4ABAA

Fragments bound to bovine trypsin for the sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATIONIC TRYPSIN
publication title The Dingo Dataset: A Comprehensive Set of Data for the Sampl Challenge.
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abaA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abaA02
2BDBA 3RXOA 3O8RA 2FOCA 4IMQA 1T32A 1TFXA 3KF2A 1YKTA 3ZV8A 4CH8B 1DWDH 1DDJA 4NIWA 1EP6A 2TGPZ 2GZ9A 2O8TA 3ATIA 1IQIA 2C93B 2V6NA 1UVTH 1ELEE 1AVWA 1P11E 1DVAH 2F83A 2F9PA 2ZPQA 3STIA 1NPMA 1GJAB 2M5TA 4NA9H 4ZUHA 1LKAA 1QFKH 1GI4A 1P04A 4K2YA 3BG4B 2GKVE 2SFAA 3IITA 1O2GH 1E0FD 2ZHDA 4K8BA 4VGCB 1SR5C 2B7DH 1C1TA 1CA0B 1DWCH 4LZ4B 3MMGA 3G01A 1GHXH 1T4VH 1YPKH 1F0UA 3T28A 1EJMA 1C5SA 1O3HA 4JZ1A 2RDLA 1T7CA 2G51A 3RM0H 1THPB 1HIAA 4MLFB 1O33A 1O2OA 2A1DB 4Y0ZE 3TIUA 1BTHH 2Y82A 1D3QB 2WV4A 1GI3A 1VITF 3I29A 3VB3A 1V2KT 4ABBA 1LPZB 5DG6A 4WMDA 1QB9A 5TCAA 2J4IA 1LPGB 4U01A 1QL8A 4OS6A 1O32A 1PQ7A 1GL0E 2ZP0H 1GMDG 2AGEX 3RUOA 1L1NA 1HBTH 3BEFB 4YLUA 2ZTXA 5PTPA 1GJ9B 1DSTA 2G55A 2WPJS 4ZHAA 3SU5A 2ZU3A 5HM9A 4NSYA 1BDAA 2CF8H 1O38A 4NA7A 2QGRA 3I78A 1H9IE 1FI8A 3ZZAA 3GY4A 1AN1E 3M3VA 2NWNA 2ZNKH 4XOJA 5EXLA 4DY7B 3RMNH 1XUFA 1AGJA 5FHTA 1MZDA 3VXEH 1F5LA 3GCHB 1JRTA 3C1KA 1A5IA 2BD8A 3EE0B 1GBFA 1TNHA 1GJ4H 3NXPA 1GG6C 1JMOH 1ARBA 1K2I1 4NIVA 1H9LB 2O9QA 2WPLS 2BQ6B 3LT3A 3DHKH 3S7KB 4TWWA 4U32A 1BBRH 1Y3UA 3A7YA 3SGBE 4X1PU 2GGVB 1FXYA 3ZVEA 3ZZDA 3P8OA 1B0FA 1SGIB 1CVWH 3FVFB 1BMLA 1FQ3A 1O3PB 5FPSA 2XC4A 3GICB 1UCYH 2QYIA 2GMTC 2WINI 4CRBA 4OS1A 1O3KA 4O3UA 2PWXA 2AMPA 1UVUH 1P2IA 1QGFA 4HZHA 1SB1H 1VR1H 1GGDB 1EAIA 1GBJA 1V6DA 1AZZA 3M5OA 1C5YB 1THRH 4FXGH 8GCHG 3GY5A 3RC5A 5JYIA 4OS5A 4IS5A 2FS8A 1FDPA 1GHYH 3TH3H 2K1QA 3UUZA 3MO3A 1MU6B 1UHBB 4FUBA 1YCPH 3Q76A 1CQQA 1LDTT 3ODFA 4CBOA 1M9UA 3CP7A 1HV7A 4I32A 4AYYB 1TQ0B 2TGTA 5ESBA 2EC9H 4JZFH 5HYOA 4BAKB 1C4V2 4YOJA 2DE8A 1GCTB 2C90B 2GCTC 3LKWA 4FUGA 3SNBA 1EZUC 1G37A 1QBVH 3MHWU 2BX3A 1CBWC 2FP7B 1ZMNA 1FPHH 1HRTH 2QC2A 3A7VA 1UK3A 4IC5A 1ZJDA 3SN8A 3L33A 2VU8E 1LHEH 3RXVA 2RA3A 1C2IA 5JPMH 1QQUA 3E3TA 1GVKB 1C2JA 1HUTH 2FOHA 3BTFE 3EQ0H 4D7FA 1IHTH 1P2QA 3A8AA 1GPZA 4X2YA 5JBBS 2D8WA 1GBCA 2J94A 2SNWA 2ZTYA 5ABWA 1O3LA 2WPIS 1RRKA 2PSYA 4DG4A 1Y5AT 1Y3YA 3GY3A 3IG6B 2PKAB 2BD4A 3RMLH 1SQAA 3RLWH 4ZKOU 1YPMH 2FOMB 2PFEA 2H9EH 5GJ4B 3KGPA 4ABEA 1HJAC 1T4UH 1AQ7A 1JXPA 1Z7KA 5GCHG 1XX9A 1D9IA 5AFZH 3Q3YA 5EPYA 4KP0A 3D62A 1HJ8A 5A2MH 3LH1A 1C5XB 3PO1C 1GI9B 5E0GA 3LPRA 4I33A 2ZC9H 3MO9A 1FIZA 1O5BB 2BVRH 4MPUA 7GCHG 2R9PA 1BHXF 4DW2U 3R3GB 2I6QA 2ZEBA 3A87A 2P94A 5C1YA 3SJOA 1MBQA 3HKIB 2BTCE 3OTJE 4WH8A 4KTCA 1G32B 2PKSB 1TMUH 3ZVDA 4BTUB 3TK6A 1F2SE 1ZGVA 1V2PT 4VGCC 3E91A 1QRZA 1CA0C 5C67A 1CE5A 1ZSLA 3K6YA 4MG3A 4MQAA 1BTYA 3OY6U 2Y80A 3SU6A 2VIQA 3GDSA 1K1OA 1OYTH 1S6HA 5AFYH 1ZR0A 1SQTA 1Q3XA 1P2NA 1EB1H 2ANMH 2YNBA 1LKBA 3A82A 1EUFA 2AGIX 1AKSB 2FDAA 1LHCH 2BLVA 2EI7A 1J17T 5DP5A 5DP4A 1AB9B 4Y0YE 2BD9A 2ZU4A 4AX9H 2AFQB 2HLCA 2R3YA 3GOVB 1UVPA 3SNAA 1EAXA 1VITH 2Z9GA 2F9NA 1PPHE 4Q2KA 1MKWK 1GJ6A 1LVBA 3ODDA 2PLXA 1FY5A 3P8FA 1TIOA 1P3EA 3UFAA 1YBWA 1QA0A 1W3CA 2J92A 1O2HA 2HNTC 1O2TA 5GWZA 1LTOA 3M61U 3M7QA 1KSNA 2ZCHP 3ZZCA 1ARCA 1HB0B 1EB2A 1EPTB 3MO6A 2RG3A 1MTNC 3DUXH 1BTXA 1C1SA 1C1MA 3ZYDA 3TU7H 2ODPA 1FAXA 3GYMA 1D6RA 2W7UA 3OU0A 2BVSH 3BN9A 4CR9A 2XXLA 2YOLA 1KDQA 2ZU1A 2GV6A 4ABDA 3UQVA 1BB0B 3V0XA 2NU0E 2GCHG 1OSSA 1ZSKA 3GCHC 1HYLA 2OC7A 1KTSB 1QY6A 3MU1A 5HXFA 1GBTA 3AASA 2DE9A 1AU8A 3EAJA 5JBCS 1C5OH 1O3MA 3SJKA 4E7NA 2GP9B 1OP0A 1SGFA 1Y5UT 1GHZA 1QJ6B 4FUDA 3A7ZA 1O3NA 2AMDA 1NFYA 3RC6A 2XBWA 1SGEE 3T62A 2VIWA 2BY7X 1DE7H 4GSOA 4RSPA 1O2IA 2BMGB 2Q6FA 4A5TS 3MWIU 3VFEA 2FTMA 3FP6E 3S9BA 1BZXE 1HXFH 3PTBA 2ZIQH 1WCZA 1TPOA 1DICA 1ZZZA 3L3TA 3SV7A 3RXEA 1XUJA 3S69A 3RLYH 4I8LA 1WSSH 3BTQE 3UWIA 1HDTH 1GGDC 2ZTZA 2A4RA 2BY9X 3SHAH 3KCGH 1S6FA 1ESTA 3BTME 1YLCA 2R2WU 5HM2A 2Z9LA 2I6SA 2Z94A 2FXRA 3FAOA 4JYUH 1DLKB 3A80A 3U69H 2O8WA 1O34A 2D1JA 4DJZB 2PR3A 3KQBA 3MNXA 1MU8B 4LOYH 3VB5A 1PQAA 2QY0B 5A8YA 2FX6A 2AYWA 1YPHE 3A84A 2V3HH 3ATKA 3F9EA 3RXBA 1GI2A 1SHHB 1GCTC 3L6PA 1TLDA 5I25A 4TYDA 1BT7A 2ZZUH 2QV1A 4NWLA 1O2NA 2G52A 4AORA 5EW2H 1J14A 1C2EA 2A7CA 1A61H 3SV9A 3V7TA 1CGHA 2BD5A 1SSXA 3RXLA 5GIBA 5A0CA 3KHVA 1Z1IA 1P05A 2A4OA 4TWYA 3PWCA 1EOLA 4UONA 1NFWA 2OC1A 2GZ7A 1NC6A 3SUFA 5C5OA 2J38A 1F5RA 1EJNA 1A3BH 1AVXA 1OS8A 3T29A 1XUHA 3RXAA 1NFXA 3HKJB 2OQ5A 1OP8A 3LONA 3SBKA 1FAKH 1E34B 1C1PA 1KXDA 2DUCA 2H5DA 2ZQ2A 4JZIA 1P9SA 4WF8A 1CA8B 3JZ1B 2CJIA 4X2WA 1KXBA 2VINA 3TITA 4ABAA 1TNLA 1MQ5A 1WQVH 5E0HA 3K9XB 4XBCA 1KXAA 3DA9B 5DP8A 2ZG0H 2TPIZ 2UUYA 1O2VA 4LXBH 2ODYB 1CT0E 1VGCC 1N1LA 1U6QA 1XXFA 2ULLA 5A8ZA 3UOPA 4SGAE 2HOBA 4E06H 3O8CA 3ATLA 1T8NA 1WYKA 1SGYE 4I8HA 2A4QA 1NRNH 5CMXH 3SV2H 1A46H 1SFIA 3HK6B 1OYQA 2OC8A 2ZI2H 2AERH 2AIPA 2BD2A 2AMQA 7KMEH 3B23B 1O39A 4M7GA 3W95A 4K1TA 2OD3B 5AVDA 1XKAC 1XUGA 2ZFQH 3SQHE 3SOSA 1GHAF 2PKSC 3M3TA 1KY9A 3SU3A 3ZZ5A 2J2UA 4A7IB 2BQWB 3AVZA 3ZZ3A 4MNXA 1P0SH 3FFGA 2QXIA 2JH5D 4Q80A 4X8VH 1WU1A 3UNSA 3Q00A 1HAVA 1GI6A 3V13A 1O2LA 1UJ1A 4AYVB 3KQCA 2QXJA 4DIIH 2JETB 1P2JA 3PB1E 1ETSH 1AB9C 4YT7H 2B9LA 4FUEA 1SI5H 1GI1A 1A3EH 1KIGH 2QF0A 4B71A 1XKBC 2BDCA 2BD7A 1EOJA 1VCQA 2VWMA 1EP5A 1SHYA 1SOTA 1V2TT 4AGKA 5CHAB 3ZVFA 1C5WB 3GYLB 3PO1B 2C8WB 4ABGA 1GBIA 1AUJA 1EPTC 2J95A 1C1OA 1K1PA 1SOZA 2CXVA 1AWFH 5IDKA 2ZKSA 1YLDA 4CR5A 4MPVA 1BRCE 3ATWA 1ZPZA 3GY7A 1BIOA 5LPFA 1OPHB 2VGCB 1OKXA 1GBLA 1SLUB 4TY6A 1ELFA 1GDQA 3GCTG 1S82A 4Y79A 1GI7B 3P8GA 2PUQH 2BY8X 2IN2A 2Y7XA 2WYJA 1C5ZB 2OP9A 1EX3A 1MZAA 4AGJA 8ESTE 1YF4A 1UVOA 1V2JT 4ZMAH 1C2HA 1GMHF 2Z6BD 1K1MA 1BMAA 6GCHF 3QZRA 2F9BH 3K6ZA 4NSVA 1N6XA 2BDHA 1S84A 3MYWA 3KN2A 2TIOA 1J8AA 3BTWE 1UTMA 1L2EA 4WMFA 5C1XA 1E35B 1BJUA 4UD9H 1BA8B 4YT6H 4F4OC 4CREA 5E0JA 2JH6D 1D4PB 3BIUH 4BTIB 2HPQH 2F9UA 3ITIA 1C1WH 2OCVB 5TCCA 3U8OH 1BRAA 4YLQH 1C5LH 2STAE 3RMOH 1FLEE 2ZHWH 3TNSA 3LGTA 1DUEA 4OS4A 1MTNB 4XE4A 1TNJA 1ZHPA 1C2LA 1DITH 2Y7ZA 1V2RT 1C9PA 5L30H 3KNXA 4GCHF 1IHSH 1DXWA 1NFUA 1Y8TA 4BOHA 4DVAU 2ALVA 1YC0A 5CE1A 1C1QA 1AKSA 1BTUA 2NU3E 1PPCE 1YCPM 1MMJN 4ZH8A 2SGAA 4CRDA 4ZHLU 2UWOA 4INLA 3F9HA 1KLJH 4HFPB 2H9TH 7ESTE 2FYQA 3PM3A 3RU4D 1GDUA 3PYHA 3TK5A 2A0QB 5EPNA 3TH2H 9ESTA 1FY8E 1L0ZA 3PMAB 3URDA 5FBEA 3TH4H 4LK4A 1IQGA 1PFXC 1SGPE 1EAUA 1S0RA 4ESTE 3SU4A 4WWYA 3A8BA 4NFFA 3FZZA 1O3OA 3KQEA 5T6FA 2XCFA 4X2VA 1H4WA 1OXGA 3Q3KA 2O8LA 1GHWH 2GX4A 3NCLA 5B6OA 2RA0A 3Q77A 2NU2E 3PMHB 1KTTB 5I46H 3U9AH 1CHOF 3MU8A 1O37A 4BAQB 3NPSA 1O5CB 1CO7E 2XNIA 1S83A 2VWOA 3D23A 3UQOA 2Q6GA 3F1SB 3LC3A 1N6YA 1QQ4A 4BAOB 1ESAA 2V3OH 1F0RA 2R0KA 4I8GA 1NU7B 3UNQA 2FESH 5T3HA 1WTHD 1S0QA 3ZZBA 4KKDA 1ELVA 4AG1A 2H6MA 3LGYA 3LJJA 3QTOH 2HGTH 3M7UA 1P8VC 1S81A 2XRCA 3LJOA 1BRBE 4K69A 1P02A 1INCA 2CHAB 4YM9A 5EOKA 4ZROA 3FP8E 2W5EA 2ZPRA 2SGFE 2WV5A 3Q3XA 2IPHA 1ID5H 1G36A 2A2QH 1ZMJA 1TE0A 1CT4E 4X6OA 3F9FA 1VZQH 2AEIH 4UEHH 1C5VA 3HATH 3P92A 2A5KA 1FUJA 3NUMA 2Y81A 1FIWA 4DIHH 1GHBF 2Z9JA 1CT2E 2KAIB 1K1LA 1QA7A 5FX6A 1MTWA 1QURH 1SVPA 1HAHH 3VXFH 1GCDA 3HGPA 1HLTH 1RS0A 5A09A 2IOTA 1T8LA 1TBZH 4HGCA 1XVOA 2BXUH 3GY6A 4R8TB 3SHCH 2IJOB 5F6MA 4XDEA 1TPPA 1UK4A 2PTNA 4NG9H 1LQEA 4YESB 2WPKS 1AIXH 4U30A 1P06A 1QL9A 3LGUA 1UTOA 4MNWA 3ZVBA 3T27A 2BB4A 3UREA 3P8NA 1TX7A 3M5LA 1QIXB 3SZNA 2GZ8A 5EXMA 1P03A 1W7XH 2VH0A 2ZHEH 5DP3A 2JETC 3UPEA 1BOQA 3GDUA 5EQRA 4A1TA 4H4FA 2P8OB 4B73A 1O5DH 1MKWH 1IQJA 3RXFA 1TGNA 1O3CA 4FUJA 1VGCB 4KTUA 4A1VA 3BTHE 4O97A 1GJ5H 1SGQE 1HPGA 4KTSA 2P59A 5CHAC 1XMNB 2Z7FE 1TOCB 2VIPA 1OWIA 2GT8A 1V2WT 4FUFA 3EYDA 1JBUH 4MTBA 1TGTA 2EI8A 2VB0A 3RXMA 1OWHA 4ZKRU 1RFNA 2FWWA 2RCEA 2ZFPH 2R3UA 1FY3A 5BPEA 3FANA 1O2SA 1X7AC 1SGRE 1FMGA 1DLEA 1L4DA 1YPEH 2FM2A 2R2MB 1O3AA 2VGCC 1GMDF 3M5MA 4ZKSU 1P2KA 2P3UB 1SMFE 3MNCA 1AUTC 1HIAB 1O2XA 2ZU2A 1GVLA 5EU8A 2QN5T 4FU8A 3H7OA 3BTEE 3T25A 1QB1A 4FVDA 1DOJA 1UMAH 5FBIA 4I8JA 4UFGH 1O36A 1C1RA 1EKBB 3PWBA 3RXSA 5C5NA 4BANB 1Q31A 3RP2A 2UUFB 4OGXA 3PLPA 4CH2B 1QBOA 4GVUA 4AFQA 2ZFFH 3U1JB 3K2UA 1HFDA 1SGTA 3ZZ9A 2XBXA 2OINA 4X6NA 4H6TA 1OWDA 1G3DA 1LQDB 1OWJA 4BAHB 1SGCA 1NM6A 1GJ8B 1FV9A 3H5CB 3LGVA 2ZF0H 2ZDMA 1GMCF 4WXVA 1DY9A 1ABIH 4JCNA 1HNEE 2ZPSA 3BG8A 3F68H 1ORFA 2BDYA 2XWBI 3GCOA 1C5QA 1A7SA 2EEKA 1EZSC 3RU4E 3A81A 4BXWA 1NRPH 1Z1JA 1ZYOA 5EW1H 4NGAH 1KLIH 4CRGA 3RXTA 1HJ9A 2Q6DA 4K60A 2SGPE 3QN7A 1GBMA 1W8BH 4Y7BA 2BYAX 2LNCA 1T8MA 4MNVA 1UVSH 1AE8H 2FOFA 4CHAB 1LMWB 1C2KA 1BITA 1C4Y2 3DFLA 1LVMA 2G81E 5E2OA 4AN7A 1YPGH 8GCHF 1YPJH 1TWXB 3N7OA 1Y5BT 1PJPA 3VB7A 5DP9A 3TJVA 1OWKA 5EG4A 1SGNE 2J34A 4R0IA 1LHDH 2ZFTA 4K3JA 2UWPA 2OXSA 3VB4A 2BZAA 1K1NA 3LU9B 1KXEA 1ZPBA 1K28D 1Y3WA 3SUGA 1A0JA 1C2GA 1NS3A 3DFJA 1TMTH 1QHRB 2VH6A 1QBNA 2AGGX 3FP7E 2BDAA 5FCKA 3H7TA 5DKMA 1MTSA 4HI3A 1BJVA 1W10U 4X1QU 3QLPH 2BM2A 3TLOA 2B5TB 3LH3A 4X0WU 1EJAA 3RU4T 1WOFA 4NIXA 4Q7ZA 1TYNA 4XBDA 2C4FH 3CS0A 3BTTE 3E0NB 1K1IA 3U8RH 1OP2A 2SGEE 3LDXH 2AS9A 2ZGHA 2CHAC 1E38B 4Y71A 5G4BA 4AG2A 4INHA 2Y5HA 3T2NA 1WV7H 1VCWA 2J9NA 3S0NA 1W2KH 4OS7A 2WUBA 3A8DA 1WAYB 1KLTA 2BDGA 4H6SB 1AHTH 4O9VA 4GHTA 3VGCB 2OC0A 2F9OA 4J1YA 1ZJKA 1MAXA 1BMMH 4Q7XA 5BRRE 2FI3E 2SGDE 3LOXA 3PMJA 3RXUA 3BEUA 1ZMLA 3GDVA 4IW4E 1BTZA 1NY22 4YOIA 5EXNA 4Z0KA 1VITG 1ZOMA 2H2ZA 1MQ6A 1W0ZU 2PSXA 3U98H 4THNH 1C5MD 4YZUA 5JB8S 2ZQ1A 1FONA 3SU2A 7GCHF 1WTGH 3GY2A 5J4SA 5F03A 1IQMA 4XBBA 3AAUA 1F0TA 2ZCLP 1TRYA 2A5AA 2FOAA 4X8SH 4AOQA 1EZXC 1DFPA 1C5TA 1PYTC 4GCHG 1UTKA 1RIWB 2CF9H 3ATMA 1BRUP 1GBBA 1FY4A 2Z9IA 3QGJA 3S9AA 1SGFG 2P8OC 1EASA 1ANDA 1O3DA 1PPZA 1O5GH 3GY8A 3QX5H 2TRMA 1TAWA 4ISHH 2FI4E 1W0YH 1DWBH 3E8LA 2OBOA 3QTVH 1GI0A 1TABE 4I8KA 2GV7A 3KQDA 5C3NA 1TPAE 3RDZA 3SJ8A 3A7TA 2ZO3H 1AY6H 2UUKB 2A2XH 4JYVH 2ODQA 1P01A 4JK5A 2Z3DA 3E16B 4IN2A 1IQLA 2QA9E 1O2YA 5H4IB 3UIRA 1NRSH 3EA9A 1GJ7B 3QDZB 1ZHRA 1TQ7B 1Z8GA 2VIDA 1K1JA 1O5FH 3GISB 1QR3E 1YGCH 2ZDAH 3ZVAA 2C8YB 2CGAA 3SGQE 3STJA 1D6WA 3SI3H 1AI8H 1CHOG 1QCPA 5E2PA 4ZXYH 1C2MA 1UHBA 2ANYA 2SGQE 1YM0A 2XBVA 4KELA 4BXSA 3ZZ8A 3F9GA 4NWKA 1AWHB 3W94A 1H8IH 2VWNA 4B75A 1MCTA 1KXFA 4MDSA 2HNTE 4CBNA 1ESBA 1DANH 1G9IE 1YYY1 2FLRH 2GCHF 3KEEA 2KAIA 4LZ1H 2Y5GA 4K1SA 3UY9A 5C20A 1V2UT 1P09A 2OBQA 1C4U2 1Z6JH 4HTCH 2NU1E 3CS7A 2NU4E 1EZQA 1T31A 2C8ZB 1E37B 2HRVA 4OGYA 1C5RA 1DS2E 5FPYA 2TGDA 4E05H 1Z8RA 2PW8H 5GPIB 1KDQB 3TNTA 1DWEH 4DT7B 1GHBG 4X2XA 1EATA 4FU7A 1A4WH 1NT1A 3E0PB 1TB6H 4Y8XA 4GPGA 3BV9B 5DGJA 3UR6A 1HAZB 4CRFA 4WVPE 4TPYA 2HVXA 1AFQB 2PHBA 2PKAA 3PROA 3SGAE 3T5FH 4FU9A 4CHAC 2JKHA 2G4UA 2VVUA 1ABJH 4JYTA 1C1VH 1SL3A 1Y59T 2VIVA 1AZ8A 4A1XA 4ASHA 3BF6H 1K21H 4ISNA 2ZFRH 1HGTH 2A45B 4ISLA 1PPBH 2ZCKP 1BCUH 1O2MA 3VPKA 5LH8A 5C2ZA 3O8BA 3RM2H 2QIQA 2SNVA 3D49H 4IMZA 4ZAEA 1O2WA 5DK1A 1SG8B 2FS9A 1HAXB 2FEQH 1TPSA 3LC5A 3I77A 3NZIA 1NRRH 2XBYA 2FLBH 3A8CA 1P57B 2WYGA 1GI8B 2GD4B 1G3CA 1LVYA 2VWLA 2R0LA 2Y6TA 5L6NH 2ZHFH 1G3BA 1UTLM 5SGAE 1QL7A 4GLYA 2ZGBH 1AE5A 2W26A 1MKXK 2GT7A 5F8TA 1O2ZA 4J2YB 4D8NA 4DCDA 4FUCA 4K8YA 1GJCB 1L4ZA 4TPIZ 3QUMP 1W12U 1KYNA 3ENSB 3MNSA 1LO6A 1ACBE 4GAWA 2ZGCA 5LPEA 4RKJB 3TVJB 4WXIA 2H1UA 1C2FA 1BQYA 1QB6A 1S85A 1MD7A 2FX4A 4Y6DA 3RXCA 2C3SA 2W7SA 2ESTE 3TJUA 5F8ZA 1UTQA 1A5GH 1OWEA 1AVGH 7LPRA 3M7TA 2HPPH 8LPRA 2P3FH 1P12E 1Z8JB 3A89A 1FJSA 1EXFA 2BZ6H 1MTUA 2QAAA 2ZDLA 2A32A 1NTPA 1G2LA 3VGCC 5K0HA 3ZZ6A 3OX7U 4ISIH 3MH6A 3RXHA 1EPTA 3KIDU 2GTBA 3B9FH 1O5AB 2ZGJA 3FZDA 1HXEH 2CN0H 3SV8A 4K5ZA 3NKKA 4BAMB 1MH0A 2FODA 1AD8H 3WY8A 2AIQA 3A7WA 3UOUA 3SNDA 1GMCG 3GCNA 4IN1A 1SC8U 1SGDE 3RC4A 1G30B 2Y5FA 4MVNA 1RJXB 2A7JA 6CHAB 4NIYA 3U8TH 1O2UA 2STBE 1ELTA 2XCNA 2WUCA 2B0FA 4B1TA 4DURA 3SUDA 1DT2A 1A0HB 4ISOA 2ZHQH 1W14U 3EGKH 4FUHA 4AFUA 3OY5U 1E36B 3AW1A 2HNTF 1H9HE 1W7GH 1RIWC 1DUAA 1RD3B 1TOMH 4WY3A 2OLGA 4WJG2 2THFB 4OS2A 4O3TA 1H8DH 1PPEE 5DO4H 4O03A 3VEQB 2XC5A 4IBLH 2D26C 4GHQA 1ETRH 1ZRKA 4X1NU 2ANKH 5C1UA 2VVCA 3ELAH 1TA2A 2VJ1A 1WBGB 2G5NA 1H1BA 4UFFH 2ILNA 3ZZ7A 1UO6A 3E1XB 1ELCA 1WUNH 5HMAA 2OQUA 1EAWA 1ZTJA 3MOCA 4A92A 4DOQA 3BSQA 3MH7A 3TJNA 3A85A 3ESTA 1TALA 4AFSA 5HGGA 5K7RA 1BHXB 3JZ2B 4KGAA 1LVOA 1Y3VA 1TBQH 4INKA 4X6MA 3U1IB 2A7HA 1ZTKA 2ZDKA 3UNRA 1HAVB 2GDDA 2BY5X 2HALA 1P2OA 1D3PB 1O0DH 5T6GA 3RXKA 3IWMA 4I7YH 1ELGA 1O3JA 3BTDE 4X1SU 4JZDH 3RXGA 1AMHA 1XUIA 3RMMH 3NWUA 1FN8A 1MCVA 1YPHC 1BBRK 2FI5E 3ZVCA 5A8XA 5FAHA 1PPGE 2YNAA 1QNJA 1XUKA 1QJ7B 3GCTF 4WH6A 1W11U 2XW9A 1UCYK 3E6PH 3MFJA 5E8EH 5JBAS 1V2LT 3LIWA 1Z8IB 2TGAA 1NRQH 5JB9S 4TY7A 1FZZA 1RGQA 2A5IA 2BD3A 3M36A 4SGBE 2ZDVH 1A1RA 1QJ1B 1PPFE 5DP6A 1W13U 1JRSA 4ZXXH 3VB6A 1TA6A 1TNKA 4XSKU 5ETXA 1J15A 4NFEA 1LCYA 4ZKNU 1V2MT 2PGQB 4A6LA 2PTCE 4YO9A 3RXIA 2EA3A 3UWJH 4B2AA 1GBDA 1YCPK 3TJOA 3B8JA 1B7XB 2O8MA 4BTTB 4I31A 1TGSZ 1TMBH 3BTGE 5FCRA 1O2RA 2BOKA 6ESTA 1TNIA 3P95A 1GDNA 1P3CA 1P9UA 2FIRH 1V2VT 1AFQC 5DP7A 2P93A 1THSH 3QO6A 1B0EA 4BNRA 2O8UA 1HAPH 1NZQH 1C1NA 3A86A 3EA8A 4D76A 1O35A 2TBSA 1O31A 1GI5A 5DPAA 1ZSJA 1P10A 1WQSA 3MU4A 4B2BA 2BHGA 4D7GA 3PLKA 1O2KA 1MTVA 1BBRE 1IAUA 2P3TB 3AAVA 3ZZ4A 5JDUB 2UWLA 1N8OB 1CSOE 1SPJA 3BG4C 1Z6EA 1JIMA 3ZYEA 2C8XB 2GDEH 1GBKA 3KL6A 3BEIB 5AHGH 4YOGA 1Q2WA 3MTYA 1UCYE 5JBTA 1IQNA 2FYRA 2BX4A 3RXRA 2WPHS 1GJDB 4D9QA 1TNGA 1EQ9A 2ZDNA 1MUEB 4UE7H 3RXJA 3S9CA 1O3GA 3MH4A 1ELBA 4NCYA 2ANWA 3UR9A 2Z3EA 4JK6A 4AFZA 2D2DA 1BMNH 2VNTA 1NO9H 5L2ZH 3PMBB 1NROH 2BQ7B 2G00A 4E7RG 1V3XA 1BUIA 1ANBA 1HCGA 2F9VA 3O8DA 2BOHB 1F0SA 1TRNA 3SNEA 3MNBA 1C5NH 1IQFA 4K1EA 3QK1A 5EQQA 1O2QA 1O3IA 1FN6A 5FPTA 4JZEH 1J9CH 5F8XA 3SORA 2ZECA 2XC0A 5DJ7A 1CHGA 1D3TB 4PROA 2ZGXH 4XFQA 2JH0D 1G3EA 2A31A 3RXDA 3BIVH 1GHAG 1GWAA 3SU0A 2BVXH 4B74A 2Q1JA 3S7HB 4MPXA 3A83A 1C5PA 5TJXA 1LPKB 2G8TA 8KME2 2P95A 1LHFH 2G5VA 3ZV9A 1GVZA 4Y10E 1F92A 3E90B 1HAOH 3AW0A 2FTLE 3QZQA 3HK3B 3SQEE 1FNIA 1D3DB 1O3EA 1VJ9U 1TGCA 1ELDE 4ABHA 2VIOA 5EQSA 2BLQA 1FY1A 4F49A 5ESTE 2FOBA 1RXPA 5FXLA 5T6DA 3DD2H 4GUXA 4X8UH 3TGJE 4AB8A 4CRCA 1PQ5A 3EDXB 3TGKE 1QTFA 1IQHA 1SLXB 3SNCA 2XWAA 1TBRH 2FPZA 2QCYA 3LGIA 3RXQA 1PQ8A 2Z3CA 3D65E 3T26A 1ETTH 2EI6A 1DX5M 1JOUB 1ZPCA 1F7ZA 1MBMA 3M3SA 5IYTA 6CHAC 3SV6A 1HAIH 2BLWA 2PV9B 2V35A 3SJIA 4UFEH 3SO3A 1C9TA 2XYAA 1C5UA 3NK8A 1O2PA 1GJBB 2ASUB 5EODA 1K22H 1TRMA 4Q7YA 1K9OE 1DM4B 2P16A 1CGJE 4H42U 4RKOB 1HAGE 4X8TH 4MNYA 4Y76A 2ZA5A 2G4TA 2QXHA 2ALPA 1GBEA 3PTNA 2FMJA 1ANEA 4DGJA 3TPIZ 4Y8YA 2F3CE 1AO5A 1A5HA 1V2NT 1TGBA 1RTKA 4U2WA 1BTWA 1ELAA 1OOKB 1A2CH 3M37A 2W3IA 1UK2A 1GMHG 2ZFSA 2FOGA 1JIRA 2PGBB 4X6PA 6GCHG 1TX8A 4NA8A 4YTAA 1IQEA 3V12A 4MPWA 1V2QT 1TONA 5GCHF 3P6ZB 1C1UH 1O3BA 4B76A 1Y3XA 4AB9A 2F91A 2LPRA 2QXGA 2FZZA 1GG6B 1L1GA 1ZTLA 3C27B 2UUJB 3URCA 4QT8C 4NZLA 3UTUH 1UTNA 4ABFA 1BTPA 1DPOA 5L2YH 3OSYA 3M5NA 2H9HA 1O30A 1TX6A 2BY6X 1VCPA 2V0BA 2CMYA 3PLBA 4IC6A 2FOEA 1A0LA 1XM1A 3F6UH 2Z9KA 1RTLA 3QGNB 1DY8A 2GMTB 2HWLB 2FO9A 4Z6AH 1MAYA 1PYTD 1DXPA 1V2OT 3MU5A 4Y7AA 1UTPA 3MI4A 1FPCH 3RXPA 3CENA 3V3MA 5AF9H 2ZU5A 2VVVA 2OUAA 1RTFB 3P17H 3TK9A 3SI4H 2BXTH 1HAYB 5LGOA 6LPRA 1SBWA 4D9RA 1JWTA 4Y11E 1ZHMA 4ZHMU 5LPRA 1UTJA 4X1RU 4NZQA 3HPTB 4UFDH 2BLOA 3M35A 2CV3A 1GBAA 3MH5A 3BTKE 2B8OH 2H5CA 3A88A 1VJAU 5EGMA 1ANCA 5GDSH 1GL1A 1Z71A 1O3FA 3DT0H 3MU0A 4Y8ZA 1ZLRA 2ZWLH 1NESE 1C2DA 1KXCA 4ABIA 1IOEA 1ZRBA 2GCTB 1DSUA 3TGIE 2W3KA 4B2CA 1YPLH 1G2MA 4AZ2B 1SLWB 1CBWB 2GVFA 5FX5A 3PV4A 2OTVA 3SJ9A 3SU1A 1V2ST 4UDWH 3SUEA 1B5GH 1AFEH 1T8OA 1YP9A 1XXDA 4FUIA 5GXPA 1GBHA 2BDIA 2WPMS 3ZVGA 3R0FA 1N8OC 1SFQB 1NN6A 2AH4X 3P70B 4WMEA 5J4QA 1SQOA 1OX1A 1ZGIA 4RN6A 1CGIE 1NU9A 4CRAA 1GHVH 3EA7A 1F5KU 9LPRA 2A4GA 1XVMA 1CU1A 3K65B 4JMYA 1IQKA 1LHGH 1QRXA 3LGWA 5A0BA 4FVBA 2QF3A 4ABJA 1S5SA 2XTTB 3QWCH 3SW2B 4IGDA 1O2JA 2PUXB 1SLVB 1O5EH 3HGNA 3OYPA 1QRWA 5A0AE 1MD8A 1MKXH 1L1JA 1J16A 1P2MA 1HJAB 3A7XA
chains in the Genus database with same CATH superfamily
4OM9A 2BDBA 3RXOA 3O8RA 2FOCA 4IMQA 1T32A 1TFXA 3KF2A 1YKTA 3ZV8A 4CH8B 1DWDH 1DDJA 4NIWA 1EP6A 2TGPZ 2GZ9A 2O8TA 3ATIA 1IQIA 2C93B 2V6NA 1UVTH 1ELEE 1AVWA 1P11E 2K8IA 1DVAH 2F83A 2F9PA 1QZ8A 2ZPQA 3STIA 5KEDA 1NPMA 1GJAB 2M5TA 4NA9H 4ZUHA 1LKAA 1QFKH 1GI4A 1P04A 4K2YA 3BG4B 2GKVE 2SFAA 3IITA 1O2GH 1E0FD 2ZHDA 4K8BA 4VGCB 1SR5C 2B7DH 1C1TA 1CA0B 1DWCH 3F2FA 4LZ4B 1YWUA 3MMGA 3G01A 1GHXH 1T4VH 1YPKH 1F0UA 3T28A 1EJMA 1C5SA 1O3HA 4JZ1A 2RDLA 1T7CA 2G51A 3RM0H 1THPB 1HIAA 1W0KD 4MLFB 1O33A 1O2OA 2A1DB 3SYJA 4Y0ZE 3TIUA 1BTHH 2Y82A 1D3QB 2WV4A 1GI3A 1VITF 3I29A 3VB3A 1V2KT 4ABBA 1LPZB 5DG6A 4WMDA 1QB9A 5TCAA 2J4IA 1LPGB 4U01A 1QL8A 1E79D 4OS6A 1O32A 1PQ7A 1GL0E 2ZP0H 1GMDG 2AGEX 3RUOA 1L1NA 1HBTH 3BEFB 4YLUA 2ZTXA 5PTPA 1GJ9B 1DSTA 2G55A 2WPJS 4ZHAA 3SU5A 2ZU3A 5HM9A 4RI0A 4NSYA 1BDAA 2CF8H 1O38A 4NA7A 2QGRA 3I78A 1H9IE 1FI8A 3ZZAA 3GY4A 1AN1E 3M3VA 2NWNA 2ZNKH 4XOJA 5EXLA 4DY7B 3RMNH 1XUFA 1AGJA 5FHTA 1MZDA 3VXEH 1F5LA 3GCHB 1JRTA 3C1KA 1A5IA 2BD8A 3EE0B 1GBFA 1TNHA 2KX4A 1GJ4H 3NXPA 1GG6C 1JMOH 1ARBA 1K2I1 2RFKC 4NIVA 1H9LB 2O9QA 2WPLS 2BQ6B 3LT3A 3DHKH 3S7KB 4TWWA 4U32A 1BBRH 1Y3UA 3A7YA 3SGBE 4X1PU 2GGVB 1FXYA 3ZVEA 3ZZDA 3P8OA 1B0FA 1SGIB 1CVWH 3FVFB 1BMLA 1FQ3A 1O3PB 5FPSA 5KECA 2XC4A 3GICB 1UCYH 2QYIA 2GMTC 2WINI 4CRBA 4OS1A 1O3KA 4O3UA 2PWXA 5EJLA 2AMPA 1UVUH 1P2IA 1QGFA 4HZHA 1SB1H 1VR1H 1GGDB 1EAIA 1GBJA 1V6DA 1AZZA 3M5OA 1C5YB 1THRH 4FXGH 8GCHG 3GY5A 3RC5A 5JYIA 4OS5A 4IS5A 2FS8A 1FDPA 1GHYH 3TH3H 2K1QA 3UUZA 3MO3A 1MU6B 1UHBB 4FUBA 1YCPH 3Q76A 1CQQA 2XOKD 1LDTT 3ODFA 4CBOA 1M9UA 3CP7A 1HV7A 4I32A 4AYYB 1TQ0B 2TGTA 5ESBA 2EC9H 4JZFH 5HYOA 4BAKB 1C4V2 4YOJA 2DE8A 1GCTB 2C90B 2GCTC 3LKWA 4FUGA 3SNBA 1EZUC 1G37A 1QBVH 3MHWU 2BX3A 1CBWC 2FP7B 1ZMNA 1FPHH 1HRTH 2QC2A 3A7VA 1UK3A 4IC5A 1ZJDA 4AC9A 3SN8A 3L33A 2VU8E 1LHEH 3RXVA 2RA3A 1C2IA 2HLDD 5JPMH 1QQUA 3E3TA 5FL7D 1GVKB 1C2JA 1HUTH 5EIYA 2FOHA 5KGOA 3BTFE 3EQ0H 4D7FA 1IHTH 1P2QA 3A8AA 1GPZA 5GNDA 4F48B 4X2YA 5JBBS 2D8WA 1GBCA 2J94A 2SNWA 2ZTYA 5ABWA 1O3LA 2WPIS 1RRKA 2PSYA 4DG4A 1Y5AT 1Y3YA 3GY3A 3IG6B 2PKAB 2BD4A 3RMLH 1SQAA 3RLWH 4ZKOU 1YPMH 2FOMB 2KCYA 2PFEA 2H9EH 5GJ4B 3ZIAD 3KGPA 4ABEA 1HJAC 1T4UH 5HIYA 1AQ7A 1JXPA 1Z7KA 5GCHG 1XX9A 1D9IA 5AFZH 3Q3YA 5EPYA 4KP0A 3D62A 1HJ8A 5A2MH 3LH1A 1C5XB 3PO1C 4RT0A 1GI9B 5E0GA 3LPRA 4I33A 2ZC9H 3MO9A 1FIZA 1O5BB 2BVRH 4MPUA 7GCHG 2F4LA 2R9PA 1BHXF 2OK5A 4DW2U 3R3GB 2I6QA 2ZEBA 3A87A 2P94A 5C1YA 3SJOA 1MBQA 3HKIB 2BTCE 3OTJE 4WH8A 4KTCA 1G32B 2PKSB 1TMUH 3ZVDA 4BTUB 3TK6A 1F2SE 1ZGVA 1V2PT 4VGCC 3E91A 1QRZA 1CA0C 5C67A 1CE5A 1ZSLA 3K6YA 4MG3A 4MQAA 1BTYA 3OY6U 2Y80A 3SU6A 2VIQA 3GDSA 1K1OA 1OYTH 1S6HA 5AFYH 1ZR0A 1SQTA 1Q3XA 1P2NA 1EB1H 2ANMH 2YNBA 1LKBA 3A82A 3FO8D 1EUFA 2AGIX 1AKSB 2FDAA 1LHCH 2BLVA 2EI7A 1J17T 5DP5A 5DP4A 1AB9B 4Y0YE 2BD9A 2ZU4A 4AX9H 2AFQB 2HLCA 2R3YA 3GOVB 1UVPA 3SNAA 1EAXA 1VITH 2Z9GA 2F9NA 1PPHE 4Q2KA 1MKWK 1GJ6A 3KQ5A 1LVBA 3ODDA 2PLXA 1FY5A 3P8FA 1TIOA 1P3EA 5DSFA 3UFAA 1YBWA 1QA0A 1W3CA 2J92A 1O2HA 2HNTC 1O2TA 5GWZA 3OAAD 1LTOA 3M61U 3M7QA 1KSNA 2ZCHP 3ZZCA 1ARCA 1HB0B 1EB2A 1EPTB 3MO6A 2RG3A 1MTNC 3DUXH 1BTXA 1C1SA 1C1MA 3ZYDA 3TU7H 2ODPA 1FAXA 3GYMA 1D6RA 2QF5A 2W7UA 3OU0A 2BVSH 4FOUC 3BN9A 4CR9A 2XXLA 2YOLA 1KDQA 2ZU1A 2GV6A 4ABDA 3UQVA 1BB0B 3V0XA 2NU0E 2GCHG 1OSSA 1ZSKA 3GCHC 1HYLA 2OC7A 1KTSB 1QY6A 3MU1A 5HXFA 1GBTA 3AASA 2DE9A 1AU8A 3EAJA 5JBCS 1C5OH 1O3MA 3H09A 3SJKA 4E7NA 2GP9B 1OP0A 1SGFA 1Y5UT 1GHZA 1QJ6B 4FUDA 3A7ZA 1O3NA 2AMDA 2HVYB 1NFYA 3RC6A 2XBWA 1SGEE 3T62A 4B6EA 3F3BA 2VIWA 2BY7X 1DE7H 4GSOA 4RSPA 1O2IA 2BMGB 2Q6FA 4A5TS 3MWIU 3VFEA 2FTMA 3FP6E 3S9BA 1BZXE 1HXFH 3PTBA 2ZIQH 1WCZA 1TPOA 1DICA 1ZZZA 3L3TA 3SV7A 3RXEA 1XUJA 3S69A 3RLYH 4I8LA 1WSSH 3BTQE 3UWIA 1HDTH 1GGDC 2ZTZA 2A4RA 2BY9X 3SHAH 3KCGH 1S6FA 1ESTA 1KMHB 3BTME 1YLCA 2R2WU 5HM2A 2Z9LA 2I6SA 2Z94A 2FXRA 3FAOA 4JYUH 1DLKB 3A80A 3U69H 2O8WA 1O34A 2D1JA 4DJZB 2PR3A 3KQBA 2KFWA 3MNXA 1MU8B 4LOYH 3VB5A 1PQAA 2QY0B 5A8YA 2FX6A 3KYGA 2AYWA 1YPHE 3A84A 2V3HH 3ATKA 3F9EA 3RXBA 1GI2A 1SHHB 1GCTC 3L6PA 1TLDA 5I25A 4TYDA 1BT7A 2ZZUH 2QV1A 4NWLA 1O2NA 1UW7A 2G52A 4AORA 5EW2H 1J14A 1C2EA 2A7CA 1A61H 3SV9A 3V7TA 1CGHA 4XD7D 2BD5A 1SSXA 3RXLA 5GIBA 5A0CA 3KHVA 1Z1IA 1P05A 2A4OA 4TWYA 3PWCA 2L74A 1EOLA 4UONA 1NFWA 2OC1A 2GZ7A 1NC6A 3OEED 3SUFA 5C5OA 2J38A 1F5RA 1EJNA 1A3BH 1AVXA 1OS8A 3T29A 1XUHA 3RXAA 1NFXA 3HKJB 2OQ5A 1OP8A 1SKYE 3LONA 3SBKA 2CK3D 1FAKH 1E34B 1C1PA 1KXDA 2DUCA 2H5DA 2ZQ2A 4JZIA 1P9SA 4WF8A 1CA8B 3JZ1B 2CJIA 4X2WA 1KXBA 2VINA 3TITA 4ABAA 1TNLA 1MQ5A 1WQVH 5E0HA 3K9XB 4XBCA 1KXAA 3DA9B 5DP8A 2ZG0H 2TPIZ 2UUYA 1O2VA 4LXBH 2ODYB 1CT0E 1VGCC 1N1LA 1U6QA 1XXFA 2ULLA 5A8ZA 3UOPA 4SGAE 2HOBA 4E06H 3O8CA 3ATLA 1T8NA 1WYKA 1SGYE 4I8HA 2A4QA 1NRNH 5CMXH 3SV2H 1A46H 1SFIA 3HK6B 1OYQA 2OC8A 2ZI2H 2AERH 2AIPA 1YY3A 2BD2A 2AMQA 7KMEH 3B23B 1O39A 4M7GA 5C0TA 2JJ2D 4K1TA 3W95A 2OD3B 5AVDA 1XKAC 1XUGA 2ZFQH 3SQHE 3SOSA 1GHAF 2PKSC 3M3TA 1KY9A 3SU3A 3ZZ5A 2J2UA 4A7IB 2BQWB 3AVZA 3ZZ3A 4MNXA 1P0SH 4DT4A 3FFGA 1YLNA 3DSOA 2QXIA 2JH5D 4Q80A 4X8VH 1WU1A 3UNSA 3Q00A 1HAVA 1GI6A 3V13A 1O2LA 1UJ1A 4AYVB 3W1EA 3KQCA 2QXJA 4DIIH 2JETB 1P2JA 3PB1E 1ETSH 1AB9C 4YT7H 2B9LA 2EY4C 4FUEA 1SI5H 1GI1A 1A3EH 1KIGH 2QF0A 4B71A 1XKBC 1MABB 2M2AA 2BDCA 2BD7A 1EOJA 1VCQA 2VWMA 1EP5A 1SHYA 1SOTA 1V2TT 4AGKA 5CHAB 3ZVFA 1C5WB 3GYLB 3PO1B 2C8WB 4ABGA 4Q4LA 1GBIA 1AUJA 1EPTC 2J95A 1C1OA 1K1PA 1SOZA 2CXVA 1AWFH 3DSGA 5IDKA 2ZKSA 4HG6A 1YLDA 4CR5A 4MPVA 4P00A 1BRCE 3ATWA 1ZPZA 3GY7A 1BIOA 5LPFA 1OPHB 2VGCB 1OKXA 1GBLA 1SLUB 4TY6A 1ELFA 1GDQA 3GCTG 1S82A 4Y79A 1GI7B 3P8GA 2PUQH 2BY8X 2IN2A 2Y7XA 2WYJA 1C5ZB 2OP9A 1EX3A 1MZAA 4AGJA 8ESTE 1YF4A 1UVOA 5DN6D 1V2JT 4ZMAH 1C2HA 1GMHF 2Z6BD 4Z1MD 1K1MA 1BMAA 6GCHF 3QZRA 5T1VA 2F9BH 3K6ZA 4NSVA 1N6XA 2BDHA 1S84A 3MYWA 3KN2A 2TIOA 1J8AA 3BTWE 1UTMA 1L2EA 4WMFA 5C1XA 1E35B 1BJUA 4UD9H 1BA8B 4YT6H 2IPQX 4F4OC 4ZCNA 4CREA 1E1RD 5E0JA 2JH6D 1D4PB 3BIUH 4BTIB 2HPQH 2F9UA 3ITIA 1C1WH 2OCVB 5TCCA 3U8OH 1BRAA 4YLQH 1C5LH 2AHME 2STAE 3RMOH 1FLEE 2ZHWH 3TNSA 3LGTA 1DUEA 4OS4A 1MTNB 4XE4A 1TNJA 2J98B 1ZHPA 1C2LA 1DITH 2Y7ZA 1V2RT 1C9PA 5L30H 3KNXA 4GCHF 1IHSH 1DXWA 1NFUA 1Y8TA 4BOHA 4DVAU 2ALVA 1YC0A 5CE1A 1C1QA 1AKSA 1BTUA 2NU3E 1PPCE 1YCPM 1MMJN 4ZH8A 2SGAA 4XRNA 4CRDA 4ZHLU 2UWOA 4INLA 3F9HA 1KLJH 4HFPB 2H9TH 7ESTE 2FYQA 3PM3A 3RU4D 1GDUA 3PYHA 3TK5A 2A0QB 5EPNA 2KZ4A 3TH2H 9ESTA 1FY8E 1L0ZA 3PMAB 3URDA 5FBEA 3TH4H 4LK4A 1IQGA 1PFXC 1SGPE 1EAUA 1S0RA 4ESTE 3SU4A 4WWYA 1SQRA 3A8BA 4NFFA 3FZZA 1O3OA 3KQEA 5T6FA 2XCFA 4X2VA 1H4WA 1OXGA 5IK2D 3Q3KA 2O8LA 1GHWH 2GX4A 3NCLA 5B6OA 2RA0A 3Q77A 2NU2E 3PMHB 1KTTB 5I46H 3U9AH 1CHOF 3MU8A 1O37A 4BAQB 3NPSA 1O5CB 1CO7E 2XNIA 1S83A 2VWOA 3D23A 3UQOA 2Q6GA 3F1SB 3LC3A 1N6YA 2KM0A 1QQ4A 4BAOB 1ESAA 2V3OH 1F0RA 2R0KA 4I8GA 1NU7B 3UNQA 3F2HA 2FESH 5T3HA 1WTHD 1S0QA 3ZZBA 4KKDA 1ELVA 4AG1A 2H6MA 3LGYA 3LJJA 3QTOH 2HGTH 3FOAA 3M7UA 1P8VC 1S81A 2XRCA 3LJOA 1BRBE 4K69A 1P02A 1INCA 2CHAB 4YM9A 5EOKA 4ZROA 3FP8E 2W5EA 2ZPRA 5EJZA 2SGFE 2WV5A 3Q3XA 2IPHA 1ID5H 1G36A 2A2QH 3WWBA 1ZMJA 1TE0A 1CT4E 4X6OA 3F9FA 1VZQH 2AEIH 4UEHH 1C5VA 3HATH 3P92A 2A5KA 1FUJA 3NUMA 2Y81A 1FIWA 4DIHH 1GHBF 2Z9JA 4P02A 1CT2E 2KAIB 1K1LA 2VBCA 1QA7A 5FX6A 1MTWA 1QURH 1SVPA 1HAHH 1K0HA 3VXFH 1GCDA 3HGPA 2YMSB 1HLTH 1RS0A 5A09A 2IOTA 1T8LA 1TBZH 4HGCA 1XVOA 2BXUH 3GY6A 3MQKC 4R8TB 3SHCH 2IJOB 2KCPA 5F6MA 4XDEA 1TPPA 1UK4A 2PTNA 4NG9H 1LQEA 4TT3D 4YESB 2WPKS 1AIXH 4U30A 1P06A 1QL9A 1COWD 3LGUA 1UTOA 4MNWA 3ZVBA 3T27A 5C17A 2BB4A 3UREA 3P8NA 1TX7A 3M5LA 1QIXB 3SZNA 4F55A 2GZ8A 5EXMA 1P03A 1W7XH 2VH0A 2ZHEH 5DP3A 2JETC 3UPEA 1BOQA 3GDUA 5EQRA 4A1TA 4H4FA 2P8OB 4B73A 1O5DH 1MKWH 1IQJA 3SZEA 3RXFA 1TGNA 1O3CA 4FUJA 1VGCB 4KTUA 4A1VA 3BTHE 4O97A 1GJ5H 1SGQE 1HPGA 4KTSA 1H8HD 2P59A 1XMNB 5CHAC 2W6ID 2Z7FE 1TOCB 2VIPA 4YXWD 1OWIA 2GT8A 1V2WT 4FUFA 3EYDA 1JBUH 4MTBA 1TGTA 2EI8A 2VB0A 3RXMA 1OWHA 4ZKRU 1RFNA 2FWWA 2RCEA 2ZFPH 2R3UA 1FY3A 5BPEA 3FANA 1O2SA 1X7AC 1SGRE 1FMGA 1DLEA 1L4DA 1YPEH 2FM2A 2R2MB 1O3AA 2VGCC 1GMDF 3M5MA 4ZKSU 1P2KA 2P3UB 1SMFE 3MNCA 1AUTC 1HIAB 1O2XA 2ZU2A 1GVLA 5EU8A 2QN5T 4FU8A 3H7OA 3BTEE 3T25A 1QB1A 4FVDA 1DOJA 1UMAH 5FBIA 4I8JA 4UFGH 1O36A 1C1RA 1EKBB 3PWBA 3RXSA 5C5NA 4BANB 1Q31A 3RP2A 2UUFB 4OGXA 3PLPA 4CH2B 1QBOA 4GVUA 4AFQA 2ZFFH 1E1QD 3K2UA 3U1JB 1HFDA 1SGTA 3ZZ9A 2XBXA 2OINA 4X6NA 4H6TA 1OWDA 1VKYA 1G3DA 1LQDB 1OWJA 4BAHB 1H8ED 1SGCA 1NM6A 4B6FA 1GJ8B 1FV9A 4ASUD 3H5CB 3LGVA 2ZF0H 4FETA 2ZDMA 1GMCF 4WXVA 1DY9A 1ABIH 4JCNA 1HNEE 2ZPSA 3BG8A 3F68H 1ORFA 2BDYA 2XWBI 3GCOA 1C5QA 1A7SA 2EEKA 1EZSC 3RU4E 3A81A 4BXWA 1NRPH 1Z1JA 1ZYOA 5EW1H 4NGAH 1KLIH 4CRGA 3RXTA 1HJ9A 2Q6DA 3FKSD 4K60A 2SGPE 3QN7A 2V3MA 1GBMA 1W8BH 4Y7BA 2BYAX 2LNCA 1T8MA 4MNVA 1UVSH 1AE8H 2FOFA 4CHAB 2L6OA 1LMWB 2K0QA 1C2KA 1BITA 1C4Y2 3DFLA 1LVMA 2G81E 5E2OA 4AN7A 1YPGH 8GCHF 1YPJH 1TWXB 3N7OA 1Y5BT 1PJPA 3VB7A 5DP9A 5C94A 3NRLA 3TJVA 1OWKA 5EG4A 1SGNE 2J34A 4R0IA 1LHDH 1W0JD 2ZFTA 4K3JA 2UWPA 2OXSA 3VB4A 2BZAA 1K1NA 3LU9B 1KXEA 1ZPBA 1K28D 1Y3WA 3SUGA 1A0JA 1C2GA 1NS3A 3DFJA 1TMTH 1QHRB 2VH6A 2WZQA 1QBNA 2AGGX 3FP7E 2BDAA 5FCKA 3H7TA 5DKMA 1MTSA 4HI3A 1BJVA 1W10U 4X1QU 3QLPH 2BM2A 3TLOA 2B5TB 3LH3A 4X0WU 1EJAA 5EJ1A 3RU4T 1WOFA 4NIXA 4Q7ZA 1TYNA 4XBDA 2C4FH 3CS0A 3BTTE 3E0NB 1K1IA 3U8RH 1OP2A 2SGEE 3LDXH 2AS9A 2ZGHA 2CHAC 1E38B 4Y71A 5G4BA 4AG2A 4INHA 2Y5HA 3F2GA 3T2NA 1WV7H 1VCWA 2J9NA 3S0NA 1NBMD 1W2KH 2W6JD 4OS7A 2WUBA 3A8DA 1WAYB 1KLTA 2BDGA 4H6SB 4I86A 1AHTH 4O9VA 4GHTA 3VGCB 2OC0A 2F9OA 4J1YA 1ZJKA 1MAXA 1BMMH 4Q7XA 5BRRE 2FI3E 2SGDE 2YMSC 3LOXA 3PMJA 3RXUA 3BEUA 1ZMLA 3GDVA 4IW4E 1BTZA 1NY22 4YOIA 5EXNA 4Z0KA 1VITG 1ZOMA 2H2ZA 1MQ6A 1W0ZU 2PSXA 3U98H 4THNH 1C5MD 4YZUA 5JB8S 3GS9A 2ZQ1A 1FONA 3SU2A 7GCHF 1WTGH 3GY2A 5J4SA 5F03A 1IQMA 4XBBA 3AAUA 1F0TA 2ZCLP 1TRYA 2A5AA 2FOAA 4X8SH 4AOQA 1EZXC 1DFPA 1C5TA 1PYTC 4GCHG 1UTKA 1RIWB 2CF9H 3ATMA 1BRUP 1GBBA 1FY4A 2Z9IA 3QGJA 3S9AA 1SGFG 2P8OC 1EASA 1ANDA 1O3DA 1PPZA 1O5GH 3GY8A 3QX5H 2TRMA 1TAWA 4ISHH 2FI4E 1W0YH 1DWBH 3E8LA 2OBOA 3QTVH 1GI0A 1TABE 4I8KA 2GV7A 3KQDA 5C3NA 1TPAE 3RDZA 3SJ8A 3A7TA 2ZO3H 1AY6H 2KR7A 2UUKB 2A2XH 4JYVH 2ODQA 2F43B 1P01A 4JK5A 2Z3DA 2JDID 3E16B 4IN2A 1IQLA 2QA9E 1O2YA 5H4IB 3UIRA 1NRSH 3EA9A 1GJ7B 3QDZB 1ZHRA 1TQ7B 1Z8GA 2VIDA 2QF4A 1K1JA 1O5FH 3GISB 1QR3E 1YGCH 2ZDAH 3ZVAA 2C8YB 2CGAA 3SGQE 3STJA 1D6WA 3SI3H 1AI8H 1CHOG 1QCPA 5E2PA 4ZXYH 1C2MA 1UHBA 2ANYA 2SGQE 1YM0A 2XBVA 4KELA 2JJ1D 3ZZ8A 4BXSA 3F9GA 4NWKA 1AWHB 3W94A 1H8IH 2VWNA 4B75A 1MCTA 1KXFA 4MDSA 2HNTE 4CBNA 1ESBA 1DANH 1G9IE 1YYY1 2FLRH 2GCHF 3KEEA 2KAIA 4LZ1H 2Y5GA 4K1SA 3UY9A 1FX0B 5C20A 1V2UT 1P09A 2OBQA 1C4U2 2XNDD 1Z6JH 4HTCH 2NU1E 3CS7A 2NU4E 1EZQA 1T31A 2KCAA 2C8ZB 1E37B 2HRVA 2JIZD 4OGYA 1C5RA 1DS2E 5FPYA 2TGDA 4E05H 1Z8RA 2PW8H 5GPIB 1KDQB 2PP6A 3U28C 3TNTA 1DWEH 4DT7B 1GHBG 4X2XA 1EATA 4FU7A 1A4WH 5CHBA 1NT1A 3E0PB 1TB6H 2J5UA 4Y8XA 4GPGA 3BV9B 5DGJA 3UR6A 1HAZB 4CRFA 4WVPE 4TPYA 2HVXA 1AFQB 2PHBA 2PKAA 3CNRA 3PROA 3SGAE 4ACAA 3T5FH 4FU9A 4CHAC 2JKHA 2G4UA 2VVUA 1ABJH 4JYTA 1C1VH 1SL3A 1Y59T 2VIVA 1AZ8A 4A1XA 4ASHA 3BF6H 3N7DA 3OE7D 1K21H 4ISNA 2LP6A 2ZFRH 1HGTH 2A45B 4ISLA 1PPBH 2ZCKP 3DSPA 1BCUH 1O2MA 3VPKA 5LH8A 5C2ZA 3O8BA 3RM2H 2QIQA 2SNVA 3D49H 4IMZA 4ZAEA 1O2WA 5DK1A 1SG8B 2FS9A 1HAXB 2FEQH 1TPSA 3LC5A 3I77A 3NZIA 1NRRH 2XBYA 2FLBH 3A8CA 1P57B 2EQNA 2WYGA 1GI8B 2GD4B 1G3CA 1LVYA 2VWLA 2R0LA 2Y6TA 5L6NH 2ZHFH 1G3BA 1UTLM 5SGAE 1QL7A 4GLYA 2ZGBH 1AE5A 2W26A 1MKXK 1NBME 2GT7A 5F8TA 1O2ZA 4J2YB 4D8NA 4DCDA 2KCOA 4FUCA 4K8YA 1GJCB 1L4ZA 4TPIZ 3QUMP 1W12U 1KYNA 3ENSB 3MNSA 1LO6A 1ACBE 3N7EA 4GAWA 2ZGCA 5LPEA 4RKJB 3TVJB 4WXIA 2H1UA 1C2FA 1BQYA 1QB6A 1S85A 1MD7A 2FX4A 4Y6DA 3RXCA 2C3SA 2W7SA 2ESTE 3TJUA 5F8ZA 1UTQA 1A5GH 1OWEA 1AVGH 7LPRA 2WV9A 3M7TA 2HPPH 3PRBA 8LPRA 2P3FH 1P12E 1Z8JB 2GJGA 1FJSA 3A89A 1EXFA 2BZ6H 1MTUA 2QAAA 2ZDLA 2A32A 1NTPA 3PRDA 1G2LA 3VGCC 5K0HA 3ZZ6A 3OX7U 4ISIH 3MH6A 3RXHA 1EPTA 3KIDU 2GTBA 3B9FH 1O5AB 2ZGJA 3FZDA 1HXEH 2CN0H 3PV5A 3SV8A 4K5ZA 3NKKA 4BAMB 1MH0A 2FODA 1AD8H 3WY8A 2AIQA 3A7WA 3UOUA 3SNDA 1GMCG 3GCNA 4IN1A 1SC8U 1SGDE 3RC4A 1G30B 2Y5FA 3WWFA 4MVNA 1RJXB 2A7JA 6CHAB 4NIYA 3U8TH 1O2UA 2STBE 1ELTA 2XCNA 2WUCA 2B0FA 4B1TA 4DURA 3SUDA 1DT2A 1A0HB 4ISOA 2ZHQH 1W14U 3EGKH 4FUHA 4AFUA 3OY5U 1E36B 3AW1A 2HNTF 1H9HE 1W7GH 1RIWC 1DUAA 1RD3B 1TOMH 4WY3A 2OLGA 4RT1A 4WJG2 4ACBA 2THFB 4OS2A 4O3TA 1H8DH 1PPEE 5DO4H 4O03A 3VEQB 2XC5A 4IBLH 2D26C 4GHQA 1ETRH 1ZRKA 4X1NU 2ANKH 5C1UA 2VVCA 1WXRA 3ELAH 1TA2A 2VJ1A 1WBGB 2G5NA 1H1BA 4UFFH 2ILNA 3ZZ7A 1UO6A 3E1XB 3UAIC 1ELCA 1WUNH 5HMAA 2OQUA 1EAWA 1ZTJA 3MOCA 4A92A 4DOQA 3BSQA 3MH7A 3TJNA 2V7QD 3A85A 3ESTA 1TALA 4AFSA 5HGGA 5K7RA 1BHXB 3JZ2B 4KGAA 1LVOA 1Y3VA 1TBQH 4INKA 4X6MA 3U1IB 2A7HA 1ZTKA 2ZDKA 3UNRA 1HAVB 2GDDA 5F53A 2BY5X 2HALA 1P2OA 1D3PB 1O0DH 5T6GA 3RXKA 3IWMA 4I7YH 1ELGA 1O3JA 3BTDE 4X1SU 4JZDH 3RXGA 1AMHA 1XUIA 3RMMH 3NWUA 1FN8A 1MCVA 1YPHC 1BBRK 2FI5E 3ZVCA 5A8XA 5FAHA 2LELA 1PPGE 2YNAA 1QNJA 1XUKA 1QJ7B 3GCTF 4WH6A 1W11U 2XW9A 1UCYK 3E6PH 3MFJA 5E8EH 5JBAS 1V2LT 3LIWA 1Z8IB 2TGAA 1NRQH 5JB9S 3WW7A 4TY7A 1FZZA 1RGQA 2A5IA 2BD3A 3F0OA 3M36A 4SGBE 2ZDVH 1A1RA 1QJ1B 1PPFE 5DP6A 1W13U 1JRSA 4ZXXH 3VB6A 1TA6A 1TNKA 4XSKU 5ETXA 1J15A 4NFEA 1LCYA 4ZKNU 1V2MT 2PGQB 4A6LA 2PTCE 4YO9A 3RXIA 2EA3A 3UWJH 4B2AA 1GBDA 1YCPK 3TJOA 3B8JA 1B7XB 2O8MA 4BTTB 4I31A 1TGSZ 1TMBH 3BTGE 5FCRA 1O2RA 2BOKA 6ESTA 1TNIA 3P95A 1GDNA 1P3CA 1P9UA 2FIRH 1V2VT 1AFQC 5DP7A 2P93A 1THSH 3QO6A 1B0EA 4BNRA 2O8UA 4TSFD 1HAPH 1NZQH 1C1NA 3A86A 3EA8A 4D76A 1O35A 2TBSA 1O31A 1GI5A 5DPAA 1ZSJA 1P10A 1WQSA 3MU4A 4B2BA 2BHGA 4D7GA 3PLKA 1O2KA 1MTVA 1BBRE 1IAUA 2P3TB 3AAVA 3ZZ4A 5JDUB 2UWLA 1N8OB 1CSOE 2J97A 1SPJA 3BG4C 1Z6EA 1JIMA 3ZYEA 2C8XB 2GDEH 1GBKA 3KL6A 3BEIB 5AHGH 4YOGA 1Q2WA 3MTYA 1UCYE 5JBTA 1IQNA 2FYRA 2BX4A 3RXRA 2WPHS 1GJDB 4D9QA 1TNGA 1EQ9A 2ZDNA 1MUEB 4UE7H 3RXJA 3S9CA 1O3GA 3MH4A 3DCLA 1ELBA 4NCYA 2ANWA 3UR9A 2Z3EA 4JK6A 4AFZA 2D2DA 1BMNH 2VNTA 1NO9H 5L2ZH 3PMBB 1NROH 2BQ7B 2G00A 4E7RG 1V3XA 1BUIA 1ANBA 1HCGA 2F9VA 3O8DA 2BOHB 1F0SA 1TRNA 3SNEA 3MNBA 1C5NH 1IQFA 4K1EA 3UB0A 3QK1A 5EQQA 1O2QA 5B6LA 1O3IA 1OHHD 1FN6A 5FPTA 4JZEH 1J9CH 5F8XA 3SORA 2ZECA 2XC0A 5DJ7A 1CHGA 1D3TB 4PROA 2ZGXH 4XFQA 2JH0D 1G3EA 2A31A 3OFND 3RXDA 3BIVH 1GHAG 1GWAA 3SU0A 2BVXH 4B74A 2Q1JA 3S7HB 4MPXA 3A83A 1C5PA 5TJXA 1LPKB 2G8TA 8KME2 2P95A 1LHFH 2G5VA 3ZV9A 1GVZA 4Y10E 1F92A 3E90B 1HAOH 3AW0A 2FTLE 3QZQA 3HK3B 3SQEE 1FNIA 1D3DB 1O3EA 1VJ9U 1TGCA 5HKKD 1ELDE 4ABHA 2VIOA 5EQSA 2BLQA 1FY1A 4F49A 5ESTE 2FOBA 1RXPA 2WHXA 5FXLA 5T6DA 3DD2H 4GUXA 4X8UH 3TGJE 4AB8A 4CRCA 1PQ5A 3EDXB 3TGKE 1QTFA 3FN8A 1IQHA 1SLXB 3SNCA 2XWAA 1TBRH 2FPZA 2QCYA 3LGIA 3RXQA 1PQ8A 2Z3CA 3D65E 3T26A 1ETTH 2EI6A 1DX5M 1JOUB 1ZPCA 1F7ZA 1MBMA 2IJD1 3M3SA 5IYTA 6CHAC 3SV6A 1HAIH 2BLWA 2PV9B 2V35A 3SJIA 4UFEH 3EE7A 3SO3A 1C9TA 2XYAA 1C5UA 3NK8A 1O2PA 1GJBB 2ASUB 5EODA 1K22H 1TRMA 2WPDD 4Q7YA 1K9OE 1DM4B 2P16A 1CGJE 4H42U 4RKOB 1HAGE 4X8TH 4MNYA 4Y76A 2ZA5A 2G4TA 2QXHA 2ALPA 1GBEA 3KYFA 2FMJA 3PTNA 5HIZA 1ANEA 4DGJA 3AK5A 3TPIZ 4Y8YA 2F3CE 1AO5A 1A5HA 1V2NT 1TGBA 1EFRD 1RTKA 4U2WA 1BTWA 1ELAA 1OOKB 1A2CH 3M37A 2W3IA 1UK2A 1GMHG 2ZFSA 4Q63A 2FOGA 1JIRA 2PGBB 4X6PA 6GCHG 1TX8A 4NA8A 4YTAA 1IQEA 3V12A 4MPWA 1V2QT 1TONA 5GCHF 3P6ZB 2J98A 1BMFD 1C1UH 1O3BA 4B76A 1Y3XA 4AB9A 2F91A 4M9FA 2LPRA 2QXGA 2FZZA 1GG6B 1L1GA 1ZTLA 1WDIA 3C27B 2YMSD 2UUJB 3URCA 4QT8C 4NZLA 3UTUH 1UTNA 3PV2A 4ABFA 1BTPA 2QE7D 1DPOA 5L2YH 3OSYA 3M5NA 2H9HA 1O30A 1TX6A 2BY6X 1VCPA 2V0BA 2CMYA 3PLBA 4IC6A 2FOEA 1A0LA 1XM1A 3F6UH 2Z9KA 1RTLA 3QGNB 1DY8A 2GMTB 2HWLB 2FO9A 4Z6AH 1MAYA 1PYTD 1DXPA 1V2OT 3MU5A 4Y7AA 1UTPA 3MI4A 1FPCH 3RXPA 3CENA 3V3MA 5AF9H 2ZU5A 2VVVA 2OUAA 1RTFB 3P17H 3TK9A 3SI4H 2BXTH 1HAYB 5LGOA 6LPRA 1SBWA 4D9RA 1JWTA 3OTPA 5CDFE 4Y11E 1ZHMA 4ZHMU 5LPRA 1UTJA 4X1RU 4NZQA 3HPTB 4UFDH 2BLOA 3M35A 2CV3A 1GBAA 3MH5A 3BTKE 2B8OH 2H5CA 3A88A 1VJAU 5EGMA 1ANCA 5GDSH 1GL1A 1Z71A 1O3FA 3DT0H 3MU0A 4Y8ZA 1ZLRA 2ZWLH 1NESE 1C2DA 1KXCA 3VG8A 4ABIA 1IOEA 1ZRBA 2GCTB 1DSUA 3TGIE 2W3KA 4B2CA 1YPLH 1G2MA 4AZ2B 1SLWB 1CBWB 2GVFA 2WSSD 5FX5A 3PV4A 2OTVA 3SJ9A 3SU1A 1V2ST 4UDWH 3SUEA 1B5GH 1AFEH 3OEHD 1T8OA 1YP9A 1XXDA 4FUIA 5GXPA 1GBHA 2BDIA 2WPMS 3ZVGA 3R0FA 1N8OC 1SFQB 1NN6A 2AH4X 3P70B 4WMEA 5J4QA 1SQOA 1OX1A 1ZGIA 2RDEA 4RN6A 1CGIE 1NU9A 4CRAA 1GHVH 3EA7A 1F5KU 9LPRA 2A4GA 1XVMA 1CU1A 3K65B 4JMYA 1IQKA 1LHGH 1QRXA 3LGWA 5A0BA 5C0UA 4FVBA 2QF3A 4ABJA 3N99A 1S5SA 2XTTB 3QWCH 3SW2B 3F0PA 4IGDA 1O2JA 2PUXB 1SLVB 1O5EH 3HGNA 3OYPA 1QRWA 5A0AE 1MD8A 1MKXH 1L1JA 1J16A 1P2MA 1S6LA 1HJAB 3A7XA
chains in the Genus database with same CATH topology
2BDBA 3RXOA 3O8RA 2FOCA 4IMQA 1T32A 1TFXA 3KF2A 1YKTA 3ZV8A 4CH8B 1DWDH 1DDJA 4NIWA 1EP6A 2TGPZ 2GZ9A 2O8TA 3ATIA 1IQIA 2C93B 2V6NA 1UVTH 1ELEE 1AVWA 1P11E 1DVAH 2F83A 2F9PA 2ZPQA 3STIA 1NPMA 1GJAB 2M5TA 4NA9H 4ZUHA 1LKAA 1QFKH 1GI4A 1P04A 4K2YA 3BG4B 2GKVE 2SFAA 3IITA 1O2GH 1E0FD 2ZHDA 4K8BA 4VGCB 1SR5C 2B7DH 1C1TA 1CA0B 1DWCH 4LZ4B 3MMGA 3G01A 1GHXH 1T4VH 1YPKH 1F0UA 3T28A 1EJMA 1C5SA 1O3HA 4JZ1A 2RDLA 1T7CA 2G51A 3RM0H 1THPB 1HIAA 4MLFB 1O33A 1O2OA 2A1DB 4Y0ZE 3TIUA 1BTHH 2Y82A 1D3QB 2WV4A 1GI3A 1VITF 3I29A 3VB3A 1V2KT 4ABBA 1LPZB 5DG6A 4WMDA 1QB9A 5TCAA 2J4IA 1LPGB 4U01A 1QL8A 4OS6A 1O32A 1PQ7A 1GL0E 2ZP0H 1GMDG 2AGEX 3RUOA 1L1NA 1HBTH 3BEFB 4YLUA 2ZTXA 5PTPA 1GJ9B 1DSTA 2G55A 2WPJS 4ZHAA 3SU5A 2ZU3A 5HM9A 4NSYA 1BDAA 2CF8H 1O38A 4NA7A 2QGRA 3I78A 1H9IE 1FI8A 3ZZAA 3GY4A 1AN1E 3M3VA 2NWNA 2ZNKH 4XOJA 5EXLA 4DY7B 3RMNH 1XUFA 1AGJA 5FHTA 1MZDA 3VXEH 1F5LA 3GCHB 1JRTA 3C1KA 1A5IA 2BD8A 3EE0B 1GBFA 1TNHA 1GJ4H 3NXPA 1GG6C 1JMOH 1ARBA 1K2I1 4NIVA 1H9LB 2O9QA 2WPLS 2BQ6B 3LT3A 3DHKH 3S7KB 4TWWA 4U32A 1BBRH 1Y3UA 3A7YA 3SGBE 4X1PU 2GGVB 1FXYA 3ZVEA 3ZZDA 3P8OA 1B0FA 1SGIB 1CVWH 3FVFB 1BMLA 1FQ3A 1O3PB 5FPSA 2XC4A 3GICB 1UCYH 2QYIA 2GMTC 2WINI 4CRBA 4OS1A 1O3KA 4O3UA 2PWXA 2AMPA 1UVUH 1P2IA 1QGFA 4HZHA 1SB1H 1VR1H 1GGDB 1EAIA 1GBJA 1V6DA 1AZZA 3M5OA 1C5YB 1THRH 4FXGH 8GCHG 3GY5A 3RC5A 5JYIA 4OS5A 4IS5A 2FS8A 1FDPA 1GHYH 3TH3H 2K1QA 3UUZA 3MO3A 1MU6B 1UHBB 4FUBA 1YCPH 3Q76A 1CQQA 1LDTT 3ODFA 4CBOA 1M9UA 3CP7A 1HV7A 4I32A 4AYYB 1TQ0B 2TGTA 5ESBA 2EC9H 4JZFH 5HYOA 4BAKB 1C4V2 4YOJA 2DE8A 1GCTB 2C90B 2GCTC 3LKWA 4FUGA 3SNBA 1EZUC 1G37A 1QBVH 3MHWU 2BX3A 1CBWC 2FP7B 1ZMNA 1FPHH 1HRTH 2QC2A 3A7VA 1UK3A 4IC5A 1ZJDA 3SN8A 3L33A 2VU8E 1LHEH 3RXVA 2RA3A 1C2IA 5JPMH 1QQUA 3E3TA 1GVKB 1C2JA 1HUTH 2FOHA 3BTFE 3EQ0H 4D7FA 1IHTH 1P2QA 3A8AA 1GPZA 4X2YA 5JBBS 2D8WA 1GBCA 2J94A 2SNWA 2ZTYA 5ABWA 1O3LA 2WPIS 1RRKA 2PSYA 4DG4A 1Y5AT 1Y3YA 3GY3A 3IG6B 2PKAB 2BD4A 3RMLH 1SQAA 3RLWH 4ZKOU 1YPMH 2FOMB 2PFEA 2H9EH 5GJ4B 3KGPA 4ABEA 1HJAC 1T4UH 1AQ7A 1JXPA 1Z7KA 5GCHG 1XX9A 1D9IA 5AFZH 3Q3YA 5EPYA 4KP0A 3D62A 1HJ8A 5A2MH 3LH1A 1C5XB 3PO1C 1GI9B 5E0GA 3LPRA 4I33A 2ZC9H 3MO9A 1FIZA 1O5BB 2BVRH 4MPUA 7GCHG 2R9PA 1BHXF 4DW2U 3R3GB 2I6QA 2ZEBA 3A87A 2P94A 5C1YA 3SJOA 1MBQA 3HKIB 2BTCE 3OTJE 4WH8A 4KTCA 1G32B 2PKSB 1TMUH 3ZVDA 4BTUB 3TK6A 1F2SE 1ZGVA 1V2PT 4VGCC 3E91A 1QRZA 1CA0C 5C67A 1CE5A 1ZSLA 3K6YA 4MG3A 4MQAA 1BTYA 3OY6U 2Y80A 3SU6A 2VIQA 3GDSA 1K1OA 1OYTH 1S6HA 5AFYH 1ZR0A 1SQTA 1Q3XA 1P2NA 1EB1H 2ANMH 2YNBA 1LKBA 3A82A 1EUFA 2AGIX 1AKSB 2FDAA 1LHCH 2BLVA 2EI7A 1J17T 5DP5A 5DP4A 1AB9B 4Y0YE 2BD9A 2ZU4A 4AX9H 2AFQB 2HLCA 2R3YA 3GOVB 1UVPA 3SNAA 1EAXA 1VITH 2Z9GA 2F9NA 1PPHE 4Q2KA 1MKWK 1GJ6A 1LVBA 3ODDA 2PLXA 1FY5A 3P8FA 1TIOA 1P3EA 3UFAA 1YBWA 1QA0A 1W3CA 2J92A 1O2HA 2HNTC 1O2TA 5GWZA 1LTOA 3M61U 3M7QA 1KSNA 2ZCHP 3ZZCA 1ARCA 1HB0B 1EB2A 1EPTB 3MO6A 2RG3A 1MTNC 3DUXH 1BTXA 1C1SA 1C1MA 3ZYDA 3TU7H 2ODPA 1FAXA 3GYMA 1D6RA 2W7UA 3OU0A 2BVSH 3BN9A 4CR9A 2XXLA 2YOLA 1KDQA 2ZU1A 2GV6A 4ABDA 3UQVA 1BB0B 3V0XA 2NU0E 2GCHG 1OSSA 1ZSKA 3GCHC 1HYLA 2OC7A 1KTSB 1QY6A 3MU1A 5HXFA 1GBTA 3AASA 2DE9A 1AU8A 3EAJA 5JBCS 1C5OH 1O3MA 3SJKA 4E7NA 2GP9B 1OP0A 1SGFA 1Y5UT 1GHZA 1QJ6B 4FUDA 3A7ZA 1O3NA 2AMDA 1NFYA 3RC6A 2XBWA 1SGEE 3T62A 2VIWA 2BY7X 1DE7H 4GSOA 4RSPA 1O2IA 2BMGB 2Q6FA 4A5TS 3MWIU 3VFEA 2FTMA 3FP6E 3S9BA 1BZXE 1HXFH 3PTBA 2ZIQH 1WCZA 1TPOA 1DICA 1ZZZA 3L3TA 3SV7A 3RXEA 1XUJA 3S69A 3RLYH 4I8LA 1WSSH 3BTQE 3UWIA 1HDTH 1GGDC 2ZTZA 2A4RA 2BY9X 3SHAH 3KCGH 1S6FA 1ESTA 3BTME 1YLCA 2R2WU 5HM2A 2Z9LA 2I6SA 2Z94A 2FXRA 3FAOA 4JYUH 1DLKB 3A80A 3U69H 2O8WA 1O34A 2D1JA 4DJZB 2PR3A 3KQBA 3MNXA 1MU8B 4LOYH 3VB5A 1PQAA 2QY0B 5A8YA 2FX6A 2AYWA 1YPHE 3A84A 2V3HH 3ATKA 3F9EA 3RXBA 1GI2A 1SHHB 1GCTC 3L6PA 1TLDA 5I25A 4TYDA 1BT7A 2ZZUH 2QV1A 4NWLA 1O2NA 2G52A 4AORA 5EW2H 1J14A 1C2EA 2A7CA 1A61H 3SV9A 3V7TA 1CGHA 2BD5A 1SSXA 3RXLA 5GIBA 5A0CA 3KHVA 1Z1IA 1P05A 2A4OA 4TWYA 3PWCA 1EOLA 4UONA 1NFWA 2OC1A 2GZ7A 1NC6A 3SUFA 5C5OA 2J38A 1F5RA 1EJNA 1A3BH 1AVXA 1OS8A 3T29A 1XUHA 3RXAA 1NFXA 3HKJB 2OQ5A 1OP8A 3LONA 3SBKA 1FAKH 1E34B 1C1PA 1KXDA 2DUCA 2H5DA 2ZQ2A 4JZIA 1P9SA 4WF8A 1CA8B 3JZ1B 2CJIA 4X2WA 1KXBA 2VINA 3TITA 4ABAA 1TNLA 1MQ5A 1WQVH 5E0HA 3K9XB 4XBCA 1KXAA 3DA9B 5DP8A 2ZG0H 2TPIZ 2UUYA 1O2VA 4LXBH 2ODYB 1CT0E 1VGCC 1N1LA 1U6QA 1XXFA 2ULLA 5A8ZA 3UOPA 4SGAE 2HOBA 4E06H 3O8CA 3ATLA 1T8NA 1WYKA 1SGYE 4I8HA 2A4QA 1NRNH 5CMXH 3SV2H 1A46H 1SFIA 3HK6B 1OYQA 2OC8A 2ZI2H 2AERH 2AIPA 2BD2A 2AMQA 7KMEH 3B23B 1O39A 4M7GA 3W95A 4K1TA 2OD3B 5AVDA 1XKAC 1XUGA 2ZFQH 3SQHE 3SOSA 1GHAF 2PKSC 3M3TA 1KY9A 3SU3A 3ZZ5A 2J2UA 4A7IB 2BQWB 3AVZA 3ZZ3A 4MNXA 1P0SH 3FFGA 2QXIA 2JH5D 4Q80A 4X8VH 1WU1A 3UNSA 3Q00A 1HAVA 1GI6A 3V13A 1O2LA 1UJ1A 4AYVB 3KQCA 2QXJA 4DIIH 2JETB 1P2JA 3PB1E 1ETSH 1AB9C 4YT7H 2B9LA 4FUEA 1SI5H 1GI1A 1A3EH 1KIGH 2QF0A 4B71A 1XKBC 2BDCA 2BD7A 1EOJA 1VCQA 2VWMA 1EP5A 1SHYA 1SOTA 1V2TT 4AGKA 5CHAB 3ZVFA 1C5WB 3GYLB 3PO1B 2C8WB 4ABGA 1GBIA 1AUJA 1EPTC 2J95A 1C1OA 1K1PA 1SOZA 2CXVA 1AWFH 5IDKA 2ZKSA 1YLDA 4CR5A 4MPVA 1BRCE 3ATWA 1ZPZA 3GY7A 1BIOA 5LPFA 1OPHB 2VGCB 1OKXA 1GBLA 1SLUB 4TY6A 1ELFA 1GDQA 3GCTG 1S82A 4Y79A 1GI7B 3P8GA 2PUQH 2BY8X 2IN2A 2Y7XA 2WYJA 1C5ZB 2OP9A 1EX3A 1MZAA 4AGJA 8ESTE 1YF4A 1UVOA 1V2JT 4ZMAH 1C2HA 1GMHF 2Z6BD 1K1MA 1BMAA 6GCHF 3QZRA 2F9BH 3K6ZA 4NSVA 1N6XA 2BDHA 1S84A 3MYWA 3KN2A 2TIOA 1J8AA 3BTWE 1UTMA 1L2EA 4WMFA 5C1XA 1E35B 1BJUA 4UD9H 1BA8B 4YT6H 4F4OC 4CREA 5E0JA 2JH6D 1D4PB 3BIUH 4BTIB 2HPQH 2F9UA 3ITIA 1C1WH 2OCVB 5TCCA 3U8OH 1BRAA 4YLQH 1C5LH 2STAE 3RMOH 1FLEE 2ZHWH 3TNSA 3LGTA 1DUEA 4OS4A 1MTNB 4XE4A 1TNJA 1ZHPA 1C2LA 1DITH 2Y7ZA 1V2RT 1C9PA 5L30H 3KNXA 4GCHF 1IHSH 1DXWA 1NFUA 1Y8TA 4BOHA 4DVAU 2ALVA 1YC0A 5CE1A 1C1QA 1AKSA 1BTUA 2NU3E 1PPCE 1YCPM 1MMJN 4ZH8A 2SGAA 4CRDA 4ZHLU 2UWOA 4INLA 3F9HA 1KLJH 4HFPB 2H9TH 7ESTE 2FYQA 3PM3A 3RU4D 1GDUA 3PYHA 3TK5A 2A0QB 5EPNA 3TH2H 9ESTA 1FY8E 1L0ZA 3PMAB 3URDA 5FBEA 3TH4H 4LK4A 1IQGA 1PFXC 1SGPE 1EAUA 1S0RA 4ESTE 3SU4A 4WWYA 3A8BA 4NFFA 3FZZA 1O3OA 3KQEA 5T6FA 2XCFA 4X2VA 1H4WA 1OXGA 3Q3KA 2O8LA 1GHWH 2GX4A 3NCLA 5B6OA 2RA0A 3Q77A 2NU2E 3PMHB 1KTTB 5I46H 3U9AH 1CHOF 3MU8A 1O37A 4BAQB 3NPSA 1O5CB 1CO7E 2XNIA 1S83A 2VWOA 3D23A 3UQOA 2Q6GA 3F1SB 3LC3A 1N6YA 1QQ4A 4BAOB 1ESAA 2V3OH 1F0RA 2R0KA 4I8GA 1NU7B 3UNQA 2FESH 5T3HA 1WTHD 1S0QA 3ZZBA 4KKDA 1ELVA 4AG1A 2H6MA 3LGYA 3LJJA 3QTOH 2HGTH 3M7UA 1P8VC 1S81A 2XRCA 3LJOA 1BRBE 4K69A 1P02A 1INCA 2CHAB 4YM9A 5EOKA 4ZROA 3FP8E 2W5EA 2ZPRA 2SGFE 2WV5A 3Q3XA 2IPHA 1ID5H 1G36A 2A2QH 1ZMJA 1TE0A 1CT4E 4X6OA 3F9FA 1VZQH 2AEIH 4UEHH 1C5VA 3HATH 3P92A 2A5KA 1FUJA 3NUMA 2Y81A 1FIWA 4DIHH 1GHBF 2Z9JA 1CT2E 2KAIB 1K1LA 1QA7A 5FX6A 1MTWA 1QURH 1SVPA 1HAHH 3VXFH 1GCDA 3HGPA 1HLTH 1RS0A 5A09A 2IOTA 1T8LA 1TBZH 4HGCA 1XVOA 2BXUH 3GY6A 4R8TB 3SHCH 2IJOB 5F6MA 4XDEA 1TPPA 1UK4A 2PTNA 4NG9H 1LQEA 4YESB 2WPKS 1AIXH 4U30A 1P06A 1QL9A 3LGUA 1UTOA 4MNWA 3ZVBA 3T27A 2BB4A 3UREA 3P8NA 1TX7A 3M5LA 1QIXB 3SZNA 2GZ8A 5EXMA 1P03A 1W7XH 2VH0A 2ZHEH 5DP3A 2JETC 3UPEA 1BOQA 3GDUA 5EQRA 4A1TA 4H4FA 2P8OB 4B73A 1O5DH 1MKWH 1IQJA 3RXFA 1TGNA 1O3CA 4FUJA 1VGCB 4KTUA 4A1VA 3BTHE 4O97A 1GJ5H 1SGQE 1HPGA 4KTSA 2P59A 5CHAC 1XMNB 2Z7FE 1TOCB 2VIPA 1OWIA 2GT8A 1V2WT 4FUFA 3EYDA 1JBUH 4MTBA 1TGTA 2EI8A 2VB0A 3RXMA 1OWHA 4ZKRU 1RFNA 2FWWA 2RCEA 2ZFPH 2R3UA 1FY3A 5BPEA 3FANA 1O2SA 1X7AC 1SGRE 1FMGA 1DLEA 1L4DA 1YPEH 2FM2A 2R2MB 1O3AA 2VGCC 1GMDF 3M5MA 4ZKSU 1P2KA 2P3UB 1SMFE 3MNCA 1AUTC 1HIAB 1O2XA 2ZU2A 1GVLA 5EU8A 2QN5T 4FU8A 3H7OA 3BTEE 3T25A 1QB1A 4FVDA 1DOJA 1UMAH 5FBIA 4I8JA 4UFGH 1O36A 1C1RA 1EKBB 3PWBA 3RXSA 5C5NA 4BANB 1Q31A 3RP2A 2UUFB 4OGXA 3PLPA 4CH2B 1QBOA 4GVUA 4AFQA 2ZFFH 3U1JB 3K2UA 1HFDA 1SGTA 3ZZ9A 2XBXA 2OINA 4X6NA 4H6TA 1OWDA 1G3DA 1LQDB 1OWJA 4BAHB 1SGCA 1NM6A 1GJ8B 1FV9A 3H5CB 3LGVA 2ZF0H 2ZDMA 1GMCF 4WXVA 1DY9A 1ABIH 4JCNA 1HNEE