AMP A;  1SG3 A;  3CMG A;  3J8F 2;  2EXI A;  4ASM B;  1JW6 A;  5GKA C;  5C71 A;  3SMH A;  3GCW A;  2Q30 A;  4HMZ A;  4A7K A;  1SEF A;  2BEO A;  1OA4 A;  3I2G A;  4EWD A;  2VVF A;  2ZEY A;  1HRI 2;  1MZE A;  1NLR A;  4GQ7 A;  4BK4 A;  3H8X A;  4YRD A;  5CAZ A;  1ZRE A;  3AYD A;  4OI1 A;  1Q8V A;  3NV3 A;  1ONA A;  2RJK A;  4HSJ A;  2XJU A;  3HPN A;  2WJS A;  4FFF A;  4O7X A;  1CES A;  4AR2 A;  1GR3 A;  2VTX J;  2FZ1 A;  1H2N A;  2A6V A;  5DAW A;  4MSV A;  2CTV A;  3W5N A;  1XQN A;  2VCA A;  3AFK A;  1ZBA 2;  4KI5 M;  4XVH A;  2WA3 A;  1TQ5 A;  1XNT A;  3EYP A;  2A1X A;  4YZ1 A;  5EYY A;  2EXJ A;  5LY2 A;  4OZX A;  1DGW X;  1DP0 A;  5C5T A;  1LNS A;  3RDI A;  2B9V A;  4XMA A;  4PLN A;  3U14 A;  4DNY A;  4QXH A;  1AF9 A;  1VRH 3;  2X8K A;  2J1A A;  2KD7 A;  1YJK A;  3CJI A;  3OBT A;  2CSG A;  2AAC A;  3AP7 A;  1V6J A;  1ZA4 A;  2HBU A;  2JDU A;  2ZAB A;  3H42 B;  2IFW A;  1FAY A;  3QCW A;  4ZU5 A;  3WSO A;  4YW1 A;  3VBF B;  5F8P A;  3LSE A;  1YXW A;  1VBB 3;  1JZ2 A;  4BXF A;  1RVF 3;  4CDX A;  2JE9 A;  1GZ9 A;  1WW7 A;  2E31 A;  3HT1 A;  5FPZ A;  2DYC A;  1NY7 1;  1XE0 A;  1VBE 1;  2HH9 A;  4NOT A;  1PMJ X;  5FZM A;  3SCG A;  1YIF A;  4AED A;  1ALY A;  3H7J A;  1TNF A;  4WM8 B;  3H8R A;  2WQ4 A;  1FXZ A;  5A7Q A;  2WNV B;  3GJA A;  4GB3 1;  4CU7 A;  1F8V A;  2IUW A;  4D6R A;  3KHC A;  3HQU A;  4MYE A;  2D5H A;  1KGY A;  3I59 B;  4DXS A;  4RR3 B;  5C9A C;  1CZV A;  3NMB A;  1VRB A;  1ZVF A;  2VMD A;  3UYJ A;  1RVF 2;  4OUS A;  1V9U 3;  1GP6 A;  3G7D A;  5DAV A;  4S2G A;  3SEE A;  2YC0 A;  4HVO A;  2QQK A;  1RUO A;  2YV8 A;  4PDW C;  3U75 A;  3K77 A;  5LZ6 A;  1BQP A;  1H4G A;  4LO6 B;  1V6I A;  1RJ8 A;  1WA6 X;  1ZRI A;  2VZR A;  3MW3 A;  1RJ7 A;  5A3W A;  1I3H A;  2Q8C A;  1CAX A;  1TME 1;  2OW4 A;  4N43 A;  4AI8 A;  4CP2 A;  1BKZ A;  3BIW E;  5BYN A;  2R07 1;  5J36 A;  3OOX A;  2JG8 C;  5FK7 A;  1LU1 A;  4AQ6 A;  1WW4 A;  4CEW A;  1D4M 2;  4YVS A;  5FKC A;  2WO3 A;  2G9F A;  3SIS A;  3DEM A;  1L7Q A;  3VBS C;  3WQ1 A;  3AVR A;  4UBG A;  2XWB B;  1WMX A;  4IEZ A;  2D6P A;  3L9J T;  4HPK B;  5DXD A;  2P34 A;  4HLT A;  1TZO A;  1YC6 1;  1J84 A;  2OPK A;  4XJZ A;  3T1L A;  3MEP A;  4ASK A;  1X36 A;  4JQT A;  1GWK A;  2VBP A;  1AYM 3;  1FT9 A;  5FY8 A;  5KHK A;  1IZ3 A;  3OD4 A;  1PGL 2;  2GN7 A;  3TN9 3;  4GAZ A;  4LBM A;  3DPR A;  5FDB A;  1KFX L;  3IIA A;  2A73 B;  2BQP A;  2CGN A;  3J8F 3;  3V65 A;  1QJX 3;  4LK6 A;  3P5B A;  2ARB A;  1PK6 A;  4CP9 B;  4PI2 A;  2ARA A;  5JMC A;  2JKX A;  4YVW A;  4L8Q A;  1YNA A;  4HKL A;  2F17 A;  5A6Y A;  4OFG A;  3ZDV A;  4YVS C;  4GH4 B;  3THP A;  3NKT A;  1JZ5 A;  1OVP A;  3EO6 A;  4A2U A;  2GH8 A;  1HX6 A;  1W6M A;  2V4A A;  3M3O A;  2XJV A;  3GXU A;  1W0N A;  4WM8 A;  3AP9 A;  5HCF A;  2XGX A;  1XB9 A;  1ULE A;  4I09 A;  4C91 A;  3ZXE A;  2BNM A;  2JDP A;  5FZ0 A;  3WXP A;  4HL0 A;  4IE6 A;  4U2A A;  3VHP A;  2LRP A;  1OKQ A;  3HN3 A;  5JR2 A;  4LHL A;  4YW5 A;  5HI0 A;  5C3O A;  1O3T A;  1XC6 A;  1A8M A;  1RUF 1;  1PO1 3;  3VBH B;  5CIS A;  1AR8 1;  3D5O A;  2R0H A;  2WO1 A;  3OY8 B;  5J09 A;  2VUJ A;  1RHI 1;  3M3I A;  5FYB A;  4PIZ A;  3S5A A;  4D69 A;  4FPF A;  4NAO A;  1OD3 A;  1TMF 2;  4I0A A;  2PYT A;  2XLF A;  4WM7 A;  1FOD 1;  2VQT A;  4E4D X;  1MEC 3;  4ARY A;  1R08 2;  4AVA A;  1US2 A;  4WM7 B;  1YQ5 A;  4I3P A;  3WP3 A;  4L9B A;  5A1L A;  3EHK A;  2R49 A;  1W03 A;  3A0N A;  5FOJ B;  1SFY A;  3LOB A;  3ZR6 A;  2ZPX A;  3ZN6 B;  4AE2 A;  4B8E A;  3T0D A;  2FD8 A;  4P9Y A;  3DYM A;  3KV6 A;  1I6X A;  3IT8 A;  2WZE A;  4YM2 A;  3ZXG A;  2ID4 A;  4QQH A;  2OT7 A;  3MIG A;  3NNM A;  4DXZ A;  4FFI A;  2UY8 A;  3ROU A;  1TME 2;  2B45 X;  4AVB A;  5JPM B;  1XE8 A;  2AUY A;  2W5F A;  2ET7 A;  3OSD A;  2R07 2;  1W9Y A;  1XU1 A;  1RHI 3;  4KWL A;  3OB8 A;  1ODN A;  4AI3 A;  1LUL A;  4P14 A;  4A45 A;  5JZG C;  3T1M A;  3RZL A;  1GV9 A;  4UYB A;  5JIU A;  1LHU A;  4M00 A;  2J1U A;  3WDT A;  3V0A A;  3GBW A;  4QX3 A;  4C1W A;  2V4V A;  4PLM A;  4BXS V;  1I5P A;  1DGL A;  4R52 A;  4KNC A;  4BQW A;  3LKJ A;  4DUV A;  1HXS 2;  5FK8 A;  2O8Q A;  1GZC A;  2ZGO A;  3CL1 A;  4KGG A;  3J7L A;  1T2X A;  2J1E A;  3BN6 A;  3HMY A;  3WP6 A;  4CCM A;  5KC6 A;  4URA A;  1D2Q A;  1MPX A;  2PMW B;  5LK5 A;  1NKG A;  5GJ6 A;  4GWI A;  1W06 A;  2ZGN A;  2A70 A;  3RG0 A;  4XOG A;  4AW7 A;  1G9C A;  5KXB A;  3KF3 A;  1Y43 B;  5DZF A;  4LQR A;  4MGI E;  5LY1 A;  2ZKL A;  4MH0 E;  3ZFF C;  4IET A;  3E5Q A;  2W08 A;  1J58 A;  4Q27 A;  5FYZ A;  2UU8 A;  5DUX A;  1DGR N;  4HXC A;  4J6G A;  4COW A;  4J1X A;  2XDV A;  1HB1 A;  3FFZ A;  3N7J A;  4Y5S A;  3THT A;  2E7Q A;  3AZZ A;  4H3W A;  2VZQ A;  4OYU A;  3WX5 A;  3FC0 A;  4OI0 A;  3IBM A;  1Y9M A;  1K5J A;  2DU1 A;  4RS5 A;  1EPZ A;  1HB4 A;  5ANQ A;  1AR9 3;  2ZMK A;  2WN3 A;  3KQR A;  4QPG C;  4X8N A;  4QQ2 A;  1BEV 2;  3MF9 A;  4FQZ A;  1DYO A;  4QX1 A;  4GA9 A;  5E8A A;  2VGD A;  3U4X A;  1ZBA 1;  4BLI A;  3K75 B;  1MS1 A;  4J1W A;  1UOG A;  4HBN A;  1GOG A;  1RUF 2;  5A7N A;  3LA7 A;  4GB3 3;  1UL9 A;  4P00 B;  4V2V A;  2QQN A;  5F2S A;  3O5S A;  5CG8 A;  5FUI A;  1NUK A;  1KDK A;  2CWM A;  4EWE A;  2RS1 1;  5J3U A;  1WCD J;  4RA0 A;  2W39 A;  3PLQ A;  3DF0 A;  4NE9 A;  4BQ5 A;  4CUC A;  4QGL A;  3J7N A;  4E8C A;  5E89 A;  1KJR A;  1RMU 2;  3RNS A;  3J8F 1;  4GMP 0;  5GZD A;  5A3M A;  3L2Y A;  3NNG A;  3LE0 A;  2UWA A;  3PME A;  3OGR A;  5LAS A;  3UNP A;  1LHN A;  4UFJ A;  4BQ4 A;  1G86 A;  4RN5 A;  1LGB A;  4LT5 A;  1M06 G;  2O14 A;  5C6C A;  3VBF A;  2QKD A;  2WR9 A;  3POF A;  1W6Q B;  1I5Z A;  3QH6 A;  4TSV A;  5JXJ A;  5FYC A;  3VDC A;  5C8C A;  1JS9 A;  2JWP A;  2VZ3 A;  2CGO A;  3KWV A;  3USS A;  4IDZ A;  1QH6 A;  1XSQ A;  1YFW A;  4KG0 A;  3RWN A;  1MS0 A;  3GGL A;  5JCT A;  4FT8 A;  1D4M 3;  4IXL A;  5JOX A;  1QWR A;  3SNM A;  3VBR C;  4UFL A;  1K5M A;  1QEX A;  1WKY A;  1H2M A;  1JH5 A;  1PIV 1;  4XDO A;  4LE3 A;  3RYR A;  3WHT A;  3OBZ A;  4NN0 A;  1N1T A;  2ARE A;  2BWC A;  1NCR A;  2ZX1 A;  3POY A;  4L11 A;  5T54 A;  4Q4V 3;  1IOA A;  3DKQ A;  2VZO A;  3APB A;  1V6O A;  4XJ8 A;  2LAL A;  5C3P A;  2F4P A;  5FYV A;  4PIY A;  3OEB A;  5FUN A;  1VBB 1;  1QOT A;  2RHP A;  1H6X A;  2BV4 A;  3AMM A;  1UY0 A;  2HWC 1;  3ZXJ A;  1SCR A;  4H7M A;  4EN8 B;  3H3L A;  1OA3 A;  5A3L A;  1V6K A;  3GZU C;  3OGG A;  2X09 A;  1C3H A;  5C8C C;  1K45 A;  3VBR A;  4LLO A;  2BOJ A;  3ZYB A;  4CP9 A;  2GME A;  4AED C;  2FDH A;  3P3P A;  3RI8 A;  4LIV A;  1JYW A;  1R1A 2;  2VQU A;  3LEG A;  2DVD A;  1YFX A;  3MLK A;  3W59 A;  4F7Z A;  1LOE A;  1QXP A;  2D6O X;  5C4W A;  4GKX A;  4CZS A;  4FOY A;  4LOR A;  4CXW A;  4UT5 A;  5FPX A;  4XJW A;  4OQ9 A;  2WS9 3;  5A1A A;  1O5L A;  3WEZ A;  2VTF A;  2ATF A;  3PVO A;  1JI6 A;  1D4V B;  3WG2 A;  2XL9 A;  1UOB A;  3INA A;  5HCA A;  4AEK A;  1EV1 1;  3FHA A;  1UD1 A;  1VBC 2;  1QJX 1;  1OD5 A;  5F3E A;  1FAT A;  3V56 A;  1CIY A;  4LO7 A;  3AKS A;  1FMD 3;  1UKR A;  2HWF 3;  1W8H A;  5JSR A;  1YLL A;  3MV0 1;  1ZZB A;  2IFR A;  3KCY A;  5FPA A;  1PVC 3;  4LEJ A;  4ORF A;  3ZKU A;  4LOT A;  4HG6 B;  5CFD B;  1KIT A;  4AI0 A;  1AYN 2;  5F5A A;  1H1A A;  2VE1 A;  5EZW A;  1YWK A;  2PQS A;  2BNN A;  3KQ4 B;  3B02 A;  3RMX A;  1ENX A;  5CEH A;  1W04 A;  4XFB A;  2XJP A;  4P9L A;  4CPB D;  2PLV 1;  5A32 B;  2A5Z A;  4QX7 A;  4CEY C;  1YFY A;  1IPJ A;  4WZF A;  3C7O A;  1AR6 2;  3ON7 A;  3TOJ A;  3WF3 A;  2MEV 1;  2D6L X;  2WQ8 A;  1UZV A;  3LF7 A;  3MIH A;  3VD5 A;  4COZ A;  2QQM A;  3VKO A;  2ZML A;  4FXG B;  2WN2 A;  5E6H A;  3M8L A;  5A3O A;  3ZDS A;  1RUN A;  5H9S A;  4ZXE A;  5T5P A;  2DDU A;  5LA0 A;  2ET1 A;  3B93 A;  3IZO A;  3VV1 A;  3ZMO A;  4BH9 A;  1VRH 2;  3KGZ A;  1TVG A;  5JMO A;  1W8Z A;  4IND A;  3IKW A;  1XYP A;  1HLC A;  2EVX A;  2RDN A;  2Y6G A;  4MOA A;  5AC9 1;  3R4D B;  4V2W A;  5SV5 A;  1ZBE 2;  2BWA A;  5BXX A;  3KSC A;  1TNR A;  2YY1 A;  3H1W A;  4FOV A;  4FAG A;  3AZX A;  4GZ9 A;  5A6X A;  5I91 A;  3T09 A;  2DWR A;  3ASI A;  5FZ1 A;  1AL2 2;  2WII B;  2VR4 A;  1QU0 A;  1C1L A;  5FZO A;  2Q1F A;  4UFI A;  4D94 A;  3ILN A;  1S0C A;  1HB2 A;  4JRL A;  5JDB A;  4ASL A;  2WNV A;  4OMC A;  5C5U A;  3VD7 A;  3M70 A;  5JZG B;  5F37 A;  1OT5 A;  3ZYG A;  3POJ A;  4Q4X 3;  2TBV A;  1NCR B;  4COU A;  4LPL A;  1OI6 A;  3I3Q A;  1CJP A;  2NM1 A;  3QD6 A;  3IB3 A;  2JDK A;  4PT6 A;  2Y26 A;  5FLH A;  3TEW A;  2P6H A;  2V73 A;  2J22 A;  4TWT A;  1J3P A;  1QOS A;  1AR7 1;  2XXZ A;  3PIG A;  4Y24 A;  4WBB A;  4QPI B;  4CDX B;  5EIY B;  1C8M 2;  2PXJ A;  3SH5 A;  3LIH A;  5FMO S;  2CDO A;  4CEY B;  3HNM A;  2FDJ A;  3BVC A;  1D2S A;  2Y60 A;  4Y20 B;  4QX0 A;  4TYS A;  5IFP A;  1ASJ 3;  1NCQ B;  4B29 A;  5CFC C;  4LNV A;  2H0V A;  2E26 A;  3RYP A;  2ZTN A;  1W6Q A;  5IVF A;  2B42 B;  1OQE A;  3QBQ A;  5IAV A;  2QCS B;  5FWE A;  2WDB A;  2Y38 A;  5GAL A;  4CEW B;  3BKZ A;  4Y4R A;  4E4H A;  2Y6H A;  3I4I A;  3K4D A;  2BPA 2;  1AR9 2;  5JWP A;  2VME A;  3IWZ A;  4LBK A;  2VCB A;  2VNR A;  1Q8O A;  5FY7 A;  4UW3 A;  2P1B A;  4NAM A;  2DF7 A;  5FZG A;  1C8M 3;  2NN8 A;  5FJH A;  1LKN A;  3FMG A;  1NA1 A;  1AR8 3;  1JUH A;  5B4N A;  1KEX A;  2CYF A;  2MEV 3;  3PUH A;  4NHK A;  4Q4W 2;  4XAC A;  3VZN A;  1WW6 A;  4AYU A;  3I49 A;  2DCY A;  1EV1 3;  3AVS A;  2GND A;  1W2T A;  2N7G A;  4QM8 A;  1F5F A;  1GOH A;  1EPW A;  5T5L A;  1JYI A;  1BK0 A;  1WWY A;  3LCP A;  4YPJ A;  3ST7 A;  2VQ0 A;  5GZC A;  4CXX A;  5J96 B;  4MUV A;  5FO8 B;  1Z0H A;  4IGQ A;  4P5H A;  1SLL A;  4AVT A;  3M4F A;  4NRP A;  5FPV A;  3ACH A;  4KBZ A;  1V9U 2;  1UIJ A;  1DIW A;  1U0A A;  4XXA A;  4C90 A;  2D98 A;  5LBB A;  2BRT A;  5CFD C;  4JHT A;  4IUG A;  4MHU A;  5JR7 B;  5AVP A;  3CBN A;  3RZZ A;  4Y26 A;  1ENR A;  1O4Y A;  3ALQ A;  4IEV A;  4AQS A;  5C3R A;  2JXA A;  1F15 A;  4AVC A;  1MR5 A;  3DPR C;  2ZGK A;  5FRE A;  3BTZ A;  4CSW A;  2OQ7 A;  3VBU C;  1A3K A;  3HN1 A;  4G3Y C;  4Q8L A;  3PUQ A;  1GP5 A;  2ILM A;  3HBZ A;  2OYZ A;  1WA4 A;  5AC9 2;  5LRS A;  4QU2 A;  4F83 A;  2K9Z A;  5F6K A;  3RMY A;  2Y8K A;  1Q8P A;  1SAC A;  2D5F A;  4PCR A;  5HCH A;  3PVB B;  4BU2 A;  3FLR A;  4QB1 A;  5BNP B;  5K0U B;  5KBF A;  1O91 A;  1RUJ 3;  1LB2 A;  3B01 A;  3R6S A;  3KV5 A;  2Y6L A;  3OF1 A;  4KL1 A;  2EF6 A;  2UWC A;  4MV2 A;  2WNU B;  2YFZ A;  2R16 A;  4FPE A;  1JOP A;  4MGZ E;  2VOT A;  2W1S A;  2WWS A;  3PTY A;  3RWK X;  1JYX A;  4H2A A;  2GAL A;  4ISQ A;  4JGZ A;  4UOJ A;  4QXB A;  4FPC A;  4XAA A;  2ZEZ A;  2QJV A;  3IAQ A;  5FZK A;  1FYU A;  4Q4Y 2;  2BU9 A;  1C8M 1;  4LKS A;  5FR3 A;  2JDZ A;  1SZB A;  2DVA A;  3I2O A;  1LOB A;  4Q4X 1;  3RYK A;  3WDV A;  3PMS A;  3ILF A;  4PDW A;  5I0S A;  5LA9 A;  4PI0 A;  3C7F A;  3ACF A;  3ME2 A;  4XCA A;  1UU5 A;  3ZYI B;  4DUW A;  2VW2 A;  5JOY A;  1LEM A;  4N43 B;  4R9C A;  1UY1 A;  5A6Q A;  1NZC A;  3C3V A;  2JE7 A;  5LWB A;  2YU1 A;  4IV3 C;  4CDU C;  3LSD A;  2CY6 A;  2Y64 A;  4JCK A;  5KR7 A;  5HV0 A;  3O1U A;  1HJG A;  3VGI A;  3N9L A;  2HEV F;  1Y9G A;  2E32 A;  2BBV A;  1W2N A;  3VHN A;  1RED A;  3VBS A;  1RUE 3;  1LOF A;  4MO3 M;  2XJQ A;  4UWD A;  1YJL A;  2PEL A;  1HKD A;  3C8X A;  2Q8E A;  4ZPI A;  4GD4 A;  5FPL A;  3AK0 A;  4HK8 A;  4Y1Y A;  5A70 A;  3GF6 A;  1U5I A;  1WBL A;  1O59 A;  3VZM A;  1JYV A;  4CDX C;  2YRO A;  1H9W A;  4YGC A;  3H7Y A;  3ZXA C;  1X8E A;  1MEC 2;  2WYF A;  2XUE A;  5F1R A;  2RJL A;  4NHM A;  4MLO A;  4OMD A;  5FUP A;  1TMF 3;  3OBA A;  4MGY E;  2A6Y A;  3IDA A;  3D4K A;  4JDN A;  4W50 A;  1RUC 3;  2DCJ A;  2QFE A;  1F35 A;  1AHS A;  4FPH A;  1U5X A;  1B09 A;  3AMN A;  4IGO A;  1ZRD A;  4UW4 A;  5F2W A;  3BOD A;  3WD5 A;  1DQ2 A;  3E6C C;  4E4S A;  1EAH 3;  1T6G C;  2VNV A;  2I2S A;  3C2U A;  1JOD A;  2WC2 A;  1MS4 A;  3CF6 E;  4LO5 B;  1Q3E A;  3E6D A;  5FP4 A;  4ZHN A;  2YUE A;  4HKO A;  1S0E A;  1HRI 3;  1JTZ X;  1EY2 A;  3VBO C;  1Q8S A;  3UGH A;  4M3C E;  1DZR A;  3W9A A;  1GP4 A;  1ZBE 3;  2Y6K A;  3I8T A;  5I0D A;  4AFD A;  1PVX A;  4XF1 A;  4ITC A;  4XUQ A;  3PHM A;  4BYY A;  2P3Y A;  5IVY A;  4CCO A;  1WME A;  3GHM A;  2BYV E;  2ZKN A;  1S0B A;  2HLE A;  4AHY A;  1XRU A;  4Q4V 1;  1ST8 A;  3T2O A;  4OHY A;  1H8T C;  4K40 A;  1RUF 3;  3BB6 A;  3ZFF B;  3WG4 A;  1H1I A;  3KVA A;  3CHX A;  3NRU A;  1GWL A;  1QJX 2;  3T2Q A;  2JDY A;  1B35 A;  2XHN A;  4ONU A;  4WZC A;  5BY5 A;  2C26 A;  3JUU A;  5DDJ 3;  2R6Q A;  5CKN A;  1FPN 1;  1W3V A;  4Z2W A;  1PVC 1;  5IK4 A;  1NXD 1;  4NHY A;  3UKT A;  1O3S A;  4Y1X A;  1ULC A;  2SBA A;  1W8T A;  1QOO A;  4AG4 A;  2BFU S;  4WV8 A;  5EJ3 A;  3WNP A;  4OCT A;  4P02 B;  3RZJ A;  4L99 A;  3JD7 2;  1DHK B;  3S7I A;  2P5B A;  5JXG A;  4FO9 A;  4Y20 A;  1UY4 A;  4B3N A;  1DYK A;  4JGZ B;  3LQC A;  3AMH A;  4XFI A;  3PNA A;  4KWU A;  1O7F A;  1XJA A;  2R06 2;  1PGW 1;  2FBE A;  1OF3 A;  3IDE A;  2A3X A;  3HR9 A;  2Y6J A;  3KCC A;  3OGS A;  1AX1 A;  3ACL A;  3ZM8 A;  5L7O B;  4JGY A;  1W28 A;  3V0B B;  2C9K A;  3RZK A;  1OQ1 A;  5BNO C;  5I0U A;  1C4R A;  2C0Z A;  1AR7 2;  4FP2 A;  4W65 A;  4XMI A;  4JGZ C;  1QJZ A;  5FXZ A;  4IEX A;  5EP9 A;  4FP3 A;  1UMZ A;  4CDW C;  2RM2 3;  1JZ3 A;  1NE4 A;  4Z82 A;  1SDW A;  2ZEW A;  4K1Z A;  4LBN A;  1YO8 A;  4XUT A;  3PL0 A;  1NE6 A;  5D8A A;  3JXS A;  2E53 A;  5BNQ A;  2YG0 A;  5DDJ 1;  4G9S B;  1AYN 1;  1GWM A;  1JZ8 A;  4YGD A;  1ZBA 3;  2A6X A;  2OZ6 A;  2ETE A;  2XLG A;  3GBF A;  3WF4 A;  5K7P A;  5LA2 A;  2BBA A;  3ZSM A;  3O1R A;  3UJO A;  3CZU A;  4COV A;  3OEA A;  4Y5T A;  3TB0 A;  1QJU 2;  1GMM A;  3LFM A;  3OUH A;  1PMI A;  3NV2 A;  4XW3 A;  2YC2 A;  5FYT A;  2VVD A;  4JDM A;  1K3I A;  5FP8 A;  4Q4W 1;  3T30 A;  1GQG A;  1BVV A;  2NYY A;  2PAK A;  1CZS A;  2PHF A;  2A6Z A;  1DZT A;  3OYW B;  3ZSE A;  4RQP B;  2BNO A;  4ZZ8 A;  5HXV A;  3VZJ A;  1ND2 C;  1QQP 3;  3JBG 3;  3ATG A;  4QMA A;  2PAM A;  1CAW B;  1BVP 1;  1FV2 A;  2WZR 2;  1W8U A;  1CWP A;  3TNQ A;  1W6N B;  4XDP A;  1UN1 A;  2CAU A;  4QPG B;  4E9K A;  4YZ5 A;  1JYN A;  1VAK A;  1IG0 A;  2JDM A;  4QPG A;  1AX2 A;  1VAV A;  2W3J A;  5JLV A;  1PO2 2;  2GNM A;  1W6N A;  1UQX A;  5AFE A;  3VLB B;  3FUQ A;  5BNP A;  2JG8 A;  3I2H A;  2HYX A;  4A4A A;  1G7Y A;  2VUC A;  4KG8 A;  4C1X A;  1H8V A;  2VMG A;  2HWE 2;  3VKN A;  4BE3 A;  1IPS A;  4Q4W 3;  1Z7S 1;  2PTM A;  3ILR A;  1JHN A;  2BUK A;  2E33 A;  2VXJ A;  4ATE A;  4Q0P A;  4AWD A;  5BNO A;  4MXV A;  2VUD A;  1NY7 2;  1X82 A;  1GAN A;  1RUI 2;  3JCI A;  3AZV A;  2ARX A;  5DPN A;  4EN0 A;  3VKM A;  4NO4 A;  2TUN A;  4FTS A;  2HWD 2;  3E97 A;  2RS3 3;  4L97 A;  3OGV A;  4WVZ A;  4GB3 2;  2YFU A;  1U12 A;  1CAW A;  5J48 A;  1C28 A;  4M4R A;  1E5I A;  1WCK A;  2AZ5 A;  2P3K A;  3PJQ A;  3I54 A;  2ZXQ A;  4I01 A;  3O1P A;  3NNJ A;  4Z8B A;  1AXK A;  4NWV A;  5FP3 A;  2DTY A;  4XC9 A;  5FYI A;  1O5U A;  1POQ A;  4CUB A;  5FV3 A;  2JDA A;  3IN9 A;  4QKN A;  3X29 B;  4E27 A;  5BNN B;  3N9O A;  1F9K A;  2GU9 A;  1IS5 A;  2JG8 B;  3FLT A;  3U10 A;  4NIH A;  1XND A;  2P2K A;  1V6M A;  3HWJ A;  2ZGU A;  5A32 A;  3CJI C;  1UWW A;  4BCU A;  2DBI A;  2G1M A;  5LRR A;  1WLT A;  2CV6 A;  3MIC A;  4Q0V A;  4RGA A;  2VJX A;  4X6Q B;  1RC6 A;  4DRR A;  3NAP A;  3V0B A;  3AYA A;  4LE4 A;  2W46 A;  5L7O A;  3NAP B;  1KS5 A;  4W4Z A;  2P4E A;  2BGC A;  4XFH A;  4YM1 A;  5IVC A;  3MYX A;  5F9T A;  3GHN A;  1F4A A;  3ZFG B;  2E7A A;  5GZG A;  3EQE A;  2YGM A;  5TSW A;  1FPN 3;  4DUX A;  2PHT A;  1W6O B;  3KF5 A;  3SEP A;  5FZ7 A;  1HXS 3;  1GYK A;  2RM2 2;  1GLH A;  4LBQ B;  5FXW A;  4YAR A;  1AUY A;  3DYO A;  3AJY A;  2ZGL A;  1O4T A;  2Q5T A;  4JRA A;  1UYY A;  4L2N A;  4KMQ A;  5LBE A;  1JXN A;  1PX4 A;  2XON A;  3POW A;  4F3J A;  2XJT A;  1NG0 A;  4GKY A;  3EJK A;  1YIP A;  2B8M A;  1OMI A;  3AMQ A;  5JXI A;  3HQX A;  1G8W A;  2DVF A;  1OOP B;  5EHD A;  3WLU A;  1YUD A;  4GMP 3;  3TBD A;  2EIE A;  2IXC A;  3FFQ A;  2ZHK A;  3CZJ A;  4BOW A;  3GJB A;  1RUD 3;  5GLT A;  4AHW A;  2NPI A;  3VBR B;  3BTY A;  4MG2 A;  4NVP A;  1H2L A;  1O3Q A;  2O0O A;  3U1X A;  1ASJ 1;  2AEY A;  4K8F A;  2HWB 3;  2VY0 A;  3BOP A;  3H3U A;  5K4L A;  5C8W A;  4Y3O A;  4LO4 B;  2EIG A;  1QNY A;  2YBK A;  1TG7 A;  1ZZ8 A;  3W20 A;  2VNO A;  4IE4 A;  2R32 A;  1DBN A;  3ACI A;  3GCX A;  4QHB A;  1MZ5 A;  3VDD A;  4AI9 A;  2PHX A;  1N3P A;  1IPK A;  1RUI 1;  1VBC 3;  2LM3 A;  2ZX4 A;  5T52 A;  1CJD A;  1Q5O A;  4WM7 C;  4HKW A;  5CNA A;  4YW7 A;  4UF0 A;  3HJR A;  1W6P A;  1S1A A;  4AI2 A;  3K4Z A;  2ZBJ A;  2G19 A;  1F5J A;  1DCS A;  4UBH A;  4E8D A;  3VD3 A;  2JEN A;  4IEO A;  4R9D A;  3DEC A;  2XUM A;  3VD4 A;  3Q8C A;  3SKJ E;  4CUG A;  3FHQ A;  1VMH A;  4UFK A;  1DF0 A;  5F39 A;  4N90 A;  4HVR A;  5IHR A;  4YGE A;  2ZAC A;  5DAP A;  1DGR A;  5A3U A;  3I3M A;  3I3B A;  5T50 A;  3ENR A;  4NPR A;  2EXK A;  3T4H B;  1VJ2 A;  5IUQ A;  2PHW A;  4P9J A;  3WNO A;  1GFF 2;  5IYY A;  5F3I A;  4LMF A;  4XDQ A;  3WT3 A;  4XTP A;  1EAH 1;  3ZSJ A;  1AYN 3;  2DUO A;  4PLO A;  1NCQ C;  2OVU A;  2VVE A;  4O65 A;  2RS1 2;  5DN2 A;  1JU3 A;  5AC9 3;  4FFH A;  4IEU A;  5FZ8 A;  1CD3 G;  3Q8A A;  3S0M A;  2VMF A;  2EAA A;  1AXY A;  3UET A;  1AJK A;  3PIJ A;  2R04 2;  4BPZ A;  4XFC A;  4LBO A;  2IZW A;  2R06 1;  3MW2 A;  1IQA A;  4FBF A;  2WBK A;  2EAK A;  1OUX A;  4PDW B;  4NPM A;  2UYB A;  1NCR C;  2CHH A;  2KXL A;  1VBD 2;  3WDW A;  3ZSL A;  1QJY 3;  2FCV A;  2VTX A;  3NAP C;  3NJV A;  4Z1V A;  1STM A;  5D2A A;  5ABJ B;  4X6R B;  1HB3 A;  1YHF A;  3NJZ A;  3ELN A;  4IGP A;  5C3S A;  4AOC A;  3M1H A;  4WVW A;  2RMU 2;  3H9A A;  5FLJ A;  3K3O A;  3U0Z A;  1FPN 2;  3G6J B;  1WZX A;  4IEY A;  1SPP A;  4KH9 A;  4N53 B;  5D21 A;  3FUO A;  4XYX A;  1HN1 A;  1CGP A;  1CON A;  2P37 A;  3I7D A;  4FPG A;  4N43 C;  4XF3 A;  5IVV A;  1RMU 3;  1PHM A;  3L2H A;  4LKE A;  1UPI A;  5FYH A;  4HFS A;  3ZXD A;  4IEW A;  1W9F A;  1RYY A;  2IWG B;  3VBF C;  2BER A;  4M4P A;  1H2K A;  3JQX A;  1E57 A;  1PGL 1;  2XVG A;  1WMD A;  4ISR A;  1RL3 A;  1PGW 2;  1ASJ 2;  2VU9 A;  3A7Q A;  2WWU A;  2GC2 A;  3KD4 A;  3RS6 A;  1QJY 2;  1W8W A;  1WLD A;  3VBU A;  4AK3 A;  5F5C A;  1LES A;  2J1R A;  2BJS A;  1W05 A;  1XPW A;  4IER A;  4BHP A;  3NV1 A;  4CU8 A;  2FDF A;  1W9S A;  1WD3 A;  2C9A A;  3MUZ 1;  4KU8 A;  4Q8K A;  1LJ7 A;  1H9P A;  2Q8O A;  2ENR A;  1NQJ A;  1YQ2 A;  4JX0 A;  3KV4 A;  3GDB A;  1EP0 A;  1RUJ 1;  1IKP A;  2HWB 2;  2DVG A;  5ANN A;  1AJO A;  1DLL A;  1PO2 1;  2PHU A;  3MHZ A;  3WNM A;  3JD7 1;  4QKD A;  1VBA 2;  4IW3 A;  4Q29 A;  1H0B A;  3NQH A;  4Q4Y 3;  1ENS A;  5C8C B;  2ZX3 A;  4D8M A;  1NQD A;  3M3C A;  2GN3 A;  3KGL A;  1JU4 A;  1EV1 2;  2AEN A;  4JAA A;  2Q1Z B;  4M0N A;  3LA3 A;  1BBT 2;  5A1F A;  1HQW A;  5FZ6 A;  2Q1M A;  3IDC B;  4YZ3 A;  3KLS A;  2W0X A;  3IDB B;  2Q0A A;  3VHO A;  4XBN A;  3UJQ A;  1S0G A;  3T0A A;  4DPN A;  3WNX A;  3RGB A;  5DG1 A;  3POI A;  3H1M A;  4P9X A;  2JD4 A;  1LU2 A;  4UW6 A;  3ZFE C;  4IV1 A;  1O8S A;  5KHJ A;  1BJQ A;  1DQ0 A;  4FVV A;  4HPK A;  4OI4 A;  3PJY A;  1OHF A;  4FXK B;  2WL1 A;  5LBF A;  1EUT A;  4ES8 A;  2JG9 C;  5DZE A;  4BQ2 A;  2H6B A;  1W39 A;  2E63 A;  1FOD 2;  3VBO A;  1GIC A;  4A41 A;  1SPP B;  3JB4 C;  5ACA 3;  3SH3 A;  2B7Y A;  2CWS A;  1UMI A;  3C7G A;  1DG6 A;  1ZRR A;  5BV6 A;  2VBB A;  3IPV B;  3QLQ A;  4MXW A;  4YG6 A;  3MGU A;  4XJA A;  2D3R A;  2GH2 A;  3T3Y A;  5C4W B;  4D6S A;  1OLM A;  2RS1 3;  3R4U A;  5F5I A;  5A7P A;  4YNI A;  2VEC A;  4FQ4 A;  2D7F A;  4LLF A;  1GQH A;  4FPL A;  4XJU A;  1D0G A;  3WV6 A;  4P08 A;  3U78 A;  1CX1 A;  4A44 A;  2E51 A;  4QDQ A;  4XPV A;  1ACC A;  3FBY A;  3SXW A;  3N9M A;  5KXE A;  5IW0 A;  3S57 A;  3I2J A;  2CU5 A;  3MIF A;  2VZV A;  1OLQ A;  1ZA7 A;  2ZJC A;  1J3R A;  4R4X A;  3CEW A;  2YBP A;  3CLP A;  4GUL A;  4IQP A;  1N3Q A;  2WO7 A;  3KHB A;  2QQJ A;  4FTE A;  2NMN A;  3RQ0 A;  2WUH A;  4AED B;  3THD A;  4G4F A;  1P8J A;  2WA4 A;  3URF A;  4CE8 A;  3O1S A;  5A7W B;  3BTX A;  1ZZ6 A;  2P3J A;  2XLA A;  1WW5 A;  4I0B A;  3O12 A;  4KQ7 A;  4CP1 A;  1NX9 A;  3U11 A;  1RXF A;  2WNO A;  3ETP A;  5FBZ A;  3DXT A;  4M0H A;  4QKF A;  1W9W A;  2MPF A;  2IC1 A;  4Y4Y A;  2JDH A;  4AXO A;  1X9T A;  3CJI B;  4W6Y A;  5A3N A;  5I93 A;  2JIG A;  4YW2 A;  2Z2S B;  2LW8 A;  4FCA A;  4QPI A;  2VCC A;  1OH4 A;  2XR4 A;  1QDO A;  5AVA A;  1DDL A;  2GNT A;  4YFW A;  1PM4 A;  3N9P A;  1AR9 1;  3FN9 A;  2JG9 A;  4DIQ A;  4IL7 A;  3WCS A;  3BIE A;  4R9A A;  4LXL A;  1REE A;  3VZK A;  2XML A;  2XKP A;  1C57 A;  4HON A;  3VDD B;  1DLC A;  1W6M B;  1K42 A;  2GSY A;  2I74 A;  4AHZ A;  5FY9 A;  3LPG A;  3NV4 A;  5HPO A;  3ZN5 A;  2GMP A;  1VMF A;  1MQT B;  3K51 A;  2W1W A;  4LO8 A;  4DY5 A;  4PHZ A;  2QQU A;  4A3Z A;  1S2B A;  3VDB A;  4Q0U A;  3ES4 A;  3N9Q A;  4MVT A;  3I59 A;  2VL4 A;  1MVE A;  3NWK A;  3VKL A;  5F7U A;  3BPS A;  4CCD A;  5C3Q A;  3DXU A;  1A78 A;  3JB8 A;  5AFB A;  1VRH 1;  1X50 A;  3T08 A;  4AHX A;  3I3D A;  4RHV 3;  5FRA A;  2FZ2 A;  2FQP A;  1MS9 A;  3WVJ A;  4B1M A;  1RUD 1;  2X29 A;  3ETQ A;  3B69 A;  1K5M C;  3BU7 A;  5FYM A;  4BQ1 A;  3EMR A;  2QDN A;  1EAH 2;  1PZ8 A;  2CNA A;  2PQQ A;  3DL3 A;  1ND3 B;  4Y22 B;  2WT0 A;  1SFN A;  3ECQ A;  4MHR A;  4QQP A;  4YW6 A;  4LBQ D;  4ES9 A;  1G9F A;  4QXC A;  2ZAA A;  1LHW A;  4URT A;  4LA3 A;  1FMD 2;  1JOB A;  4LOS A;  5L19 A;  1S0J A;  2ADD A;  3HBK A;  1YI9 A;  3LA2 A;  1CAU B;  1RUG 2;  5BNP C;  3ZYP A;  1LOA A;  2XVL A;  3B9I A;  1W6O A;  1RTV A;  1UOJ A;  1YQC A;  1BZW A;  1MQT A;  3KS7 A;  2QE3 A;  1D0H A;  4GWN A;  2VM9 A;  2WKK A;  5LAT A;  5I8T A;  1QIQ A;  2IXK A;  1PO1 1;  2ZGS A;  2DV9 A;  4LJH A;  5GZF A;  4IE0 A;  4ZY9 A;  4O9E A;  3WW1 A;  3WDX A;  3SQO A;  4QX5 A;  4BQY A;  1LOC A;  4IEQ A;  1XNK A;  2GC3 A;  3O1T A;  2ES3 A;  2X10 A;  2JD9 A;  2E7T A;  2TNF A;  3EBR A;  4LBL A;  5L9R A;  1F31 A;  2RS5 2;  2WZP P;  3VN4 A;  4QPY A;  3RZH A;  2NP0 A;  4PQ9 A;  5EQU A;  1R09 2;  4D6Q A;  5A3P A;  4AVV A;  5DQ0 A;  1R1A 1;  4FFG A;  3ZYH A;  1UYX A;  2BTV C;  4XUR A;  3S5Q A;  4OUL A;  2WFF 1;  2OKX A;  2Y0I A;  4CDW B;  3UES A;  4EN9 B;  3I2F A;  3IAP A;  1UU4 A;  4NJ4 A;  1J3Q A;  3AC0 A;  4PIX A;  4Q0Q A;  2PLV 3;  1O8P A;  4PBP A;  3MF6 A;  5K0U C;  5G04 L;  1BMV 1;  2W68 A;  4XET A;  1QHD A;  1C5H A;  4BM8 A;  5E88 A;  3UT0 A;  3M7A A;  1AL2 3;  1W8N A;  1HN0 A;  4E2G A;  4OUM A;  1W8O A;  4X8P A;  3NVC A;  1UU6 A;  2RMU 3;  2HEY F;  2PN5 A;  4FPY A;  4NMI A;  3H8U A;  2ZGR A;  4KBB A;  3AKR A;  1G9B A;  4FOW A;  1YQ6 A;  3WQB A;  4XTM A;  2JDN A;  4AGG A;  1PZ7 A;  3AKQ A;  1RUJ 2;  1NXM A;  2HWB 1;  3JBG 1;  4UFM A;  3WG3 A;  4YZ2 A;  2ORZ A;  5APA A;  1HDK A;  2R07 3;  1SQ4 A;  2RE9 A;  4EQV A;  1UY3 A;  1R64 A;  3K46 A;  3AYE A;  2VQA A;  3FL7 A;  3M3Q A;  1YQ8 A;  4P9W A;  2R0F A;  1UZW A;  5IVB A;  1UCX A;  2WT2 A;  4OHW A;  4BWO A;  5FPU A;  2W95 A;  4RS5 B;  1YRZ A;  2Y33 A;  2HYK A;  1HIX A;  2VC9 A;  3WQ7 A;  1JHJ A;  4QQL A;  1MS8 A;  4FOQ A;  1Z7S 3;  2AEZ A;  1J1T A;  2VZU A;  1UXZ A;  5JVV A;  4XQW A;  4CDW A;  5DUU A;  2XKO A;  4AEM A;  1IS3 A;  4DOU A;  1DU3 D;  1N1S A;  3WIN E;  4XAE A;  1E5H A;  1EYB A;  1H8T A;  5GLV A;  3MLL A;  1S2E A;  3TYJ A;  4RQP A;  3UV9 A;  3TRS B;  4CP0 A;  1OPO A;  2GP5 A;  1QJY 1;  3SCH A;  3DKW A;  4GH4 A;  4HAN A;  4KWJ A;  2ZGT A;  1TE1 B;  2QUO A;  2YMZ A;  3BCW A;  3J7M A;  1UYZ A;  1QF3 A;  1XNA A;  2MEV 2;  3MZH A;  4FAH A;  5JXH A;  5EJZ B;  1REF A;  1E5S A;  1V70 A;  2Z69 A;  1KJL A;  3K4A A;  4MGK E;  4QXK A;  2JKB A;  2BW8 A;  3LB9 A;  1DQ6 A;  2QQL A;  1BBT 3;  1WMF A;  4XJ9 A;  4Q5O A;  1OVS A;  1CVN A;  4Q4X 2;  4NIG A;  2WFF 3;  4P5Y A;  4JQR A;  2VOK A;  2WQZ C;  2OQ6 A;  1PIV 3;  3PUR A;  2WS9 1;  3WF0 A;  1ZBE 1;  4EV0 A;  1TEI A;  5T5J A;  1JMU B;  2DTW A;  4JVA A;  2RS5 1;  4V1P A;  4YM0 A;  1UAI A;  2B39 A;  3AKT A;  2YYO A;  1QMJ A;  3EB7 A;  5GLU A;  1KXG A;  3ZIX A;  4B7K A;  2WO2 A;  3AXD A;  4AL9 A;  1NYW A;  3JQW A;  1ODM A;  4ZXK A;  3AYC A;  5FXX A;  1CAX B;  3VZL A;  3O1M A;  3QAC A;  3RFR A;  4CU6 A;  2YGL A;  2RJ2 A;  4I3G A;  2RVA A;  1LRH A;  4RR3 C;  5C9A B;  1VBA 1;  5BNN C;  5KXC A;  4CDU B;  2RR1 1;  2V5Y A;  3D0S A;  3I97 A;  4NRM A;  5L9B A;  5A6Z A;  1S55 A;  2QVS B;  4W6W A;  3H8O A;  4WVM B;  2ZGM A;  1YI7 A;  3H3Z A;  1BBT 1;  2Z79 A;  4JHZ A;  4QU1 A;  4WM8 C;  4O61 A;  1LGC A;  1V6L A;  3EXU A;  4GAL A;  4WVV A;  1LOD A;  1WUV A;  4NRO A;  1AYM 1;  4J25 A;  3VHR A;  4DB5 A;  1ZRF A;  3ZOI A;  4I30 A;  4XE9 A;  3GZE A;  5A3T A;  5IWF A;  3WG1 A;  5FQ0 B;  3K3N A;  1QJU 3;  2QQW A;  4Y1V A;  4BJ0 A;  3BUC A;  5IAT A;  4TLF A;  2W1U A;  2W47 A;  2QZ3 A;  5EV7 A;  4QX8 A;  3RVH A;  1RXG A;  5CKQ A;  2V09 A;  2BGO A;  1BLZ A;  1RIN A;  3RSJ A;  1RGS A;  1X8M A;  2JB4 A;  1JOJ A;  1RUC 1;  2RS3 1;  1ZZ9 A;  2ZMN A;  1R08 3;  3NJY A;  3ZMN A;  3GBG A;  3OJB A;  4LBQ A;  1EUU A;  4LUL A;  5FY5 A;  2PHR A;  1GKB A;  1XU2 A;  3PTR B;  4XZP A;  5HV4 A;  4C8D A;  1ND3 A;  5E16 A;  4COY A;  3ZLI A;  3ZFE B;  1KD7 A;  4RYD A;  2R06 3;  2YDE A;  2K0G A;  2I45 A;  2NQY A;  4UI9 L;  5CBL A;  1PK6 C;  1UKG A;  5CAD A;  3OPW A;  2XJR A;  3M2M A;  3ZN6 A;  3ZIW A;  1V9U 1;  4LHS A;  2VW0 A;  1ULO A;  3H1Y A;  4OHZ A;  5EJ1 B;  5H9P A;  1RUH 3;  2DCT A;  3P6B A;  1RUD 2;  4LHK A;  1Z78 A;  4BQ3 A;  5LK7 B;  1WLW A;  3W58 A;  1JZ4 A;  5J37 A;  4L0P A;  3QH7 A;  1HJF A;  2V5D A;  3FWE A;  2QQI A;  1DGW A;  3I2K A;  3WDY A;  3ZN4 A;  1SDD B;  1ZX5 A;  3J26 N;  4CCJ A;  4OI2 A;  3OY8 A;  1KS4 A;  3ZPO A;  1FMD 1;  2X5I B;  1IKQ A;  4I02 A;  2UWB A;  2HBT A;  2HWE 1;  3TWI A;  3AP4 A;  3FBM A;  4RS5 C;  4YVS B;  4JV4 A;  5KHI A;  3UKV A;  1M4W A;  4Y22 A;  3NST A;  1O6U A;  1XYN A;  4AAP A;  4UF0 B;  1QKQ A;  4DO0 A;  5J1X A;  4MAD A;  3T0B A;  2HKX A;  4MGQ A;  3KV9 A;  5GZE A;  5CA6 A;  4NUB A;  3ORJ A;  4XQ4 A;  5D8A C;  4XIK A;  4E4Z A;  1V6N A;  4EWA A;  5FKB A;  3KCX A;  1NOV A;  5CIR A;  4OHX A;  4AQ2 A;  3OUJ A;  5FZ3 A;  1GZW A;  3MW4 A;  3Q8F A;  4NHX A;  1XOY A;  3J4U H;  5EWS A;  1HQL A;  3SCF A;  4CDQ A;  1AR8 2;  1SLA A;  4YVW B;  4AAX A;  4H14 A;  3O0X A;  2R1D A;  2OX0 A;  2DCZ A;  1B35 B;  1IQD C;  4B7E A;  3N7L A;  2VZT A;  1JUI A;  4N53 C;  4F8A A;  1OXC A;  3E1F 1;  1GQP A;  5E1R A;  4LR4 A;  3WNK A;  2B46 X;  2F6B A;  3K2O A;  3KZ4 C;  4LA2 A;  5SV8 A;  1JZ6 A;  3HAG A;  4XFF A;  1AYM 2;  2Y34 A;  1HV0 A;  3A4U A;  5FZD A;  1UZY A;  3KT7 A;  4P9I A;  4EZH A;  1VBE 2;  2JIJ A;  3ES1 A;  5I8Y A;  3LDK A;  1HQN A;  4GH4 C;  1N1V A;  1G9A A;  5EFU A;  4RR3 A;  3HEI A;  2LUW A;  2OII A;  2C24 A;  4XBQ A;  3WUD A;  2RS3 2;  2WZR 1;  2GC0 A;  5DG2 A;  4AQT A;  5DUV A;  4I2O A;  5D1I A;  1KDM A;  3PDQ A;  4YYO A;  5LCW L;  1I9R A;  3DN7 A;  2WT1 A;  1W99 A;  1WBF A;  2Q4S A;  2ZX2 A;  3PU3 A;  1SLI A;  2RM2 1;  2HWF 1;  2HJI A;  4Y33 A;  2WYS A;  2WNV C;  4YG0 A;  1ZM1 A;  1A6C A;  2A3Y A;  1CAV B;  3I3E A;  1MEC 1;  2H6C A;  2VH9 A;  2KA3 A;  4Z07 A;  3THC A;  1UPS A;  1UZ0 A;  3VBO B;  1R09 1;  1G6N A;  1J59 A;  1C5I A;  3ZR5 A;  3BI3 A;  2A71 A;  3I2D A;  1L7R A;  3WP4 A;  3ZKY A;  1X33 A;  2DUQ A;  4YM3 A;  2YXS A;  1OFN A;  4Q26 A;  3O7O A;  2VCM A;  3ZSK A;  1B35 C;  3HT2 A;  2ARC A;  4YLZ A;  5LEJ A;  3BU0 A;  5FZF A;  2BGP A;  1DYP A;  4XAB A;  1D4M 1;  3ZYF A;  1A34 A;  2UUR A;  3DYP A;  1AVB A;  3LEI A;  1GNZ A;  3OTF A;  4BLJ A;  5A7W A;  3TN9 1;  5J7M A;  2VMH A;  3OG2 A;  1KQR A;  4CU9 A;  4EYU A;  2XPJ A;  4XHX A;  4OLL A;  2DCK A;  1NLQ A;  2YBS A;  4Z92 B;  3VDA A;  4QB6 A;  1CPM A;  5JI9 A;  1CQ9 A;  1W0P A;  3NW4 A;  2A7A A;  3S6P A;  4A42 A;  5JAX A;  2J42 A;  4NR1 A;  3V0A B;  3MFA A;  1LOF C;  4BMB A;  1RIT A;  4Z2A A;  1OUS A;  1OLR A;  1BHG A;  5F5Q A;  4ET7 A;  2QQO A;  3O1O A;  3JBG 2;  1GNH A;  3MPB A;  3OCP A;  5IAX A;  5FP7 A;  4B4R A;  2XL7 A;  3O0V A;  1VAM A;  2GDF A;  2GMM A;  2Y6F A;  4DFS A;  2MNG A;  2RR1 3;  3CQO A;  1E5R A;  5ACA 1;  4LUM A;  1SLT A;  1NZI A;  1LHV A;  4AGR A;  4N8M A;  4IV1 C;  1RMU 1;  1QY4 A;  1W2O A;  1GUI A;  3USU B;  4HN1 A;  2ZOE B;  3OBR A;  4D0Q A;  3WUC A;  1LAJ A;  2K2S A;  1WCS A;  4GWJ A;  1RUG 3;  4PF5 A;  4B4P A;  1UNB A;  4QX2 A;  5LW9 A;  1GZT A;  1MVQ A;  3VBU B;  4AFB A;  3C7E A;  1G9D A;  3POB A;  4BDV B;  4EJR A;  1FNY A;  1HRV 2;  2NZ9 A;  3ZXK A;  4XUN A;  1YYN A;  1CR7 A;  3HD8 B;  3ZYJ B;  5C4W C;  2LRO A;  4YZ4 A;  4RQP C;  2O8O A;  2VOW A;  2PFW A;  4ZS2 A;  4NIA A;  3N3H A;  1NAE A;  2E9Q A;  4QHO A;  1PNF A;  4R8H A;  2WIN B;  3AXE A;  5DAB A;  5CB7 A;  1VIW B;  5I0T A;  3P3N A;  4PF1 A;  1OA2 A;  4WVM A;  5IK7 A;  3OYW A;  2C6S A;  1LR5 A;  4DS0 A;  4W8J A;  1PIV 2;  2XQX A;  1R09 3;  1VE0 A;  1QDC A;  4XF4 A;  1S4C A;  3KVB A;  4OVE A;  5A33 A;  5K8S A;  2OPW A;  3A22 A;  2EXH A;  5FY4 A;  2Q8D A;  4JGY B;  2ZEX A;  5ISL A;  1OLM E;  4MZU A;  2EA7 A;  3SLI A;  1W6P B;  2ZHN A;  4SBV A;  1COV 2;  3QOP A;  3CDZ B;  1GSL A;  1WCQ A;  1ULP A;  4YVW C;  5DAX A;  4E2S A;  4CA9 A;  3F95 A;  1SLC A;  5L73 A;  2RMU 1;  1QJU 1;  1W2U A;  3AKP A;  4NRQ A;  3VL8 A;  3M3E A;  5IVE A;  3WF2 A;  1QQP 1;  4XUO A;  4IV1 B;  2W52 A;  3N7M A;  5FZH A;  3MLJ A;  2W9X A;  2HEW F;  2JEC A;  3AX4 A;  3HNY M;  2JIC A;  4EN6 B;  1JYC A;  2CL2 A;  1COV 3;  2W2I A;  2Z4F A;  2VXR A;  2XBO 2;  5LBC A;  1N47 A;  2HWE 3;  2SLI A;  3GZT B;  4XFA A;  4XUP A;  4ZU4 A;  4BB3 A;  5JOZ A;  4K1Y A;  4S2F A;  4DEQ A;  2EAL A;  2VUA A;  2F4L A;  4QPI C;  5DUW A;  4AFM A;  4LBJ A;  1RUI 3;  1VBC 1;  4DQA A;  1OFS A;  2P3I A;  4CCL A;  1KRI A;  3USU A;  4Q0S A;  2XB6 C;  2YB7 A;  1QXR A;  2AGS A;  2BVB A;  4QDR A;  3SKV A;  2P6C A;  2O1Q A;  1F4H A;  1U5Z A;  1PMH X;  1VBD 3;  3MPP G;  4QHZ A;  1MS3 A;  4RHV 1;  4XHB A;  2MHF A;  4BQX A;  5L36 A;  3HIF A;  3LEK A;  3WF1 A;  5C33 A;  5T5O A;  5IK5 A;  2YZ4 A;  3AL6 A;  3D82 A;  1AXZ A;  1VAL A;  2ORX A;  2GP3 A;  2ZHL A;  5G05 L;  3NNF A;  1Z7S 2;  2C5D A;  3B3Q E;  3SH4 A;  4XIL A;  1W8F A;  3BYW A;  5K9Y A;  3GNE A;  3H50 A;  4KU7 A;  1RB8 G;  3MBW A;  1LEC A;  4JTO A;  3TEX A;  2DFB A;  1RUC 2;  1K12 A;  1Q56 A;  2G4I A;  1QGL A;  2R04 1;  2RR1 2;  3NJX A;  5IK8 A;  3VDD C;  3MDP A;  2WSU A;  3NNL A;  1RHI 2;  2HWD 1;  2PLV 2;  2TEP A;  3AP5 A;  3B7M A;  4MGT A;  5CFC A;  1CX4 A;  1LED A;  1AL0 G;  2WLQ A;  3S7E A;  1SBD A;  5LA1 A;  3J7H A;  4UXA A;  1ZZ7 A;  2B9U A;  2G9Z A;  2VZS A;  1Q8Q A;  2XG3 A;  4A6S A;  4M3C B;  1IHM A;  4FI9 A;  1QJE A;  3U07 A;  4ERO A;  2AH2 A;  1ND2 B;  5GLZ A;  4YGB A;  4AVS A;  2R7E B;  3ABZ A;  2JJ6 A;  1PGS A;  1GNY A;  4M3C A;  3O14 A;  1OOP A;  3TEY A;  3N35 A;  1ZNP A;  1LEN A;  1XBF A;  4FPO B;  3W5M A;  4Y1Z A;  1VP6 A;  2XQR A;  2VUL A;  1SBF A;  4HOO A;  2ZGQ A;  2BVV A;  4BIS A;  3KT4 A;  4IES A;  4B4Q A;  2Y0O A;  3AJZ A;  3LPF A;  2V72 A;  5ABJ A;  3WNN A;  1L7L A;  3D6E A;  4AFA A;  2D6M A;  2I07 B;  4Q1R A;  3BOW A;  3AM2 A;  1VPH A;  2D97 A;  1VB2 A;  2J7M A;  1POV 0;  1O3R A;  1DQ5 A;  1UOF A;  1SMV A;  1COV 1;  3DV8 A;  4CTE A;  3NKG A;  2AC1 A;  1L3J A;  4K9S A;  2VZP A;  4JZR A;  4HZF A;  3J9S A;  4BIF A;  1R1A 3;  1GOF A;  2BOI A;  4S2D A;  3ZVX A;  4ATF A;  4CCC A;  4KWK A;  4MGS A;  5T3N A;  4BIO A;  3FHI B;  5FZ9 A;  3D0J A;  3LWC A;  1AX0 A;  1W9T A;  4IE5 A;  4XEZ A;  1Y3T A;  4TLG A;  4A3X A;  4ZU7 A;  2CGP A;  1OPM A;  5M0T A;  5ABJ C;  2WZ8 A;  1VR3 A;  2OS2 A;  1FX5 A;  4BZ4 A;  1HV1 A;  1RUH 1;  4RSU A;  2ZA9 A;  3E5U A;  4QB2 A;  5H9Q A;  1R1Z A;  4GMP 1;  5CKM A;  3I2I A;  3GYD A;  2HWF 2;  3LIG A;  2D43 A;  4Q2F A;  1CPN A;  4QAW A;  4RGG A;  2QBX A;  5K0U A;  5HCB A;  4OQ8 A;  2Z42 A;  1XYO A;  5FPB A;  1ZRC A;  1FOD 3;  1SCS A;  2A75 A;  1FI2 A;  2UYA A;  1NT0 A;  3LZZ A;  2EIC A;  1X7N A;  3WW4 A;  3B00 A;  4DZG A;  4CDQ B;  5HXM A;  5BUV A;  2PA7 A;  5CG9 A;  4QDS A;  4N53 A;  3VD9 A;  1VBB 2;  4JTN A;  3UGG A;  2J1S A;  4NHL A;  2QQV A;  3TAY A;  3IMM A;  1N3O A;  3F2Z A;  5FYU A;  5FZC A;  1S0F A;  1GU3 A;  2BDR A;  4DEV A;  3CNA A;  4QPW A;  4K8R B;  2KM2 A;  5F6L B;  1OOP C;  1BK1 A;  2K46 A;  3MFC A;  3RZM A;  3POE A;  4LKF A;  3UGF A;  5CZK A;  3ITQ A;  2FHR A;  4AI1 A;  2GNB A;  2Z5W A;  5L7O C;  1S0I A;  3AB0 A;  1UIK A;  4CVU A;  1LCL A;  1VB4 A;  2IVI B;  3FX3 A;  1CN1 A;  3VBH C;  1UX7 A;  5D8A B;  4NII A;  2OXB A;  4OUE A;  1QXJ A;  5FXV A;  1IG3 A;  5H9R A;  2FMY A;  5LB6 A;  2FMD A;  2WAO A;  4AZZ A;  2RV9 A;  4UW5 A;  1F2N A;  4MET A;  1YCI A;  4BME A;  2DUR A;  3VBS B;  5JIA A;  4K7J A;  2XOM A;  1Y7B A;  3MIB A;  4LKD A;  3JD7 3;  4XF0 A;  3ZFG C;  1XNB A;  1DFQ A;  2ZGP A;  5CFC B;  2W91 A;  3LAG A;  4YSF A;  1UY2 A;  3UK9 A;  2IVJ A;  3WW2 A;  3ZO0 B;  1S0D A;  1XXN A;  1NA1 B;  1W90 A;  2OA2 A;  1RUE 2;  3OPZ A;  4RFT 0;  4IV3 A;  5HBA A;  1BCX A;  2ZS6 B;  4YW4 A;  4CDQ C;  3BTA A;  3PUS A;  1K5M B;  2DBN A;  5FZE A;  2L9L A;  5FO9 B;  5FFO C;  4Q1P A;  3ZFE A;  5CYY A;  4QD2 A;  4QT6 A;  3ZX7 A;  2BP6 A;  5A33 B;  1HRV 1;  4LIT A;  2B4K A;  1VBD 1;  3TN9 2;  1J1L A;  1UZZ A;  2QTW B;  1UW8 A;  2VAU A;  4P9G A;  5BNO B;  3AZW A;  1OC1 A;  2A6W A;  3NO8 A;  4LHN A;  1H4H A;  5EYX A;  5FMO L;  2W92 A;  2ZZJ A;  2JE8 A;  4NWW A;  4AGV A;  3N9N A;  5BPX A;  2HWD 3;  1S2K A;  2PHD A;  4TZD A;  5CFD A;  1ND3 C;  4Q4Y 1;  2HWC 2;  2J1T A;  3H0O A;  4LUK A;  4L92 A;  5FY1 A;  4CEW C;  3D8C A;  5ACA 2;  3WR0 A;  3AZY A;  4A6O A;  3MI8 A;  5KXD A;  3DUI A;  4QGN A;  5FMC A;  2R1B A;  3N36 A;  1ND2 A;  1ZZC A;  4IEP A;  5FZ4 A;  2C1F A;  4XIO A;  1HRV 3;  4Y5Z 0;  1LHO A;  2WZR 3;  1W0O A;  4QGM A;  1C8N A;  1FV3 A;  1GZW B;  4QM9 A;  1W2A X;  2D93 A;  3VB9 A;  2WAB A;  5B4X A;  2ZHM A;  3VBH A; 
#chains in the Genus database with same CATH homology
 4OYU A;  2VZQ A;  3OGV A;  2W87 A;  2YFU A;  3HNB M;  4CU6 A;  2RJ2 A;  2RVA A;  4M4R A;  2WN3 A;  2ZXQ A;  4QX1 A;  1DYO A;  3I97 A;  3K75 B;  4CUB A;  2W94 A;  2JDA A;  1GOG A;  4JHZ A;  2VMC A;  4P00 B;  2QQN A;  5FUI A;  4TTG A;  1NUK A;  3III A;  1UWW A;  2EID A;  3BGA A;  2VJX A;  4CUC A;  4E8C A;  4BJ0 A;  2W46 A;  3MV1 1;  4W4Z A;  2W1U A;  2W47 A;  4ZZ5 A;  3T2P A;  2BGO A;  3NNG A;  3LE0 A;  3OGR A;  3UNP A;  1F4A A;  4RN5 A;  5JXJ A;  4JKK A;  4DUX A;  4XZU G;  1EUU A;  4OZO A;  4UAP A;  3SEP A;  3VDC A;  4ARX A;  2VZ3 A;  2X05 A;  3DYO A;  3GGL A;  4RYD A;  1UYY A;  4KMQ A;  4UI9 L;  1WKY A;  1PX4 A;  3A23 A;  2XON A;  3HOB A;  1PX3 A;  3U37 A;  4LHS A;  1ULO A;  5JXI A;  4DXR A;  2VZO A;  3MO4 A;  5EJ1 B;  3P6B A;  2WAA A;  2EIE A;  1JZ4 A;  3CZJ A;  3OEB A;  4L0P A;  4JKM A;  2V5D A;  1H6X A;  2QQI A;  1UY0 A;  3I2K A;  1SDD B;  1D7P M;  2X09 A;  1K45 A;  1TG7 A;  3ACI A;  1JYW A;  2VQU A;  3LEG A;  2C4X A;  5J1X A;  4MAD A;  3HJR A;  3T0B A;  5C70 A;  3K4Z A;  4MGQ A;  3WNL A;  4E8D A;  5A1A A;  3VD3 A;  3WEZ A;  2VTF A;  1J83 A;  3VD4 A;  3DEC A;  1JI6 A;  3SKJ E;  3CKH A;  3FHA A;  3FHQ A;  3ACG A;  2W1Q A;  4CUA A;  3I3B A;  1CIY A;  4AAX A;  3WNO A;  1UMH A;  5IYY A;  1CZT A;  1IQD C;  3MV0 1;  5IFT A;  2VZT A;  4BK5 A;  3A21 A;  3E1F 1;  1GQP A;  5DN2 A;  3WNK A;  1US3 A;  4HG6 B;  1JU3 A;  1JZ6 A;  2PQS A;  2YC4 A;  2VMF A;  3GM8 A;  3UET A;  2WBK A;  3HEI A;  3C7O A;  3WF3 A;  2WQ8 A;  3VD5 A;  2QQM A;  2WN2 A;  5LCW L;  3CIH A;  3NJV A;  1W99 A;  5C7G A;  4ZXE A;  2WYS A;  2DDU A;  5LA0 A;  5JMO A;  3I3E A;  1TVG A;  1JZ7 A;  3THC A;  2Y6G A;  4MOA A;  1UZ0 A;  3P1I A;  1L7R A;  4GZ9 A;  1HN1 A;  3T09 A;  2VR4 A;  4PQQ A;  1RYY A;  2BGP A;  3DYP A;  2BER A;  4M4P A;  4OMC A;  3LEI A;  3VD7 A;  1SHW B;  1OT5 A;  3OG2 A;  4CU9 A;  3A7Q A;  2BZD A;  4LPL A;  2DCK A;  2EIB A;  3IB3 A;  3VDA A;  4PT6 A;  4QB6 A;  2J22 A;  2J1R A;  1XPW A;  5EIY B;  4CU8 A;  1W9S A;  4A42 A;  3MUZ 1;  2CDO A;  3HNM A;  1YQ2 A;  4JX0 A;  4Z2A A;  4QX0 A;  1BHG A;  3GDB A;  4ET7 A;  2QQO A;  5IFP A;  2LS6 A;  1H6Y A;  3PUI A;  4DXT A;  2E26 A;  3WNM A;  5JUV A;  4TXW A;  3NQH A;  3CQO A;  2WDB A;  4D8M A;  2Y6H A;  3K4D A;  5IJR A;  1JU4 A;  2VME A;  1OF4 A;  2VCB A;  1GUI A;  4D0Q A;  4GWJ A;  3D3A A;  4QX2 A;  3C7E A;  5DMY A;  5B4N A;  4BDV B;  1KEX A;  3T0A A;  5IHR A;  3PUH A;  3MUY 1;  4XUN A;  2J1V A;  3C7H A;  1NAE A;  1GOH A;  2CDP A;  1O8S A;  4YPJ A;  4PF1 A;  1UXX X;  1EUT A;  4W8J A;  2XQX A;  3ACH A;  2VO5 A;  4A41 A;  3A22 A;  4IUG A;  1UMI A;  3C7G A;  2ZEX A;  3CDZ B;  1WCQ A;  1ULP A;  4JKL A;  2VZ1 A;  1SG3 A;  3CMG A;  4P08 A;  5C71 A;  1CX1 A;  4A44 A;  4QDQ A;  3WF2 A;  4XUO A;  3I2G A;  3I2J A;  2ZEY A;  2Y8K A;  4BK4 A;  2W9X A;  2VZV A;  3HNY M;  4QB1 A;  2Z4F A;  3HPN A;  2Y6L A;  2QQJ A;  2YFZ A;  4XUP A;  3W5N A;  2WUH A;  2VOT A;  2W1S A;  2VCA A;  4KI5 M;  4XVH A;  3THD A;  4DEQ A;  1XNT A;  3EYP A;  1JYX A;  1P8J A;  4UOJ A;  1DP0 A;  1LNS A;  1NX9 A;  2B9V A;  2ZEZ A;  3ETP A;  2YB7 A;  3SKV A;  4QDR A;  3IAQ A;  4LKS A;  1F4H A;  1PMH X;  2J1A A;  2KD7 A;  1W9W A;  3LEK A;  3WF1 A;  3WSO A;  2ORX A;  5G05 L;  3C7F A;  2LW8 A;  3ACF A;  4DUW A;  1JZ2 A;  2VCC A;  1UY1 A;  1OH4 A;  2E31 A;  3MBW A;  1K12 A;  1PMJ X;  3FN9 A;  3NJX A;  2Y64 A;  2E32 A;  1K42 A;  1DLC A;  5LA1 A;  3J7H A;  4MO3 M;  2VZS A;  3LPG A;  4CU7 A;  5HPO A;  3C8X A;  2W1W A;  4FI9 A;  1KGY A;  4DXS A;  4A3Z A;  1CZV A;  3VDB A;  2VMD A;  1O59 A;  1JYV A;  2R7E B;  2VL4 A;  3ABZ A;  1GNY A;  5F7U A;  3SEE A;  2QQK A;  3W5M A;  3T08 A;  3I3D A;  3K77 A;  2VZR A;  4OMD A;  3OBA A;  3IDA A;  3LPF A;  2V72 A;  3WNN A;  4W50 A;  2DCJ A;  3ECQ A;  2J7M A;  2WO3 A;  2VZP A;  1L7Q A;  1GOF A;  1J84 A;  2Y6K A;  4MGS A;  5I0D A;  1W9T A;  4XUQ A;  2VM9 A;  2WZ8 A;  4ZY9 A;  2HLE A;  4QB2 A;  3T2O A;  3I2I A;  3NRU A;  2X10 A;  2JD9 A;  4QAW A;  3T2Q A;  2QBX A;  2JKX A;  2XHN A;  2C26 A;  1JZ5 A;  2EIC A;  5HXM A;  4AG4 A;  4QDS A;  5DQ0 A;  3VD9 A;  3WNP A;  2J1S A;  3GXU A;  1UYX A;  4P02 B;  4XUR A;  1W0N A;  3F2Z A;  5JXG A;  1GU3 A;  1UY4 A;  2OKX A;  4DEV A;  3UES A;  3I2F A;  3IAP A;  3AC0 A;  4QPW A;  3LQC A;  1O8P A;  4KWU A;  5G04 L;  1OF3 A;  5CZK A;  3HN3 A;  2Y6J A;  3OGS A;  3ZM8 A;  5JR2 A;  1W8N A;  2C9K A;  1XC6 A;  4CVU A;  1W8O A;  2WO1 A;  1OD3 A;  1UX7 A;  1JZ3 A;  4OUE A;  3WQB A;  2ZEW A;  2VQT A;  4XUT A;  4ARY A;  2ORZ A;  3JXS A;  1US2 A;  2WAO A;  2RV9 A;  1UY3 A;  1R64 A;  2YG0 A;  3K46 A;  3FL7 A;  1JZ8 A;  2XOM A;  3WF4 A;  3T0D A;  2W95 A;  2BBA A;  5LA2 A;  2W91 A;  3DYM A;  1UY2 A;  3CZU A;  2VC9 A;  2WZE A;  3OEA A;  1JHJ A;  2ID4 A;  1GMM A;  2VZU A;  1UXZ A;  2L9L A;  2YC2 A;  5CYY A;  1K3I A;  2B4K A;  2W5F A;  1CZS A;  3OB8 A;  4A45 A;  4ZZ8 A;  2J1U A;  4QX3 A;  2W92 A;  2V4V A;  4BXS V;  1UYZ A;  1I5P A;  1XNA A;  2JE8 A;  5JXH A;  5EJZ B;  4DUV A;  3K4A A;  1JYN A;  2W3J A;  2QQL A;  2J1T A;  1T2X A;  2J1E A;  3BN6 A;  4A6O A;  1MPX A;  3I2H A;  2HYX A;  4P5Y A;  1NKG A;  4A4A A;  4GWI A;  3WF0 A;  2E33 A;  4LQR A;  3EB7 A;  5DPN A;  2WAB A;  5B4X A;  2WO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...