4ABAA

Fragments bound to bovine trypsin for the sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Dingo Dataset: A Comprehensive Set of Data for the Sampl Challenge.
pubmed doi rcsb
molecule keywords CATIONIC TRYPSIN
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abaA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abaA02
1AMHA 2FZZA 3TJNA 1QRZA 1D3QB 1IQNA 4ZKOU 4FU9A 2WV5A 3KQBA 1U6QA 3MWIU 5CHAC 2ODPA 1S6FA 4AB9A 1GI5A 1V2JT 4OS7A 3RC5A 3CP7A 1CHGA 3U69H 5EQSA 3DA9B 2GX4A 1G2MA 4DCDA 3BEUA 3E8LA 3SU2A 3T25A 1NFUA 1AZZA 1HIAB 2QA9E 1Q31A 2XC5A 4VGCB 1QFKH 1ZGIA 4B2AA 1H8IH 1NESE 2STBE 2HALA 2QXIA 1HJ9A 1ORFA 2F9NA 4Y7BA 3KHVA 2FODA 1BZXE 1L2EA 1TGTA 1MTUA 1ZSLA 4H4FA 2WPJS 3TJOA 4DIIH 2QGRA 1MKXK 2A7CA 3PMAB 5EQQA 1XUKA 2FOFA 2BLQA 2GCTB 3HKIB 1TRNA 1RD3B 4A7IB 1XVMA 2GZ7A 1O2LA 1K28D 4K3JA 5GWZA 1NRQH 4I8HA 3RXSA 3RM2H 2VH6A 4CREA 2A31A 1ETRH 1S83A 2G55A 1BIOA 1AUTC 1JMOH 2SGQE 3CS7A 1C5WB 4YT6H 5T3HA 1KDQB 4ZXYH 2BB4A 3SNDA 3MO6A 2OBOA 5TJXA 2ZTXA 2Q6GA 1OYQA 1EJAA 4X6PA 3A80A 3ZZ7A 4X1PU 3F9FA 5DP9A 1DS2E 3SI3H 5F03A 2C8XB 3RC6A 1ACBE 2HPPH 4UEHH 4NZLA 1JIRA 1BBRE 1ZYOA 1HRTH 3D62A 4B2CA 1CT2E 3HATH 1O3OA 1GBLA 4BTUB 5F8XA 3ATMA 1A61H 4CRGA 1GJ9B 1QL7A 2G51A 5EPNA 2R2MB 3AVZA 3TGIE 1XMNB 3NUMA 1TIOA 5JYIA 1AQ7A 1BTHH 4ZKSU 3KCGH 5BPEA 1EQ9A 1CA0B 3SU6A 2GMTC 4U01A 1AZ8A 3I77A 4E7NA 1DXWA 1OXGA 3A7VA 4ABEA 2FYRA 3ELAH 5EU8A 3STIA 1VJAU 1YC0A 1TMTH 1EKBB 4XFQA 1TA2A 1AUJA 2NU0E 2OUAA 4OS6A 2VIOA 3T26A 5DP8A 3PMBB 3QWCH 4K69A 1PPFE 4CHAB 1C4Y2 3E6PH 1DWDH 1LDTT 1BRAA 3E1XB 1ZSKA 3A87A 5AVDA 1O2TA 1OP8A 2ZIQH 3W94A 1C2LA 4Q7YA 1FIZA 3GY2A 4IN1A 1YP9A 4WH6A 1LPZB 1DITH 3E0NB 1ZR0A 1TX6A 3RXPA 3UY9A 3P8FA 2SNWA 3BSQA 3RXVA 1O32A 1SQOA 2UUKB 1LKAA 4BAKB 4CH2B 3SZNA 2AFQB 1BQYA 4TWYA 1IQFA 3Q77A 3Q76A 4H6SB 1GHVH 1HAGE 3F6UH 3QN7A 4E05H 3S69A 3ZYDA 2P93A 1GGDC 1GDNA 3JZ2B 1FAKH 1DICA 1FJSA 4I7YH 2KAIB 1NO9H 2ASUB 3GCOA 3M5NA 3SW2B 5C5OA 2HPQH 1FONA 2J2UA 3M35A 4UDWH 5J4SA 2Z9GA 2PSXA 2J34A 5FAHA 1EX3A 4A6LA 1TNIA 1KXBA 1BUIA 3FAOA 4AYYB 4B74A 3MH5A 3SU4A 1MTNB 2IJOB 2ZGCA 3VB4A 1GCDA 1EUFA 2ZTYA 2QXHA 4TY6A 1RTLA 1GCTC 1DDJA 3FP6E 2ZDNA 1EPTB 4FUIA 3MHWU 3AW1A 1H9HE 7GCHG 3SJIA 3L3TA 1YPKH 3QO6A 1AWHB 1WYKA 3E90B 2AH4X 3RMMH 3B9FH 5PTPA 8GCHG 4X8VH 3ZZCA 1GPZA 1Y5BT 3Q3KA 3WY8A 2QXGA 1P2JA 1F7ZA 1G3EA 5FX6A 3EE0B 2BD4A 5IYTA 1A0LA 2EA3A 5LPEA 3RP2A 2WPLS 4LZ4B 1D3PB 3LGTA 3A81A 4DY7B 1EZSC 1F5RA 1FY4A 1GJ8B 1O3FA 3JZ1B 1GI6A 4RSPA 3VGCB 1SHHB 1GVZA 1HPGA 4ZHLU 1JOUB 4HZHA 5HYOA 1MTSA 4K1TA 2GV6A 1DWEH 1GI2A 2XC0A 2AGEX 2VGCC 3BTME 1HJAB 5K7RA 1EATA 2YNAA 1BMNH 1O3CA 2F9PA 4NWLA 2PR3A 1WCZA 1ZSJA 2RA0A 2VVUA 1CQQA 4NSVA 4X2VA 3B8JA 3SOSA 4NA7A 1ARBA 4Q80A 5DP4A 4DURA 1A5IA 1O5EH 3OY6U 1GBIA 1W13U 2RA3A 2ANMH 1AB9C 4XDEA 9ESTA 4E06H 4MDSA 1ID5H 2BD7A 3K65B 2A45B 4AOQA 1YF4A 1V2OT 2A4RA 2Z3EA 1KXAA 3S0NA 2OLGA 4U32A 1JRTA 3O8RA 1GMCF 3OYPA 2Y82A 2FOEA 4X8UH 3LGWA 1GL0E 3RXEA 2XWBI 1TE0A 3C27B 4X8SH 3A8AA 1MAXA 4NWKA 1TWXB 3RXMA 3BG4C 4AX9H 5FBIA 4ABDA 4YTAA 1EB1H 2P3UB 1FAXA 2DE8A 1P3CA 1NC6A 3UQOA 1VITH 4O3UA 1E35B 2QF0A 2FTMA 3DHKH 1IQGA 3F9GA 3ZVFA 2UUFB 1J17T 1WQSA 1C4U2 3T5FH 3U1IB 3KQEA 1YPJH 3ZVDA 1Z8GA 1UJ1A 4WVPE 1HAZB 3PROA 1ANEA 1BRUP 5A0AE 2FTLE 3VFEA 5EW2H 1UTPA 1C1SA 5DP5A 1V2NT 5LH8A 1P05A 3PO1C 4DW2U 1K1NA 1CSOE 1O3KA 2PUXB 2GT7A 4B1TA 4K8BA 5EGMA 2PTNA 3ATIA 2RG3A 1H4WA 1AI8H 2GVFA 3GISB 1T4VH 2ZGBH 4AFSA 2BQ7B 1GWAA 4X1RU 3SO3A 2QCYA 2W7SA 3S7KB 5GJ4B 4WMDA 1O5FH 3UNRA 1GBEA 1KTTB 1O39A 3GDUA 1DOJA 1TALA 1GI9B 3LDXH 2A5KA 5FBEA 2J94A 1O31A 1SGQE 1SGDE 2XBVA 4CH8B 2BTCE 4ZHAA 1OPHB 5JBAS 1UCYH 3SV9A 3ATWA 3GICB 3UNQA 2Z94A 1AE8H 1LPKB 3M36A 3UR9A 3ZZ5A 1VZQH 3KGPA 3RMOH 1P2IA 2ZHDA 3GY4A 3IITA 3RLWH 2BD3A 6GCHG 3ATKA 4MNYA 3SBKA 1FY5A 5FPTA 5CE1A 4I33A 4INKA 1O2VA 1P9SA 1TPOA 2FOBA 1XUIA 1W11U 4D9RA 1ELCA 3TNSA 1MCTA 1UTKA 4HTCH 1K1LA 4AG2A 2Y81A 1V2TT 1HAYB 1XKAC 3MH6A 1F5KU 3RXRA 4NIYA 1NZQH 1SR5C 1EZXC 2GD4B 5FCRA 1MKWH 2VVVA 3GOVB 3A89A 1W3CA 2BQ6B 3BTWE 4UFDH 1L1JA 1O2RA 3NWUA 4HFPB 1O0DH 1N6XA 4UONA 1TGNA 1TAWA 1B0EA 2Z9KA 1FNIA 1O2IA 1SGPE 3BN9A 4X2YA 1C9PA 5E2OA 3PTBA 1K21H 2M5TA 3F9EA 4MQAA 1QGFA 1VJ9U 3T29A 2AEIH 1BRBE 2C4FH 1F0RA 2W3KA 3EA8A 1GBAA 1C5UA 2G4TA 2BY9X 1P12E 3SHAH 4SGBE 3M3TA 4GCHF 1O2MA 6LPRA 1GJAB 3SGQE 2FOCA 1W14U 4YM9A 3KQCA 2KAIA 3P17H 4B71A 4YZUA 3SI4H 1RRKA 1GHBG 3RXBA 1CVWH 2ZFSA 3MU0A 1BTXA 3VXEH 1RIWC 1GVLA 1HAXB 1P2MA 4NIWA 4Y8XA 3TLOA 3CS0A 1DX5M 3UR6A 2ZKSA 1TNJA 4NIVA 4B76A 1HLTH 3C1KA 3DFJA 2QN5T 3ZVAA 2C8ZB 2EI6A 1UVOA 2Q1JA 5F8ZA 4BNRA 4JK6A 3BG8A 3UIRA 1QQUA 1VITG 2SGDE 3DFLA 3L33A 1OP2A 1YPEH 2P59A 5EXLA 1C1MA 6CHAB 2OTVA 4J1YA 1LQDB 4Y0YE 2TGDA 2ZU3A 2F3CE 2AIPA 5ESBA 1YBWA 3LH1A 3MU8A 2ZDLA 2CXVA 1YKTA 1JXPA 2GZ8A 2HRVA 3GY7A 2BD5A 1QIXB 5LPRA 1HUTH 3TK5A 1SBWA 3QK1A 3RXAA 1C5MD 3EA9A 2UUJB 1SOZA 1MBMA 1TPSA 3V3MA 3KIDU 2GV7A 1O3AA 2QF3A 1NRSH 2A7HA 1GJ4H 1QTFA 5L30H 1OWEA 2BHGA 1TQ0B 2CHAC 2F9VA 4A1TA 1OX1A 5DP7A 1OP0A 2JETC 4X6OA 1UO6A 2O8MA 4O3TA 2H5DA 1LHDH 3PLBA 2OC8A 1Y8TA 2VINA 3M5OA 1FPHH 1PQ8A 2H6MA 2PUQH 5DO4H 1ZPCA 1UK3A 1O3HA 2XBWA 1XUJA 2J38A 5FX5A 2Z9JA 1B0FA 1TPAE 5DKMA 1GI0A 4ZKRU 4ASHA 4INLA 1FY3A 5F6MA 3A8DA 2A2XH 1SGCA 2LNCA 3A7ZA 1CU1A 5A09A 3MO3A 1OYTH 2XBYA 1A1RA 1C2IA 1O5CB 2ILNA 3SV8A 1O38A 1SLUB 2SNVA 3HGNA 2ZPQA 5EW1H 3MFJA 2BLVA 4DVAU 5L2ZH 4NFEA 1SGFA 4Z6AH 4I8JA 2OXSA 1QCPA 3UWIA 2FS9A 1MTVA 1BTPA 5B6OA 3TPIZ 1UCYK 1XVOA 1GMDG 4A1VA 1HFDA 3LJOA 3V13A 1O3PB 1XX9A 1O3NA 3RXOA 2GT8A 2FYQA 1DLEA 1O2NA 5EG4A 7LPRA 4HGCA 3EYDA 3MNBA 4FUJA 4ZAEA 2XTTB 1TNLA 2OC7A 5CHAB 1IQLA 2BDIA 3ZZ8A 1GBKA 1V2KT 1GBFA 2D2DA 1HDTH 3H7TA 1N6YA 1AFEH 5EOKA 3RXHA 2BDHA 1KXEA 4CBOA 2OC1A 4GSOA 2WPHS 1GG6C 4F49A 1NY22 2VIDA 1QBNA 3VXFH 3ZV9A 1IQKA 1K1OA 1V2UT 1UVTH 1GJ5H 3NK8A 3UQVA 1ZRBA 2V3OH 1J8AA 3GY6A 4SGAE 1N8OC 2RDLA 5HM2A 3EGKH 8ESTE 1C1VH 3TITA 3ZZ3A 1TA6A 2PTCE 4MNVA 1TX8A 4A5TS 2ZCHP 2TGPZ 3TVJB 4TWWA 2VJ1A 1GI8B 1O2JA 2ZPSA 3QDZB 3RMNH 3T62A 1D4PB 3U98H 2XXLA 1BA8B 3U8OH 3A83A 2BDAA 1BRCE 4BAMB 5C1UA 3LPRA 3K2UA 4CRCA 1A3BH 1O3JA 3OY5U 1QL8A 3ODDA 2BQWB 4FUDA 1EJNA 4IN2A 1TRMA 2A4QA 1QJ1B 1ESTA 1ANDA 1LVMA 1GJ6A 1BHXB 1C2HA 1DWBH 3SHCH 2R0LA 3HKJB 4O9VA 1IQHA 1TQ7B 2PWXA 1SGEE 1O3GA 1TGBA 3SNBA 3VPKA 4IMQA 1GBBA 1CGIE 1QJ6B 5I46H 1YCPH 1E36B 2A2QH 2NU4E 4MVNA 1AHTH 4MPWA 3VB7A 3LJJA 2G5VA 3LONA 2GKVE 4JYTA 1J15A 2H2ZA 1ZMLA 1D3TB 3GYMA 4Y6DA 4X2XA 1G30B 1W0ZU 1ZMJA 2BXUH 1F5LA 1ELBA 1PFXC 1OWHA 3TK6A 1KXDA 2ZC9H 2WYJA 3BTQE 4Y0ZE 1DUAA 3ATLA 3PWCA 3GY8A 1UCYE 1HAOH 1SSXA 2CJIA 1SGFG 1WSSH 4XBBA 3SNCA 2J92A 1HAIH 4OS2A 4RKOB 1V2MT 1Q3XA 2XBXA 3N7OA 1GMHG 1D3DB 1GJDB 4Y71A 1QJ7B 4ZXXH 1O34A 3PLKA 1BTYA 2V6NA 2AMQA 4MPUA 1ELFA 4CBNA 4DJZB 4CR9A 3A7XA 1EAWA 1KLIH 2FOMB 2TPIZ 1O3BA 1A7SA 2ZDKA 1GHYH 2ZGHA 1A3EH 5GDSH 2FWWA 5J4QA 2C8YB 1KY9A 4JYVH 1WTGH 2SGFE 1YLDA 3S9BA 4A92A 4BTTB 4TY7A 3UFAA 2A4OA 3TK9A 1CA0C 1DFPA 1EAUA 1C5RA 1GHAF 2BYAX 1UTMA 5LPFA 2V3HH 5GCHF 3GCHC 5AF9H 2OCVB 3BIUH 4WXIA 5T6GA 1TB6H 1GGDB 2ZHQH 4X1SU 5E2PA 2ZCLP 4AFUA 4BAOB 1SQTA 2BDCA 2FDAA 3ZVGA 2WPKS 2K1QA 2A4GA 1QA0A 4CHAC 5DGJA 4IC6A 1S5SA 4AN7A 3U9AH 3RLYH 1OKXA 4ABHA 3ESTA 1THRH 3V12A 2FX4A 1FDPA 2C3SA 4QT8C 1T8LA 1AKSA 2QIQA 1GCTB 4WH8A 2VIQA 3MOCA 4I8GA 3SU3A 4UD9H 1JBUH 3URCA 4X1NU 2FLRH 4WY3A 3M37A 5GPIB 1TBQH 1GMDF 1O3IA 1NS3A 2ANYA 5DP6A 1TX7A 1QR3E 4ZUHA 3KN2A 1TOMH 3KL6A 1C5ZB 2F9OA 5SGAE 1YPMH 4FUHA 5L2YH 2ULLA 1P0SH 5AFZH 1W0YH 1O5AB 4IS5A 1W7XH 4MG3A 5HGGA 3SJ8A 4NG9H 1BTZA 1ELEE 1TMBH 1BITA 3BEFB 4BTIB 2B9LA 3GCTG 3LT3A 4YOJA 1Q2WA 1ZTLA 1UVUH 3L6PA 3NXPA 3TH2H 2FLBH 1NN6A 1XUGA 3UNSA 1T32A 5T6FA 3M5LA 3GDVA 4GUXA 1AE5A 1LHFH 1P10A 1NFYA 2FXRA 1EOJA 1EPTC 2B7DH 2WPMS 2Y7XA 2FX6A 1YGCH 2ZFTA 3SUGA 1UHBB 1ABIH 2B0FA 2Q6DA 3PMJA 1AB9B 4WWYA 3SUDA 2FOHA 3SV7A 1VCWA 1LO6A 2RCEA 3EAJA 2GCHG 1FN6A 2BZAA 3MTYA 1C1RA 1TNGA 2P3TB 4KKDA 3EA7A 1WQVH 1YCPK 1C5NH 1TPPA 2PGQB 3ZZBA 4B2BA 1O2UA 1MUEB 1ELAA 1V2WT 2XRCA 2XYAA 3VGCC 4B73A 2PLXA 2PW8H 1LMWB 1SI5H 1A5HA 1K1IA 3BTGE 2IPHA 4MNXA 3BG4B 4CRAA 4IBLH 5E8EH 3BTKE 2P16A 3LGIA 4LZ1H 3PB1E 1G2LA 1JIMA 4NGAH 3FP7E 1XXDA 3DT0H 1GI3A 5HM9A 1JRSA 2UWOA 5BRRE 2O8UA 2W3IA 3RXQA 1OWIA 1SB1H 1OSSA 1O3MA 3BTEE 1T4UH 1EP5A 5DG6A 3Q3YA 3I29A 3BTDE 4ABBA 1F0SA 3A8CA 3P6ZB 2BX3A 4UE7H 3SNAA 1SMFE 1TYNA 1GHWH 4FU7A 4I8KA 3LGVA 2HLCA 2PHBA 4B75A 1GJ7B 4DG4A 3E16B 3TGJE 3AAVA 1HV7A 3TU7H 2FM2A 1UTNA 2ESTE 1THPB 4NFFA 5A0CA 1AO5A 3P95A 1O36A 1F0UA 3MH4A 2AERH 4H42U 1Y3YA 2ZGXH 2I6SA 1CGJE 1NPMA 1E34B 1YPHE 3P8GA 9LPRA 3VB3A 1C1PA 1CBWC 1FI8A 1C2MA 2ZQ2A 1PQ7A 3MMGA 2D1JA 3LGUA 2A1DB 1B5GH 3EDXB 3AASA 4YOIA 4JZ1A 4X0WU 5A8ZA 3A7TA 3OTJE 2HNTE 1EOLA 3QTOH 1LTOA 2HVXA 4IC5A 4AFQA 2G81E 4BAHB 1C1OA 2O8LA 2R0KA 3QTVH 3SJ9A 3UTUH 2FIRH 4FUGA 2AYWA 1ETTH 3M7TA 1ZLRA 2ZTZA 3BEIB 1AWFH 1F2SE 2QY0B 4ABFA 3MO9A 2F9UA 1CGHA 4I31A 1WBGB 1JWTA 2PKSB 4F4OC 1AGJA 1S0QA 4FUCA 4DOQA 1IQEA 1UTOA 1KLTA 1T31A 1AIXH 1D6WA 2AIQA 1SGRE 1ZMNA 1J9CH 1PQ5A 1XXFA 3BTFE 3W95A 3TH3H 1HYLA 2VIPA 1DY8A 1TNHA 4AG1A 3TIUA 1C2DA 1O2KA 5F8TA 1P2KA 3HPTB 1MTWA 1W10U 2PKAA 3ENSB 2ZP0H 2C8WB 3D49H 1PJPA 2G4UA 3E0PB 4OGXA 3ZZ9A 4JCNA 3PV4A 3E91A 1A5GH 3OSYA 1VCPA 4M7GA 2OQUA 5C20A 1ELVA 1A0HB 1G32B 2GGVB 2QC2A 3NZIA 2QXJA 1NT1A 3RU4E 1KYNA 5FXLA 2V35A 1F0TA 1S85A 1BTWA 3ODFA 1J16A 1ESBA 4UFGH 2ZFQH 1FPCH 1NRPH 1V2LT 1C2GA 5DP3A 7GCHF 5FPYA 3RXFA 4K1SA 3TJUA 1XUHA 1HBTH 2ZZUH 5E0HA 1MMJN 3VEQB 8GCHF 3RXLA 1BJVA 3Q3XA 1P04A 3GCTF 2J4IA 3SGAE 2FP7B 2VB0A 3RXCA 4K60A 2BXTH 2H9TH 2EC9H 1QY6A 3T28A 4ISHH 4OGYA 1VGCC 1ZGVA 1IQMA 5FCKA 2D8WA 5C5NA 4GHTA 1T7CA 3K9XB 1CO7E 3RC4A 1GHXH 1K1PA 4GLYA 1HXEH 1WOFA 7KMEH 1C5QA 1IOEA 3VB6A 3BV9B 1VCQA 2OD3B 1LHEH 4TPYA 3H5CB 2TRMA 4TYDA 1HJ8A 1EJMA 1ETSH 2BY6X 2ZA5A 5JBTA 5JDUB 4D8NA 2Q6FA 1Z6EA 3U1JB 5ETXA 1LVBA 1NRNH 2JETB 2W26A 4WXVA 3SU0A 2OBQA 3K6YA 4IMZA 5I25A 5C67A 1OS8A 4ABIA 1NM6A 1AFQC 2LPRA 2BY8X 3R3GB 2IOTA 1SFQB 1D6RA 1AKSB 2FS8A 1EP6A 1ZPBA 5EQRA 2BOHB 4MPXA 3SJKA 1NU7B 1Z8IB 1DY9A 1GDQA 6CHAC 1CHOG 1SC8U 5JB8S 1S84A 1RTKA 1LVYA 1UHBA 3IG6B 3SUEA 3URDA 1SFIA 3A85A 1O2OA 1P2OA 4AYVB 2UWLA 2VVCA 4AGKA 1O35A 1T8MA 1C1QA 6ESTA 2XW9A 4Z0KA 2A0QB 5DJ7A 1G3BA 3LC5A 1EZQA 5JPMH 3SGBE 1FXYA 1GJBB 4MTBA 2ZI2H 1RS0A 4Y8YA 5CMXH 1ELGA 2XC4A 5C1XA 1NFWA 3GY3A 1RXPA 1F92A 3FZZA 4O97A 4K2YA 1SGYE 2F9BH 4IW4E 1TBRH 2Z9LA 2P8OB 1HCGA 3LC3A 3D65E 4ABAA 1W12U 3GYLB 5HMAA 2BLOA 3PTNA 1KLJH 2GZ9A 1GBTA 3ZZDA 4OS4A 4RN6A 3RXIA 3SU5A 4D9QA 3NKKA 1GBJA 8KME2 2Z6BD 1NRRH 4XBDA 1PPEE 2A5IA 2BM2A 3MNSA 7ESTE 2Z3DA 2W5EA 3LGYA 1P01A 3LU9B 3O8DA 1ZHMA 3KQDA 3RXDA 1BJUA 1GHZA 2BOKA 1LKBA 2VWMA 2Y5GA 2BD8A 3S9CA 1GG6B 2BDGA 5GIBA 1ANCA 2NU3E 2WINI 3PLPA 1O5DH 4FUBA 1C2KA 2FMJA 1ZJKA 1C5PA 1RFNA 1GBDA 3IWMA 4AZ2B 1FIWA 1XKBC 1MBQA 1C5VA 3SNEA 1DVAH 3GDSA 1MD7A 1V2PT 6GCHF 1QRXA 1P3EA 1MKWK 2QV1A 1HAHH 3NCLA 4WF8A 2ZHEH 4NIXA 1V2VT 2YNBA 1FY1A 2CN0H 2VH0A 2PFEA 4ISOA 2ZO3H 3SUFA 4ABJA 1X7AC 3STJA 1G36A 1CT4E 4FUEA 1WV7H 3MU1A 3RXKA 4X8TH 2C90B 2WYGA 1Y59T 4I32A 1V2ST 1Y3WA 1C5YB 3RU4T 3F9HA 1TRYA 2SGAA 1K1MA 4NSYA 4WMFA 1ZPZA 2ZGJA 3DD2H 1SHYA 3BIVH 4CRBA 1O2GH 3A82A 4XE4A 5C3NA 1Y3UA 2ZHFH 2QAAA 1O33A 5E0GA 1QRWA 4VGCC 5A0BA 1H9IE 1MQ5A 1LHCH 1IHSH 2FESH 2CMYA 3A84A 1P11E 4PROA 2NWNA 2Y5HA 1H9LB 5DK1A 1ZHPA 2EI7A 1DLKB 2GCTC 1GBMA 1C5SA 1P9UA 1DSUA 2Y5FA 1GHBF 4I8LA 1C5OH 1IQIA 3SJOA 4KGAA 1DPOA 4IGDA 1GMCG 5T6DA 3FZDA 1PPHE 1GVKB 5L6NH 1SL3A 5DPAA 1O30A 1OOKB 1J14A 1HGTH 1L4ZA 5E0JA 2WV4A 5AFYH 3MU4A 2GMTB 1BMLA 1BHXF 3TGKE 2ZF0H 1VITF 2XWAA 4THNH 2H5CA 2F83A 2CF9H 1B7XB 3GY5A 2ZPRA 2SFAA 5HXFA 4AFZA 2C93B 2ZU5A 2VWNA 1SGTA 1KSNA 1FV9A 1UMAH 1S6HA 1TGCA 1C1NA 4K8YA 2BD9A 3S9AA 3GCNA 3SQHE 3QX5H 1W8BH 2Z7FE 4MLFB 3LH3A 1FN8A 2JH0D 1VR1H 2P94A 1ABJH 1C1TA 1Z6JH 4BANB 3A8BA 3QZRA 1YYY1 2PKAB 1V6DA 1ARCA 4J2YB 2THFB 3GCHB 3MH7A 5K0HA 1AVXA 1CHOF 4ESTE 2GDDA 1SGIB 1YCPM 3AW0A 2JH5D 2O8WA 3P92A 4CRDA 2ZQ1A 1CT0E 1IAUA 3M61U 1E37B 1MU6B 5A8XA 3FP8E 2FI3E 3LIWA 3U8TH 1DE7H 1SPJA 2QYIA 3RU4D 1NFXA 3KNXA 4FVBA 3ZZ4A 1Z1IA 3HK6B 1Y3VA 2GP9B 1QBOA 2R3YA 4JZEH 1LPGB 4Q7XA 4GPGA 1N1LA 4YESB 2XCFA 2ZU1A 4GAWA 1SLWB 4BAQB 4WMEA 3G01A 4JYUH 1K9OE 1AU8A 1Z8JB 3HK3B 4JZDH 2A32A 1UTLM 4UFFH 3ZZAA 1AD8H 4Q2KA 1AY6H 1WUNH 1O2PA 4ZHMU 5LGOA 1FY8E 2P3FH 3MI4A 3R0FA 5EXMA 2BX4A 1PYTD 4FU8A 3E3TA 1QBVH 4Q7ZA 1GBCA 1QHRB 4Y76A 3P8OA 2GTBA 1IHTH 1FZZA 2NU2E 2ZDAH 1V2RT 4CR5A 1O3DA 3F68H 2GDEH 1TLDA 4LOYH 1LVOA 1MAYA 3M7UA 4NA8A 2A5AA 1UK2A 1H8DH 3KEEA 1E0FD 4R0IA 3PWBA 1MZAA 1UK4A 1YLCA 2BLWA 2TBSA 2WUCA 4U2WA 1QL9A 1O5GH 1C2JA 2PSYA 3BTTE 5C2ZA 1O5BB 2NU1E 5JB9S 1TABE 3FVFB 2R2WU 1TNKA 3UOUA 4AB8A 3QZQA 1KXFA 1MTNC 4ABGA 2V0BA 1KXCA 2F91A 2VGCB 3SQEE 1CA8B 4GCHG 1TONA 1HAVA 1UVSH 4NCYA 1HNEE 1L0ZA 2OC0A 2G00A 2ZWLH 1O3LA 1E38B 2G52A 3A86A 1WTHD 1V2QT 3D23A 3PYHA 2TIOA 1DANH 3ZVBA 4UFEH 1HB0B 2J9NA 2EI8A 1TBZH 1MCVA 2BVSH 1W7GH 3ZV8A 3B23B 4GHQA 3T2NA 1SG8B 3MU5A 1SOTA 3UPEA 5A8YA 3M3VA 1L1GA 1QURH 1RTFB 5JBBS 1O2QA 1C1UH 1PQAA 5IDKA 2R9PA 1WU1A 3F1SB 3M7QA 3SV6A 1TGSZ 1K22H 1C4V2 4OS5A 1WAYB 1K1JA 1QB6A 1S0RA 1SQAA 3BF6H 3DUXH 1Z7KA 4HI3A 1HJAC 2SGEE 1C5TA 1M9UA 4YO9A 3MNXA 3RMLH 3A7WA 3P8NA 1BTUA 2ZECA 3VB5A 3LKWA 1MU8B 1H1BA 5EPYA 1ZHRA 3NPSA 1PPBH 4ZROA 4BXSA 1Z8RA 2H9EH 5JBCS 1C2EA 3M3SA 3M5MA 4JMYA 1TFXA 1BOQA 1BB0B 5C1YA 3ZZ6A 3TJVA 1QB1A 1UVPA 2ZDVH 3PMHB 1ZTKA 8LPRA 3RXGA 1A4WH 5EODA 4Y8ZA 1HIAA 2AS9A 2CF8H 2BY7X 1DXPA 5ABWA 1P57B 3PO1B 4D76A 1DM4B 4Y11E 2BDBA 3ZVEA 4NZQA 4KTUA 1O2XA 3ZYEA 1CBWB 1L4DA 2XCNA 1K2I1 2SGPE 2JH6D 4DIHH 1EASA 1GMHF 3A88A 3Q00A 4ZMAH 2BVRH 1BDAA 1YPGH 1C5LH 1OWDA 4YT7H 1SLVB 3A7YA 2IN2A 2ZFPH 4FVDA 1ELTA 1PPZA 2VWOA 4XSKU 4ZH8A 1SLXB 4ISLA 1UTJA 3EQ0H 1AVWA 2OQ5A 1Z71A 4K5ZA 3RUOA 1KDQA 2FPZA 2ZNKH 2Y80A 1YPLH 2P95A 1LCYA 2UWPA 1XUFA 1UTQA 2HOBA 1HXFH 2J95A 1G9IE 1LQEA 1EAIA 2CV3A 1NROH 4X6NA 2CGAA 1NTPA 2HWLB 1RJXB 2R3UA 4JZFH 2ZCKP 1EAXA 1ESAA 1INCA 2DUCA 1BBRH 4KP0A 2ZU2A 2OINA 1A2CH 2AMPA 3PM3A 4R8TB 2B5TB 1P2NA 1P8VC 1P06A 2ZU4A 3CENA 2A7JA 3QGNB 1XM1A 1IQJA 1SVPA 2BZ6H 1MZDA 2ODQA 1EXFA 1YPHC 4Y79A 2VU8E 4BOHA 1O2HA 1A0JA 3OX7U 1T8OA 1C1WH 1PPGE 3I78A 1ELDE 4FXGH 1MD8A 2FO9A 1BCUH 2HNTC 1G3DA 2HNTF 2Y7ZA 3TH4H 2D26C 1BMAA 4CRFA 4DGJA 1W2KH 2PKSC 2ZG0H 1MH0A 3ZVCA 3QLPH 1NU9A 3K6ZA 3SN8A 1GL1A 2VIVA 1AN1E 3T27A 1BMMH 4WJG2 5G4BA 4XOJA 3SV2H 1O2YA 4DT7B 2AGIX 2ZDMA 3RXTA 4YLUA 2ANKH 1S81A 3SORA 4JZIA 2W7UA 1DT2A 1O2ZA 2HGTH 5FHTA 1RIWB 1GJCB 2BY5X 2TGTA 1T8NA 2Z9IA 1VGCB 1Y5UT 2TGAA 4Y10E 1FQ3A 5TCAA 3P70B 3V7TA 2DE9A 3QGJA 1MKXH 2VNTA 4TPIZ 1ZJDA 2ALVA 3RXUA 2OP9A 1EZUC 3HGPA 2PGBB 2EEKA 1Z1JA 1C9TA 1P03A 4D7FA 2FI5E 1ZRKA 4X1QU 2ZHWH 3LOXA 3QUMP 4KTCA 4X6MA 2XNIA 1C5XB 2B8OH 4ISNA 3TNTA 5FPSA 1ZOMA 2JKHA 2ZFFH 1GDUA 1MQ6A 1ZTJA 1SGNE 3S7HB 2GCHF 5H4IB 4Y7AA 5AHGH 1AFQB 1O2WA 1QA7A 4KELA 1DUEA 4INHA 1RGQA 2CHAB 4O03A 1O2SA 4K1EA 4YOGA 2I6QA 1QQ4A 1EPTA 4RKJB 3RM0H 4X2WA 3UWJH 2FEQH 2H1UA 1GI1A 1QB9A 1D9IA 1OWJA 3RXJA 4H6TA 3AAUA 1TOCB 4LXBH 2AGGX 1A46H 4XBCA 2BDYA 2G8TA 4NA9H 2VWLA 2PV9B 4KTSA 1PYTC 4YLQH 4ISIH 1GI7B 2BD2A 1ZZZA 2O8TA 3MNCA 1TMUH 3FFGA 4AGJA 5GXPA 1DSTA 3KF2A 2ODYB 2FI4E 5A2MH 3MYWA 1G3CA 1OWKA 1BT7A 2BMGB 1EB2A 5EXNA 1GHAG 1ANBA 1P09A 4D7GA 2ZEBA 5GCHG 1QNJA 3UOPA 2VIWA 1C2FA 2ZFRH 4LK4A 2BVXH 1YM0A 4BXWA 1GI4A 4MNWA 2ANWA 1DWCH 4ZKNU 2G5NA 4A1XA 3H7OA 3BTHE 1FUJA 1AVGH 3ITIA 3FANA 1Y5AT 1HAVB 1PPCE 2AMDA 1G37A 3SU1A 3RDZA 2WPIS 2Z3CA 1L1NA 1LHGH 4OS1A 1BBRK 2UUYA 4E7RG 1V3XA 4GVUA 5ESTE 1S82A 2FOGA 1Y3XA 2O9QA 4AORA 2P8OC 4U30A 1P02A 2YOLA 1THSH 1KTSB 2Y6TA 1O3EA 1KIGH 4MPVA 1FMGA 2WUBA 3U8RH 3O8CA 1P2QA 1CE5A 1FLEE 1N8OB 2FOAA 3O8BA 2STAE 3UUZA 5TCCA 1O37A 4FUFA 1GBHA 2ALPA 3V0XA 1HAPH 2H9HA 3OU0A 3UREA 4JK5A
chains in the Genus database with same CATH superfamily
1AMHA 2FZZA 3TJNA 1QRZA 1D3QB 1IQNA 4ZKOU 4FU9A 2WV5A 3KQBA 1U6QA 2XOKD 1SQRA 3MWIU 5CHAC 2ODPA 1S6FA 4AB9A 1GI5A 1V2JT 4OS7A 4FETA 3RC5A 3CP7A 3F2GA 1CHGA 3H09A 2PP6A 5EQSA 3U69H 3DA9B 2GX4A 1G2MA 4DCDA 3BEUA 3E8LA 2J98B 3SU2A 3T25A 1NFUA 1AZZA 1HIAB 2QA9E 1Q31A 2XC5A 4VGCB 1QFKH 1ZGIA 4B2AA 1H8IH 1NESE 2STBE 2HALA 3F2FA 2QXIA 1HJ9A 1ORFA 2F9NA 4Y7BA 3KHVA 2FODA 1BZXE 1L2EA 1TGTA 1MTUA 1ZSLA 4H4FA 2WPJS 3TJOA 4DIIH 2QGRA 1MKXK 2A7CA 3PMAB 5EQQA 1XUKA 2FOFA 2BLQA 2GCTB 3HKIB 1TRNA 1RD3B 4A7IB 1XVMA 2GZ7A 1O2LA 1K28D 4K3JA 5HIZA 5GWZA 3NRLA 1NRQH 4I8HA 3RXSA 3RM2H 2VH6A 4CREA 2A31A 1ETRH 2KR7A 1S83A 2G55A 1BIOA 1AUTC 1JMOH 2SGQE 3CS7A 1C5WB 4YT6H 5T3HA 1YLNA 1KDQB 4ZXYH 2BB4A 3SNDA 3MO6A 2OBOA 5TJXA 2ZTXA 2Q6GA 1OYQA 1EJAA 4X6PA 3A80A 3ZZ7A 5HIYA 2F43B 4X1PU 3F9FA 2XNDD 5DP9A 1DS2E 3SI3H 5IK2D 2WSSD 5F03A 2C8XB 3RC6A 1ACBE 2HPPH 4UEHH 4NZLA 1JIRA 1BBRE 1ZYOA 1HRTH 3D62A 4B2CA 1CT2E 3HATH 1O3OA 3SYJA 4Q4LA 1GBLA 4BTUB 5F8XA 1W0JD 3ATMA 1A61H 4CRGA 1GJ9B 1QL7A 2G51A 5EPNA 2R2MB 3AVZA 3TGIE 1XMNB 3NUMA 2J97A 1TIOA 5JYIA 1AQ7A 1BTHH 4ZKSU 3KCGH 5BPEA 1EQ9A 1CA0B 3SU6A 4B6FA 2GMTC 4U01A 1AZ8A 3I77A 4E7NA 1DXWA 1OXGA 3A7VA 4ABEA 2FYRA 3ELAH 5EU8A 3STIA 1VJAU 1YC0A 1TMTH 1EKBB 4XFQA 1TA2A 1AUJA 2NU0E 2OUAA 4OS6A 2VIOA 2KCOA 3T26A 5DP8A 3PMBB 3QWCH 4K69A 3OFND 1PPFE 4CHAB 1C4Y2 3E6PH 1DWDH 1LDTT 1BRAA 3E1XB 1ZSKA 3A87A 5AVDA 1O2TA 1OP8A 2ZIQH 3W94A 1C2LA 4Q7YA 1FIZA 3GY2A 4IN1A 1YP9A 4WH6A 1LPZB 1DITH 3E0NB 1ZR0A 1TX6A 3OTPA 3RXPA 3UY9A 3P8FA 2SNWA 3BSQA 5EJLA 3RXVA 1O32A 1SQOA 2UUKB 1LKAA 4BAKB 4CH2B 3SZNA 2AFQB 1BQYA 4TWYA 5FL7D 1IQFA 3Q77A 3Q76A 4H6SB 1GHVH 1HAGE 3F6UH 3QN7A 4E05H 3S69A 3ZYDA 2P93A 1GGDC 1GDNA 3JZ2B 1FAKH 1DICA 1FJSA 4I7YH 2KAIB 1NO9H 2ASUB 3GCOA 3M5NA 3SW2B 5C5OA 2HPQH 1FONA 2J2UA 3M35A 4UDWH 5J4SA 2Z9GA 2PSXA 2J34A 5FAHA 1EX3A 2KCPA 4A6LA 1TNIA 1KXBA 1BUIA 3FAOA 4AYYB 3PV5A 4B74A 3MH5A 3SU4A 1MTNB 2IJOB 2ZGCA 3VB4A 1GCDA 1EUFA 2ZTYA 2QXHA 4TY6A 1RTLA 1GCTC 1DDJA 3FP6E 2ZDNA 2JJ2D 1EPTB 1WXRA 4FUIA 3MHWU 3AW1A 1H9HE 7GCHG 3SJIA 3L3TA 1YPKH 3QO6A 1AWHB 1WYKA 3E90B 2AH4X 3RMMH 2HVYB 1E1QD 3B9FH 5PTPA 8GCHG 4X8VH 3ZZCA 1GPZA 1Y5BT 3Q3KA 3WY8A 2QXGA 1P2JA 1F7ZA 1G3EA 5FX6A 3EE0B 2BD4A 5IYTA 1A0LA 2EA3A 5LPEA 3RP2A 2WPLS 4LZ4B 1D3PB 3LGTA 3A81A 4DY7B 1EZSC 1F5RA 1FY4A 1GJ8B 1O3FA 3JZ1B 1GI6A 4RSPA 3VGCB 3OE7D 1SHHB 1GVZA 1HPGA 4ZHLU 1JOUB 4HZHA 5HYOA 1MTSA 4K1TA 2GV6A 1DWEH 1GI2A 2XC0A 2AGEX 2VGCC 3BTME 1HJAB 5K7RA 1EATA 2YNAA 1BMNH 1O3CA 2F9PA 4NWLA 2PR3A 1WCZA 1ZSJA 2RA0A 2VVUA 1CQQA 4NSVA 4X2VA 3B8JA 3SOSA 3N7EA 4NA7A 1ARBA 4Q80A 5DP4A 4DURA 1A5IA 1O5EH 3OY6U 1GBIA 1W13U 2RA3A 2ANMH 5C0UA 1AB9C 2QE7D 4XDEA 9ESTA 4E06H 4MDSA 1ID5H 2BD7A 3K65B 2A45B 4AOQA 1YF4A 1V2OT 2A4RA 2Z3EA 1KXAA 2IPQX 2EQNA 3S0NA 2OLGA 4U32A 1JRTA 3O8RA 1GMCF 3OYPA 2Y82A 2FOEA 4X8UH 3LGWA 1GL0E 2J98A 3RXEA 2XWBI 1TE0A 3C27B 4X8SH 3A8AA 1MAXA 4NWKA 1TWXB 3RXMA 3BG4C 4AX9H 5FBIA 4ABDA 4YTAA 1EB1H 2P3UB 1FAXA 2DE8A 1P3CA 1NC6A 3UQOA 1VITH 4O3UA 1E35B 2QF0A 2FTMA 3DHKH 3F3BA 1IQGA 3F9GA 3ZVFA 2UUFB 1J17T 1WQSA 1C4U2 3T5FH 3U1IB 3KQEA 1YPJH 3ZVDA 5GNDA 1Z8GA 1UJ1A 4WVPE 2JJ1D 1HAZB 3PROA 1ANEA 1BRUP 5A0AE 4ZCNA 2FTLE 3VFEA 5EW2H 1UTPA 1C1SA 5DP5A 1V2NT 5LH8A 1P05A 3PO1C 4DW2U 1K1NA 1CSOE 1O3KA 2PUXB 2GT7A 4B1TA 4K8BA 5EGMA 2PTNA 3ATIA 2RG3A 1H4WA 1AI8H 2GVFA 3GISB 1T4VH 2ZGBH 4AFSA 2BQ7B 1GWAA 4X1RU 3SO3A 2QCYA 2W7SA 3S7KB 5GJ4B 4WMDA 1O5FH 3UNRA 1GBEA 1KTTB 1O39A 3GDUA 1DOJA 1TALA 4OM9A 1GI9B 3LDXH 2A5KA 5FBEA 2J94A 1O31A 1SGQE 1SGDE 2XBVA 4CH8B 2BTCE 4ZHAA 1OPHB 5JBAS 1UCYH 3SV9A 3ATWA 3GICB 3UNQA 2Z94A 4RI0A 1AE8H 1LPKB 3M36A 3UR9A 3ZZ5A 1VZQH 3KGPA 3RMOH 1P2IA 2ZHDA 3GY4A 3IITA 3RLWH 2BD3A 2KZ4A 1COWD 1S6LA 3ATKA 4MNYA 6GCHG 3SBKA 1FY5A 5FPTA 1NBME 5CE1A 4I33A 4INKA 1O2VA 1P9SA 1TPOA 2FOBA 4B6EA 1XUIA 1W11U 4D9RA 1ELCA 3TNSA 1MCTA 1UTKA 4HTCH 3AK5A 1K1LA 4AG2A 2Y81A 1V2TT 1HAYB 1XKAC 3MH6A 2LELA 1F5KU 3RXRA 4NIYA 3DCLA 1NZQH 1SR5C 1EZXC 2GD4B 5FCRA 1MKWH 4FOUC 2VVVA 3GOVB 3A89A 1W3CA 2BQ6B 3BTWE 4UFDH 1L1JA 1O2RA 3NWUA 4HFPB 5KECA 1O0DH 1N6XA 4UONA 1TGNA 1TAWA 1B0EA 5DSFA 2Z9KA 2M2AA 1FNIA 1O2IA 1SGPE 3BN9A 4X2YA 1C9PA 5E2OA 3PTBA 1K21H 2M5TA 3F9EA 4MQAA 1QGFA 1VJ9U 3T29A 2AEIH 1BRBE 2C4FH 1F0RA 2W3KA 3EA8A 1GBAA 1C5UA 2G4TA 2BY9X 1P12E 3SHAH 2F4LA 4SGBE 3M3TA 4GCHF 1O2MA 6LPRA 1GJAB 3SGQE 2FOCA 1W14U 4YM9A 3KQ5A 3KQCA 2JIZD 2KAIA 3P17H 4B71A 4YZUA 3SI4H 1RRKA 1GHBG 3RXBA 1CVWH 2ZFSA 3MU0A 1BTXA 4TSFD 3VXEH 1RIWC 1GVLA 1HAXB 1P2MA 4NIWA 4Y8XA 3TLOA 3CS0A 1DX5M 3UR6A 2ZKSA 1TNJA 4NIVA 4B76A 3UAIC 1HLTH 3C1KA 3DFJA 2QN5T 3ZVAA 1H8ED 2C8ZB 2EI6A 1UVOA 2Q1JA 5F8ZA 4BNRA 4JK6A 3BG8A 3UIRA 1QQUA 1VITG 2SGDE 3DFLA 3L33A 1OP2A 1YPEH 2P59A 5EXLA 1C1MA 6CHAB 2OTVA 4J1YA 1LQDB 4Y0YE 2TGDA 2ZU3A 2F3CE 2AIPA 5ESBA 1YBWA 3LH1A 3MU8A 2ZDLA 2CXVA 1YKTA 1JXPA 2GZ8A 2HRVA 3GY7A 2BD5A 1QIXB 2W6JD 5LPRA 1HUTH 3TK5A 1SBWA 3QK1A 3RXAA 1C5MD 3EA9A 2UUJB 3GS9A 1SOZA 1MBMA 1TPSA 3V3MA 3KIDU 2GV7A 1O3AA 2QF3A 1NRSH 2A7HA 1GJ4H 1QTFA 5L30H 1OWEA 2BHGA 1TQ0B 2CHAC 2F9VA 4A1TA 1OX1A 3WWFA 2WZQA 5DP7A 1OP0A 2JETC 4X6OA 3CNRA 1UO6A 2O8MA 4O3TA 2H5DA 1LHDH 3PLBA 2OC8A 1Y8TA 2VINA 3M5OA 1FPHH 1PQ8A 2H6MA 2PUQH 5DO4H 1ZPCA 1UK3A 1O3HA 2XBWA 1XUJA 2J38A 5FX5A 2Z9JA 1B0FA 1TPAE 5DKMA 1GI0A 4ZKRU 3PV2A 4ASHA 4INLA 1FY3A 5F6MA 2K0QA 3A8DA 2A2XH 1SGCA 2LNCA 3A7ZA 1CU1A 5A09A 3MO3A 1OYTH 2XBYA 1A1RA 1C2IA 1O5CB 2ILNA 3SV8A 1O38A 1SLUB 2SNVA 3HGNA 2ZPQA 5EW1H 3MFJA 2BLVA 5EJZA 4DVAU 5L2ZH 1YWUA 4NFEA 1SGFA 4Z6AH 4I8JA 2OXSA 1QCPA 3UWIA 2FS9A 1MTVA 1BTPA 5B6OA 3TPIZ 2KCAA 1UCYK 1XVOA 1GMDG 4A1VA 1HFDA 3LJOA 3V13A 1O3PB 1XX9A 1O3NA 3RXOA 2GT8A 2FYQA 1DLEA 1O2NA 5EG4A 7LPRA 4HGCA 3EYDA 3MNBA 4FUJA 4ZAEA 2XTTB 1TNLA 2OC7A 5CHAB 1IQLA 2BDIA 3ZZ8A 1GBKA 1V2KT 1GBFA 2D2DA 1HDTH 3H7TA 1N6YA 1AFEH 5EOKA 3RXHA 2BDHA 1KXEA 4CBOA 2OC1A 4GSOA 2WPHS 1GG6C 4F49A 1NY22 2VIDA 1QBNA 3VXFH 3ZV9A 1IQKA 1K1OA 1V2UT 1UVTH 1GJ5H 3NK8A 3UQVA 1ZRBA 2V3OH 1J8AA 5HKKD 3GY6A 4SGAE 1N8OC 2RDLA 5HM2A 3EGKH 8ESTE 1C1VH 3TITA 3ZZ3A 4HG6A 1TA6A 2PTCE 4MNVA 1TX8A 4A5TS 2ZCHP 2TGPZ 3TVJB 4TWWA 2VJ1A 1GI8B 1O2JA 2ZPSA 3QDZB 3RMNH 3T62A 1D4PB 3U98H 2XXLA 1BA8B 3U8OH 3A83A 2BDAA 1BRCE 4BAMB 5C1UA 3LPRA 3K2UA 4CRCA 1A3BH 1O3JA 3OY5U 1QL8A 3ODDA 2BQWB 4FUDA 1EJNA 4IN2A 1TRMA 2A4QA 4F55A 1QJ1B 1ESTA 1ANDA 1LVMA 1GJ6A 1BHXB 1C2HA 1DWBH 3SHCH 2R0LA 3HKJB 4O9VA 1IQHA 1TQ7B 2PWXA 1SGEE 1O3GA 1TGBA 3SNBA 3VPKA 3DSPA 4IMQA 1GBBA 1CGIE 1QJ6B 5I46H 1E79D 1YCPH 1E36B 2A2QH 2NU4E 4MVNA 1AHTH 4MPWA 3VB7A 3LJJA 2G5VA 3LONA 2GKVE 4JYTA 1J15A 2H2ZA 1ZMLA 1D3TB 3GYMA 4Y6DA 4X2XA 1G30B 1W0ZU 1ZMJA 2BXUH 1F5LA 1ELBA 1PFXC 1OWHA 3TK6A 4Q63A 4P00A 1KXDA 2ZC9H 2KCYA 2WYJA 3BTQE 4Y0ZE 1DUAA 3ATLA 3PWCA 2YMSD 3GY8A 1SKYE 1UCYE 1HAOH 1SSXA 1FX0B 2CJIA 1SGFG 1WSSH 4XBBA 3SNCA 2J92A 1HAIH 4OS2A 4RKOB 1V2MT 1Q3XA 2XBXA 3N7OA 1GMHG 1D3DB 1GJDB 4Y71A 1QJ7B 4ZXXH 1O34A 1MABB 3PLKA 1BTYA 2V6NA 2AMQA 4MPUA 1ELFA 4CBNA 4DJZB 4CR9A 3A7XA 1EAWA 1KLIH 2FOMB 2TPIZ 1O3BA 1A7SA 2ZDKA 1GHYH 2ZGHA 1A3EH 5GDSH 2FWWA 5J4QA 2C8YB 1KY9A 4JYVH 1WTGH 2SGFE 1YLDA 3S9BA 4A92A 1H8HD 4TY7A 4BTTB 3UFAA 2A4OA 5C17A 3TK9A 1CA0C 1DFPA 1EAUA 1C5RA 1GHAF 2BYAX 1UTMA 5LPFA 2V3HH 5GCHF 3GCHC 5AF9H 2OCVB 3BIUH 4WXIA 5T6GA 1TB6H 1GGDB 2ZHQH 4X1SU 4XRNA 5E2PA 2ZCLP 4AFUA 4BAOB 1SQTA 2BDCA 2FDAA 3ZVGA 2WPKS 2K1QA 2A4GA 1QA0A 4CHAC 5DGJA 4IC6A 1S5SA 4AN7A 3U9AH 3RLYH 1OKXA 4ABHA 3ESTA 2L6OA 1THRH 3V12A 2FX4A 1FDPA 2C3SA 4QT8C 3OEHD 1T8LA 1AKSA 2QIQA 2HLDD 1GCTB 4WH8A 2VIQA 3FOAA 3MOCA 4I8GA 3SU3A 4UD9H 1JBUH 3URCA 4X1NU 2AHME 2FLRH 3N99A 4WY3A 3M37A 5GPIB 1TBQH 1GMDF 1O3IA 1NS3A 2ANYA 5DP6A 1TX7A 1QR3E 4ZUHA 3KN2A 1TOMH 5C94A 2RDEA 3KL6A 1C5ZB 2F9OA 5SGAE 1YPMH 4FUHA 5L2YH 2ULLA 1P0SH 5AFZH 4ACBA 1W0YH 1O5AB 2JDID 4IS5A 1W7XH 4ASUD 4MG3A 5HGGA 3SJ8A 4NG9H 1BTZA 1ELEE 1TMBH 1BITA 3BEFB 4BTIB 2B9LA 3GCTG 3LT3A 4YOJA 1Q2WA 1ZTLA 1UVUH 3L6PA 3NXPA 3TH2H 2FLBH 1NN6A 1XUGA 2L74A 3UNSA 2VBCA 1T32A 5T6FA 3M5LA 3GDVA 3PRBA 4GUXA 1AE5A 1LHFH 1P10A 1NFYA 2FXRA 1EOJA 1EPTC 2B7DH 2WPMS 2Y7XA 2FX6A 1YGCH 2ZFTA 3SUGA 1UHBB 1ABIH 2B0FA 2Q6DA 3PMJA 1AB9B 4WWYA 3SUDA 2FOHA 3SV7A 1VCWA 1LO6A 2RCEA 3W1EA 3EAJA 2GCHG 1FN6A 2BZAA 3MTYA 3F0OA 1C1RA 1TNGA 2KM0A 4M9FA 2P3TB 4KKDA 2RFKC 3EA7A 1WQVH 1YCPK 1C5NH 1TPPA 3PRDA 2PGQB 3ZZBA 4B2BA 1O2UA 1MUEB 1ELAA 1V2WT 2XRCA 2XYAA 3VGCC 4B73A 2PLXA 2PW8H 1LMWB 1SI5H 3N7DA 1A5HA 1K1IA 5C0TA 3BTGE 2IPHA 4MNXA 3BG4B 4CRAA 4IBLH 5E8EH 3BTKE 2P16A 3LGIA 4LZ1H 3F2HA 1G2LA 3PB1E 1JIMA 4NGAH 3FP7E 1XXDA 3DT0H 1GI3A 5HM9A 1JRSA 2UWOA 5BRRE 2O8UA 2W3IA 3RXQA 1OWIA 1SB1H 1OSSA 1O3MA 3BTEE 1T4UH 1EP5A 5DG6A 3Q3YA 3I29A 3BTDE 4ABBA 1F0SA 1OHHD 3A8CA 3P6ZB 1QZ8A 2BX3A 4UE7H 3EE7A 3SNAA 2J5UA 1SMFE 1TYNA 1GHWH 4FU7A 4I8KA 3LGVA 2HLCA 1E1RD 2PHBA 4B75A 1GJ7B 4DG4A 3E16B 3TGJE 3AAVA 1HV7A 3TU7H 2FM2A 1UTNA 2ESTE 1THPB 4NFFA 5A0CA 1AO5A 3P95A 1O36A 1F0UA 2GJGA 3MH4A 2AERH 4H42U 1Y3YA 2ZGXH 2I6SA 1CGJE 1NPMA 1E34B 1YPHE 3P8GA 9LPRA 3VB3A 1C1PA 1CBWC 1FI8A 1C2MA 2ZQ2A 1PQ7A 3OEED 3MMGA 2D1JA 3LGUA 2A1DB 1B5GH 3EDXB 3AASA 4YOIA 4JZ1A 4X0WU 5A8ZA 3A7TA 3OTJE 2HNTE 1EOLA 3QTOH 1LTOA 2HVXA 4IC5A 5T1VA 4AFQA 2G81E 4BAHB 1C1OA 2O8LA 2R0KA 3QTVH 3SJ9A 3UTUH 2FIRH 4FUGA 2AYWA 2V7QD 1ETTH 3M7TA 1ZLRA 2ZTZA 3BEIB 1AWFH 1F2SE 2QY0B 4ABFA 3MO9A 2F9UA 1KMHB 1CGHA 4I31A 1WBGB 1JWTA 2PKSB 4F4OC 1AGJA 1S0QA 4FUCA 4DOQA 1IQEA 1UTOA 1KLTA 1T31A 1AIXH 1D6WA 2AIQA 1SGRE 2OK5A 1W0KD 1ZMNA 1J9CH 1PQ5A 1XXFA 3BTFE 3W95A 3TH3H 1HYLA 2VIPA 1DY8A 1TNHA 4AG1A 3TIUA 1C2DA 1O2KA 5F8TA 1P2KA 3HPTB 1MTWA 1W10U 2PKAA 3ENSB 2ZP0H 2C8WB 3D49H 1PJPA 2G4UA 3E0PB 4OGXA 3ZZ9A 4JCNA 3PV4A 3E91A 1A5GH 3OSYA 1VCPA 4M7GA 2OQUA 5C20A 1ELVA 1A0HB 1G32B 2GGVB 2QC2A 2YMSC 3NZIA 2QXJA 1NT1A 3RU4E 1KYNA 5FXLA 2V35A 1F0TA 1S85A 1BTWA 3ODFA 1J16A 1ESBA 4UFGH 2ZFQH 1FPCH 1NRPH 1V2LT 1C2GA 5DP3A 7GCHF 5FPYA 3RXFA 4K1SA 3TJUA 1XUHA 1HBTH 2ZZUH 5E0HA 1MMJN 3VEQB 8GCHF 3RXLA 1BJVA 3Q3XA 1P04A 3GCTF 2J4IA 3SGAE 2FP7B 2VB0A 3RXCA 4K60A 2BXTH 2H9TH 2EC9H 1QY6A 3T28A 2WPDD 4ISHH 4OGYA 1VGCC 1ZGVA 1IQMA 5FCKA 2D8WA 5C5NA 4GHTA 1T7CA 3K9XB 1CO7E 3RC4A 1YY3A 1GHXH 1K1PA 2WHXA 4GLYA 1HXEH 1WOFA 7KMEH 1C5QA 1IOEA 3VB6A 3BV9B 1VCQA 2OD3B 1LHEH 4TPYA 3H5CB 2TRMA 4TYDA 1HJ8A 3WWBA 1EJMA 1ETSH 2BY6X 2ZA5A 5JBTA 5JDUB 4D8NA 2Q6FA 1Z6EA 4XD7D 3U1JB 5ETXA 1LVBA 1NRNH 2JETB 2W26A 4WXVA 3SU0A 1UW7A 2OBQA 3K6YA 4IMZA 5I25A 3F0PA 5C67A 1OS8A 4ABIA 1NM6A 1AFQC 2LPRA 2BY8X 3R3GB 2IOTA 1SFQB 1D6RA 1AKSB 2FS8A 1EP6A 1ZPBA 5EQRA 2BOHB 4MPXA 3SJKA 1NU7B 1Z8IB 1DY9A 1GDQA 6CHAC 1CHOG 1SC8U 5JB8S 1S84A 1RTKA 1LVYA 1UHBA 2CK3D 3IG6B 3SUEA 3URDA 1SFIA 3A85A 1O2OA 1P2OA 4AYVB 2UWLA 2VVCA 4AGKA 1O35A 4YXWD 1T8MA 1C1QA 6ESTA 2XW9A 4AC9A 4Z0KA 2A0QB 5DJ7A 1G3BA 3LC5A 1EZQA 5JPMH 3SGBE 1FXYA 1GJBB 4MTBA 2ZI2H 1RS0A 4Y8YA 5CMXH 1ELGA 2XC4A 5C1XA 1NFWA 3GY3A 1RXPA 1F92A 3FZZA 4O97A 4K2YA 1SGYE 2F9BH 4IW4E 1TBRH 2Z9LA 2P8OB 1HCGA 3LC3A 3D65E 4ABAA 1W12U 3GYLB 5HMAA 2BLOA 3PTNA 1KLJH 2GZ9A 1GBTA 3ZZDA 4OS4A 4RN6A 3RXIA 3SU5A 4D9QA 3NKKA 1GBJA 8KME2 2Z6BD 1NRRH 4XBDA 1PPEE 2A5IA 2BM2A 3MNSA 7ESTE 2Z3DA 2W5EA 3LGYA 1P01A 3LU9B 3O8DA 1ZHMA 3FN8A 3KQDA 3RXDA 1BJUA 1GHZA 2BOKA 1LKBA 2VWMA 2Y5GA 2BD8A 3S9CA 1GG6B 2BDGA 5GIBA 1ANCA 2NU3E 2WINI 3PLPA 1O5DH 4FUBA 1C2KA 2FMJA 1ZJKA 1C5PA 1RFNA 1GBDA 3IWMA 4AZ2B 1FIWA 1XKBC 1MBQA 1C5VA 3SNEA 1DVAH 3GDSA 1MD7A 1V2PT 6GCHF 1QRXA 1P3EA 1MKWK 2QV1A 1HAHH 3NCLA 4WF8A 2ZHEH 4NIXA 1V2VT 2YNBA 1FY1A 2CN0H 2VH0A 2PFEA 4ISOA 2ZO3H 3SUFA 4ABJA 1X7AC 3STJA 1G36A 1CT4E 4FUEA 1WV7H 3MU1A 3RXKA 4X8TH 2C90B 2WYGA 1Y59T 4I32A 3U28C 1V2ST 1Y3WA 1C5YB 3RU4T 3F9HA 1TRYA 2SGAA 1K1MA 4NSYA 4WMFA 1ZPZA 2ZGJA 3DD2H 1SHYA 3BIVH 4CRBA 1O2GH 3A82A 4XE4A 5C3NA 1Y3UA 2ZHFH 2QAAA 1O33A 5E0GA 1QRWA 3MQKC 4VGCC 5A0BA 1H9IE 1MQ5A 1LHCH 1IHSH 2FESH 2CMYA 3A84A 1P11E 4PROA 2NWNA 2LP6A 1H9LB 2Y5HA 5DK1A 1ZHPA 2EI7A 1DLKB 2GCTC 1GBMA 1C5SA 1P9UA 1DSUA 2Y5FA 1GHBF 4I8LA 1C5OH 1IQIA 3SJOA 4KGAA 1DPOA 4IGDA 1GMCG 5T6DA 3FZDA 1PPHE 1GVKB 5L6NH 1SL3A 5DPAA 1O30A 1OOKB 1J14A 1HGTH 3ZIAD 1L4ZA 5E0JA 2WV4A 5AFYH 3MU4A 2GMTB 1BMLA 1BHXF 5B6LA 3TGKE 2ZF0H 1VITF 2XWAA 4THNH 2H5CA 2F83A 2QF5A 5KGOA 2CF9H 1B7XB 3GY5A 2ZPRA 2SFAA 5HXFA 4AFZA 2C93B 2ZU5A 2VWNA 1SGTA 1KSNA 1FV9A 1UMAH 1S6HA 1NBMD 1TGCA 1C1NA 4K8YA 2BD9A 3S9AA 3GCNA 5CHBA 3SQHE 3QX5H 1W8BH 2Z7FE 4MLFB 3LH3A 1FN8A 2JH0D 1VR1H 2P94A 1ABJH 1C1TA 2WV9A 1Z6JH 4BANB 4P02A 3A8BA 3QZRA 1YYY1 2PKAB 1V6DA 1ARCA 4J2YB 1VKYA 2THFB 3GCHB 3MH7A 5K0HA 1AVXA 1CHOF 4ESTE 2GDDA 1SGIB 1YCPM 3AW0A 2JH5D 2O8WA 3P92A 4CRDA 2ZQ1A 1CT0E 1IAUA 3M61U 1E37B 1MU6B 5A8XA 3FP8E 2KFWA 2FI3E 3LIWA 3U8TH 1DE7H 1SPJA 2QYIA 3RU4D 1NFXA 3KNXA 4FVBA 3ZZ4A 1Z1IA 3HK6B 1Y3VA 2GP9B 1QBOA 2R3YA 4JZEH 1LPGB 4Q7XA 4GPGA 1N1LA 4YESB 2XCFA 2ZU1A 4GAWA 1SLWB 4BAQB 4WMEA 3G01A 4JYUH 1K9OE 1AU8A 1Z8JB 3HK3B 4JZDH 2A32A 1UTLM 4UFFH 3ZZAA 1AD8H 4Q2KA 1AY6H 1WUNH 1O2PA 3FO8D 4ZHMU 5LGOA 1FY8E 2P3FH 3MI4A 3R0FA 5EXMA 2BX4A 1PYTD 4FU8A 3E3TA 1QBVH 4Q7ZA 1GBCA 1QHRB 4Y76A 3P8OA 2GTBA 1IHTH 1FZZA 2NU2E 2ZDAH 1V2RT 4CR5A 1O3DA 3F68H 2GDEH 1TLDA 4LOYH 1LVOA 1MAYA 3M7UA 4NA8A 2A5AA 1UK2A 1H8DH 3KEEA 1E0FD 4R0IA 3PWBA 1MZAA 1UK4A 1YLCA 2BLWA 2TBSA 2WUCA 4U2WA 1QL9A 1O5GH 1C2JA 2PSYA 3BTTE 5C2ZA 1O5BB 2NU1E 5JB9S 1TABE 2V3MA 3FVFB 2R2WU 1TNKA 3UOUA 4AB8A 3KYFA 3QZQA 1KXFA 1MTNC 4ABGA 2V0BA 1KXCA 2F91A 2VGCB 3SQEE 1CA8B 4GCHG 1TONA 1HAVA 1UVSH 4NCYA 1HNEE 1L0ZA 2OC0A 2G00A 2ZWLH 1O3LA 1E38B 2G52A 3A86A 4ACAA 1WTHD 1V2QT 3D23A 3PYHA 2TIOA 1DANH 3ZVBA 4UFEH 1HB0B 2J9NA 2EI8A 1TBZH 1MCVA 2BVSH 1W7GH 3ZV8A 3B23B 4GHQA 3DSOA 3T2NA 1SG8B 3MU5A 1SOTA 3UPEA 5A8YA 3VG8A 3M3VA 1L1GA 1QURH 1RTFB 5JBBS 1O2QA 1C1UH 1PQAA 5IDKA 2R9PA 1WU1A 3F1SB 3M7QA 3SV6A 1TGSZ 1K22H 1C4V2 4OS5A 1WAYB 1K1JA 1QB6A 1S0RA 5EJ1A 4DT4A 1SQAA 3BF6H 3DUXH 1Z7KA 4HI3A 1K0HA 3KYGA 1HJAC 2SGEE 1C5TA 1M9UA 4YO9A 3MNXA 3RMLH 3A7WA 3P8NA 1BTUA 2ZECA 3VB5A 3LKWA 2IJD1 1MU8B 1H1BA 5EPYA 1ZHRA 3NPSA 1PPBH 4ZROA 4BXSA 1Z8RA 2H9EH 5JBCS 1C2EA 3M3SA 3M5MA 4JMYA 1TFXA 1BOQA 1BB0B 5C1YA 3ZZ6A 3TJVA 1EFRD 5F53A 1QB1A 1UVPA 2ZDVH 3PMHB 1ZTKA 8LPRA 3RXGA 1A4WH 5EODA 4Y8ZA 1HIAA 2AS9A 2CF8H 2BY7X 1DXPA 5ABWA 1P57B 3PO1B 4D76A 1DM4B 4Y11E 2BDBA 3ZVEA 4NZQA 4KTUA 1O2XA 3ZYEA 1CBWB 1L4DA 2XCNA 1K2I1 2SGPE 2JH6D 4DIHH 1EASA 1GMHF 3A88A 3Q00A 4ZMAH 2BVRH 5DN6D 1BDAA 1YPGH 1C5LH 1OWDA 4YT7H 1SLVB 3A7YA 2IN2A 2ZFPH 4FVDA 1ELTA 1PPZA 2VWOA 4XSKU 4ZH8A 1SLXB 4ISLA 1UTJA 3EQ0H 1AVWA 2OQ5A 1Z71A 4K5ZA 3RUOA 1KDQA 2FPZA 2ZNKH 2Y80A 5EIYA 1YPLH 2P95A 4Z1MD 1LCYA 2UWPA 1XUFA 1UTQA 2HOBA 1HXFH 2W6ID 2J95A 1G9IE 1LQEA 1EAIA 2CV3A 1NROH 4X6NA 2K8IA 2CGAA 1NTPA 2HWLB 3WW7A 1RJXB 2R3UA 4JZFH 2ZCKP 1EAXA 1ESAA 1INCA 2DUCA 1BBRH 4KP0A 2ZU2A 2OINA 1A2CH 2AMPA 3PM3A 4R8TB 2B5TB 1P2NA 1P8VC 1P06A 1BMFD 2ZU4A 3CENA 2A7JA 3QGNB 1XM1A 1IQJA 1SVPA 2BZ6H 3OAAD 1MZDA 2ODQA 1EXFA 1YPHC 4Y79A 2VU8E 4BOHA 1O2HA 1A0JA 3OX7U 1T8OA 1C1WH 1PPGE 3I78A 3DSGA 1ELDE 4FXGH 2YMSB 1MD8A 2FO9A 1BCUH 2HNTC 1G3DA 2HNTF 2Y7ZA 3TH4H 2D26C 1BMAA 4CRFA 4DGJA 1W2KH 2PKSC 2ZG0H 1MH0A 3ZVCA 3QLPH 1NU9A 1WDIA 3K6ZA 3SN8A 1GL1A 2VIVA 1AN1E 3T27A 1BMMH 4WJG2 5G4BA 4XOJA 3SV2H 1O2YA 4DT7B 2AGIX 2ZDMA 3RXTA 4YLUA 2ANKH 1S81A 3SORA 4JZIA 2W7UA 1DT2A 1O2ZA 2HGTH 5FHTA 1RIWB 1GJCB 2BY5X 2TGTA 1T8NA 2Z9IA 1VGCB 1Y5UT 2TGAA 4Y10E 1FQ3A 5TCAA 3P70B 3V7TA 2DE9A 3QGJA 1MKXH 2VNTA 4TPIZ 1ZJDA 2ALVA 3RXUA 2OP9A 1EZUC 3HGPA 2PGBB 2EEKA 1Z1JA 1C9TA 4TT3D 1P03A 4D7FA 2FI5E 1ZRKA 4X1QU 2ZHWH 3LOXA 3QUMP 4KTCA 4X6MA 2XNIA 1C5XB 2B8OH 4ISNA 3TNTA 4F48B 5FPSA 1ZOMA 2JKHA 2ZFFH 1GDUA 1MQ6A 1ZTJA 1SGNE 3S7HB 2GCHF 5H4IB 4Y7AA 5AHGH 1AFQB 1O2WA 1QA7A 4KELA 1DUEA 4INHA 1RGQA 2CHAB 4O03A 1O2SA 4K1EA 4YOGA 2I6QA 1QQ4A 1EPTA 4RKJB 3RM0H 4X2WA 3UWJH 2FEQH 2H1UA 1GI1A 1QB9A 1D9IA 1OWJA 3RXJA 4H6TA 3AAUA 1TOCB 4LXBH 2AGGX 1A46H 4XBCA 2BDYA 2G8TA 4NA9H 2VWLA 2PV9B 4KTSA 1PYTC 4YLQH 4ISIH 1GI7B 2BD2A 1ZZZA 2O8TA 3MNCA 1TMUH 3FFGA 4RT0A 4AGJA 5GXPA 1DSTA 3KF2A 2ODYB 2FI4E 3UB0A 5A2MH 3MYWA 1G3CA 1OWKA 1BT7A 3FKSD 2QF4A 2BMGB 2EY4C 1EB2A 5EXNA 1GHAG 1ANBA 1P09A 4D7GA 2ZEBA 5GCHG 1QNJA 3UOPA 2VIWA 1C2FA 2ZFRH 4LK4A 5CDFE 2BVXH 1YM0A 4BXWA 1GI4A 4MNWA 2ANWA 1DWCH 4ZKNU 2G5NA 4A1XA 3H7OA 3BTHE 1FUJA 1AVGH 3ITIA 3FANA 1Y5AT 5KEDA 1HAVB 1PPCE 2AMDA 1G37A 3SU1A 3RDZA 2WPIS 2Z3CA 1L1NA 1LHGH 4RT1A 4I86A 4OS1A 1BBRK 2UUYA 4E7RG 1V3XA 4GVUA 5ESTE 1S82A 2FOGA 1Y3XA 2O9QA 4AORA 2P8OC 4U30A 1P02A 2YOLA 1THSH 1KTSB 2Y6TA 1O3EA 1KIGH 4MPVA 1FMGA 2WUBA 3U8RH 3O8CA 1P2QA 1CE5A 1FLEE 1N8OB 2FOAA 3O8BA 3SZEA 2STAE 3UUZA 5TCCA 1O37A 4FUFA 1GBHA 2ALPA 3V0XA 1HAPH 2H9HA 3OU0A 3UREA 2KX4A 4JK5A
chains in the Genus database with same CATH topology
1AMHA 2FZZA 3TJNA 1QRZA 1D3QB 1IQNA 4ZKOU 4FU9A 2WV5A 3KQBA 1U6QA 3MWIU 5CHAC 2ODPA 1S6FA 4AB9A 1GI5A 1V2JT 4OS7A 3RC5A 3CP7A 1CHGA 3U69H 5EQSA 3DA9B 2GX4A 1G2MA 4DCDA 3BEUA 3E8LA 3SU2A 3T25A 1NFUA 1AZZA 1HIAB 2QA9E 1Q31A 2XC5A 4VGCB 1QFKH 1ZGIA 4B2AA 1H8IH 1NESE 2STBE 2HALA 2QXIA 1HJ9A 1ORFA 2F9NA 4Y7BA 3KHVA 2FODA 1BZXE 1L2EA 1TGTA 1MTUA 1ZSLA 4H4FA 2WPJS 3TJOA 4DIIH 2QGRA 1MKXK 2A7CA 3PMAB 5EQQA 1XUKA 2FOFA 2BLQA 2GCTB 3HKIB 1TRNA 1RD3B 4A7IB 1XVMA 2GZ7A 1O2LA 1K28D 4K3JA 5GWZA 1NRQH 4I8HA 3RXSA 3RM2H 2VH6A 4CREA 2A31A 1ETRH 1S83A 2G55A 1BIOA 1AUTC 1JMOH 2SGQE 3CS7A 1C5WB 4YT6H 5T3HA 1KDQB 4ZXYH 2BB4A 3SNDA 3MO6A 2OBOA 5TJXA 2ZTXA 2Q6GA 1OYQA 1EJAA 4X6PA 3A80A 3ZZ7A 4X1PU 3F9FA 5DP9A 1DS2E 3SI3H 5F03A 2C8XB 3RC6A 1ACBE 2HPPH 4UEHH 4NZLA 1JIRA 1BBRE 1ZYOA 1HRTH 3D62A 4B2CA 1CT2E 3HATH 1O3OA 1GBLA 4BTUB 5F8XA 3ATMA 1A61H 4CRGA 1GJ9B 1QL7A 2G51A 5EPNA 2R2MB 3AVZA 3TGIE 1XMNB 3NUMA 1TIOA 5JYIA 1AQ7A 1BTHH 4ZKSU 3KCGH 5BPEA 1EQ9A 1CA0B 3SU6A 2GMTC 4U01A 1AZ8A 3I77A 4E7NA 1DXWA 1OXGA 3A7VA 4ABEA 2FYRA 3ELAH 5EU8A 3STIA 1VJAU 1YC0A 1TMTH 1EKBB 4XFQA 1TA2A 1AUJA 2NU0E 2OUAA 4OS6A 2VIOA 3T26A 5DP8A 3PMBB 3QWCH 4K69A 1PPFE 4CHAB 1C4Y2 3E6PH 1DWDH 1LDTT 1BRAA 3E1XB 1ZSKA 3A87A 5AVDA 1O2TA 1OP8A 2ZIQH 3W94A 1C2LA 4Q7YA 1FIZA 3GY2A 4IN1A 1YP9A 4WH6A 1LPZB 1DITH 3E0NB 1ZR0A 1TX6A 3RXPA 3UY9A 3P8FA 2SNWA 3BSQA 3RXVA 1O32A 1SQOA 2UUKB 1LKAA 4BAKB 4CH2B 3SZNA 2AFQB 1BQYA 4TWYA 1IQFA 3Q77A 3Q76A 4H6SB 1GHVH 1HAGE 3F6UH 3QN7A 4E05H 3S69A 3ZYDA 2P93A 1GGDC 1GDNA 3JZ2B 1FAKH 1DICA 1FJSA 4I7YH 2KAIB 1NO9H 2ASUB 3GCOA 3M5NA 3SW2B 5C5OA 2HPQH 1FONA 2J2UA 3M35A 4UDWH 5J4SA 2Z9GA 2PSXA 2J34A 5FAHA 1EX3A 4A6LA 1TNIA 1KXBA 1BUIA 3FAOA 4AYYB 4B74A 3MH5A 3SU4A 1MTNB 2IJOB 2ZGCA 3VB4A 1GCDA 1EUFA 2ZTYA 2QXHA 4TY6A 1RTLA 1GCTC 1DDJA 3FP6E 2ZDNA 1EPTB 4FUIA 3MHWU 3AW1A 1H9HE 7GCHG 3SJIA 3L3TA 1YPKH 3QO6A 1AWHB 1WYKA 3E90B 2AH4X 3RMMH 3B9FH 5PTPA 8GCHG 4X8VH 3ZZCA 1GPZA 1Y5BT 3Q3KA 3WY8A 2QXGA 1P2JA 1F7ZA 1G3EA 5FX6A 3EE0B 2BD4A 5IYTA 1A0LA 2EA3A 5LPEA 3RP2A 2WPLS 4LZ4B 1D3PB 3LGTA 3A81A 4DY7B 1EZSC 1F5RA 1FY4A 1GJ8B 1O3FA 3JZ1B 1GI6A 4RSPA 3VGCB 1SHHB 1GVZA 1HPGA 4ZHLU 1JOUB 4HZHA 5HYOA 1MTSA 4K1TA 2GV6A 1DWEH 1GI2A 2XC0A 2AGEX 2VGCC 3BTME 1HJAB 5K7RA 1EATA 2YNAA 1BMNH 1O3CA 2F9PA 4NWLA 2PR3A 1WCZA 1ZSJA 2RA0A 2VVUA 1CQQA 4NSVA 4X2VA 3B8JA 3SOSA 4NA7A 1ARBA 4Q80A 5DP4A 4DURA 1A5IA 1O5EH 3OY6U 1GBIA 1W13U 2RA3A 2ANMH 1AB9C 4XDEA 9ESTA 4E06H 4MDSA 1ID5H 2BD7A 3K65B 2A45B 4AOQA 1YF4A 1V2OT 2A4RA 2Z3EA 1KXAA 3S0NA 2OLGA 4U32A 1JRTA 3O8RA 1GMCF 3OYPA 2Y82A 2FOEA 4X8UH 3LGWA 1GL0E 3RXEA 2XWBI 1TE0A 3C27B 4X8SH 3A8AA 1MAXA 4NWKA 1TWXB 3RXMA 3BG4C 4AX9H 5FBIA 4ABDA 4YTAA 1EB1H 2P3UB 1FAXA 2DE8A 1P3CA 1NC6A 3UQOA 1VITH 4O3UA 1E35B 2QF0A 2FTMA 3DHKH 1IQGA 3F9GA 3ZVFA 2UUFB 1J17T 1WQSA 1C4U2 3T5FH 3U1IB 3KQEA 1YPJH 3ZVDA 1Z8GA 1UJ1A 4WVPE 1HAZB 3PROA 1ANEA 1BRUP 5A0AE 2FTLE 3VFEA 5EW2H 1UTPA 1C1SA 5DP5A 1V2NT 5LH8A 1P05A 3PO1C 4DW2U 1K1NA 1CSOE 1O3KA 2PUXB 2GT7A 4B1TA 4K8BA 5EGMA 2PTNA 3ATIA 2RG3A 1H4WA 1AI8H 2GVFA 3GISB 1T4VH 2ZGBH 4AFSA 2BQ7B 1GWAA 4X1RU 3SO3A 2QCYA 2W7SA 3S7KB 5GJ4B 4WMDA 1O5FH 3UNRA 1GBEA 1KTTB 1O39A 3GDUA 1DOJA 1TALA 1GI9B 3LDXH 2A5KA 5FBEA 2J94A 1O31A 1SGQE 1SGDE 2XBVA 4CH8B 2BTCE 4ZHAA 1OPHB 5JBAS 1UCYH 3SV9A 3ATWA 3GICB 3UNQA 2Z94A 1AE8H 1LPKB 3M36A 3UR9A 3ZZ5A 1VZQH 3KGPA 3RMOH 1P2IA 2ZHDA 3GY4A 3IITA 3RLWH 2BD3A 6GCHG 3ATKA 4MNYA 3SBKA 1FY5A 5FPTA 5CE1A 4I33A 4INKA 1O2VA 1P9SA 1TPOA 2FOBA 1XUIA 1W11U 4D9RA 1ELCA 3TNSA 1MCTA 1UTKA 4HTCH 1K1LA 4AG2A 2Y81A 1V2TT 1HAYB 1XKAC 3MH6A 1F5KU 3RXRA 4NIYA 1NZQH 1SR5C 1EZXC 2GD4B 5FCRA 1MKWH 2VVVA 3GOVB 3A89A 1W3CA 2BQ6B 3BTWE 4UFDH 1L1JA 1O2RA 3NWUA 4HFPB 1O0DH 1N6XA 4UONA 1TGNA 1TAWA 1B0EA 2Z9KA 1FNIA 1O2IA 1SGPE 3BN9A 4X2YA 1C9PA 5E2OA 3PTBA 1K21H 2M5TA 3F9EA 4MQAA 1QGFA 1VJ9U 3T29A 2AEIH 1BRBE 2C4FH 1F0RA 2W3KA 3EA8A 1GBAA 1C5UA 2G4TA 2BY9X 1P12E 3SHAH 4SGBE 3M3TA 4GCHF 1O2MA 6LPRA 1GJAB 3SGQE 2FOCA 1W14U 4YM9A 3KQCA 2KAIA 3P17H 4B71A 4YZUA 3SI4H 1RRKA 1GHBG 3RXBA 1CVWH 2ZFSA 3MU0A 1BTXA 3VXEH 1RIWC 1GVLA 1HAXB 1P2MA 4NIWA 4Y8XA 3TLOA 3CS0A 1DX5M 3UR6A 2ZKSA 1TNJA 4NIVA 4B76A 1HLTH 3C1KA 3DFJA 2QN5T 3ZVAA 2C8ZB 2EI6A 1UVOA 2Q1JA 5F8ZA 4BNRA 4JK6A 3BG8A 3UIRA 1QQUA 1VITG 2SGDE 3DFLA 3L33A 1OP2A 1YPEH 2P59A 5EXLA 1C1MA 6CHAB 2OTVA 4J1YA 1LQDB 4Y0YE 2TGDA 2ZU3A 2F3CE 2AIPA 5ESBA 1YBWA 3LH1A 3MU8A 2ZDLA 2CXVA 1YKTA 1JXPA 2GZ8A 2HRVA 3GY7A 2BD5A 1QIXB 5LPRA 1HUTH 3TK5A 1SBWA 3QK1A 3RXAA 1C5MD 3EA9A 2UUJB 1SOZA 1MBMA 1TPSA 3V3MA 3KIDU 2GV7A 1O3AA 2QF3A 1NRSH 2A7HA 1GJ4H 1QTFA 5L30H 1OWEA 2BHGA 1TQ0B 2CHAC 2F9VA 4A1TA 1OX1A 5DP7A 1OP0A 2JETC 4X6OA 1UO6A 2O8MA 4O3TA 2H5DA 1LHDH 3PLBA 2OC8A 1Y8TA 2VINA 3M5OA 1FPHH 1PQ8A 2H6MA 2PUQH 5DO4H 1ZPCA 1UK3A 1O3HA 2XBWA 1XUJA 2J38A 5FX5A 2Z9JA 1B0FA 1TPAE 5DKMA 1GI0A 4ZKRU 4ASHA 4INLA 1FY3A 5F6MA 3A8DA 2A2XH 1SGCA 2LNCA 3A7ZA 1CU1A 5A09A 3MO3A 1OYTH 2XBYA 1A1RA 1C2IA 1O5CB 2ILNA 3SV8A 1O38A 1SLUB 2SNVA 3HGNA 2ZPQA 5EW1H 3MFJA 2BLVA 4DVAU 5L2ZH 4NFEA 1SGFA 4Z6AH 4I8JA 2OXSA 1QCPA 3UWIA 2FS9A 1MTVA 1BTPA 5B6OA 3TPIZ 1UCYK 1XVOA 1GMDG 4A1VA 1HFDA 3LJOA 3V13A 1O3PB 1XX9A 1O3NA 3RXOA 2GT8A 2FYQA 1DLEA 1O2NA 5EG4A 7LPRA 4HGCA 3EYDA 3MNBA 4FUJA 4ZAEA 2XTTB 1TNLA 2OC7A 5CHAB 1IQLA 2BDIA 3ZZ8A 1GBKA 1V2KT 1GBFA 2D2DA 1HDTH 3H7TA 1N6YA 1AFEH 5EOKA 3RXHA 2BDHA 1KXEA 4CBOA 2OC1A 4GSOA 2WPHS 1GG6C 4F49A 1NY22 2VIDA 1QBNA 3VXFH 3ZV9A 1IQKA 1K1OA 1V2UT 1UVTH 1GJ5H 3NK8A 3UQVA 1ZRBA 2V3OH 1J8AA 3GY6A 4SGAE 1N8OC 2RDLA 5HM2A 3EGKH 8ESTE 1C1VH 3TITA 3ZZ3A 1TA6A 2PTCE 4MNVA 1TX8A 4A5TS 2ZCHP 2TGPZ 3TVJB 4TWWA 2VJ1A 1GI8B 1O2JA 2ZPSA 3QDZB 3RMNH 3T62A 1D4PB 3U98H 2XXLA 1BA8B 3U8OH 3A83A 2BDAA 1BRCE 4BAMB 5C1UA 3LPRA 3K2UA 4CRCA 1A3BH 1O3JA 3OY5U 1QL8A 3ODDA 2BQWB 4FUDA 1EJNA 4IN2A 1TRMA 2A4QA 1QJ1B 1ESTA 1ANDA 1LVMA 1GJ6A 1BHXB 1C2HA 1DWBH 3SHCH 2R0LA 3HKJB 4O9VA 1IQHA 1TQ7B 2PWXA 1SGEE 1O3GA 1TGBA 3SNBA 3VPKA 4IMQA 1GBBA 1CGIE 1QJ6B 5I46H 1YCPH 1E36B 2A2QH 2NU4E 4MVNA 1AHTH 4MPWA 3VB7A 3LJJA 2G5VA 3LONA 2GKVE 4JYTA 1J15A 2H2ZA 1ZMLA 1D3TB 3GYMA 4Y6DA 4X2XA 1G30B 1W0ZU 1ZMJA 2BXUH 1F5LA 1ELBA 1PFXC 1OWHA 3TK6A 1KXDA 2ZC9H 2WYJA 3BTQE 4Y0ZE 1DUAA 3ATLA 3PWCA 3GY8A 1UCYE 1HAOH 1SSXA 2CJIA 1SGFG 1WSSH 4XBBA 3SNCA 2J92A 1HAIH 4OS2A 4RKOB 1V2MT 1Q3XA 2XBXA 3N7OA 1GMHG 1D3DB 1GJDB 4Y71A 1QJ7B 4ZXXH 1O34A 3PLKA 1BTYA 2V6NA 2AMQA 4MPUA 1ELFA 4CBNA 4DJZB 4CR9A 3A7XA 1EAWA 1KLIH 2FOMB 2TPIZ 1O3BA 1A7SA 2ZDKA 1GHYH 2ZGHA 1A3EH 5GDSH 2FWWA 5J4QA 2C8YB 1KY9A 4JYVH 1WTGH 2SGFE 1YLDA 3S9BA 4A92A 4BTTB 4TY7A 3UFAA 2A4OA 3TK9A 1CA0C 1DFPA 1EAUA 1C5RA 1GHAF 2BYAX 1UTMA 5LPFA 2V3HH 5GCHF 3GCHC 5AF9H 2OCVB 3BIUH 4WXIA 5T6GA 1TB6H 1GGDB 2ZHQH 4X1SU 5E2PA 2ZCLP 4AFUA 4BAOB 1SQTA 2BDCA 2FDAA 3ZVGA 2WPKS 2K1QA 2A4GA 1QA0A 4CHAC 5DGJA 4IC6A 1S5SA 4AN7A 3U9AH 3RLYH 1OKXA 4ABHA 3ESTA 1THRH 3V12A 2FX4A 1FDPA 2C3SA 4QT8C 1T8LA 1AKSA 2QIQA 1GCTB 4WH8A 2VIQA 3MOCA 4I8GA 3SU3A 4UD9H 1JBUH 3URCA 4X1NU 2FLRH 4WY3A 3M37A 5GPIB 1TBQH 1GMDF 1O3IA 1NS3A 2ANYA 5DP6A 1TX7A 1QR3E 4ZUHA 3KN2A 1TOMH 3KL6A 1C5ZB 2F9OA 5SGAE 1YPMH 4FUHA 5L2YH 2ULLA 1P0SH 5AFZH 1W0YH 1O5AB 4IS5A 1W7XH 4MG3A 5HGGA 3SJ8A 4NG9H 1BTZA 1ELEE 1TMBH 1BITA 3BEFB 4BTIB 2B9LA 3GCTG 3LT3A 4YOJA 1Q2WA 1ZTLA 1UVUH 3L6PA 3NXPA 3TH2H 2FLBH 1NN6A 1XUGA 3UNSA 1T32A 5T6FA 3M5LA 3GDVA 4GUXA 1AE5A 1LHFH 1P10A 1NFYA 2FXRA 1EOJA 1EPTC 2B7DH 2WPMS 2Y7XA 2FX6A 1YGCH 2ZFTA 3SUGA 1UHBB 1ABIH 2B0FA 2Q6DA 3PMJA 1AB9B 4WWYA 3SUDA 2FOHA 3SV7A 1VCWA 1LO6A 2RCEA 3EAJA 2GCHG 1FN6A 2BZAA 3MTYA 1C1RA 1TNGA 2P3TB 4KKDA 3EA7A 1WQVH 1YCPK 1C5NH 1TPPA 2PGQB 3ZZBA 4B2BA 1O2UA 1MUEB 1ELAA 1V2WT 2XRCA 2XYAA 3VGCC 4B73A 2PLXA 2PW8H 1LMWB 1SI5H 1A5HA 1K1IA 3BTGE 2IPHA 4MNXA 3BG4B 4CRAA 4IBLH 5E8EH 3BTKE 2P16A 3LGIA 4LZ1H 3PB1E 1G2LA 1JIMA 4NGAH 3FP7E 1XXDA 3DT0H 1GI3A 5HM9A 1JRSA 2UWOA 5BRRE 2O8UA 2W3IA 3RXQA 1OWIA 1SB1H 1OSSA <