4AB5A

Regulatory domain structure of nmb2055 (metr) a lysr family regulator from n. meningitidis
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
216
structure length
216
Chain Sequence
GEAGELRIAVECHTCFDWLMPAMGEFRPMWPQVELDIVSGFQADPVGLLLQHRADLAIVSEAEKQNGISFQPLFAYEMVGICAPDHPLAAKNVWTAEDFIGETLITYPVPDEMLDLPKKILIPKNINPPRRHSELTIAIIQLVASRRGIAALPYWTVMPYLEKGYVVHRQITADGLQSKLYAAIRTEDTDKSYLNNFCQIIRERGFADLPGLSELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATOR, LYSR FAMILY
publication title Structure of the Regulatory Domain of the Lysr Family Regulator Nmb2055 (Metr-Like Protein) from Neisseria Meningitidis
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Transcription
total genus 51
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4ab5A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4ab5A02
4ZEDA 4EF2A 1B3GA 4G4PA 3AXFA 4LZ7A 3V5AA 3IR1A 1ATGA 3U92A 1URSA 1AMFA 1MH4A 4WXJA 4XKRA 4TOZA 1QVSA 3TQLA 2HAVA 4NF6A 2PMSA 1JEVA 2ZMBA 4FAJA 1ZU0A 1S7YA 4F1VA 3OO7A 2Z22A 2V3TA 1M5EA 5H8FB 3U8QA 4G8NA 2RINA 1CE2A 2OCUA 3CR9A 5DT6A 3RT6B 1MM6A 3FV2A 1II5A 4YB6A 3VDFA 3E13X 5JK4A 4Z7EA 3O66A 2Y7RA 3TTNA 1LBCA 3SEUA 4C0RA 4R72A 1FQCA 4U22A 4EDPA 3Q28A 4RNSA 4R6KA 3MVYA 3G3IA 2F6PA 1YPNA 4IO4A 4ZE8A 3KN7A 1DOTA 2I49A 2QJEA 5I2KB 4F3SA 3FVKA 4KPTA 1P1UA 3HHFA 1RYXA 5CI5A 3FV1A 1S50A 2PX1A 3PMWA 1MQJA 2I6EA 1VR5A 4RXLA 1XS5A 4QFKA 3TEPA 5ITOA 1H3DA 1FW0A 2UYEA 2QS3A 2XXQA 4IB2A 3K01A 3TTKA 4PP0A 1MRPA 3C33A 2XD3A 1B5JA 1OQHA 3I3VA 4IY6A 4QFLA 2DWHA 4X9TA 3C32A 3B6QA 3PGFA 3MPKA 2I58A 3IX1A 2QPQA 5I57B 4RPNA 1H43A 4IO7A 5H8HA 3RQTA 1GTKA 2D5WA 3PPPA 2XXYA 1P1WA 2YJPA 1P1OA 4QSDA 4R9GA 3T9HB 5HM4B 4K3FA 1B32A 1IXHA 2ZYNA 2DWIA 3RPWA 3K2DA 1D3KA 1RYOA 2HZLA 3CI8A 1LBBA 4FEDA 4JDFA 1IZ1A 1SQYA 4YICA 3IAZA 4OMBA 3TTLA 1MPDA 5BWJA 4LQ5A 2Y7IA 3SEXA 3MQ9A 2UXAA 3PUVE 2Y7PA 2LAOA 4XTCQ 1UIVA 3R6UA 3UGWA 1LFIA 5AA2A 3IB2A 2A5TA 3TTRA 5L9SA 3EHUA 5CMMA 3FIRA 1B0LA 2PT1A 1B3HA 3FJGA 4EXKA 5DTBA 1XHYA 1TWYA 1SI0A 1CB6A 2V25A 1T0KA 3OSRA 1JQFA 3ZKKA 3TFLA 4GL0A 4IO5A 5EHMA 2OWSA 3FXRA 1MY2A 1B9JA 1FCKA 1Y4TA 3CG1A 4RK9A 5I59B 3CG3A 4ELQA 1POTA 1SDXA 1A8FA 4U23A 2DE2A 4ZEFA 3Q25A 4GD5A 4OYVA 4U4XA 2XXVA 3QXMA 2RCBA 4OWDA 5DVFA 5H8NA 3GZGA 3HV1A 4LVQA 2DVZA 3OMBA 3HPIA 2DP8A 3FVNA 1NL5A 1O7TA 3EN3A 3PPQA 2REGA 4F3PA 1OVBA 1BIYA 3K1PA 4G8HA 4H67A 4R6YA 3LUYA 1UQWA 1PBPA 4H5FA 5CMCA 3OELA 1NH7A 1ZBMA 2Y7WA 1A54A 4OTEA 4EUOA 5TPAB 4MLQA 3B7DA 2RCAA 4HTGA 5IAIA 5HBCA 2FA7A 4JXIA 4ZE9A 2QMXA 1Y3NA 2ONRA 3TYHA 3IOVA 3N26A 2RF1A 4Z0IA 3VXBA 4KFQA 2GHAA 4X1BA 2R71A 5B70A 3TTMA 1SYIA 4GRKA 3FVGA 4OETA 1WVJA 4AB5A 2ZYOA 3MWBA 3FXUA 1B05A 5DEXB 3T96B 4H8IA 3LSLA 4DLDA 1S9TA 1VE4A 4I1DA 1QJMA 4TQUQ 1QKAA 2I3VA 4OQOA 4KI0E 1FQFA 4RK2A 4QRZA 1GR2A 3EHSA 2P0SA 1VFDA 3MZ9A 4NF8B 4THIA 3PV0E 1SYHA 1N04A 4LONB 4JB7A 1LFHA 1MPCA 2XXIA 4NEDA 2OZZA 1MXYA 2HAUA 3E9XA 1B7ZA 4LUBA 3T9XB 5JTYB 1URDA 1WODA 1LAHE 5A5XB 4LZ5A 2GHBA 3SESA 1GV8A 3P7IA 1M5CA 1LFGA 1SW4A 4QF9A 2O7IA 3TQWA 4JWXA 2FYIA 2QSXA 3BFUA 4GIZA 4OENA 3OXNA 3T22A 1SD3A 2PBWA 3G7WA 4NWDA 1Z7NE 4ELPA 2ZNUA 1OIBA 4MFIA 4GL8A 3S9NC 4NF5B 3S9MC 1MH3A 4OHNA 2OLBA 2GH9A 3B6WA 3A3UA 3HHGA 1MXUA 5J1DA 5KCJA 4G2ZA 1D9YA 3Q29A 1LLSA 3C9HA 4QSEA 1P1QA 4U2RA 5FHMA 3TCFA 2DXRA 1NKXA 3PU5A 1AIVA 4HW8A 3WAFA 4ZZAA 3TODA 2Q9TA 2RKMA 2B3BA 4FECA 3U94A 2D21A 3MVZA 2OK2A 4M1VA 1R9QA 4PFYA 1HSEA 2AL5A 3VXCA 4R9FA 4GLIA 3K02A 4C1TA 1Y3QA 2YPNA 5LOMA 5KDTA 5TP9B 4NF4A 4NE4A 4UA8A 1B3LA 1QUKA 3G3KA 3G3HA 3KFMA 1SW1A 2KLFA 3TELA 2H25A 4R75A 3OO6A 1LAXA 3G3GA 1B1XA 2HEUA 2V93A 4KYEA 2XX9A 2F7CA 3PD9A 3UP9A 4H8JA 5ICQA 1Q1KA 3SEYA 5CRYA 5AA1A 3W9VA 3IL1B 4MH5A 5ICTA 3MAMA 2X7PA 4YKJA 3TDJA 3FGSA 2O1LA 2XXPA 4Q8RA 4FEBA 2Z8FA 4ND9A 3ILUB 3SDFA 3C34A 1A7LA 1MY4A 2XXHA 3T93B 1SI1A 1R1NA 2PVUA 4G68A 3BKIB 2XXXA 1B1HA 3QSLA 4O3CA 2ALUA 3USDA 2H99A 4IY5A 5I58A 1VSOA 3OSQA 1DMBA 1AH5A 2VP1A 3EQ1A 4EXLA 4LATA 1Y20A 4N13A 1MDQA 4YZZA 5K2YA 4XKPA 3D4CA 4KYDA 5HPQA 4F1YA 2M8CA 5AA3A 3CSBA 1H76A 1B2HA 3LC8A 5H8QB 4FJPA 3TAJA 4RJZA 5I2NB 1DPEA 3SEVA 2O51A 2F5XA 4BDRA 2Z8DA 4KR5A 2DWJA 4EQBA 5DVIA 2AYSA 4L17A 3KN3A 5CMBA 1N76A 4YMAA 3RT8A 4DXCA 1B3EA 5AA4B 1O63A 1O64A 1Y9UA 3O6GA 3C35A 1MPBA 1Y4CA 4OVJA 5EHSA 4UACA 5M2VA 4QFOA 1D9VA 4U4SA 3MVWA 2PYYA 4ZECA 1VFEA 1ZKBA 1P99A 3UK4A 1B7UA 2O7UA 4C1UA 1Y3PA 1MY1A 4YB5A 3HN0A 4YAHX 3SERA 2RC7A 3H6UA 1J1NA 3VVDA 5H8FA 5I56B 3A3CA 1SVXB 1ZMGA 2F35A 4YU0A 3B6TA 3S4UA 3C31A 3O9PA 1LB9A 2VGQA 3L6GA 2OWTA 4EQ7A 2XD2A 1JETA 4KD5A 4PFTA 5KZTA 1BTJA 2ZYKA 2Q8JA 3RNNA 3SEWA 3THIA 5I2KA 4GXSB 1LAGE 3KEIA 3K1MA 4BDNA 3PMVA 3K6UA 4XIGQ 1P1NA 1MG1A 4HCYA 5I84A 5F1QA 3LSXA 4JSDA 2F8DA 4IGTA 4XKNA 4YMBA 3MVXA 1ANFA 4WEPA 2QS2A 1UTHB 2P2AA 4OFOA 5FHNA 2XXUA 4QHQA 2UVGA 3MW0A 2X26A 4OEUA 1PEBA 3R7XA 2F36A 3EPEA 1L5TA 1DTZA 1A55A 3FJ7A 5DVJA 1GGGA 3MP1A 2GFEA 2NOOA 3TCHA 4IO3A 1UIUA 3KOTA 3SETA 4G68C 1GVCA 3QK6A 2DQVA 4U1OA 3GBAA 3IORA 3KSJA 2AIXA 2DXYA 3TKDA 1UTBB 3IJXB 3ILTB 3A09A 1N0TA 5I57A 2VD2A 3IOWA 3PMXA 4H6DA 1B0HA 4KQPA 3PUZE 1KWHA 4JWOA 2Y84A 4GWOA 2B65A 1XT8A 3IB1A 1TFDA 4POWA 3MZ1A 3MP8A 2ONSA 4QFPA 3LSWA 4U1ZA 3FJMA 1YTVA 3KGCA 3VLVA 4PQJA 3K00A 4I8CA 3PPOA 2NWJA 3DLNA 1M5DA 4AQ4A 1N7XA 3IO6A 4NF6B 1IITA 1WDNA 4F19A 1EH3A 1M5BA 1USYH 3ZS6A 3H4ZA 4LP2B 1YCJA 4WEDA 2WKYA 4YKPA 4ZS9A 4R6HA 1HSLA 4POXA 2E1SA 1DPPA 4H5GA 4I62A 4E0XA 1D4NA 4ELRA 2BJJX 1NNKA 2HCAA 4F3GA 1QUJA 1B52A 4IO6A 5K2XA 2I4CA 4U21A 5ITPA 4DDDA 1MXXA 1HSJA 4BDOA 3K6VA 1QULA 2QRYA 1FQEA 3VVEA 1Y1ZA 4ZZEA 1IXCA 3HCQA 1R6ZA 4KYSA 2REJA 3S9EA 3QYTA 5I59A 1FTJA 3H3GA 3K0VA 1B6HA 3KN8A 1B4HA 3F11A 1MQDA 3N6TA 3LR1A 1A8EA 1B46A 1H45A 4BDMA 1FTKA 4GF8A 3GBBA 4TLLB 4F31B 1N7WA 3QUJA 3MC2A 4R73A 3EF7A 2Q88A 3T66A 1USYE 4QSCA 3QAXA 4R2FA 4GOTA 3VLUA 2HZKA 2F7AA 2VD3A 4YKKA 1IQ7A 3S2VA 4G77A 1QKBA 2HFBA 4DIGA 3K4UA 4M4GA 3UORA 3IB0A 2DE3A 1EU8A 2ANJA 2UVJA 1XVXA 2F97A 3OD7A 2I48A 5AA2D 4OZ9A 3CSGA 2PT2A 3HSTA 2G29A 3FUZA 5CC2A 2RC8A 3H6TA 1OLCA 2ONKE 2H98A 1R9LA 2XXRA 3PUWE 5EYFA 5TPAA 3RUMA 3N6UA 4ONYA 3MUQA 3VLWA 5H8HB 3RY3A 2A5SA 3H6WA 4ELOA 3FVOA 5L9MA 2DE4A 1MS7A 2V84A 3UA8A 1NMUA 3KJ7A 3VV5A 1FTLA 1FQBA 4ESXA 2XXWA 1JW1A 2NUVA 3RTWB 3DP8A 4QFNA 3IJOB 4LZ8A 3LSFB 2ABHA 2NVUB 5DEXA 3K6XA 3ONMA 1JEUA 1FTMA 1IXGA 4R74A 3FXQA 3T9VA 3PUYE 2DWAA 1QW0A 4F29A 5L8DA 3UN6A 3MPLA 1EZOA 5AA2B 2A5TB 3KJTA 2D3IA 1ZTYA 3OO8A 4ZEIA 4P11A 3E3KA 4NF8A 4OFLA 3LBSA 3G3JA 1B51A 4F18A 4R2BA 1BP5A 4N07A 3BBRA 3T9UA 1MY0A 5JTYA 1ZJLA 5CMKA 1MXZA 3RN8A 5A5XA 1FQDA 2IA4A 4F39A 4BDQA 2DVCA 2V3UA 4DZ1A 5B7DA 3MZBA 4ISUA 2CMOA 5BUUA 2X7QA 1AOVA 4E0WA 3S9LC 2Q2AA 4I9DA 4IO2A 1PC3A 3IK6B 2O84X 4YB7A 4ESWA 3U93A 3HO7A 1NH8A 4PFUA 2H9BA 2XXTA 1LGBC 4FORA 3PUXE 5H8NB 2UVHA 1Q35A 4NF5A 5L9OA 3QUFA 3UIFA 1JW5A 5CM6A 3C36A 3CIJA 1SW2A 1F9BA 1OMPA 1PBQA 2E0SA 3H6VA 3CRBA 3KOSA 4IGRA 3W15C 4G8MA 3PD8A 4NMYA 1N84A 3JZJA 3U72A 1FTOA 1MQHA 3OOAA 4LQ2A 4JBZA 4H65A 2Q2CA 3Q27A 1US4A 4PETA 2Z8EA 4HS7A 4MLVA 1TT1A 2ESNA 4O3BA 4WKMA 1PB7A 1IIWA 1LCTA 1MQIA 4RPOA 3V83A 3V8XB 1NNPA 3IOUA 1MXWA 4HCWA 1NNFA 1B4ZA 2P1SA 3FD3A 3ZKLA 3OEMA 3PPNA 5CBRA 3CFXA 1TFAA 3JYRA 1EZPA 4FATA 3Q26A 2UYFA 2THIA 3JV9A 3DM0A 1JW4A 5TP9A 2XX7A 1B5HA 4O3AA 1URGA 3IO4A 4KHZE 3O97A 1NNTA 4KCCA 2W7YA 3O6IA 2DYXA 1PB9A 4JSOA 3I5OA 1MM7A 5ELVA 1RKMA 1IXIA 1I6QA 1I6BA 4RA1A 4EQ9A 3CVGA 1AL3A 2YLNA 3H03A 2R6GE 3OO9A 1Z7ME 1FQAA 2NXOA 3CFLA 3H06B 3RGYA 2Y7KA 2ZNTA 3CFZA 5FHOA 2Z23A 3M3FA 4RYAA 2F78A 5CBSA 1ELJA 3ECRA 4RY1A 2I4BA 2O69A 2FNCA 4PFWA 2ZYMA 2V3QA 1I69A 3MBPA 2G93A 2QL3A 3R26A 3QIMA 2R9JA 4TLMB 4X1DA 1XVYA 3O29A 3TPAA 2VHAA 3D4GA 1B58A 4XXUA 1MXVA 3GXAA 4AB6A 1N3XA 5H8SA 4N6PA 5H8QA 2QS1A 1B40A 5I2NA 1JVYA 2O68A 5KCJB 2B3FA 4P0GA 2CZLA 2UVIA 1A40A 1US5A 4ECFA 4DXUA 3DP4A 5AA4A 2GRVA 3IOTA 4OXVA 2AL4A 1XOCA 3U1OA 4ZDMA 2I0CA 3PPRA 5F7VA 1MY3A 4DCYA 4H0WA 1TXFA 5FTIA 4Q0CA 4BDLA 4KCDA 3BFTA 2QS4A 2HXWA 4DCXA 2DOJA 1QUIA 3O28A 4GQOA 3ODBA 2I0BA 4DE8A 1BLFA 4F2QA 3ZSFA 1DSNA 3O2AA 4ZEKA 2QMWA 3DP6A 3KBRA 1IUDA 2DSFA 4OFJA 1LAFE 4PE5B 3RTFB 5AE4A 5KDTB 4NTLA 3I6VA 4NF4B 3VE1B 4FE8A 1SBPA 4XKQA 1MDP1 1YAEA 4H1XA 1H44A 4MF3A 1Y1MA 3OEKA 5I56A 4F3BA 4EF1A 4Q30B 3TZAA 1I6AA 2RC9A 3MP6A 5IKBA 4X48A 3FZVA 3OENA 3TCGA 3KSXA 1B3FA 2H4IA 3MJNA 3KG2A 1POY1 1XC1A 4GFRA 3O6HA 1LB8A 3M8UA 1IEJA 2XHDA 1OVTA 2ZXTA 1OLAA 3GLBA 4G68B 1M5FA 3TMGA 3G3FA 2O6AA 4FIMA 4BLAA 3H7MA 3WAEA 3SKPA 3FASA 2F34A 5I58B 4Q5TA 2I3WA 4F1UA 3C4MA 1ZIUA 1UTHA 2H5YA 1A99A 4F22A 2OJTA 3N5LA 5DYHA 2Q89A 4NWCA 3RLFE 3EHTA 4ZEBA 3K6WA 4OESA 1OQGA 3N94A 4DXBA 4F2OA 2O1MA 3K1NA 2DS9A 3L6HA 4JWYA 4YKIA 2F6GA 1DTGA 3W9WA 3M3LA 4OEVA 4OERA 1ZLQA 3KZGA 4P0IA 1LCFA 1UTBA 1BKAA 1EZ9A 3M3KA 2IEEA 3V89B 1PB8A 2VOZA 3E4RA 3VFJA 3FATA 2XX8A 4LA9A 4GXAA 3DELB 1MQGA 1JVXA 2OBGA 1JNFA 3VVFA 5JEIA 5FTHA 4MBPA 5ISUA 3TUSA 1SW5A 2HQ0A 4GVOA 2F7BA 1B7HA 1LSTA 2ZNSA 1B5IA 1N3WA 1NFTA 1PDAA 5TU0A
chains in the Genus database with same CATH superfamily
4ZEDA 4EF2A 1B3GA 4G4PA 3AXFA 4LZ7A 3V5AA 3IR1A 1ATGA 3U92A 1URSA 1AMFA 1MH4A 3RYDA 4WXJA 4XKRA 4TOZA 1QVSA 3TQLA 2HAVA 4PDHA 4NF6A 2PMSA 1JEVA 2ZMBA 4FAJA 1ZU0A 1S7YA 4F1VA 3OO7A 2Z22A 2V3TA 3HFUA 3E78A 1M5EA 1SPIA 5H8FB 3U8QA 3U65A 4G8NA 2RINA 1CE2A 2OCUA 3CR9A 5DT6A 2FVZA 3RT6B 1MM6A 3FV2A 1II5A 4GWZA 4YB6A 3VDFA 3E13X 5JK4A 4Z7EA 3O66A 2Y7RA 4N6DA 3TTNA 1LBCA 3SEUA 4C0RA 4R72A 1FQCA 4U22A 4EDPA 3Q28A 4RNSA 4R6KA 3MVYA 3G3IA 2F6PA 1YPNA 4IO4A 4ZE8A 3KN7A 1DOTA 2I49A 2QJEA 5I2KB 4F3SA 3FVKA 1FPFA 4KPTA 1P1UA 3HHFA 4PAFA 1RYXA 5CI5A 3FV1A 1S50A 2XXKA 1RDXA 4HE0A 2PX1A 3PMWA 1EYIA 2Y5LA 1FBPA 1MQJA 2I6EA 4PE3A 2WYKA 1VR5A 4RXLA 1XS5A 4QFKA 3TEPA 5ITOA 1FPIA 1H3DA 1FW0A 2UYEA 2QS3A 4MX6A 2XWVA 2XXQA 4P3LA 4IB2A 3K01A 3TTKA 4PP0A 1MRPA 3C33A 2XD3A 1B5JA 1OQHA 3KBZA 3I3VA 4IY6A 4QFLA 2DWHA 4X9TA 3C32A 4N81A 4P56A 3B6QA 3PGFA 3MPKA 2I58A 3IX1A 2QPQA 5I57B 4RPNA 5I5PA 1H43A 4IO7A 5H8HA 3RQTA 1GTKA 2D5WA 3PPPA 2XXYA 1P1WA 2YJPA 1P1OA 4NX1A 4QSDA 4R9GA 3T9HB 1IMEA 2B4MA 5HM4B 4K3FA 1B32A 1IXHA 2ZYNA 2DWIA 3RPWA 3K2DA 1IMBA 1D3KA 1RYOA 2HZLA 3CI8A 3A29A 1LBBA 4FEDA 4JDFA 1IZ1A 1SQYA 4YICA 3IAZA 4OMBA 3TTLA 1MPDA 5BWJA 4LQ5A 2Y7IA 3SEXA 3MQ9A 2UXAA 3PUVE 2Y7PA 2LAOA 4XTCQ 1UIVA 3R6UA 4XFEA 3UGWA 3GYYA 4GWXA 1LFIA 5AA2A 3IB2A 2A5TA 4PFIA 3TTRA 5L9SA 3EHUA 5CMMA 3FIRA 1B0LA 2PT1A 1B3HA 3FJGA 4EXKA 5DTBA 1XHYA 1TWYA 1SI0A 1CB6A 2V25A 1T0KA 1LBWA 3OSRA 1JQFA 3ZKKA 3TFLA 4GL0A 4IO5A 5EHMA 2OWSA 3FXRA 1MY2A 4P9KA 1B9JA 1FCKA 1Y4TA 3CG1A 4RK9A 5I59B 3CG3A 4ELQA 1POTA 1SDXA 1A8FA 4U23A 4N4UA 2DE2A 4ZEFA 3Q25A 4GD5A 4OYVA 4U4XA 2XXVA 3QXMA 2RCBA 4OWDA 4MCOA 5DVFA 4NG7A 5H8NA 3GZGA 3HV1A 4LVQA 4NAPA 2DVZA 3T0JA 3OMBA 3EKIA 3HPIA 2DP8A 3FVNA 1NL5A 2F3BA 1O7TA 3EN3A 3PPQA 2REGA 4F3PA 1OVBA 3RPLB 1BIYA 3K1PA 4G8HA 4H67A 4R6YA 4NHBA 3LUYA 1UQWA 1PBPA 4H5FA 5CMCA 3OELA 1NH7A 1FPDA 1ZBMA 4PC9A 2Y7WA 1A54A 4OTEA 4EUOA 5TPAB 4MLQA 1FPEA 1FPJA 3B7DA 2RCAA 4HTGA 5IAIA 5HBCA 2FA7A 4JXIA 2B4LA 4ZE9A 2QMXA 1Y3NA 2ONRA 3LV0A 3TYHA 3IOVA 4MNPA 5IZ1A 3N26A 2RF1A 4Z0IA 3VXBA 4KFQA 4NN3A 2GHAA 4X1BA 2R71A 5B70A 3TTMA 1SYIA 4GRKA 3FVGA 4OETA 1WVJA 4AB5A 2ZYOA 3MWBA 3FXUA 1B05A 5DEXB 4NF0A 3T96B 4H8IA 3LSLA 4DLDA 1S9TA 2V4CA 1VE4A 4I1DA 1QJMA 4TQUQ 1QKAA 2HHMA 2I3VA 4OQOA 4KI0E 1FQFA 4RK2A 4QRZA 4HE2A 1GR2A 1XI6A 3EHSA 2P0SA 4PFBA 1FJ9A 1VFDA 3MZ9A 4NF8B 4THIA 3PV0E 1SYHA 1N04A 4LONB 4JB7A 1LFHA 1MPCA 2XXIA 4NEDA 2OZZA 1MXYA 2HAUA 3E9XA 5LTCA 1B7ZA 4LUBA 3T9XB 4HXVA 5JTYB 1URDA 5EQ8A 1WODA 1LAHE 5A5XB 4LZ5A 2GHBA 1G0IA 3SESA 1GV8A 3P7IA 1M5CA 1LFGA 1SW4A 4MJOA 4QF9A 4DI3D 2O7IA 3TQWA 4JWXA 2FYIA 2QSXA 3BFUA 4GIZA 4OENA 3OXNA 3T22A 1SD3A 2PBWA 3G7WA 4JVDA 4NWDA 1FBDA 1Z7NE 4ELPA 2ZNUA 1OIBA 4P8BA 4MFIA 4GL8A 3S9NC 4NF5B 3S9MC 1MH3A 4OHNA 2OLBA 2GH9A 3B6WA 3A3UA 3HHGA 1MXUA 3MSTA 1JP4A 1NUZA 3RPLA 5J1DA 5KCJA 4G2ZA 1D9YA 3Q29A 1LLSA 3C9HA 4QSEA 1P1QA 3IFAA 4U2RA 5FHMA 3TCFA 2DXRA 1NKXA 3PU5A 1AIVA 1LEVA 4HW8A 4GBVA 3WAFA 4ZZAA 3TODA 2Q9TA 2RKMA 4PBHA 2B3BA 4OVRA 4FECA 3U94A 2D21A 3MVZA 2OK2A 4GWSA 4M1VA 1DK4A 2Y5KA 1R9QA 4PFYA 1HSEA 2AL5A 3VXCA 4R9FA 4X04A 4GLIA 5EYGA 3K02A 4C1TA 1Y3QA 2YPNA 5LOMA 4MAGA 5KDTA 1QGXA 5TP9B 4NF4A 4NE4A 4UA8A 1B3LA 1QUKA 3G3KA 4N15A 3G3HA 3KFMA 1SW1A 2KLFA 3TELA 2H25A 4R75A 3OO6A 1LAXA 3G3GA 1B1XA 3QMFA 2HEUA 2V93A 3ISPA 4KYEA 4N8YA 2FHYA 2XX9A 2F7CA 3PD9A 3UP9A 4H8JA 5ICQA 1Q1KA 1FTAA 3SEYA 5CRYA 5AA1A 4O7MA 3W9VA 4O7IA 3IL1B 4MH5A 4GX4A 4MEVA 5ICTA 1LBXA 3MAMA 2X7PA 4YKJA 3TDJA 3FGSA 2O1LA 2XXPA 2PFYA 4Q8RA 4FEBA 2Z8FA 4ND9A 3ILUB 3SDFA 4PAKA 3C34A 1A7LA 1MY4A 2XXHA 3T93B 1SI1A 1R1NA 2PVUA 4G68A 3BKIB 2XXXA 1B1HA 3QSLA 4O3CA 2ALUA 3USDA 1FPLA 2Q8MA 2H99A 4IY5A 5I58A 1VSOA 4P1LA 4N91A 3OSQA 1DMBA 1AH5A 2HPGA 2VP1A 3EQ1A 2XWKA 4EXLA 2ZZVA 4LATA 5IZ3A 1Y20A 4N13A 3ROJA 4MMPA 1MDQA 4YZZA 5K2YA 4XKPA 1NUXA 3D4CA 4KYDA 5HPQA 4F1YA 2M8CA 5AA3A 3CSBA 1H76A 3B8BA 2HXRA 2P3NA 1B2HA 5I7IA 2QVUA 3LC8A 5H8QB 3D1RA 4FJPA 5T3JA 3TAJA 4RJZA 5I2NB 1DPEA 3SEVA 2O51A 2F5XA 4BDRA 2Z8DA 4KR5A 2DWJA 4EQBA 5DVIA 2AYSA 1IMAA 4L17A 3KN3A 2OWZA 4N8GA 5CMBA 1N76A 4YMAA 1FPGA 3RT8A 4DXCA 1B3EA 1NV1A 5AA4B 1O63A 1NV0A 1O64A 1Y9UA 3O6GA 5LDZA 3C35A 1MPBA 1Y4CA 4OVJA 5EHSA 4UACA 5M2VA 5ET5A 4QFOA 2WX9A 1D9VA 4H45A 4U4SA 4N17A 3MVWA 2PYYA 4ZECA 1VFEA 1ZKBA 1P99A 4PGNA 3UK4A 1B7UA 2O7UA 4C1UA 1Y3PA 4P1EA 1MY1A 4YB5A 3HN0A 2CZKA 4YAHX 3SERA 2RC7A 3H6UA 1J1NA 3VVDA 5H8FA 5I56B 3A3CA 1SVXB 1ZMGA 2F35A 4YU0A 3B6TA 2GQ1A 4LN5A 4MNIA 3S4UA 3C31A 3O9PA 3B50A 4GWWA 2CZHA 1LB9A 1IMCA 2VGQA 3L6GA 2OWTA 4EQ7A 2XD2A 1JETA 4KD5A 4PFTA 5KZTA 1BTJA 2ZYKA 1FBHA 2Q8JA 3RNNA 3SEWA 3THIA 5I2KA 4GXSB 1LAGE 2ZZWA 3KEIA 3K1MA 5ESYA 4BDNA 2VPOA 3PMVA 3K6UA 2WYPA 4XIGQ 1P1NA 1MG1A 4HCYA 5I84A 4PGPA 5F1QA 3LSXA 4JSDA 2F8DA 4IGTA 4XKNA 4YMBA 5FBPA 3MVXA 1ANFA 4WEPA 2QS2A 1UTHB 2P2AA 4OFOA 5FHNA 2XXUA 4QHQA 4OVQA 2UVGA 3MW0A 1NV5A 2X26A 4OEUA 1PEBA 3BIHA 3R7XA 2F36A 1NV7A 3EPEA 1L5TA 1DTZA 1A55A 3FJ7A 5DVJA 1GGGA 3MP1A 4MIJA 2GFEA 2NOOA 3TCHA 4IO3A 1YYZA 1UIUA 3KOTA 3SETA 1IMDA 4G68C 1GVCA 3QK6A 2DQVA 4U1OA 3GBAA 3IORA 3KSJA 5F24A 2AIXA 2DXYA 3TKDA 4AS4A 1UTBB 5EYHA 3IJXB 3ILTB 3A09A 1FPKA 1N0TA 5I57A 2VD2A 4GBWA 3IOWA 3PMXA 4H6DA 4GWYA 1B0HA 4PAIA 4UABA 4KQPA 3PUZE 1KWHA 4OANA 4JWOA 2Y84A 1K9YA 4GWOA 4GWUA 2B65A 1XT8A 3IB1A 1TFDA 4POWA 3MZ1A 3MP8A 2VT5A 2ONSA 4QFPA 3LSWA 4U1ZA 1LBVA 3FJMA 1YTVA 3KGCA 3VLVA 4PQJA 3K00A 4I8CA 3PPOA 2NWJA 1DBZA 3DLNA 1M5DA 4AQ4A 2QFLA 1N7XA 3IO6A 2PFZA 4NF6B 1IITA 2DDKA 1WDNA 4F19A 1EH3A 1Q9DA 1M5BA 1USYH 3ZS6A 3H4ZA 4LP2B 1YCJA 4WEDA 2WKYA 4YKPA 4ZS9A 3SZPA 4R6HA 1HSLA 4POXA 2E1SA 1DPPA 4H5GA 4I62A 4XF5A 4E0XA 1D4NA 4ELRA 2BJJX 1NNKA 2HCAA 4F3GA 1QUJA 1B52A 4IO6A 4NGUA 3E79A 5K2XA 4IR8A 2I4CA 4U21A 5ITPA 4DDDA 1MXXA 1HSJA 4BDOA 3K6VA 1QULA 2QRYA 1FQEA 3VVEA 1Y1ZA 4ZZEA 1IXCA 3HCQA 1R6ZA 4KYSA 2REJA 3S9EA 4H46A 1BK4A 3QYTA 5I59A 1FTJA 3H3GA 3K0VA 1B6HA 1FBFA 3KN8A 1B4HA 3F11A 1MQDA 3N6TA 3LR1A 1A8EA 1B46A 1H45A 4BDMA 1FTKA 4GF8A 3GBBA 4TLLB 2FIXA 1N7WA 4F31B 3QUJA 3MC2A 4R73A 3EF7A 5ET7A 2Q88A 3T66A 1USYE 4QSCA 3QAXA 4R2FA 4GOTA 3VLUA 2HZKA 2F7AA 2VD3A 4YKKA 1IQ7A 3S2VA 4G77A 1QKBA 2KQZA 2HFBA 4DIGA 3K4UA 4M4GA 3UORA 3IB0A 1LBYA 2DE3A 1EU8A 2ANJA 2UVJA 4I40A 1XVXA 2F97A 3OD7A 3FXBA 2I48A 5AA2D 4OZ9A 3CSGA 2PT2A 3HSTA 2G29A 3FUZA 5CC2A 2RC8A 3H6TA 1OLCA 2MKZA 2ONKE 2H98A 1R9LA 2XXRA 3PUWE 5EYFA 5TPAA 3RUMA 3N6UA 4ONYA 3MUQA 3VLWA 1CNQA 5H8HB 3RY3A 2A5SA 1NV6A 3H6WA 4ELOA 4PTKA 1D9QA 3FVOA 5L9MA 4JVCA 1KZ8A 2DE4A 1MS7A 2V84A 3UA8A 4MNCA 4PF8A 1NMUA 3KJ7A 3VV5A 1FTLA 1FQBA 4ESXA 2XXWA 1JW1A 2NUVA 3RTWB 1NV4A 4QBAA 3DP8A 4QFNA 3IJOB 4LZ8A 2VPNA 3LSFB 5DW8A 2ABHA 3LUZA 2NVUB 5DEXA 3K6XA 3ONMA 4PFRA 5EQ9A 1JEUA 1FTMA 1IXGA 2L5VA 4R74A 1VDWA 3FXQA 3T9VA 3PUYE 2DWAA 1QW0A 4F29A 5L8DA 3UN6A 3MPLA 1EZOA 5AA2B 2A5TB 3KJTA 2D3IA 1ZTYA 3OO8A 4ZEIA 4P11A 1EYJA 2XWOA 3CHGA 3E3KA 4NF8A 4OFLA 2WBDA 2CEYA 3LBSA 3G3JA 1B51A 3KC0A 1K9ZA 4F18A 4R2BA 1BP5A 4N07A 3BBRA 3T9UA 1MY0A 5JTYA 1ZJLA 3MYUA 5CMKA 1MXZA 5I3SA 3RN8A 5A5XA 1FQDA 2IA4A 3PTYA 4F39A 1INPA 4BDQA 2DVCA 2V3UA 4DZ1A 4NQ8A 5B7DA 3MZBA 1FBEA 4ISUA 2CMOA 5BUUA 1NUYA 2X7QA 1AOVA 4E0WA 3S9LC 2Q2AA 4I9DA 4IO2A 1PC3A 1KA1A 3IK6B 2O84X 4P47A 4YB7A 4ESWA 3U93A 4I3YA 3HO7A 1NH8A 4PFUA 2H9BA 2WEFA 2XXTA 1LGBC 4FORA 3PUXE 4O94A 2UVHA 5H8NB 1FRPA 1Q35A 4NF5A 2CEXA 5L9OA 3QUFA 3UIFA 1JW5A 5CM6A 3C36A 3CIJA 1SW2A 1FBGA 1F9BA 2BJIA 1OMPA 1PBQA 2E0SA 3H6VA 3CRBA 3KOSA 4IGRA 3W15C 4G8MA 3PD8A 4NMYA 1N84A 3JZJA 4I3EA 3U72A 1FTOA 1MQHA 3OOAA 4LQ2A 4JBZA 4H65A 2Q2CA 3Q27A 4KXPA 1US4A 2Q74A 2WBBA 4PETA 2Z8EA 4HS7A 4MLVA 1TT1A 2ESNA 4O3BA 4WKMA 1PB7A 1IIWA 1LCTA 1MQIA 4RPOA 3V83A 3V8XB 1NNPA 3IOUA 1MXWA 4HCWA 1NNFA 1B4ZA 2P1SA 3FD3A 3ZKLA 3OEMA 3PPNA 2PCRA 5CBRA 3CFXA 1TFAA 3JYRA 1EZPA 4FATA 3Q26A 2UYFA 2THIA 3JV9A 3DM0A 1JW4A 5TP9A 2OX3A 2XX7A 1B5HA 4O3AA 1URGA 3IO4A 4KHZE 3O97A 1NNTA 4KCCA 4G61A 2W7YA 4N6KA 3O6IA 2DYXA 1PB9A 4JSOA 3I5OA 3T1BA 3KC1A 1MM7A 1FJ6A 3FBPA 5ELVA 1RKMA 1IXIA 1FSAA 2ZZXA 5ET6A 2R8TA 1I6QA 1I6BA 4RA1A 2JJKA 4EQ9A 3CVGA 1AL3A 2YLNA 3H03A 1KA0A 2R6GE 3OO9A 1NUWA 4AS5A 4JVIA 1Z7ME 1FQAA 1EYKA 2NXOA 3CFLA 3H06B 3RGYA 2Y7KA 1RDZA 2ZNTA 3CFZA 5FHOA 2Z23A 3M3FA 4RYAA 2F78A 5CBSA 1ELJA 4PDDA 3ECRA 4RY1A 2I4BA 5A5LA 2O69A 2XA5A 2FNCA 1RDYA 4PFWA 2ZYMA 2V3QA 1I69A 3MBPA 5IGAA 5ET8A 2G93A 2QL3A 3R26A 3QIMA 2R9JA 4TLMB 4X1DA 1XVYA 3O29A 3TPAA 2VHAA 3D4GA 4FBPA 1B58A 1NI9A 4XXUA 1MXVA 2CZIA 3GXAA 1IMFA 4AB6A 1N3XA 5H8SA 4HE1A 4N6PA 5H8QA 2QS1A 1B40A 5I2NA 1DCUA 1JVYA 2O68A 5KCJB 2B3FA 4P0GA 2CZLA 2UVIA 1A40A 1US5A 4ECFA 1G0HA 4X8RA 4DXUA 3DP4A 4QXDA 5EQ7A 5J16A 1YXIA 5AA4A 2GRVA 2FBPA 3IOTA 4OXVA 2AL4A 1XOCA 3U1OA 4ZDMA 2I0CA 3PPRA 5F7VA 1MY3A 4DCYA 4H0WA 1TXFA 5FTIA 4Q0CA 4BDLA 4PCDA 3BIGA 4KCDA 3BFTA 2QS4A 2HXWA 4DCXA 2DOJA 1QUIA 3O28A 4GQOA 3ODBA 2I0BA 4PBQA 4MHFA 4DE8A 1BLFA 4F2QA 3ZSFA 3IFCA 1DSNA 2FIEA 2P3VA 3O2AA 4ZEKA 2QMWA 3DP6A 4O8MA 3KBRA 5EQAA 1IUDA 2DSFA 4OFJA 1LAFE 4PE5B 4GX3A 3RTFB 5AE4A 5KDTB 4NTLA 3I6VA 4NF4B 3VE1B 4FE8A 1SBPA 4XKQA 1FBCA 2QVVA 1MDP1 1YAEA 4H1XA 2XWIA 2KR0A 1H44A 4MF3A 1Y1MA 2QVRA 3OEKA 5I56A 4F3BA 4EF1A 4Q30B 3TZAA 1I6AA 4GX6A 2RC9A 3MP6A 1YZ0A 5IKBA 4X48A 3FZVA 3OENA 3TCGA 3KSXA 1B3FA 2H4IA 4XEQA 3MJNA 3KG2A 1POY1 1XC1A 4GFRA 1AWBA 3O6HA 1LB8A 3M8UA 1FPBA 1IEJA 2XHDA 1OVTA 2ZXTA 1OLAA 3GLBA 4G68B 1M5FA 3TMGA 4OVTA 3G3FA 2O6AA 4FIMA 4DI4B 4BLAA 3H7MA 3WAEA 3SKPA 3FASA 2F34A 5I58B 4Q5TA 2I3WA 4F1UA 4OA4A 3C4MA 1ZIUA 1UTHA 2H5YA 1A99A 4F22A 2OJTA 3N5LA 5DYHA 5IZ3B 2Q89A 5IZZA 4NWCA 3RLFE 3EHTA 4ZEBA 3K6WA 4OESA 1OQGA 3N94A 4DXBA 4F2OA 2O1MA 3K1NA 2DS9A 3L6HA 4JWYA 4YKIA 2F6GA 5IM2A 1DTGA 3W9WA 3M3LA 3NOHA 4OEVA 4OERA 1ZLQA 3KZGA 4P0IA 1LCFA 1UTBA 1BKAA 1EZ9A 3M3KA 2IEEA 3V89B 1PB8A 1LBZA 2VOZA 3E4RA 3VFJA 1NV3A 3FATA 2XX8A 4LA9A 4GXAA 3DELB 4OVSA 1MQGA 1JVXA 2OBGA 1JNFA 3VVFA 5JEIA 5FTHA 4MBPA 5ISUA 2F3DA 3TUSA 4OVPA 1SW5A 2HQ0A 4GVOA 2F7BA 1B7HA 4PF6A 1LSTA 1NV2A 2ZNSA 1B5IA 1N3WA 1NFTA 1PDAA 5TU0A
chains in the Genus database with same CATH topology
4ZEDA 4EF2A 1B3GA 4G4PA 3AXFA 4LZ7A 3V5AA 3IR1A 1ATGA 3U92A 1URSA 1AMFA 1MH4A 4WXJA 4XKRA 4TOZA 1QVSA 3TQLA 2HAVA 4NF6A 2PMSA 1JEVA 2ZMBA 4FAJA 1ZU0A 1S7YA 4F1VA 3OO7A 2Z22A 2V3TA 1M5EA 5H8FB 3U8QA 4G8NA 2RINA 1CE2A 2OCUA 3CR9A 5DT6A 3RT6B 1MM6A 3FV2A 1II5A 4YB6A 3VDFA 3E13X 5JK4A 4Z7EA 3O66A 2Y7RA 3TTNA 1LBCA 3SEUA 4C0RA 4R72A 1FQCA 4U22A 4EDPA 3Q28A 4RNSA 4R6KA 3MVYA 3G3IA 2F6PA 1YPNA 4IO4A 4ZE8A 3KN7A 1DOTA 2I49A 2QJEA 5I2KB 4F3SA 3FVKA 4KPTA 1P1UA 3HHFA 1RYXA 5CI5A 3FV1A 1S50A 2PX1A 3PMWA 1MQJA 2I6EA 1VR5A 4RXLA 1XS5A 4QFKA 3TEPA 5ITOA 1H3DA 1FW0A 2UYEA 2QS3A 2XXQA 4IB2A 3K01A 3TTKA 4PP0A 1MRPA 3C33A 2XD3A 1B5JA 1OQHA 3I3VA 4IY6A 4QFLA 2DWHA 4X9TA 3C32A 3B6QA 3PGFA 3MPKA 2I58A 3IX1A 2QPQA 5I57B 4RPNA 1H43A 4IO7A 5H8HA 3RQTA 1GTKA 2D5WA 3PPPA 2XXYA 1P1WA 2YJPA 1P1OA 4QSDA 4R9GA 3T9HB 5HM4B 4K3FA 1B32A 1IXHA 2ZYNA 2DWIA 3RPWA 3K2DA 1D3KA 1RYOA 2HZLA 3CI8A 1LBBA 4FEDA 4JDFA 1IZ1A 1SQYA 4YICA 3IAZA 4OMBA 3TTLA 1MPDA 5BWJA 4LQ5A 2Y7IA 3SEXA 3MQ9A 2UXAA 3PUVE 2Y7PA 2LAOA 4XTCQ 1UIVA 3R6UA 3UGWA 1LFIA 5AA2A 3IB2A 2A5TA 3TTRA 5L9SA 3EHUA 5CMMA 3FIRA 1B0LA 2PT1A 1B3HA 3FJGA 4EXKA 5DTBA 1XHYA 1TWYA 1SI0A 1CB6A 2V25A 1T0KA 3OSRA 1JQFA 3ZKKA 3TFLA 4GL0A 4IO5A 5EHMA 2OWSA 3FXRA 1MY2A 1B9JA 1FCKA 1Y4TA 3CG1A 4RK9A 5I59B 3CG3A 4ELQA 1POTA 1SDXA 1A8FA 4U23A 2DE2A 4ZEFA 3Q25A 4GD5A 4OYVA 4U4XA 2XXVA 3QXMA 2RCBA 4OWDA 5DVFA 5H8NA 3GZGA 3HV1A 4LVQA 2DVZA 3OMBA 3HPIA 2DP8A 3FVNA 1NL5A 1O7TA 3EN3A 3PPQA 2REGA 4F3PA 1OVBA 1BIYA 3K1PA 4G8HA 4H67A 4R6YA 3LUYA 1UQWA 1PBPA 4H5FA 5CMCA 3OELA 1NH7A 1ZBMA 2Y7WA 1A54A 4OTEA 4EUOA 5TPAB 4MLQA 3B7DA 2RCAA 4HTGA 5IAIA 5HBCA 2FA7A 4JXIA 4ZE9A 2QMXA 1Y3NA 2ONRA 3TYHA 3IOVA 3N26A 2RF1A 4Z0IA 3VXBA 4KFQA 2GHAA 4X1BA 2R71A 5B70A 3TTMA 1SYIA 4GRKA 3FVGA 4OETA 1WVJA 4AB5A 2ZYOA 3MWBA 3FXUA 1B05A 5DEXB 3T96B 4H8IA 3LSLA 4DLDA 1S9TA 1VE4A 4I1DA 1QJMA 4TQUQ 1QKAA 2I3VA 4OQOA 4KI0E 1FQFA 4RK2A 4QRZA 1GR2A 3EHSA 2P0SA 1VFDA 3MZ9A 4NF8B 4THIA 3PV0E 1SYHA 1N04A 4LONB 4JB7A 1LFHA 1MPCA 2XXIA 4NEDA 2OZZA 1MXYA 2HAUA 3E9XA 1B7ZA 4LUBA 3T9XB 5JTYB 1URDA 1WODA 1LAHE 5A5XB 4LZ5A 2GHBA 3SESA 1GV8A 3P7IA 1M5CA 1LFGA 1SW4A 4QF9A 2O7IA 3TQWA 4JWXA 2FYIA 2QSXA 3BFUA 4GIZA 4OENA 3OXNA 3T22A 1SD3A 2PBWA 3G7WA 4NWDA 1Z7NE 4ELPA 2ZNUA 1OIBA 4MFIA 4GL8A 3S9NC 4NF5B 3S9MC 1MH3A 4OHNA 2OLBA 2GH9A 3B6WA 3A3UA 3HHGA 1MXUA 5J1DA 5KCJA 4G2ZA 1D9YA 3Q29A 1LLSA 3C9HA 4QSEA 1P1QA 4U2RA 5FHMA 3TCFA 2DXRA 1NKXA 3PU5A 1AIVA 4HW8A 3WAFA 4ZZAA 3TODA 2Q9TA 2RKMA 2B3BA 4FECA 3U94A 2D21A 3MVZA 2OK2A 4M1VA 1R9QA 4PFYA 1HSEA 2AL5A 3VXCA 4R9FA 4GLIA 3K02A 4C1TA 1Y3QA 2YPNA 5LOMA 5KDTA 5TP9B 4NF4A 4NE4A 4UA8A 1B3LA 1QUKA 3G3KA 3G3HA 3KFMA 1SW1A 2KLFA 3TELA 2H25A 4R75A 3OO6A 1LAXA 3G3GA 1B1XA 2HEUA 2V93A 4KYEA 2XX9A 2F7CA 3PD9A 3UP9A 4H8JA 5ICQA 1Q1KA 3SEYA 5CRYA 5AA1A 3W9VA 3IL1B 4MH5A 5ICTA 3MAMA 2X7PA 4YKJA 3TDJA 3FGSA 2O1LA 2XXPA 4Q8RA 4FEBA 2Z8FA 4ND9A 3ILUB 3SDFA 3C34A 1A7LA 1MY4A 2XXHA 3T93B 1SI1A 1R1NA 2PVUA 4G68A 3BKIB 2XXXA 1B1HA 3QSLA 4O3CA 2ALUA 3USDA 2H99A 4IY5A 5I58A 1VSOA 3OSQA 1DMBA 1AH5A 2VP1A 3EQ1A 4EXLA 4LATA 1Y20A 4N13A 1MDQA 4YZZA 5K2YA 4XKPA 3D4CA 4KYDA 5HPQA 4F1YA 2M8CA 5AA3A 3CSBA 1H76A 1B2HA 3LC8A 5H8QB 4FJPA 3TAJA 4RJZA 5I2NB 1DPEA 3SEVA 2O51A 2F5XA 4BDRA 2Z8DA 4KR5A 2DWJA 4EQBA 5DVIA 2AYSA 4L17A 3KN3A 5CMBA 1N76A 4YMAA 3RT8A 4DXCA 1B3EA 5AA4B 1O63A 1O64A 1Y9UA 3O6GA 3C35A 1MPBA 1Y4CA 4OVJA 5EHSA 4UACA 5M2VA 4QFOA 1D9VA 4U4SA 3MVWA 2PYYA 4ZECA 1VFEA 1ZKBA 1P99A 3UK4A 1B7UA 2O7UA 4C1UA 1Y3PA 1MY1A 4YB5A 3HN0A 4YAHX 3SERA 2RC7A 3H6UA 1J1NA 3VVDA 5H8FA 5I56B 3A3CA 1SVXB 1ZMGA 2F35A 4YU0A 3B6TA 3S4UA 3C31A 3O9PA 1LB9A 2VGQA 3L6GA 2OWTA 4EQ7A 2XD2A 1JETA 4KD5A 4PFTA 5KZTA 1BTJA 2ZYKA 2Q8JA 3RNNA 3SEWA 3THIA 5I2KA 4GXSB 1LAGE 3KEIA 3K1MA 4BDNA 3PMVA 3K6UA 4XIGQ 1P1NA 1MG1A 4HCYA 5I84A 5F1QA 3LSXA 4JSDA 2F8DA 4IGTA 4XKNA 4YMBA 3MVXA 1ANFA 4WEPA 2QS2A 1UTHB 2P2AA 4OFOA 5FHNA 2XXUA 4QHQA 2UVGA 3MW0A 2X26A 4OEUA 1PEBA 3R7XA 2F36A 3EPEA 1L5TA 1DTZA 1A55A 3FJ7A 5DVJA 1GGGA 3MP1A 2GFEA 2NOOA 3TCHA 4IO3A 1UIUA 3KOTA 3SETA 4G68C 1GVCA 3QK6A 2DQVA 4U1OA 3GBAA 3IORA 3KSJA 2AIXA 2DXYA 3TKDA 1UTBB 3IJXB 3ILTB 3A09A 1N0TA 5I57A 2VD2A 3IOWA 3PMXA 4H6DA 1B0HA 4KQPA 3PUZE 1KWHA 4JWOA 2Y84A 4GWOA 2B65A 1XT8A 3IB1A 1TFDA 4POWA 3MZ1A 3MP8A 2ONSA 4QFPA 3LSWA 4U1ZA 3FJMA 1YTVA 3KGCA 3VLVA 4PQJA 3K00A 4I8CA 3PPOA 2NWJA 3DLNA 1M5DA 4AQ4A 1N7XA 3IO6A 4NF6B 1IITA 1WDNA 4F19A 1EH3A 1M5BA 1USYH 3ZS6A 3H4ZA 4LP2B 1YCJA 4WEDA 2WKYA 4YKPA 4ZS9A 4R6HA 1HSLA 4POXA 2E1SA 1DPPA 4H5GA 4I62A 4E0XA 1D4NA 4ELRA 2BJJX 1NNKA 2HCAA 4F3GA 1QUJA 1B52A 4IO6A 5K2XA 2I4CA 4U21A 5ITPA 4DDDA 1MXXA 1HSJA 4BDOA 3K6VA 1QULA 2QRYA 1FQEA 3VVEA 1Y1ZA 4ZZEA 1IXCA 3HCQA 1R6ZA 4KYSA 2REJA 3S9EA 3QYTA 5I59A 1FTJA 3H3GA 3K0VA 1B6HA 3KN8A 1B4HA 3F11A 1MQDA 3N6TA 3LR1A 1A8EA 1B46A 1H45A 4BDMA 1FTKA 4GF8A 3GBBA 4TLLB 4F31B 1N7WA 3QUJA 3MC2A 4R73A 3EF7A 2Q88A 3T66A 1USYE 4QSCA 3QAXA 4R2FA 4GOTA 3VLUA 2HZKA 2F7AA 2VD3A 4YKKA 1IQ7A 3S2VA 4G77A 1QKBA 2HFBA 4DIGA 3K4UA 4M4GA 3UORA 3IB0A 2DE3A 1EU8A 2ANJA 2UVJA 1XVXA 2F97A 3OD7A 2I48A 5AA2D 4OZ9A 3CSGA 2PT2A 3HSTA 2G29A 3FUZA 5CC2A 2RC8A 3H6TA 1OLCA 2ONKE 2H98A 1R9LA 2XXRA 3PUWE 5EYFA 5TPAA 3RUMA 3N6UA 4ONYA 3MUQA 3VLWA 5H8HB 3RY3A 2A5SA 3H6WA 4ELOA 3FVOA 5L9MA 2DE4A 1MS7A 2V84A 3UA8A 1NMUA 3KJ7A 3VV5A 1FTLA 1FQBA 4ESXA 2XXWA 1JW1A 2NUVA 3RTWB 3DP8A 4QFNA 3IJOB 4LZ8A 3LSFB 2ABHA 2NVUB 5DEXA 3K6XA 3ONMA 1JEUA 1FTMA 1IXGA 4R74A 3FXQA 3T9VA 3PUYE 2DWAA 1QW0A 4F29A 5L8DA 3UN6A 3MPLA 1EZOA 5AA2B 2A5TB 3KJTA 2D3IA 1ZTYA 3OO8A 4ZEIA 4P11A 3E3KA 4NF8A 4OFLA 3LBSA 3G3JA 1B51A 4F18A 4R2BA 1BP5A 4N07A 3BBRA 3T9UA 1MY0A 5JTYA 1ZJLA 5CMKA 1MXZA 3RN8A 5A5XA 1FQDA 2IA4A 4F39A 4BDQA 2DVCA 2V3UA 4DZ1A 5B7DA 3MZBA 4ISUA 2CMOA 5BUUA 2X7QA 1AOVA 4E0WA 3S9LC 2Q2AA 4I9DA 4IO2A 1PC3A 3IK6B 2O84X 4YB7A 4ESWA 3U93A 3HO7A 1NH8A 4PFUA 2H9BA 2XXTA 1LGBC 4FORA 3PUXE 5H8NB 2UVHA 1Q35A 4NF5A 5L9OA 3QUFA 3UIFA 1JW5A 5CM6A 3C36A 3CIJA 1SW2A 1F9BA 1OMPA 1PBQA 2E0SA 3H6VA 3CRBA 3KOSA 4IGRA 3W15C 4G8MA 3PD8A 4NMYA 1N84A 3JZJA 3U72A 1FTOA 1MQHA 3OOAA 4LQ2A 4JBZA 4H65A 2Q2CA 3Q27A 1US4A 4PETA 2Z8EA 4HS7A 4MLVA 1TT1A 2ESNA 4O3BA 4WKMA 1PB7A 1IIWA 1LCTA 1MQIA 4RPOA 3V83A 3V8XB 1NNPA 3IOUA 1MXWA 4HCWA 1NNFA 1B4ZA 2P1SA 3FD3A 3ZKLA 3OEMA 3PPNA 5CBRA 3CFXA 1TFAA 3JYRA 1EZPA 4FATA 3Q26A 2UYFA 2THIA 3JV9A 3DM0A 1JW4A 5TP9A 2XX7A 1B5HA 4O3AA 1URGA 3IO4A 4KHZE 3O97A 1NNTA 4KCCA 2W7YA 3O6IA 2DYXA 1PB9A 4JSOA 3I5OA 1MM7A 5ELVA 1RKMA 1IXIA 1I6QA 1I6BA 4RA1A 4EQ9A 3CVGA 1AL3A 2YLNA 3H03A 2R6GE 3OO9A 1Z7ME 1FQAA 2NXOA 3CFLA 3H06B 3RGYA 2Y7KA 2ZNTA 3CFZA 5FHOA 2Z23A 3M3FA 4RYAA 2F78A 5CBSA 1ELJA 3ECRA 4RY1A 2I4BA 2O69A 2FNCA 4PFWA 2ZYMA 2V3QA 1I69A 3MBPA 2G93A 2QL3A 3R26A 3QIMA 2R9JA 4TLMB 4X1DA 1XVYA 3O29A 3TPAA 2VHAA 3D4GA 1B58A 4XXUA 1MXVA 3GXAA 4AB6A 1N3XA 5H8SA 4N6PA 5H8QA 2QS1A 1B40A 5I2NA 1JVYA 2O68A 5KCJB 2B3FA 4P0GA 2CZLA 2UVIA 1A40A 1US5A 4ECFA 4DXUA 3DP4A 5AA4A 2GRVA 3IOTA 4OXVA 2AL4A 1XOCA 3U1OA 4ZDMA 2I0CA 3PPRA 5F7VA 1MY3A 4DCYA 4H0WA 1TXFA 5FTIA 4Q0CA 4BDLA 4KCDA 3BFTA 2QS4A 2HXWA 4DCXA 2DOJA 1QUIA 3O28A 4GQOA 3ODBA 2I0BA 4DE8A 1BLFA 4F2QA 3ZSFA 1DSNA 3O2AA 4ZEKA 2QMWA 3DP6A 3KBRA 1IUDA 2DSFA 4OFJA 1LAFE 4PE5B 3RTFB 5AE4A 5KDTB 4NTLA 3I6VA 4NF4B 3VE1B 4FE8A 1SBPA 4XKQA 1MDP1 1YAEA 4H1XA 1H44A 4MF3A 1Y1MA 3OEKA 5I56A 4F3BA 4EF1A 4Q30B 3TZAA 1I6AA 2RC9A 3MP6A 5IKBA 4X48A 3FZVA 3OENA 3TCGA 3KSXA 1B3FA 2H4IA 3MJNA 3KG2A 1POY1 1XC1A 4GFRA 3O6HA 1LB8A 3M8UA 1IEJA 2XHDA 1OVTA 2ZXTA 1OLAA 3GLBA 4G68B 1M5FA 3TMGA 3G3FA 2O6AA 4FIMA 4BLAA 3H7MA 3WAEA 3SKPA 3FASA 2F34A 5I58B 4Q5TA 2I3WA 4F1UA 3C4MA 1ZIUA 1UTHA 2H5YA 1A99A 4F22A 2OJTA 3N5LA 5DYHA 2Q89A 4NWCA 3RLFE 3EHTA 4ZEBA 3K6WA 4OESA 1OQGA 3N94A 4DXBA 4F2OA 2O1MA 3K1NA 2DS9A 3L6HA 4JWYA 4YKIA 2F6GA 1DTGA 3W9WA 3M3LA 4OEVA 4OERA 1ZLQA 3KZGA 4P0IA 1LCFA 1UTBA 1BKAA 1EZ9A 3M3KA 2IEEA 3V89B 1PB8A 2VOZA 3E4RA 3VFJA 3FATA 2XX8A 4LA9A 4GXAA 3DELB 1MQGA 1JVXA 2OBGA 1JNFA 3VVFA 5JEIA 5FTHA 4MBPA 5ISUA 3TUSA 1SW5A 2HQ0A 4GVOA 2F7BA 1B7HA 1LSTA 2ZNSA 1B5IA 1N3WA 1NFTA 1PDAA 5TU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZED A;  4EF2 A;  1B3G A;  4G4P A;  3AXF A;  4LZ7 A;  3V5A A;  3IR1 A;  1ATG A;  3U92 A;  1URS A;  1AMF A;  1MH4 A;  4WXJ A;  4XKR A;  4TOZ A;  1QVS A;  3TQL A;  2HAV A;  4NF6 A;  2PMS A;  1JEV A;  2ZMB A;  4FAJ A;  1ZU0 A;  1S7Y A;  4F1V A;  3OO7 A;  2Z22 A;  2V3T A;  1M5E A;  5H8F B;  3U8Q A;  4G8N A;  2RIN A;  1CE2 A;  2OCU A;  3CR9 A;  5DT6 A;  3RT6 B;  1MM6 A;  3FV2 A;  1II5 A;  4YB6 A;  3VDF A;  3E13 X;  5JK4 A;  4Z7E A;  3O66 A;  2Y7R A;  3TTN A;  1LBC A;  3SEU A;  4C0R A;  4R72 A;  1FQC A;  4U22 A;  4EDP A;  3Q28 A;  4RNS A;  4R6K A;  3MVY A;  3G3I A;  2F6P A;  1YPN A;  4IO4 A;  4ZE8 A;  3KN7 A;  1DOT A;  2I49 A;  2QJE A;  5I2K B;  4F3S A;  3FVK A;  4KPT A;  1P1U A;  3HHF A;  1RYX A;  5CI5 A;  3FV1 A;  1S50 A;  2PX1 A;  3PMW A;  1MQJ A;  2I6E A;  1VR5 A;  4RXL A;  1XS5 A;  4QFK A;  3TEP A;  5ITO A;  1H3D A;  1FW0 A;  2UYE A;  2QS3 A;  2XXQ A;  4IB2 A;  3K01 A;  3TTK A;  4PP0 A;  1MRP A;  3C33 A;  2XD3 A;  1B5J A;  1OQH A;  3I3V A;  4IY6 A;  4QFL A;  2DWH A;  4X9T A;  3C32 A;  3B6Q A;  3PGF A;  3MPK A;  2I58 A;  3IX1 A;  2QPQ A;  5I57 B;  4RPN A;  1H43 A;  4IO7 A;  5H8H A;  3RQT A;  1GTK A;  2D5W A;  3PPP A;  2XXY A;  1P1W A;  2YJP A;  1P1O A;  4QSD A;  4R9G A;  3T9H B;  5HM4 B;  4K3F A;  1B32 A;  1IXH A;  2ZYN A;  2DWI A;  3RPW A;  3K2D A;  1D3K A;  1RYO A;  2HZL A;  3CI8 A;  1LBB A;  4FED A;  4JDF A;  1IZ1 A;  1SQY A;  4YIC A;  3IAZ A;  4OMB A;  3TTL A;  1MPD A;  5BWJ A;  4LQ5 A;  2Y7I A;  3SEX A;  3MQ9 A;  2UXA A;  3PUV E;  2Y7P A;  2LAO A;  4XTC Q;  1UIV A;  3R6U A;  3UGW A;  1LFI A;  5AA2 A;  3IB2 A;  2A5T A;  3TTR A;  5L9S A;  3EHU A;  5CMM A;  3FIR A;  1B0L A;  2PT1 A;  1B3H A;  3FJG A;  4EXK A;  5DTB A;  1XHY A;  1TWY A;  1SI0 A;  1CB6 A;  2V25 A;  1T0K A;  3OSR A;  1JQF A;  3ZKK A;  3TFL A;  4GL0 A;  4IO5 A;  5EHM A;  2OWS A;  3FXR A;  1MY2 A;  1B9J A;  1FCK A;  1Y4T A;  3CG1 A;  4RK9 A;  5I59 B;  3CG3 A;  4ELQ A;  1POT A;  1SDX A;  1A8F A;  4U23 A;  2DE2 A;  4ZEF A;  3Q25 A;  4GD5 A;  4OYV A;  4U4X A;  2XXV A;  3QXM A;  2RCB A;  4OWD A;  5DVF A;  5H8N A;  3GZG A;  3HV1 A;  4LVQ A;  2DVZ A;  3OMB A;  3HPI A;  2DP8 A;  3FVN A;  1NL5 A;  1O7T A;  3EN3 A;  3PPQ A;  2REG A;  4F3P A;  1OVB A;  1BIY A;  3K1P A;  4G8H A;  4H67 A;  4R6Y A;  3LUY A;  1UQW A;  1PBP A;  4H5F A;  5CMC A;  3OEL A;  1NH7 A;  1ZBM A;  2Y7W A;  1A54 A;  4OTE A;  4EUO A;  5TPA B;  4MLQ A;  3B7D A;  2RCA A;  4HTG A;  5IAI A;  5HBC A;  2FA7 A;  4JXI A;  4ZE9 A;  2QMX A;  1Y3N A;  2ONR A;  3TYH A;  3IOV A;  3N26 A;  2RF1 A;  4Z0I A;  3VXB A;  4KFQ A;  2GHA A;  4X1B A;  2R71 A;  5B70 A;  3TTM A;  1SYI A;  4GRK A;  3FVG A;  4OET A;  1WVJ A;  4AB5 A;  2ZYO A;  3MWB A;  3FXU A;  1B05 A;  5DEX B;  3T96 B;  4H8I A;  3LSL A;  4DLD A;  1S9T A;  1VE4 A;  4I1D A;  1QJM A;  4TQU Q;  1QKA A;  2I3V A;  4OQO A;  4KI0 E;  1FQF A;  4RK2 A;  4QRZ A;  1GR2 A;  3EHS A;  2P0S A;  1VFD A;  3MZ9 A;  4NF8 B;  4THI A;  3PV0 E;  1SYH A;  1N04 A;  4LON B;  4JB7 A;  1LFH A;  1MPC A;  2XXI A;  4NED A;  2OZZ A;  1MXY A;  2HAU A;  3E9X A;  1B7Z A;  4LUB A;  3T9X B;  5JTY B;  1URD A;  1WOD A;  1LAH E;  5A5X B;  4LZ5 A;  2GHB A;  3SES A;  1GV8 A;  3P7I A;  1M5C A;  1LFG A;  1SW4 A;  4QF9 A;  2O7I A;  3TQW A;  4JWX A;  2FYI A;  2QSX A;  3BFU A;  4GIZ A;  4OEN A;  3OXN A;  3T22 A;  1SD3 A;  2PBW A;  3G7W A;  4NWD A;  1Z7N E;  4ELP A;  2ZNU A;  1OIB A;  4MFI A;  4GL8 A;  3S9N C;  4NF5 B;  3S9M C;  1MH3 A;  4OHN A;  2OLB A;  2GH9 A;  3B6W A;  3A3U A;  3HHG A;  1MXU A;  5J1D A;  5KCJ A;  4G2Z A;  1D9Y A;  3Q29 A;  1LLS A;  3C9H A;  4QSE A;  1P1Q A;  4U2R A;  5FHM A;  3TCF A;  2DXR A;  1NKX A;  3PU5 A;  1AIV A;  4HW8 A;  3WAF A;  4ZZA A;  3TOD A;  2Q9T A;  2RKM A;  2B3B A;  4FEC A;  3U94 A;  2D21 A;  3MVZ A;  2OK2 A;  4M1V A;  1R9Q A;  4PFY A;  1HSE A;  2AL5 A;  3VXC A;  4R9F A;  4GLI A;  3K02 A;  4C1T A;  1Y3Q A;  2YPN A;  5LOM A;  5KDT A;  5TP9 B;  4NF4 A;  4NE4 A;  4UA8 A;  1B3L A;  1QUK A;  3G3K A;  3G3H A;  3KFM A;  1SW1 A;  2KLF A;  3TEL A;  2H25 A;  4R75 A;  3OO6 A;  1LAX A;  3G3G A;  1B1X A;  2HEU A;  2V93 A;  4KYE A;  2XX9 A;  2F7C A;  3PD9 A;  3UP9 A;  4H8J A;  5ICQ A;  1Q1K A;  3SEY A;  5CRY A;  5AA1 A;  3W9V A;  3IL1 B;  4MH5 A;  5ICT A;  3MAM A;  2X7P A;  4YKJ A;  3TDJ A;  3FGS A;  2O1L A;  2XXP A;  4Q8R A;  4FEB A;  2Z8F A;  4ND9 A;  3ILU B;  3SDF A;  3C34 A;  1A7L A;  1MY4 A;  2XXH A;  3T93 B;  1SI1 A;  1R1N A;  2PVU A;  4G68 A;  3BKI B;  2XXX A;  1B1H A;  3QSL A;  4O3C A;  2ALU A;  3USD A;  2H99 A;  4IY5 A;  5I58 A;  1VSO A;  3OSQ A;  1DMB A;  1AH5 A;  2VP1 A;  3EQ1 A;  4EXL A;  4LAT A;  1Y20 A;  4N13 A;  1MDQ A;  4YZZ A;  5K2Y A;  4XKP A;  3D4C A;  4KYD A;  5HPQ A;  4F1Y A;  2M8C A;  5AA3 A;  3CSB A;  1H76 A;  1B2H A;  3LC8 A;  5H8Q B;  4FJP A;  3TAJ A;  4RJZ A;  5I2N B;  1DPE A;  3SEV A;  2O51 A;  2F5X A;  4BDR A;  2Z8D A;  4KR5 A;  2DWJ A;  4EQB A;  5DVI A;  2AYS A;  4L17 A;  3KN3 A;  5CMB A;  1N76 A;  4YMA A;  3RT8 A;  4DXC A;  1B3E A;  5AA4 B;  1O63 A;  1O64 A;  1Y9U A;  3O6G A;  3C35 A;  1MPB A;  1Y4C A;  4OVJ A;  5EHS A;  4UAC A;  5M2V A;  4QFO A;  1D9V A;  4U4S A;  3MVW A;  2PYY A;  4ZEC A;  1VFE A;  1ZKB A;  1P99 A;  3UK4 A;  1B7U A;  2O7U A;  4C1U A;  1Y3P A;  1MY1 A;  4YB5 A;  3HN0 A;  4YAH X;  3SER A;  2RC7 A;  3H6U A;  1J1N A;  3VVD A;  5H8F A;  5I56 B;  3A3C A;  1SVX B;  1ZMG A;  2F35 A;  4YU0 A;  3B6T A;  3S4U A;  3C31 A;  3O9P A;  1LB9 A;  2VGQ A;  3L6G A;  2OWT A;  4EQ7 A;  2XD2 A;  1JET A;  4KD5 A;  4PFT A;  5KZT A;  1BTJ A;  2ZYK A;  2Q8J A;  3RNN A;  3SEW A;  3THI A;  5I2K A;  4GXS B;  1LAG E;  3KEI A;  3K1M A;  4BDN A;  3PMV A;  3K6U A;  4XIG Q;  1P1N A;  1MG1 A;  4HCY A;  5I84 A;  5F1Q A;  3LSX A;  4JSD A;  2F8D A;  4IGT A;  4XKN A;  4YMB A;  3MVX A;  1ANF A;  4WEP A;  2QS2 A;  1UTH B;  2P2A A;  4OFO A;  5FHN A;  2XXU A;  4QHQ A;  2UVG A;  3MW0 A;  2X26 A;  4OEU A;  1PEB A;  3R7X A;  2F36 A;  3EPE A;  1L5T A;  1DTZ A;  1A55 A;  3FJ7 A;  5DVJ A;  1GGG A;  3MP1 A;  2GFE A;  2NOO A;  3TCH A;  4IO3 A;  1UIU A;  3KOT A;  3SET A;  4G68 C;  1GVC A;  3QK6 A;  2DQV A;  4U1O A;  3GBA A;  3IOR A;  3KSJ A;  2AIX A;  2DXY A;  3TKD A;  1UTB B;  3IJX B;  3ILT B;  3A09 A;  1N0T A;  5I57 A;  2VD2 A;  3IOW A;  3PMX A;  4H6D A;  1B0H A;  4KQP A;  3PUZ E;  1KWH A;  4JWO A;  2Y84 A;  4GWO A;  2B65 A;  1XT8 A;  3IB1 A;  1TFD A;  4POW A;  3MZ1 A;  3MP8 A;  2ONS A;  4QFP A;  3LSW A;  4U1Z A;  3FJM A;  1YTV A;  3KGC A;  3VLV A;  4PQJ A;  3K00 A;  4I8C A;  3PPO A;  2NWJ A;  3DLN A;  1M5D A;  4AQ4 A;  1N7X A;  3IO6 A;  4NF6 B;  1IIT A;  1WDN A;  4F19 A;  1EH3 A;  1M5B A;  1USY H;  3ZS6 A;  3H4Z A;  4LP2 B;  1YCJ A;  4WED A;  2WKY A;  4YKP A;  4ZS9 A;  4R6H A;  1HSL A;  4POX A;  2E1S A;  1DPP A;  4H5G A;  4I62 A;  4E0X A;  1D4N A;  4ELR A;  2BJJ X;  1NNK A;  2HCA A;  4F3G A;  1QUJ A;  1B52 A;  4IO6 A;  5K2X A;  2I4C A;  4U21 A;  5ITP A;  4DDD A;  1MXX A;  1HSJ A;  4BDO A;  3K6V A;  1QUL A;  2QRY A;  1FQE A;  3VVE A;  1Y1Z A;  4ZZE A;  1IXC A;  3HCQ A;  1R6Z A;  4KYS A;  2REJ A;  3S9E A;  3QYT A;  5I59 A;  1FTJ A;  3H3G A;  3K0V A;  1B6H A;  3KN8 A;  1B4H A;  3F11 A;  1MQD A;  3N6T A;  3LR1 A;  1A8E A;  1B46 A;  1H45 A;  4BDM A;  1FTK A;  4GF8 A;  3GBB A;  4TLL B;  4F31 B;  1N7W A;  3QUJ A;  3MC2 A;  4R73 A;  3EF7 A;  2Q88 A;  3T66 A;  1USY E;  4QSC A;  3QAX A;  4R2F A;  4GOT A;  3VLU A;  2HZK A;  2F7A A;  2VD3 A;  4YKK A;  1IQ7 A;  3S2V A;  4G77 A;  1QKB A;  2HFB A;  4DIG A;  3K4U A;  4M4G A;  3UOR A;  3IB0 A;  2DE3 A;  1EU8 A;  2ANJ A;  2UVJ A;  1XVX A;  2F97 A;  3OD7 A;  2I48 A;  5AA2 D;  4OZ9 A;  3CSG A;  2PT2 A;  3HST A;  2G29 A;  3FUZ A;  5CC2 A;  2RC8 A;  3H6T A;  1OLC A;  2ONK E;  2H98 A;  1R9L A;  2XXR A;  3PUW E;  5EYF A;  5TPA A;  3RUM A;  3N6U A;  4ONY A;  3MUQ A;  3VLW A;  5H8H B;  3RY3 A;  2A5S A;  3H6W A;  4ELO A;  3FVO A;  5L9M A;  2DE4 A;  1MS7 A;  2V84 A;  3UA8 A;  1NMU A;  3KJ7 A;  3VV5 A;  1FTL A;  1FQB A;  4ESX A;  2XXW A;  1JW1 A;  2NUV A;  3RTW B;  3DP8 A;  4QFN A;  3IJO B;  4LZ8 A;  3LSF B;  2ABH A;  2NVU B;  5DEX A;  3K6X A;  3ONM A;  1JEU A;  1FTM A;  1IXG A;  4R74 A;  3FXQ A;  3T9V A;  3PUY E;  2DWA A;  1QW0 A;  4F29 A;  5L8D A;  3UN6 A;  3MPL A;  1EZO A;  5AA2 B;  2A5T B;  3KJT A;  2D3I A;  1ZTY A;  3OO8 A;  4ZEI A;  4P11 A;  3E3K A;  4NF8 A;  4OFL A;  3LBS A;  3G3J A;  1B51 A;  4F18 A;  4R2B A;  1BP5 A;  4N07 A;  3BBR A;  3T9U A;  1MY0 A;  5JTY A;  1ZJL A;  5CMK A;  1MXZ A;  3RN8 A;  5A5X A;  1FQD A;  2IA4 A;  4F39 A;  4BDQ A;  2DVC A;  2V3U A;  4DZ1 A;  5B7D A;  3MZB A;  4ISU A;  2CMO A;  5BUU A;  2X7Q A;  1AOV A;  4E0W A;  3S9L C;  2Q2A A;  4I9D A;  4IO2 A;  1PC3 A;  3IK6 B;  2O84 X;  4YB7 A;  4ESW A;  3U93 A;  3HO7 A;  1NH8 A;  4PFU A;  2H9B A;  2XXT A;  1LGB C;  4FOR A;  3PUX E;  5H8N B;  2UVH A;  1Q35 A;  4NF5 A;  5L9O A;  3QUF A;  3UIF A;  1JW5 A;  5CM6 A;  3C36 A;  3CIJ A;  1SW2 A;  1F9B A;  1OMP A;  1PBQ A;  2E0S A;  3H6V A;  3CRB A;  3KOS A;  4IGR A;  3W15 C;  4G8M A;  3PD8 A;  4NMY A;  1N84 A;  3JZJ A;  3U72 A;  1FTO A;  1MQH A;  3OOA A;  4LQ2 A;  4JBZ A;  4H65 A;  2Q2C A;  3Q27 A;  1US4 A;  4PET A;  2Z8E A;  4HS7 A;  4MLV A;  1TT1 A;  2ESN A;  4O3B A;  4WKM A;  1PB7 A;  1IIW A;  1LCT A;  1MQI A;  4RPO A;  3V83 A;  3V8X B;  1NNP A;  3IOU A;  1MXW A;  4HCW A;  1NNF A;  1B4Z A;  2P1S A;  3FD3 A;  3ZKL A;  3OEM A;  3PPN A;  5CBR A;  3CFX A;  1TFA A;  3JYR A;  1EZP A;  4FAT A;  3Q26 A;  2UYF A;  2THI A;  3JV9 A;  3DM0 A;  1JW4 A;  5TP9 A;  2XX7 A;  1B5H A;  4O3A A;  1URG A;  3IO4 A;  4KHZ E;  3O97 A;  1NNT A;  4KCC A;  2W7Y A;  3O6I A;  2DYX A;  1PB9 A;  4JSO A;  3I5O A;  1MM7 A;  5ELV A;  1RKM A;  1IXI A;  1I6Q A;  1I6B A;  4RA1 A;  4EQ9 A;  3CVG A;  1AL3 A;  2YLN A;  3H03 A;  2R6G E;  3OO9 A;  1Z7M E;  1FQA A;  2NXO A;  3CFL A;  3H06 B;  3RGY A;  2Y7K A;  2ZNT A;  3CFZ A;  5FHO A;  2Z23 A;  3M3F A;  4RYA A;  2F78 A;  5CBS A;  1ELJ A;  3ECR A;  4RY1 A;  2I4B A;  2O69 A;  2FNC A;  4PFW A;  2ZYM A;  2V3Q A;  1I69 A;  3MBP A;  2G93 A;  2QL3 A;  3R26 A;  3QIM A;  2R9J A;  4TLM B;  4X1D A;  1XVY A;  3O29 A;  3TPA A;  2VHA A;  3D4G A;  1B58 A;  4XXU A;  1MXV A;  3GXA A;  4AB6 A;  1N3X A;  5H8S A;  4N6P A;  5H8Q A;  2QS1 A;  1B40 A;  5I2N A;  1JVY A;  2O68 A;  5KCJ B;  2B3F A;  4P0G A;  2CZL A;  2UVI A;  1A40 A;  1US5 A;  4ECF A;  4DXU A;  3DP4 A;  5AA4 A;  2GRV A;  3IOT A;  4OXV A;  2AL4 A;  1XOC A;  3U1O A;  4ZDM A;  2I0C A;  3PPR A;  5F7V A;  1MY3 A;  4DCY A;  4H0W A;  1TXF A;  5FTI A;  4Q0C A;  4BDL A;  4KCD A;  3BFT A;  2QS4 A;  2HXW A;  4DCX A;  2DOJ A;  1QUI A;  3O28 A;  4GQO A;  3ODB A;  2I0B A;  4DE8 A;  1BLF A;  4F2Q A;  3ZSF A;  1DSN A;  3O2A A;  4ZEK A;  2QMW A;  3DP6 A;  3KBR A;  1IUD A;  2DSF A;  4OFJ A;  1LAF E;  4PE5 B;  3RTF B;  5AE4 A;  5KDT B;  4NTL A;  3I6V A;  4NF4 B;  3VE1 B;  4FE8 A;  1SBP A;  4XKQ A;  1MDP 1;  1YAE A;  4H1X A;  1H44 A;  4MF3 A;  1Y1M A;  3OEK A;  5I56 A;  4F3B A;  4EF1 A;  4Q30 B;  3TZA A;  1I6A A;  2RC9 A;  3MP6 A;  5IKB A;  4X48 A;  3FZV A;  3OEN A;  3TCG A;  3KSX A;  1B3F A;  2H4I A;  3MJN A;  3KG2 A;  1POY 1;  1XC1 A;  4GFR A;  3O6H A;  1LB8 A;  3M8U A;  1IEJ A;  2XHD A;  1OVT A;  2ZXT A;  1OLA A;  3GLB A;  4G68 B;  1M5F A;  3TMG A;  3G3F A;  2O6A A;  4FIM A;  4BLA A;  3H7M A;  3WAE A;  3SKP A;  3FAS A;  2F34 A;  5I58 B;  4Q5T A;  2I3W A;  4F1U A;  3C4M A;  1ZIU A;  1UTH A;  2H5Y A;  1A99 A;  4F22 A;  2OJT A;  3N5L A;  5DYH A;  2Q89 A;  4NWC A;  3RLF E;  3EHT A;  4ZEB A;  3K6W A;  4OES A;  1OQG A;  3N94 A;  4DXB A;  4F2O A;  2O1M A;  3K1N A;  2DS9 A;  3L6H A;  4JWY A;  4YKI A;  2F6G A;  1DTG A;  3W9W A;  3M3L A;  4OEV A;  4OER A;  1ZLQ A;  3KZG A;  4P0I A;  1LCF A;  1UTB A;  1BKA A;  1EZ9 A;  3M3K A;  2IEE A;  3V89 B;  1PB8 A;  2VOZ A;  3E4R A;  3VFJ A;  3FAT A;  2XX8 A;  4LA9 A;  4GXA A;  3DEL B;  1MQG A;  1JVX A;  2OBG A;  1JNF A;  3VVF A;  5JEI A;  5FTH A;  4MBP A;  5ISU A;  3TUS A;  1SW5 A;  2HQ0 A;  4GVO A;  2F7B A;  1B7H A;  1LST A;  2ZNS A;  1B5I A;  1N3W A;  1NFT A;  1PDA A;  5TU0 A; 
#chains in the Genus database with same CATH topology
 4ZED A;  4EF2 A;  1B3G A;  4G4P A;  3AXF A;  4LZ7 A;  3V5A A;  3IR1 A;  1ATG A;  3U92 A;  1URS A;  1AMF A;  1MH4 A;  3RYD A;  4WXJ A;  4XKR A;  4TOZ A;  1QVS A;  3TQL A;  2HAV A;  4PDH A;  4NF6 A;  2PMS A;  1JEV A;  2ZMB A;  4FAJ A;  1ZU0 A;  1S7Y A;  4F1V A;  3OO7 A;  2Z22 A;  2V3T A;  3HFU A;  3E78 A;  1M5E A;  1SPI A;  5H8F B;  3U8Q A;  3U65 A;  4G8N A;  2RIN A;  1CE2 A;  2OCU A;  3CR9 A;  5DT6 A;  2FVZ A;  3RT6 B;  1MM6 A;  3FV2 A;  1II5 A;  4GWZ A;  4YB6 A;  3VDF A;  3E13 X;  5JK4 A;  4Z7E A;  3O66 A;  2Y7R A;  4N6D A;  3TTN A;  1LBC A;  3SEU A;  4C0R A;  4R72 A;  1FQC A;  4U22 A;  4EDP A;  3Q28 A;  4RNS A;  4R6K A;  3MVY A;  3G3I A;  2F6P A;  1YPN A;  4IO4 A;  4ZE8 A;  3KN7 A;  1DOT A;  2I49 A;  2QJE A;  5I2K B;  4F3S A;  3FVK A;  1FPF A;  4KPT A;  1P1U A;  3HHF A;  4PAF A;  1RYX A;  5CI5 A;  3FV1 A;  1S50 A;  2XXK A;  1RDX A;  4HE0 A;  2PX1 A;  3PMW A;  1EYI A;  2Y5L A;  1FBP A;  1MQJ A;  2I6E A;  4PE3 A;  2WYK A;  1VR5 A;  4RXL A;  1XS5 A;  4QFK A;  3TEP A;  5ITO A;  1FPI A;  1H3D A;  1FW0 A;  2UYE A;  2QS3 A;  4MX6 A;  2XWV A;  2XXQ A;  4P3L A;  4IB2 A;  3K01 A;  3TTK A;  4PP0 A;  1MRP A;  3C33 A;  2XD3 A;  1B5J A;  1OQH A;  3KBZ A;  3I3V A;  4IY6 A;  4QFL A;  2DWH A;  4X9T A;  3C32 A;  4N81 A;  4P56 A;  3B6Q A;  3PGF A;  3MPK A;  2I58 A;  3IX1 A;  2QPQ A;  5I57 B;  4RPN A;  5I5P A;  1H43 A;  4IO7 A;  5H8H A;  3RQT A;  1GTK A;  2D5W A;  3PPP A;  2XXY A;  1P1W A;  2YJP A;  1P1O A;  4NX1 A;  4QSD A;  4R9G A;  3T9H B;  1IME A;  2B4M A;  5HM4 B;  4K3F A;  1B32 A;  1IXH A;  2ZYN A;  2DWI A;  3RPW A;  3K2D A;  1IMB A;  1D3K A;  1RYO A;  2HZL A;  3CI8 A;  3A29 A;  1LBB A;  4FED A;  4JDF A;  1IZ1 A;  1SQY A;  4YIC A;  3IAZ A;  4OMB A;  3TTL A;  1MPD A;  5BWJ A;  4LQ5 A;  2Y7I A;  3SEX A;  3MQ9 A;  2UXA A;  3PUV E;  2Y7P A;  2LAO A;  4XTC Q;  1UIV A;  3R6U A;  4XFE A;  3UGW A;  3GYY A;  4GWX A;  1LFI A;  5AA2 A;  3IB2 A;  2A5T A;  4PFI A;  3TTR A;  5L9S A;  3EHU A;  5CMM A;  3FIR A;  1B0L A;  2PT1 A;  1B3H A;  3FJG A;  4EXK A;  5DTB A;  1XHY A;  1TWY A;  1SI0 A;  1CB6 A;  2V25 A;  1T0K A;  1LBW A;  3OSR A;  1JQF A;  3ZKK A;  3TFL A;  4GL0 A;  4IO5 A;  5EHM A;  2OWS A;  3FXR A;  1MY2 A;  4P9K A;  1B9J A;  1FCK A;  1Y4T A;  3CG1 A;  4RK9 A;  5I59 B;  3CG3 A;  4ELQ A;  1POT A;  1SDX A;  1A8F A;  4U23 A;  4N4U A;  2DE2 A;  4ZEF A;  3Q25 A;  4GD5 A;  4OYV A;  4U4X A;  2XXV A;  3QXM A;  2RCB A;  4OWD A;  4MCO A;  5DVF A;  4NG7 A;  5H8N A;  3GZG A;  3HV1 A;  4LVQ A;  4NAP A;  2DVZ A;  3T0J A;  3OMB A;  3EKI A;  3HPI A;  2DP8 A;  3FVN A;  1NL5 A;  2F3B A;  1O7T A;  3EN3 A;  3PPQ A;  2REG A;  4F3P A;  1OVB A;  3RPL B;  1BIY A;  3K1P A;  4G8H A;  4H67 A;  4R6Y A;  4NHB A;  3LUY A;  1UQW A;  1PBP A;  4H5F A;  5CMC A;  3OEL A;  1NH7 A;  1FPD A;  1ZBM A;  4PC9 A;  2Y7W A;  1A54 A;  4OTE A;  4EUO A;  5TPA B;  4MLQ A;  1FPE A;  1FPJ A;  3B7D A;  2RCA A;  4HTG A;  5IAI A;  5HBC A;  2FA7 A;  4JXI A;  2B4L A;  4ZE9 A;  2QMX A;  1Y3N A;  2ONR A;  3LV0 A;  3TYH A;  3IOV A;  4MNP A;  5IZ1 A;  3N26 A;  2RF1 A;  4Z0I A;  3VXB A;  4KFQ A;  4NN3 A;  2GHA A;  4X1B A;  2R71 A;  5B70 A;  3TTM A;  1SYI A;  4GRK A;  3FVG A;  4OET A;  1WVJ A;  4AB5 A;  2ZYO A;  3MWB A;  3FXU A;  1B05 A;  5DEX B;  4NF0 A;  3T96 B;  4H8I A;  3LSL A;  4DLD A;  1S9T A;  2V4C A;  1VE4 A;  4I1D A;  1QJM A;  4TQU Q;  1QKA A;  2HHM A;  2I3V A;  4OQO A;  4KI0 E;  1FQF A;  4RK2 A;  4QRZ A;  4HE2 A;  1GR2 A;  1XI6 A;  3EHS A;  2P0S A;  4PFB A;  1FJ9 A;  1VFD A;  3MZ9 A;  4NF8 B;  4THI A;  3PV0 E;  1SYH A;  1N04 A;  4LON B;  4JB7 A;  1LFH A;  1MPC A;  2XXI A;  4NED A;  2OZZ A;  1MXY A;  2HAU A;  3E9X A;  5LTC A;  1B7Z A;  4LUB A;  3T9X B;  4HXV A;  5JTY B;  1URD A;  5EQ8 A;  1WOD A;  1LAH E;  5A5X B;  4LZ5 A;  2GHB A;  1G0I A;  3SES A;  1GV8 A;  3P7I A;  1M5C A;  1LFG A;  1SW4 A;  4MJO A;  4QF9 A;  4DI3 D;  2O7I A;  3TQW A;  4JWX A;  2FYI A;  2QSX A;  3BFU A;  4GIZ A;  4OEN A;  3OXN A;  3T22 A;  1SD3 A;  2PBW A;  3G7W A;  4JVD A;  4NWD A;  1FBD A;  1Z7N E;  4ELP A;  2ZNU A;  1OIB A;  4P8B A;  4MFI A;  4GL8 A;  3S9N C;  4NF5 B;  3S9M C;  1MH3 A;  4OHN A;  2OLB A;  2GH9 A;  3B6W A;  3A3U A;  3HHG A;  1MXU A;  3MST A;  1JP4 A;  1NUZ A;  3RPL A;  5J1D A;  5KCJ A;  4G2Z A;  1D9Y A;  3Q29 A;  1LLS A;  3C9H A;  4QSE A;  1P1Q A;  3IFA A;  4U2R A;  5FHM A;  3TCF A;  2DXR A;  1NKX A;  3PU5 A;  1AIV A;  1LEV A;  4HW8 A;  4GBV A;  3WAF A;  4ZZA A;  3TOD A;  2Q9T A;  2RKM A;  4PBH A;  2B3B A;  4OVR A;  4FEC A;  3U94 A;  2D21 A;  3MVZ A;  2OK2 A;  4GWS A;  4M1V A;  1DK4 A;  2Y5K A;  1R9Q A;  4PFY A;  1HSE A;  2AL5 A;  3VXC A;  4R9F A;  4X04 A;  4GLI A;  5EYG A;  3K02 A;  4C1T A;  1Y3Q A;  2YPN A;  5LOM A;  4MAG A;  5KDT A;  1QGX A;  5TP9 B;  4NF4 A;  4NE4 A;  4UA8 A;  1B3L A;  1QUK A;  3G3K A;  4N15 A;  3G3H A;  3KFM A;  1SW1 A;  2KLF A;  3TEL A;  2H25 A;  4R75 A;  3OO6 A;  1LAX A;  3G3G A;  1B1X A;  3QMF A;  2HEU A;  2V93 A;  3ISP A;  4KYE A;  4N8Y A;  2FHY A;  2XX9 A;  2F7C A;  3PD9 A;  3UP9 A;  4H8J A;  5ICQ A;  1Q1K A;  1FTA A;  3SEY A;  5CRY A;  5AA1 A;  4O7M A;  3W9V A;  4O7I A;  3IL1 B;  4MH5 A;  4GX4 A;  4MEV A;  5ICT A;  1LBX A;  3MAM A;  2X7P A;  4YKJ A;  3TDJ A;  3FGS A;  2O1L A;  2XXP A;  2PFY A;  4Q8R A;  4FEB A;  2Z8F A;  4ND9 A;  3ILU B;  3SDF A;  4PAK A;  3C34 A;  1A7L A;  1MY4 A;  2XXH A;  3T93 B;  1SI1 A;  1R1N A;  2PVU A;  4G68 A;  3BKI B;  2XXX A;  1B1H A;  3QSL A;  4O3C A;  2ALU A;  3USD A;  1FPL A;  2Q8M A;  2H99 A;  4IY5 A;  5I58 A;  1VSO A;  4P1L A;  4N91 A;  3OSQ A;  1DMB A;  1AH5 A;  2HPG A;  2VP1 A;  3EQ1 A;  2XWK A;  4EXL A;  2ZZV A;  4LAT A;  5IZ3 A;  1Y20 A;  4N13 A;  3ROJ A;  4MMP A;  1MDQ A;  4YZZ A;  5K2Y A;  4XKP A;  1NUX A;  3D4C A;  4KYD A;  5HPQ A;  4F1Y A;  2M8C A;  5AA3 A;  3CSB A;  1H76 A;  3B8B A;  2HXR A;  2P3N A;  1B2H A;  5I7I A;  2QVU A;  3LC8 A;  5H8Q B;  3D1R A;  4FJP A;  5T3J A;  3TAJ A;  4RJZ A;  5I2N B;  1DPE A;  3SEV A;  2O51 A;  2F5X A;  4BDR A;  2Z8D A;  4KR5 A;  2DWJ A;  4EQB A;  5DVI A;  2AYS A;  1IMA A;  4L17 A;  3KN3 A;  2OWZ A;  4N8G A;  5CMB A;  1N76 A;  4YMA A;  1FPG A;  3RT8 A;  4DXC A;  1B3E A;  1NV1 A;  5AA4 B;  1O63 A;  1NV0 A;  1O64 A;  1Y9U A;  3O6G A;  5LDZ A;  3C35 A;  1MPB A;  1Y4C A;  4OVJ A;  5EHS A;  4UAC A;  5M2V A;  5ET5 A;  4QFO A;  2WX9 A;  1D9V A;  4H45 A;  4U4S A;  4N17 A;  3MVW A;  2PYY A;  4ZEC A;  1VFE A;  1ZKB A;  1P99 A;  4PGN A;  3UK4 A;  1B7U A;  2O7U A;  4C1U A;  1Y3P A;  4P1E A;  1MY1 A;  4YB5 A;  3HN0 A;  2CZK A;  4YAH X;  3SER A;  2RC7 A;  3H6U A;  1J1N A;  3VVD A;  5H8F A;  5I56 B;  3A3C A;  1SVX B;  1ZMG A;  2F35 A;  4YU0 A;  3B6T A;  2GQ1 A;  4LN5 A;  4MNI A;  3S4U A;  3C31 A;  3O9P A;  3B50 A;  4GWW A;  2CZH A;  1LB9 A;  1IMC A;  2VGQ A;  3L6G A;  2OWT A;  4EQ7 A;  2XD2 A;  1JET A;  4KD5 A;  4PFT A;  5KZT A;  1BTJ A;  2ZYK A;  1FBH A;  2Q8J A;  3RNN A;  3SEW A;  3THI A;  5I2K A;  4GXS B;  1LAG E;  2ZZW A;  3KEI A;  3K1M A;  5ESY A;  4BDN A;  2VPO A;  3PMV A;  3K6U A;  2WYP A;  4XIG Q;  1P1N A;  1MG1 A;  4HCY A;  5I84 A;  4PGP A;  5F1Q A;  3LSX A;  4JSD A;  2F8D A;  4IGT A;  4XKN A;  4YMB A;  5FBP A;  3MVX A;  1ANF A;  4WEP A;  2QS2 A;  1UTH B;  2P2A A;  4OFO A;  5FHN A;  2XXU A;  4QHQ A;  4OVQ A;  2UVG A;  3MW0 A;  1NV5 A;  2X26 A;  4OEU A;  1PEB A;  3BIH A;  3R7X A;  2F36 A;  1NV7 A;  3EPE A;  1L5T A;  1DTZ A;  1A55 A;  3FJ7 A;  5DVJ A;  1GGG A;  3MP1 A;  4MIJ A;  2GFE A;  2NOO A;  3TCH A;  4IO3 A;  1YYZ A;  1UIU A;  3KOT A;  3SET A;  1IMD A;  4G68 C;  1GVC A;  3QK6 A;  2DQV A;  4U1O A;  3GBA A;  3IOR A;  3KSJ A;  5F24 A;  2AIX A;  2DXY A;  3TKD A;  4AS4 A;  1UTB B;  5EYH A;  3IJX B;  3ILT B;  3A09 A;  1FPK A;  1N0T A;  5I57 A;  2VD2 A;  4GBW A;  3IOW A;  3PMX A;  4H6D A;  4GWY A;  1B0H A;  4PAI A;  4UAB A;  4KQP A;  3PUZ E;  1KWH A;  4OAN A;  4JWO A;  2Y84 A;  1K9Y A;  4GWO A;  4GWU A;  2B65 A;  1XT8 A;  3IB1 A;  1TFD A;  4POW A;  3MZ1 A;  3MP8 A;  2VT5 A;  2ONS A;  4QFP A;  3LSW A;  4U1Z A;  1LBV A;  3FJM A;  1YTV A;  3KGC A;  3VLV A;  4PQJ A;  3K00 A;  4I8C A;  3PPO A;  2NWJ A;  1DBZ A;  3DLN A;  1M5D A;  4AQ4 A;  2QFL A;  1N7X A;  3IO6 A;  2PFZ A;  4NF6 B;  1IIT A;  2DDK A;  1WDN A;  4F19 A;  1EH3 A;  1Q9D A;  1M5B A;  1USY H;  3ZS6 A;  3H4Z A;  4LP2 B;  1YCJ A;  4WED A;  2WKY A;  4YKP A;  4ZS9 A;  3SZP A;  4R6H A;  1HSL A;  4POX A;  2E1S A;  1DPP A;  4H5G A;  4I62 A;  4XF5 A;  4E0X A;  1D4N A;  4ELR A;  2BJJ X;  1NNK A;  2HCA A;  4F3G A;  1QUJ A;  1B52 A;  4IO6 A;  4NGU A;  3E79 A;  5K2X A;  4IR8 A;  2I4C A;  4U21 A;  5ITP A;  4DDD A;  1MXX A;  1HSJ A;  4BDO A;  3K6V A;  1QUL A;  2QRY A;  1FQE A;  3VVE A;  1Y1Z A;  4ZZE A;  1IXC A;  3HCQ A;  1R6Z A;  4KYS A;  2REJ A;  3S9E A;  4H46 A;  1BK4 A;  3QYT A;  5I59 A;  1FTJ A;  3H3G A;  3K0V A;  1B6H A;  1FBF A;  3KN8 A;  1B4H A;  3F11 A;  1MQD A;  3N6T A;  3LR1 A;  1A8E A;  1B46 A;  1H45 A;  4BDM A;  1FTK A;  4GF8 A;  3GBB A;  4TLL B;  2FIX A;  1N7W A;  4F31 B;  3QUJ A;  3MC2 A;  4R73 A;  3EF7 A;  5ET7 A;  2Q88 A;  3T66 A;  1USY E;  4QSC A;  3QAX A;  4R2F A;  4GOT A;  3VLU A;  2HZK A;  2F7A A;  2VD3 A;  4YKK A;  1IQ7 A;  3S2V A;  4G77 A;  1QKB A;  2KQZ A;  2HFB A;  4DIG A;  3K4U A;  4M4G A;  3UOR A;  3IB0 A;  1LBY A;  2DE3 A;  1EU8 A;  2ANJ A;  2UVJ A;  4I40 A;  1XVX A;  2F97 A;  3OD7 A;  3FXB A;  2I48 A;  5AA2 D;  4OZ9 A;  3CSG A;  2PT2 A;  3HST A;  2G29 A;  3FUZ A;  5CC2 A;  2RC8 A;  3H6T A;  1OLC A;  2MKZ A;  2ONK E;  2H98 A;  1R9L A;  2XXR A;  3PUW E;  5EYF A;  5TPA A;  3RUM A;  3N6U A;  4ONY A;  3MUQ A;  3VLW A;  1CNQ A;  5H8H B;  3RY3 A;  2A5S A;  1NV6 A;  3H6W A;  4ELO A;  4PTK A;  1D9Q A;  3FVO A;  5L9M A;  4JVC A;  1KZ8 A;  2DE4 A;  1MS7 A;  2V84 A;  3UA8 A;  4MNC A;  4PF8 A;  1NMU A;  3KJ7 A;  3VV5 A;  1FTL A;  1FQB A;  4ESX A;  2XXW A;  1JW1 A;  2NUV A;  3RTW B;  1NV4 A;  4QBA A;  3DP8 A;  4QFN A;  3IJO B;  4LZ8 A;  2VPN A;  3LSF B;  5DW8 A;  2ABH A;  3LUZ A;  2NVU B;  5DEX A;  3K6X A;  3ONM A;  4PFR A;  5EQ9 A;  1JEU A;  1FTM A;  1IXG A;  2L5V A;  4R74 A;  1VDW A;  3FXQ A;  3T9V A;  3PUY E;  2DWA A;  1QW0 A;  4F29 A;  5L8D A;  3UN6 A;  3MPL A;  1EZO A;  5AA2 B;  2A5T B;  3KJT A;  2D3I A;  1ZTY A;  3OO8 A;  4ZEI A;  4P11 A;  1EYJ A;  2XWO A;  3CHG A;  3E3K A;  4NF8 A;  4OFL A;  2WBD A;  2CEY A;  3LBS A;  3G3J A;  1B51 A;  3KC0 A;  1K9Z A;  4F18 A;  4R2B A;  1BP5 A;  4N07 A;  3BBR A;  3T9U A;  1MY0 A;  5JTY A;  1ZJL A;  3MYU A;  5CMK A;  1MXZ A;  5I3S A;  3RN8 A;  5A5X A;  1FQD A;  2IA4 A;  3PTY A;  4F39 A;  1INP A;  4BDQ A;  2DVC A;  2V3U A;  4DZ1 A;  4NQ8 A;  5B7D A;  3MZB A;  1FBE A;  4ISU A;  2CMO A;  5BUU A;  1NUY A;  2X7Q A;  1AOV A;  4E0W A;  3S9L C;  2Q2A A;  4I9D A;  4IO2 A;  1PC3 A;  1KA1 A;  3IK6 B;  2O84 X;  4P47 A;  4YB7 A;  4ESW A;  3U93 A;  4I3Y A;  3HO7 A;  1NH8 A;  4PFU A;  2H9B A;  2WEF A;  2XXT A;  1LGB C;  4FOR A;  3PUX E;  4O94 A;  2UVH A;  5H8N B;  1FRP A;  1Q35 A;  4NF5 A;  2CEX A;  5L9O A;  3QUF A;  3UIF A;  1JW5 A;  5CM6 A;  3C36 A;  3CIJ A;  1SW2 A;  1FBG A;  1F9B A;  2BJI A;  1OMP A;  1PBQ A;  2E0S A;  3H6V A;  3CRB A;  3KOS A;  4IGR A;  3W15 C;  4G8M A;  3PD8 A;  4NMY A;  1N84 A;  3JZJ A;  4I3E A;  3U72 A;  1FTO A;  1MQH A;  3OOA A;  4LQ2 A;  4JBZ A;  4H65 A;  2Q2C A;  3Q27 A;  4KXP A;  1US4 A;  2Q74 A;  2WBB A;  4PET A;  2Z8E A;  4HS7 A;  4MLV A;  1TT1 A;  2ESN A;  4O3B A;  4WKM A;  1PB7 A;  1IIW A;  1LCT A;  1MQI A;  4RPO A;  3V83 A;  3V8X B;  1NNP A;  3IOU A;  1MXW A;  4HCW A;  1NNF A;  1B4Z A;  2P1S A;  3FD3 A;  3ZKL A;  3OEM A;  3PPN A;  2PCR A;  5CBR A;  3CFX A;  1TFA A;  3JYR A;  1EZP A;  4FAT A;  3Q26 A;  2UYF A;  2THI A;  3JV9 A;  3DM0 A;  1JW4 A;  5TP9 A;  2OX3 A;  2XX7 A;  1B5H A;  4O3A A;  1URG A;  3IO4 A;  4KHZ E;  3O97 A;  1NNT A;  4KCC A;  4G61 A;  2W7Y A;  4N6K A;  3O6I A;  2DYX A;  1PB9 A;  4JSO A;  3I5O A;  3T1B A;  3KC1 A;  1MM7 A;  1FJ6 A;  3FBP A;  5ELV A;  1RKM A;  1IXI A;  1FSA A;  2ZZX A;  5ET6 A;  2R8T A;  1I6Q A;  1I6B A;  4RA1 A;  2JJK A;  4EQ9 A;  3CVG A;  1AL3 A;  2YLN A;  3H03 A;  1KA0 A;  2R6G E;  3OO9 A;  1NUW A;  4AS5 A;  4JVI A;  1Z7M E;  1FQA A;  1EYK A;  2NXO A;  3CFL A;  3H06 B;  3RGY A;  2Y7K A;  1RDZ A;  2ZNT A;  3CFZ A;  5FHO A;  2Z23 A;  3M3F A;  4RYA A;  2F78 A;  5CBS A;  1ELJ A;  4PDD A;  3ECR A;  4RY1 A;  2I4B A;  5A5L A;  2O69 A;  2XA5 A;  2FNC A;  1RDY A;  4PFW A;  2ZYM A;  2V3Q A;  1I69 A;  3MBP A;  5IGA A;  5ET8 A;  2G93 A;  2QL3 A;  3R26 A;  3QIM A;  2R9J A;  4TLM B;  4X1D A;  1XVY A;  3O29 A;  3TPA A;  2VHA A;  3D4G A;  4FBP A;  1B58 A;  1NI9 A;  4XXU A;  1MXV A;  2CZI A;  3GXA A;  1IMF A;  4AB6 A;  1N3X A;  5H8S A;  4HE1 A;  4N6P A;  5H8Q A;  2QS1 A;  1B40 A;  5I2N A;  1DCU A;  1JVY A;  2O68 A;  5KCJ B;  2B3F A;  4P0G A;  2CZL A;  2UVI A;  1A40 A;  1US5 A;  4ECF A;  1G0H A;  4X8R A;  4DXU A;  3DP4 A;  4QXD A;  5EQ7 A;  5J16 A;  1YXI A;  5AA4 A;  2GRV A;  2FBP A;  3IOT A;  4OXV A;  2AL4 A;  1XOC A;  3U1O A;  4ZDM A;  2I0C A;  3PPR A;  5F7V A;  1MY3 A;  4DCY A;  4H0W A;  1TXF A;  5FTI A;  4Q0C A;  4BDL A;  4PCD A;  3BIG A;  4KCD A;  3BFT A;  2QS4 A;  2HXW A;  4DCX A;  2DOJ A;  1QUI A;  3O28 A;  4GQO A;  3ODB A;  2I0B A;  4PBQ A;  4MHF A;  4DE8 A;  1BLF A;  4F2Q A;  3ZSF A;  3IFC A;  1DSN A;  2FIE A;  2P3V A;  3O2A A;  4ZEK A;  2QMW A;  3DP6 A;  4O8M A;  3KBR A;  5EQA A;  1IUD A;  2DSF A;  4OFJ A;  1LAF E;  4PE5 B;  4GX3 A;  3RTF B;  5AE4 A;  5KDT B;  4NTL A;  3I6V A;  4NF4 B;  3VE1 B;  4FE8 A;  1SBP A;  4XKQ A;  1FBC A;  2QVV A;  1MDP 1;  1YAE A;  4H1X A;  2XWI A;  2KR0 A;  1H44 A;  4MF3 A;  1Y1M A;  2QVR A;  3OEK A;  5I56 A;  4F3B A;  4EF1 A;  4Q30 B;  3TZA A;  1I6A A;  4GX6 A;  2RC9 A;  3MP6 A;  1YZ0 A;  5IKB A;  4X48 A;  3FZV A;  3OEN A;  3TCG A;  3KSX A;  1B3F A;  2H4I A;  4XEQ A;  3MJN A;  3KG2 A;  1POY 1;  1XC1 A;  4GFR A;  1AWB A;  3O6H A;  1LB8 A;  3M8U A;  1FPB A;  1IEJ A;  2XHD A;  1OVT A;  2ZXT A;  1OLA A;  3GLB A;  4G68 B;  1M5F A;  3TMG A;  4OVT A;  3G3F A;  2O6A A;  4FIM A;  4DI4 B;  4BLA A;  3H7M A;  3WAE A;  3SKP A;  3FAS A;  2F34 A;  5I58 B;  4Q5T A;  2I3W A;  4F1U A;  4OA4 A;  3C4M A;  1ZIU A;  1UTH A;  2H5Y A;  1A99 A;  4F22 A;  2OJT A;  3N5L A;  5DYH A;  5IZ3 B;  2Q89 A;  5IZZ A;  4NWC A;  3RLF E;  3EHT A;  4ZEB A;  3K6W A;  4OES A;  1OQG A;  3N94 A;  4DXB A;  4F2O A;  2O1M A;  3K1N A;  2DS9 A;  3L6H A;  4JWY A;  4YKI A;  2F6G A;  5IM2 A;  1DTG A;  3W9W A;  3M3L A;  3NOH A;  4OEV A;  4OER A;  1ZLQ A;  3KZG A;  4P0I A;  1LCF A;  1UTB A;  1BKA A;  1EZ9 A;  3M3K A;  2IEE A;  3V89 B;  1PB8 A;  1LBZ A;  2VOZ A;  3E4R A;  3VFJ A;  1NV3 A;  3FAT A;  2XX8 A;  4LA9 A;  4GXA A;  3DEL B;  4OVS A;  1MQG A;  1JVX A;  2OBG A;  1JNF A;  3VVF A;  5JEI A;  5FTH A;  4MBP A;  5ISU A;  2F3D A;  3TUS A;  4OVP A;  1SW5 A;  2HQ0 A;  4GVO A;  2F7B A;  1B7H A;  4PF6 A;  1LST A;  1NV2 A;  2ZNS A;  1B5I A;  1N3W A;  1NFT A;  1PDA A;  5TU0 A; 
#chains in the Genus database with same CATH homology
 4ZED A;  4EF2 A;  1B3G A;  4G4P A;  3AXF A;  4LZ7 A;  3V5A A;  3IR1 A;  1ATG A;  3U92 A;  1URS A;  1AMF A;  1MH4 A;  4WXJ A;  4XKR A;  4TOZ A;  1QVS A;  3TQL A;  2HAV A;  4NF6 A;  2PMS A;  1JEV A;  2ZMB A;  4FAJ A;  1ZU0 A;  1S7Y A;  4F1V A;  3OO7 A;  2Z22 A;  2V3T A;  1M5E A;  5H8F B;  3U8Q A;  4G8N A;  2RIN A;  1CE2 A;  2OCU A;  3CR9 A;  5DT6 A;  3RT6 B;  1MM6 A;  3FV2 A;  1II5 A;  4YB6 A;  3VDF A;  3E13 X;  5JK4 A;  4Z7E A;  3O66 A;  2Y7R A;  3TTN A;  1LBC A;  3SEU A;  4C0R A;  4R72 A;  1FQC A;  4U22 A;  4EDP A;  3Q28 A;  4RNS A;  4R6K A;  3MVY A;  3G3I A;  2F6P A;  1YPN A;  4IO4 A;  4ZE8 A;  3KN7 A;  1DOT A;  2I49 A;  2QJE A;  5I2K B;  4F3S A;  3FVK A;  4KPT A;  1P1U A;  3HHF A;  1RYX A;  5CI5 A;  3FV1 A;  1S50 A;  2PX1 A;  3PMW A;  1MQJ A;  2I6E A;  1VR5 A;  4RXL A;  1XS5 A;  4QFK A;  3TEP A;  5ITO A;  1H3D A;  1FW0 A;  2UYE A;  2QS3 A;  2XXQ A;  4IB2 A;  3K01 A;  3TTK A;  4PP0 A;  1MRP A;  3C33 A;  2XD3 A;  1B5J A;  1OQH A;  3I3V A;  4IY6 A;  4QFL A;  2DWH A;  4X9T A;  3C32 A;  3B6Q A;  3PGF A;  3MPK A;  2I58 A;  3IX1 A;  2QPQ A;  5I57 B;  4RPN A;  1H43 A;  4IO7 A;  5H8H A;  3RQT A;  1GTK A;  2D5W A;  3PPP A;  2XXY A;  1P1W A;  2YJP A;  1P1O A;  4QSD A;  4R9G A;  3T9H B;  5HM4 B;  4K3F A;  1B32 A;  1IXH A;  2ZYN A;  2DWI A;  3RPW A;  3K2D A;  1D3K A;  1RYO A;  2HZL A;  3CI8 A;  1LBB A;  4FED A;  4JDF A;  1IZ1 A;  1SQY A;  4YIC A;  3IAZ A;  4OMB A;  3TTL A;  1MPD A;  5BWJ A;  4LQ5 A;  2Y7I A;  3SEX A;  3MQ9 A;  2UXA A;  3PUV E;  2Y7P A;  2LAO A;  4XTC Q;  1UIV A;  3R6U A;  3UGW A;  1LFI A;  5AA2 A;  3IB2 A;  2A5T A;  3TTR A;  5L9S A;  3EHU A;  5CMM A;  3FIR A;  1B0L A;  2PT1 A;  1B3H A;  3FJG A;  4EXK A;  5DTB A;  1XHY A;  1TWY A;  1SI0 A;  1CB6 A;  2V25 A;  1T0K A;  3OSR A;  1JQF A;  3ZKK A;  3TFL A;  4GL0 A;  4IO5 A;  5EHM A;  2OWS A;  3FXR A;  1MY2 A;  1B9J A;  1FCK A;  1Y4T A;  3CG1 A;  4RK9 A;  5I59 B;  3CG3 A;  4ELQ A;  1POT A;  1SDX A;  1A8F A;  4U23 A;  2DE2 A;  4ZEF A;  3Q25 A;  4GD5 A;  4OYV A;  4U4X A;  2XXV A;  3QXM A;  2RCB A;  4OWD A;  5DVF A;  5H8N A;  3GZG A;  3HV1 A;  4LVQ A;  2DVZ A;  3OMB A;  3HPI A;  2DP8 A;  3FVN A;  1NL5 A;  1O7T A;  3EN3 A;  3PPQ A;  2REG A;  4F3P A;  1OVB A;  1BIY A;  3K1P A;  4G8H A;  4H67 A;  4R6Y A;  3LUY A;  1UQW A;  1PBP A;  4H5F A;  5CMC A;  3OEL A;  1NH7 A;  1ZBM A;  2Y7W A;  1A54 A;  4OTE A;  4EUO A;  5TPA B;  4MLQ A;  3B7D A;  2RCA A;  4HTG A;  5IAI A;  5HBC A;  2FA7 A;  4JXI A;  4ZE9 A;  2QMX A;  1Y3N A;  2ONR A;  3TYH A;  3IOV A;  3N26 A;  2RF1 A;  4Z0I A;  3VXB A;  4KFQ A;  2GHA A;  4X1B A;  2R71 A;  5B70 A;  3TTM A;  1SYI A;  4GRK A;  3FVG A;  4OET A;  1WVJ A;  4AB5 A;  2ZYO A;  3MWB A;  3FXU A;  1B05 A;  5DEX B;  3T96 B;  4H8I A;  3LSL A;  4DLD A;  1S9T A;  1VE4 A;  4I1D A;  1QJM A;  4TQU Q;  1QKA A;  2I3V A;  4OQO A;  4KI0 E;  1FQF A;  4RK2 A;  4QRZ A;  1GR2 A;  3EHS A;  2P0S A;  1VFD A;  3MZ9 A;  4NF8 B;  4THI A;  3PV0 E;  1SYH A;  1N04 A;  4LON B;  4JB7 A;  1LFH A;  1MPC A;  2XXI A;  4NED A;  2OZZ A;  1MXY A;  2HAU A;  3E9X A;  1B7Z A;  4LUB A;  3T9X B;  5JTY B;  1URD A;  1WOD A;  1LAH E;  5A5X B;  4LZ5 A;  2GHB A;  3SES A;  1GV8 A;  3P7I A;  1M5C A;  1LFG A;  1SW4 A;  4QF9 A;  2O7I A;  3TQW A;  4JWX A;  2FYI A;  2QSX A;  3BFU A;  4GIZ A;  4OEN A;  3OXN A;  3T22 A;  1SD3 A;  2PBW A;  3G7W A;  4NWD A;  1Z7N E;  4ELP A;  2ZNU A;  1OIB A;  4MFI A;  4GL8 A;  3S9N C;  4NF5 B;  3S9M C;  1MH3 A;  4OHN A;  2OLB A;  2GH9 A;  3B6W A;  3A3U A;  3HHG A;  1MXU A;  5J1D A;  5KCJ A;  4G2Z A;  1D9Y A;  3Q29 A;  1LLS A;  3C9H A;  4QSE A;  1P1Q A;  4U2R A;  5FHM A;  3TCF A;  2DXR A;  1NKX A;  3PU5 A;  1AIV A;  4HW8 A;  3WAF A;  4ZZA A;  3TOD A;  2Q9T A;  2RKM A;  2B3B A;  4FEC A;  3U94 A;  2D21 A;  3MVZ A;  2OK2 A;  4M1V A;  1R9Q A;  4PFY A;  1HSE A;  2AL5 A;  3VXC A;  4R9F A;  4GLI A;  3K02 A;  4C1T A;  1Y3Q A;  2YPN A;  5LOM A;  5KDT A;  5TP9 B;  4NF4 A;  4NE4 A;  4UA8 A;  1B3L A;  1QUK A;  3G3K A;  3G3H A;  3KFM A;  1SW1 A;  2KLF A;  3TEL A;  2H25 A;  4R75 A;  3OO6 A;  1LAX A;  3G3G A;  1B1X A;  2HEU A;  2V93 A;  4KYE A;  2XX9 A;  2F7C A;  3PD9 A;  3UP9 A;  4H8J A;  5ICQ A;  1Q1K A;  3SEY A;  5CRY A;  5AA1 A;  3W9V A;  3IL1 B;  4MH5 A;  5ICT A;  3MAM A;  2X7P A;  4YKJ A;  3TDJ A;  3FGS A;  2O1L A;  2XXP A;  4Q8R A;  4FEB A;  2Z8F A;  4ND9 A;  3ILU B;  3SDF A;  3C34 A;  1A7L A;  1MY4 A;  2XXH A;  3T93 B;  1SI1 A;  1R1N A;  2PVU A;  4G68 A;  3BKI B;  2XXX A;  1B1H A;  3QSL A;  4O3C A;  2ALU A;  3USD A;  2H99 A;  4IY5 A;  5I58 A;  1VSO A;  3OSQ A;  1DMB A;  1AH5 A;  2VP1 A;  3EQ1 A;  4EXL A;  4LAT A;  1Y20 A;  4N13 A;  1MDQ A;  4YZZ A;  5K2Y A;  4XKP A;  3D4C A;  4KYD A;  5HPQ A;  4F1Y A;  2M8C A;  5AA3 A;  3CSB A;  1H76 A;  1B2H A;  3LC8 A;  5H8Q B;  4FJP A;  3TAJ A;  4RJZ A;  5I2N B;  1DPE A;  3SEV A;  2O51 A;  2F5X A;  4BDR A;  2Z8D A;  4KR5 A;  2DWJ A;  4EQB A;  5DVI A;  2AYS A;  4L17 A;  3KN3 A;  5CMB A;  1N76 A;  4YMA A;  3RT8 A;  4DXC A;  1B3E A;  5AA4 B;  1O63 A;  1O64 A;  1Y9U A;  3O6G A;  3C35 A;  1MPB A;  1Y4C A;  4OVJ A;  5EHS A;  4UAC A;  5M2V A;  4QFO A;  1D9V A;  4U4S A;  3MVW A;  2PYY A;  4ZEC A;  1VFE A;  1ZKB A;  1P99 A;  3UK4 A;  1B7U A;  2O7U A;  4C1U A;  1Y3P A;  1MY1 A;  4YB5 A;  3HN0 A;  4YAH X;  3SER A;  2RC7 A;  3H6U A;  1J1N A;  3VVD A;  5H8F A;  5I56 B;  3A3C A;  1SVX B;  1ZMG A;  2F35 A;  4YU0 A;  3B6T A;  3S4U A;  3C31 A;  3O9P A;  1LB9 A;  2VGQ A;  3L6G A;  2OWT A;  4EQ7 A;  2XD2 A;  1JET A;  4KD5 A;  4PFT A;  5KZT A;  1BTJ A;  2ZYK A;  2Q8J A;  3RNN A;  3SEW A;  3THI A;  5I2K A;  4GXS B;  1LAG E;  3KEI A;  3K1M A;  4BDN A;  3PMV A;  3K6U A;  4XIG Q;  1P1N A;  1MG1 A;  4HCY A;  5I84 A;  5F1Q A;  3LSX A;  4JSD A;  2F8D A;  4IGT A;  4XKN A;  4YMB A;  3MVX A;  1ANF A;  4WEP A;  2QS2 A;  1UTH B;  2P2A A;  4OFO A;  5FHN A;  2XXU A;  4QHQ A;  2UVG A;  3MW0 A;  2X26 A;  4OEU A;  1PEB A;  3R7X A;  2F36 A;  3EPE A;  1L5T A;  1DTZ A;  1A55 A;  3FJ7 A;  5DVJ A;  1GGG A;  3MP1 A;  2GFE A;  2NOO A;  3TCH A;  4IO3 A;  1UIU A;  3KOT A;  3SET A;  4G68 C;  1GVC A;  3QK6 A;  2DQV A;  4U1O A;  3GBA A;  3IOR A;  3KSJ A;  2AIX A;  2DXY A;  3TKD A;  1UTB B;  3IJX B;  3ILT B;  3A09 A;  1N0T A;  5I57 A;  2VD2 A;  3IOW A;  3PMX A;  4H6D A;  1B0H A;  4KQP A;  3PUZ E;  1KWH A;  4JWO A;  2Y84 A;  4GWO A;  2B65 A;  1XT8 A;  3IB1 A;  1TFD A;  4POW A;  3MZ1 A;  3MP8 A;  2ONS A;  4QFP A;  3LSW A;  4U1Z A;  3FJM A;  1YTV A;  3KGC A;  3VLV A;  4PQJ A;  3K00 A;  4I8C A;  3PPO A;  2NWJ A;  3DLN A;  1M5D A;  4AQ4 A;  1N7X A;  3IO6 A;  4NF6 B;  1IIT A;  1WDN A;  4F19 A;  1EH3 A;  1M5B A;  1USY H;  3ZS6 A;  3H4Z A;  4LP2 B;  1YCJ A;  4WED A;  2WKY A;  4YKP A;  4ZS9 A;  4R6H A;  1HSL A;  4POX A;  2E1S A;  1DPP A;  4H5G A;  4I62 A;  4E0X A;  1D4N A;  4ELR A;  2BJJ X;  1NNK A;  2HCA A;  4F3G A;  1QUJ A;  1B52 A;  4IO6 A;  5K2X A;  2I4C A;  4U21 A;  5ITP A;  4DDD A;  1MXX A;  1HSJ A;  4BDO A;  3K6V A;  1QUL A;  2QRY A;  1FQE A;  3VVE A;  1Y1Z A;  4ZZE A;  1IXC A;  3HCQ A;  1R6Z A;  4KYS A;  2REJ A;  3S9E A;  3QYT A;  5I59 A;  1FTJ A;  3H3G A;  3K0V A;  1B6H A;  3KN8 A;  1B4H A;  3F11 A;  1MQD A;  3N6T A;  3LR1 A;  1A8E A;  1B46 A;  1H45 A;  4BDM A;  1FTK A;  4GF8 A;  3GBB A;  4TLL B;  4F31 B;  1N7W A;  3QUJ A;  3MC2 A;  4R73 A;  3EF7 A;  2Q88 A;  3T66 A;  1USY E;  4QSC A;  3QAX A;  4R2F A;  4GOT A;  3VLU A;  2HZK A;  2F7A A;  2VD3 A;  4YKK A;  1IQ7 A;  3S2V A;  4G77 A;  1QKB A;  2HFB A;  4DIG A;  3K4U A;  4M4G A;  3UOR A;  3IB0 A;  2DE3 A;  1EU8 A;  2ANJ A;  2UVJ A;  1XVX A;  2F97 A;  3OD7 A;  2I48 A;  5AA2 D;  4OZ9 A;  3CSG A;  2PT2 A;  3HST A;  2G29 A;  3FUZ A;  5CC2 A;  2RC8 A;  3H6T A;  1OLC A;  2ONK E;  2H98 A;  1R9L A;  2XXR A;  3PUW E;  5EYF A;  5TPA A;  3RUM A;  3N6U A;  4ONY A;  3MUQ A;  3VLW A;  5H8H B;  3RY3 A;  2A5S A;  3H6W A;  4ELO A;  3FVO A;  5L9M A;  2DE4 A;  1MS7 A;  2V84 A;  3UA8 A;  1NMU A;  3KJ7 A;  3VV5 A;  1FTL A;  1FQB A;  4ESX A;  2XXW A;  1JW1 A;  2NUV A;  3RTW B;  3DP8 A;  4QFN A;  3IJO B;  4LZ8 A;  3LSF B;  2ABH A;  2NVU B;  5DEX A;  3K6X A;  3ONM A;  1JEU A;  1FTM A;  1IXG A;  4R74 A;  3FXQ A;  3T9V A;  3PUY E;  2DWA A;  1QW0 A;  4F29 A;  5L8D A;  3UN6 A;  3MPL A;  1EZO A;  5AA2 B;  2A5T B;  3KJT A;  2D3I A;  1ZTY A;  3OO8 A;  4ZEI A;  4P11 A;  3E3K A;  4NF8 A;  4OFL A;  3LBS A;  3G3J A;  1B51 A;  4F18 A;  4R2B A;  1BP5 A;  4N07 A;  3BBR A;  3T9U A;  1MY0 A;  5JTY A;  1ZJL A;  5CMK A;  1MXZ A;  3RN8 A;  5A5X A;  1FQD A;  2IA4 A;  4F39 A;  4BDQ A;  2DVC A;  2V3U A;  4DZ1 A;  5B7D A;  3MZB A;  4ISU A;  2CMO A;  5BUU A;  2X7Q A;  1AOV A;  4E0W A;  3S9L C;  2Q2A A;  4I9D A;  4IO2 A;  1PC3 A;  3IK6 B;  2O84 X;  4YB7 A;  4ESW A;  3U93 A;  3HO7 A;  1NH8 A;  4PFU A;  2H9B A;  2XXT A;  1LGB C;  4FOR A;  3PUX E;  5H8N B;  2UVH A;  1Q35 A;  4NF5 A;  5L9O A;  3QUF A;  3UIF A;  1JW5 A;  5CM6 A;  3C36 A;  3CIJ A;  1SW2 A;  1F9B A;  1OMP A;  1PBQ A;  2E0S A;  3H6V A;  3CRB A;  3KOS A;  4IGR A;  3W15 C;  4G8M A;  3PD8 A;  4NMY A;  1N84 A;  3JZJ A;  3U72 A;  1FTO A;  1MQH A;  3OOA A;  4LQ2 A;  4JBZ A;  4H65 A;  2Q2C A;  3Q27 A;  1US4 A;  4PET A;  2Z8E A;  4HS7 A;  4MLV A;  1TT1 A;  2ESN A;  4O3B A;  4WKM A;  1PB7 A;  1IIW A;  1LCT A;  1MQI A;  4RPO A;  3V83 A;  3V8X B;  1NNP A;  3IOU A;  1MXW A;  4HCW A;  1NNF A;  1B4Z A;  2P1S A;  3FD3 A;  3ZKL A;  3OEM A;  3PPN A;  5CBR A;  3CFX A;  1TFA A;  3JYR A;  1EZP A;  4FAT A;  3Q26 A;  2UYF A;  2THI A;  3JV9 A;  3DM0 A;  1JW4 A;  5TP9 A;  2XX7 A;  1B5H A;  4O3A A;  1URG A;  3IO4 A;  4KHZ E;  3O97 A;  1NNT A;  4KCC A;  2W7Y A;  3O6I A;  2DYX A;  1PB9 A;  4JSO A;  3I5O A;  1MM7 A;  5ELV A;  1RKM A;  1IXI A;  1I6Q A;  1I6B A;  4RA1 A;  4EQ9 A;  3CVG A;  1AL3 A;  2YLN A;  3H03 A;  2R6G E;  3OO9 A;  1Z7M E;  1FQA A;  2NXO A;  3CFL A;  3H06 B;  3RGY A;  2Y7K A;  2ZNT A;  3CFZ A;  5FHO A;  2Z23 A;  3M3F A;  4RYA A;  2F78 A;  5CBS A;  1ELJ A;  3ECR A;  4RY1 A;  2I4B A;  2O69 A;  2FNC A;  4PFW A;  2ZYM A;  2V3Q A;  1I69 A;  3MBP A;  2G93 A;  2QL3 A;  3R26 A;  3QIM A;  2R9J A;  4TLM B;  4X1D A;  1XVY A;  3O29 A;  3TPA A;  2VHA A;  3D4G A;  1B58 A;  4XXU A;  1MXV A;  3GXA A;  4AB6 A;  1N3X A;  5H8S A;  4N6P A;  5H8Q A;  2QS1 A;  1B40 A;  5I2N A;  1JVY A;  2O68 A;  5KCJ B;  2B3F A;  4P0G A;  2CZL A;  2UVI A;  1A40 A;  1US5 A;  4ECF A;  4DXU A;  3DP4 A;  5AA4 A;  2GRV A;  3IOT A;  4OXV A;  2AL4 A;  1XOC A;  3U1O A;  4ZDM A;  2I0C A;  3PPR A;  5F7V A;  1MY3 A;  4DCY A;  4H0W A;  1TXF A;  5FTI A;  4Q0C A;  4BDL A;  4KCD A;  3BFT A;  2QS4 A;  2HXW A;  4DCX A;  2DOJ A;  1QUI A;  3O28 A;  4GQO A;  3ODB A;  2I0B A;  4DE8 A;  1BLF A;  4F2Q A;  3ZSF A;  1DSN A;  3O2A A;  4ZEK A;  2QMW A;  3DP6 A;  3KBR A;  1IUD A;  2DSF A;  4OFJ A;  1LAF E;  4PE5 B;  3RTF B;  5AE4 A;  5KDT B;  4NTL A;  3I6V A;  4NF4 B;  3VE1 B;  4FE8 A;  1SBP A;  4XKQ A;  1MDP 1;  1YAE A;  4H1X A;  1H44 A;  4MF3 A;  1Y1M A;  3OEK A;  5I56 A;  4F3B A;  4EF1 A;  4Q30 B;  3TZA A;  1I6A A;  2RC9 A;  3MP6 A;  5IKB A;  4X48 A;  3FZV A;  3OEN A;  3TCG A;  3KSX A;  1B3F A;  2H4I A;  3MJN A;  3KG2 A;  1POY 1;  1XC1 A;  4GFR A;  3O6H A;  1LB8 A;  3M8U A;  1IEJ A;  2XHD A;  1OVT A;  2ZXT A;  1OLA A;  3GLB A;  4G68 B;  1M5F A;  3TMG A;  3G3F A;  2O6A A;  4FIM A;  4BLA A;  3H7M A;  3WAE A;  3SKP A;  3FAS A;  2F34 A;  5I58 B;  4Q5T A;  2I3W A;  4F1U A;  3C4M A;  1ZIU A;  1UTH A;  2H5Y A;  1A99 A;  4F22 A;  2OJT A;  3N5L A;  5DYH A;  2Q89 A;  4NWC A;  3RLF E;  3EHT A;  4ZEB A;  3K6W A;  4OES A;  1OQG A;  3N94 A;  4DXB A;  4F2O A;  2O1M A;  3K1N A;  2DS9 A;  3L6H A;  4JWY A;  4YKI A;  2F6G A;  1DTG A;  3W9W A;  3M3L A;  4OEV A;  4OER A;  1ZLQ A;  3KZG A;  4P0I A;  1LCF A;  1UTB A;  1BKA A;  1EZ9 A;  3M3K A;  2IEE A;  3V89 B;  1PB8 A;  2VOZ A;  3E4R A;  3VFJ A;  3FAT A;  2XX8 A;  4LA9 A;  4GXA A;  3DEL B;  1MQG A;  1JVX A;  2OBG A;  1JNF A;  3VVF A;  5JEI A;  5FTH A;  4MBP A;  5ISU A;  3TUS A;  1SW5 A;  2HQ0 A;  4GVO A;  2F7B A;  1B7H A;  1LST A;  2ZNS A;  1B5I A;  1N3W A;  1NFT A;  1PDA A;  5TU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...