4ABFA

Fragments bound to bovine trypsin for the sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Dingo Dataset: A Comprehensive Set of Data for the Sampl Challenge.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords CATIONIC TRYPSIN
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abfA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abfA02
3ZVDA 1THRH 2BVXH 1TQ7B 3DD2H 3QTVH 1AKSB 1ZHRA 1G36A 5LPRA 2AEIH 2FIRH 2Y82A 1OP8A 1YPGH 2SNVA 3M35A 5C5OA 1QRXA 3S9BA 3LH3A 3ZV8A 1SHHB 3TJVA 1SQOA 2PWXA 2GD4B 1F7ZA 1CHGA 4JMYA 5ESBA 1E34B 1GHAG 1O30A 4IC5A 5FPTA 1GMCF 1MKWH 3LJOA 2QXGA 2HNTC 2Y81A 3PLKA 1GI5A 3MH6A 1UTLM 4ABHA 3KF2A 4CRDA 3SV6A 4KELA 3LGWA 4ABIA 3A84A 2AMQA 3F6UH 1N1LA 4ESTE 2BDGA 3TK9A 1B5GH 3RXMA 4ZMAH 1J8AA 4DG4A 4KKDA 1CSOE 1GL0E 1TNHA 1OOKB 1GDQA 1B0FA 1DY8A 1EQ9A 1HJAB 1NRSH 2XBVA 5EG4A 4I8KA 1T4UH 4Y7BA 1ELVA 4ZKSU 5JPMH 1XVMA 3PMJA 4MPUA 4I33A 1RFNA 4A6LA 1YLCA 5DG6A 4AYVB 3GY2A 3URCA 2O8WA 2A0QB 2OUAA 1CT2E 1HDTH 3BG4B 3SU1A 2ZU2A 1D3TB 3RXDA 4D76A 3SJ8A 3SORA 1K1IA 3QUMP 2VH6A 1IQIA 2BY8X 4ABJA 3SV8A 1XKBC 1GHWH 1TPSA 1N8OC 4X8TH 1O2PA 2Q1JA 1GBBA 2XRCA 1EJMA 1FPCH 3SI3H 2DE9A 2XCNA 4J2YB 2ZDLA 3F9FA 3VEQB 2VGCC 5GJ4B 1ZTKA 1F92A 2P3FH 2P94A 1MU8B 3SUDA 1ELDE 3VGCB 1A0JA 3BEFB 2WYGA 5AVDA 3E3TA 3A8AA 3AAUA 2RDLA 5EXLA 2J4IA 1LHEH 3RXBA 3TH2H 1C1QA 3SZNA 4XBCA 5EW1H 4NWKA 2F9VA 3TH3H 2VWMA 1BJVA 3RXCA 2Z7FE 1S84A 1WQSA 1O3FA 2UUFB 4D7GA 2C8ZB 2FOEA 2ZTZA 4K8YA 2AH4X 4O3TA 4NFFA 5HMAA 1RS0A 3PROA 1SI5H 1V6DA 1O35A 1OKXA 1H8DH 1QJ1B 1PPBH 1O31A 1ZR0A 2O8UA 4NA9H 2AGIX 2BY7X 1UVUH 2VIOA 1AWFH 1AD8H 1LVOA 1UK4A 4ISIH 3MYWA 1FY3A 3KQCA 1P2KA 5EPNA 2GV6A 1K1LA 1YCPM 4E05H 3SW2B 1SSXA 3QWCH 1HAXB 2HNTF 1YP9A 2RA3A 4K69A 2QAAA 4B73A 1EX3A 2ZU5A 4X6PA 2BVRH 3GDUA 2OQ5A 4LXBH 2AMDA 4BANB 5GWZA 4AFQA 1V2RT 2FO9A 3HATH 1ZGVA 3CS7A 4X2YA 1GBLA 3O8RA 4RKJB 2CN0H 6GCHF 1MZAA 1H8IH 1P01A 3T29A 8KME2 3MH5A 3ZVCA 2OP9A 1GGDB 1WYKA 2A32A 4DIIH 3GY5A 2RG3A 4R0IA 4ZHAA 1AVGH 1O3PB 2FOBA 1XX9A 4OGXA 1S0RA 1PYTC 2PTNA 1EPTC 4Y8YA 1XMNB 1A2CH 1NPMA 2J34A 1EXFA 2OCVB 3E1XB 1YPEH 3LONA 6ESTA 1PPCE 4BTUB 1CHOF 1F5LA 3PLPA 1C2DA 3LOXA 4PROA 3HK3B 3MNBA 1BRCE 2ZKSA 4YLQH 4AYYB 3PM3A 4WH6A 2WPMS 4VGCC 2Y7ZA 2Y5FA 3MMGA 5GXPA 2FYQA 2A45B 1IQGA 3LT3A 1QBNA 3E0NB 3GYLB 4GVUA 3HPTB 1IQMA 1J16A 2WPKS 4HI3A 4Y71A 1TMBH 4MG3A 1O3GA 4E7RG 1NFUA 3GDVA 1GI4A 3Q3KA 2A7HA 2BM2A 4FU9A 4Q80A 1NU9A 1YCPK 3A86A 4HZHA 1O5BB 1TBRH 2WYJA 1V2OT 3ZVFA 1UTJA 2CJIA 1O2SA 1CA0B 3SU4A 1GJ5H 1RJXB 2ZNKH 1JXPA 3MWIU 1G3DA 1ZZZA 5T6DA 1Q3XA 1D3DB 1V2KT 1C5RA 1WAYB 3FANA 3O8BA 1C5PA 1HCGA 3ZZ9A 1B7XB 4NA7A 4NSVA 1CU1A 1HAYB 3GICB 1UVSH 2ZPRA 3A7VA 2ILNA 1YKTA 4MQAA 2EA3A 2GVFA 2G5NA 1WV7H 2B0FA 3AAVA 5JBCS 4TWWA 1IQFA 2VWLA 3TJUA 2XC4A 3TU7H 1NC6A 1GG6B 1GJCB 5FAHA 3ZZ4A 2BOHB 1GJ7B 2VU8E 1H9LB 4TYDA 3H7OA 8GCHG 3T5FH 1GJ8B 2ZGCA 5HGGA 4SGBE 3UUZA 3E90B 4FUFA 1C2EA 1DWCH 1HV7A 2OQUA 1TNLA 3W94A 2CMYA 4TPIZ 1W7GH 1GJAB 3TGJE 3CP7A 1K2I1 4AFZA 2BX3A 2V6NA 2ZO3H 3DHKH 4YOJA 1AQ7A 3K2UA 1SGQE 4M7GA 3ENSB 2R0LA 4RSPA 4XBDA 7GCHF 2WPHS 4MNWA 1VJ9U 5GDSH 1V3XA 1P11E 3N7OA 3M61U 1O36A 8GCHF 4WF8A 1LVYA 1PQ5A 4JZFH 4JK6A 2CHAC 1V2LT 1KLIH 1C5YB 2HLCA 1QJ7B 3ZVEA 2BMGB 1MTVA 1XKAC 2ZWLH 3VB4A 3RP2A 1IQNA 2TBSA 4B2BA 1DX5M 1P0SH 1ORFA 2A4QA 1O2KA 4OS6A 4KTCA 2W7UA 1VR1H 3SV9A 5E0GA 5E8EH 2B7DH 2BQ7B 2GT8A 1TB6H 1C5ZB 3T26A 5AFYH 2H9EH 1JRTA 1L4DA 3MFJA 3F9HA 3NUMA 1TGTA 5ESTE 2H9HA 3BG8A 2JH6D 1BTUA 2SGDE 3UOUA 1O37A 3QN7A 1K1JA 3RXVA 1MD8A 1DLKB 3U8OH 4D9RA 1HLTH 1T8NA 4UD9H 1ZMNA 3P70B 1UO6A 5GIBA 5L2ZH 1FJSA 3RXJA 2TRMA 2WV4A 1ZJKA 1T32A 1C1VH 3L3TA 4GLYA 2W5EA 1TALA 2FS9A 1DDJA 2P3TB 1T31A 3TJNA 1J14A 1TRYA 2WUBA 1DVAH 1FLEE 1SB1H 1F0SA 1HFDA 1MCVA 2ZPQA 4B76A 3PTBA 2ZG0H 1GI9B 3BSQA 2J2UA 2PUXB 3MU0A 3H7TA 1ETTH 2NU4E 1ZPCA 3T27A 1O32A 1Z8IB 5EXMA 3RXAA 1EPTB 1TFXA 2BD8A 1D4PB 2FDAA 1ZTLA 1O5CB 4MTBA 1DICA 5EW2H 4WJG2 2XTTB 2D1JA 4E7NA 4TY7A 1FIZA 3D65E 3W95A 4ZKNU 3OU0A 1HYLA 2B8OH 1VGCC 3VB7A 3E16B 3QO6A 3SV7A 1NTPA 2Y6TA 1W13U 2WPJS 1OX1A 1EP5A 4DVAU 3E0PB 1HAZB 1AU8A 1C5WB 2JKHA 2ZF0H 2BXTH 4CR5A 1EAUA 3K6ZA 5EU8A 3SNDA 4CRAA 3LC3A 1A5GH 1ELFA 2VIPA 1IQJA 1QB6A 3PYHA 3A7WA 4JZEH 1MKXH 1AMHA 1SGDE 1FI8A 2ESTE 3UQOA 4WMFA 1CT4E 3Q3YA 3SJOA 4UONA 2QXJA 1C5MD 1BCUH 3SJIA 3RC6A 1YPKH 2BQWB 2OXSA 4MVNA 3DUXH 2FLRH 1GCTC 1L0ZA 2A7JA 1TNKA 3T28A 2D26C 3MU5A 4UFFH 3RXIA 1Y3XA 4NA8A 2ZFQH 3AW0A 1GJBB 1BMLA 1ZRKA 4WMEA 1TRNA 1THPB 3Q76A 1C1OA 1V2UT 2Q6FA 1QNJA 2ZU1A 2RCEA 3U1JB 1BB0B 4I8HA 1EOJA 1KSNA 1GDNA 1IQLA 1T4VH 5A0AE 1G3CA 1KIGH 2XC5A 3ZZ8A 4JYUH 1MBMA 4MNYA 4O3UA 1UHBB 5LH8A 2PGQB 2QV1A 1ABIH 1LO6A 2A5AA 2CF8H 6CHAB 1QB1A 5CMXH 3P6ZB 3OSYA 4YTAA 1GMDF 2BY9X 1P09A 2V0BA 1LHGH 4AOQA 1V2WT 3PB1E 4AX9H 2ZFTA 1BTZA 2R2MB 1DWEH 1GHVH 2V3HH 1OSSA 4GHQA 4WH8A 1GL1A 1ZSJA 3UWJH 3UIRA 4D7FA 2PKAB 1TOMH 1UCYE 3NCLA 3F68H 2ODPA 1OWKA 4A5TS 1AUJA 4WWYA 4IMZA 3ATMA 4WMDA 1CGHA 2Z3DA 2OC1A 1JMOH 1VCQA 3SHAH 4AG2A 1BBRH 5JBTA 1KLTA 2BD4A 1O2QA 1S5SA 3ODFA 1W2KH 5DP4A 3OY6U 1O2ZA 1A5IA 1V2NT 2BD5A 3GCHC 3UQVA 4LZ4B 3GY7A 2FZZA 4NCYA 5E0HA 1HRTH 4F4OC 1JRSA 3EA8A 2BDBA 2VWOA 5L6NH 3E6PH 1PPHE 1FY8E 1TNIA 3RMMH 2A31A 1O3AA 3SQHE 2PW8H 3ZZ6A 3LIWA 2FOHA 2UUJB 1K1PA 4X6OA 1SMFE 1GDUA 2QF3A 3BTME 1QA0A 4Q7XA 1HXEH 3TK5A 3A81A 2G81E 1TE0A 3RXUA 1DUAA 1O0DH 2FI3E 2PGBB 1X7AC 1C2MA 3LH1A 4TWYA 3S7KB 2ODQA 2GCTC 2G55A 2H1UA 1AFQC 1TBZH 5CHAB 1YC0A 3PO1B 3SGAE 2ZDVH 3BIVH 4XOJA 2ZHFH 2TGPZ 1YYY1 2OBQA 3BEUA 3FAOA 3GY8A 9ESTA 5EQQA 5J4SA 2QCYA 1ANDA 2ZCHP 5G4BA 3BTGE 2TGAA 3BTQE 3NK8A 1N6XA 5F03A 1WTHD 1WOFA 5GPIB 2ZHEH 1KXCA 4NIYA 1EASA 3LU9B 1HIAA 2ZQ1A 1NFXA 1Y3YA 1NFWA 3A7ZA 5EOKA 1BTXA 1YF4A 1SHYA 1FNIA 2PSXA 5JB9S 1SG8B 1AWHB 1Z71A 1ZSLA 1O38A 2I6SA 2WUCA 3Q77A 2UUKB 2FTLE 2JETB 1TIOA 3O8CA 1UTQA 3ATKA 1JIMA 1IQKA 1CBWC 3TGKE 1GBEA 3RLWH 4YOGA 1NESE 3A7XA 4QT8C 1TA6A 3SGBE 1XXDA 5A8ZA 2O9QA 2ZFPH 1S82A 2B5TB 1O3LA 1Z7KA 4ISOA 1C5LH 2R0KA 3VGCC 1MTUA 1A0HB 3AASA 5GCHF 4FUIA 3RU4E 1SPJA 3SUEA 1G2MA 3A89A 2ZDKA 4CBNA 4Y8ZA 3MH4A 1C1PA 1FXYA 3M37A 4NWLA 1TWXB 1LPZB 3RDZA 1D6WA 3TITA 1GJ4H 5FBIA 1BRBE 5BPEA 1GI2A 3GISB 2PKSC 4Y10E 3ZZDA 1GBJA 3M3SA 5DKMA 3MO9A 4YOIA 2QY0B 3ATLA 4IC6A 3TNTA 5GCHG 1NM6A 4BAHB 2XNIA 1NY22 2BXUH 4CHAB 4Y76A 1BRUP 1FZZA 4JZDH 4XFQA 2UWLA 1Q31A 4FUCA 4CHAC 2AYWA 1MU6B 4NG9H 2BDAA 4BXWA 2KAIA 3SNCA 1FY5A 3MU8A 4FVBA 4CRCA 1O2MA 1TLDA 2HWLB 3RXRA 1PFXC 5C2ZA 1O3MA 1SC8U 1C1TA 1YPMH 2XW9A 1U6QA 3SHCH 1Y3VA 2A4GA 2ZFFH 3UREA 4H4FA 1ZLRA 1H9IE 1RTLA 4NGAH 4F49A 4X2XA 2BYAX 2EC9H 1UCYK 2CGAA 1VCPA 2BTCE 3BTEE 1GI0A 2HGTH 3GY4A 3UNSA 2JH0D 1TRMA 4SGAE 1YBWA 2G00A 2NU3E 1T8OA 1XXFA 1HJ9A 1MTNB 1W8BH 1DSTA 2H2ZA 2ZECA 4NIXA 3NWUA 1MAYA 1SLWB 2QF0A 1O2OA 2GZ7A 2M5TA 4K1SA 3MO3A 3RU4T 1GJ9B 1WSSH 3KCGH 1VITH 1DOJA 4J1YA 1XUKA 1HAVB 3GY6A 4GHTA 3VB3A 5C1UA 1SGTA 1BTWA 3RXOA 2GKVE 4ABAA 2BY5X 2GCHG 1AIXH 4X1PU 4AFSA 1TX8A 5K0HA 5F8XA 2Q6DA 1S6HA 1C1UH 4VGCB 3SV2H 1KTTB 1A0LA 1GCTB 4OS4A 1BZXE 1EAXA 5BRRE 3D49H 1RGQA 4Z6AH 1CA0C 1NU7B 2OD3B 4OS2A 3FP7E 4Y8XA 2ZTXA 4JCNA 5AFZH 3SUGA 1G32B 4K2YA 3LGYA 1Q2WA 4DOQA 1V2QT 2RA0A 1AE5A 1LVMA 4AN7A 1SGRE 2FXRA 1BRAA 2W3KA 3QGNB 4FU7A 1K21H 4Q7ZA 1UTNA 1QQUA 1C2LA 1NRPH 1PQ7A 2PUQH 2VVVA 3ZVAA 4XSKU 1ANEA 2R9PA 5E2PA 1C4V2 1IOEA 4BAQB 2BDCA 4ZAEA 4CR9A 4X1QU 1MAXA 1FIWA 1ZPBA 2ULLA 3RMLH 4INHA 1G3EA 1JBUH 3S0NA 1A1RA 1SLXB 2BDIA 2VIQA 3HGPA 1CVWH 1HJAC 4K3JA 1VGCB 1ELGA 1O2NA 3ODDA 2XBYA 4RKOB 4IMQA 3M36A 1PPZA 1ACBE 1HJ8A 2FP7B 3M3VA 4MLFB 3SNAA 1KLJH 4DT7B 2FOGA 1FAXA 1XUJA 1ARBA 1SGNE 3L33A 3TPIZ 4FUHA 1SLVB 1MD7A 3U8RH 3DFLA 4GUXA 1EP6A 3OY5U 3BEIB 1S83A 1Y3WA 1C1MA 4Y0YE 3E91A 2BLOA 1DWBH 2H5DA 1GMHG 1P06A 3OTJE 1H9HE 2ZA5A 2ZIQH 5FXLA 3TH4H 1SOZA 1NS3A 1G3BA 1NO9H 2VGCB 1BDAA 1Z6EA 4A7IB 1NRQH 2HPQH 2FEQH 2OC0A 2TIOA 2PLXA 1GBTA 1C1SA 7LPRA 1ZGIA 4I7YH 1SR5C 1A3EH 4AB9A 4ABDA 2O8LA 3QTOH 5TJXA 4JYTA 3R3GB 3U9AH 2WINI 1L1GA 3ZVBA 3ZVGA 3TGIE 4CRBA 3PWBA 2UUYA 2F91A 4RN6A 1AHTH 5JB8S 1DT2A 4KTUA 3V13A 2TGTA 1PJPA 4XDEA 2WV5A 2GZ8A 1C1NA 3IWMA 5DP3A 1LHFH 1O3OA 2TPIZ 2AGEX 1C4Y2 2FWWA 5A09A 4B71A 4Q7YA 1C2HA 1W7XH 1DLEA 1O3HA 3SU6A 2BVSH 4FUBA 2OINA 2SGFE 2XXLA 1UVTH 1ELEE 1NT1A 1O33A 4X2WA 2FESH 2F9UA 1Y5BT 2SFAA 5HM2A 1SFIA 1EZSC 1VZQH 1QL7A 3A8CA 2ZU3A 5FCRA 2O8TA 5C67A 1GBHA 5C5NA 4OS7A 1DFPA 1SGPE 3VXFH 3TJOA 4AFUA 1FY1A 5ABWA 1FDPA 2PSYA 1P2NA 5JBBS 1TNGA 3L6PA 3BTHE 3ATIA 5C20A 2BOKA 1C9TA 1HUTH 3C1KA 4UEHH 2GT7A 4Y7AA 2ASUB 4OS5A 3FP6E 3ITIA 5JYIA 2K1QA 3EA7A 1TNJA 2STBE 2DE8A 1FN8A 1AI8H 3RXTA 2AFQB 3IG6B 1NN6A 2Z3EA 1ABJH 3JZ1B 1O2TA 3M3TA 2VIWA 1AGJA 2P16A 1G9IE 1BUIA 3ZZ5A 3MH7A 1V2MT 3UFAA 3EGKH 1DY9A 5C3NA 1GHAF 3B8JA 2FM2A 3M7UA 3SGQE 4H42U 2NU2E 5DJ7A 4AB8A 2BD3A 1HAIH 4INKA 3P95A 2A5KA 4ZKOU 3TNSA 3BG4C 1O2VA 5E2OA 3SJKA 2Z6BD 3T62A 2ZEBA 1Z1IA 4O03A 4WXVA 1RXPA 1VITF 5H4IB 4X1SU 1ELBA 1UK3A 3GDSA 1MCTA 1ELTA 2WPIS 1BTHH 3MU1A 1G37A 3CENA 1LQDB 2V3OH 3HK6B 3RU4D 2FOFA 4TY6A 1ESAA 5A2MH 4Y11E 1RTFB 4YLUA 3P8OA 1P2JA 1W11U 3BTKE 1MKXK 5E0JA 1KTSB 1KDQA 3NPSA 3V12A 3I78A 5EQSA 1QY6A 3B9FH 3GCHB 3P8NA 1AFEH 3KEEA 5DGJA 2NU0E 1LKAA 1EJNA 1S81A 2CHAB 1XUGA 1O5AB 1LQEA 4X6MA 1JIRA 1ZJDA 1H4WA 2IOTA 5FHTA 3JZ2B 2VIVA 2BHGA 2XYAA 2F83A 1DS2E 1FV9A 1BBRK 4B75A 2R3UA 1F5RA 1IHTH 1D3QB 1O3KA 1WTGH 2B9LA 2WPLS 2A2XH 1XUFA 3GYMA 1K1OA 4LOYH 3IITA 3A8DA 2ZDMA 5EGMA 1P9SA 1GBDA 1EPTA 2P8OC 4D8NA 1RRKA 1C2JA 2F3CE 1GMDG 3BIUH 3C27B 3SQEE 3S9AA 1NRRH 5CE1A 2ZC9H 1GWAA 1DXWA 1YLDA 2P3UB 3PMBB 2EI7A 1B0EA 4TPYA 1YPHE 4JZ1A 1FQ3A 1QCPA 1P2MA 1FPHH 1EZUC 1WU1A 3A87A 1OPHB 1RIWB 4AGKA 1KXEA 2BLVA 1E35B 3PTNA 1GVKB 2ZI2H 4IN1A 4NZQA 3BTTE 3QLPH 1TX6A 2H9TH 1K9OE 1ZHMA 1O2JA 4B74A 3M5MA 1L2EA 1TOCB 3AW1A 2YNAA 4IBLH 1CGIE 5FPSA 1AE8H 3TK6A 3MNCA 1F0TA 3U8TH 3V3MA 2SGQE 1LPKB 1C5OH 2J92A 1BHXF 2ALVA 3URDA 2ZZUH 1P3CA 4ZKRU 2BDYA 2VVUA 1BT7A 2OC7A 2BY6X 2BLWA 2Y7XA 2ZDAH 3SUFA 2SGAA 3A82A 4K60A 1LHDH 1P02A 5PTPA 3VPKA 5A8XA 1INCA 5T6FA 2QXHA 2FMJA 2Z9IA 3I29A 5TCCA 4BNRA 2CF9H 7GCHG 2HNTE 1QIXB 2C3SA 1QBOA 2EEKA 3NXPA 5DK1A 1OS8A 1P2QA 2FOMB 1C1RA 3ATWA 1OWDA 4BTTB 2G4UA 5AF9H 2C93B 1Y8TA 2GMTB 2BZ6H 3U1IB 3ZYEA 2ZCLP 1O3EA 3WY8A 1YPHC 4K8BA 1GHBF 1O5GH 2BD2A 2IPHA 3A85A 5TCAA 3VFEA 1HAPH 1PYTD 2FYRA 3GCOA 2UWPA 4ISLA 2C4FH 1O2HA 3D23A 1DXPA 4Y79A 2BD9A 2HPPH 2FX6A 4DGJA 4HTCH 1AZZA 1Z8JB 2GZ9A 1QB9A 4FVDA 3VB5A 3V0XA 1J17T 4I32A 4JYVH 1TPPA 3PO1C 1O39A 3QZRA 1CGJE 2BX4A 1ETSH 1FN6A 2P59A 1TONA 1AVXA 1ESBA 1BA8B 4WVPE 1TBQH 3M5OA 5IYTA 1NZQH 5J4QA 3LDXH 1DM4B 3LGIA 4B2AA 5L2YH 3KHVA 1A46H 2BLQA 3GY3A 2W3IA 1ELCA 1O2LA 1P2IA 3KQEA 2ZHWH 4BAOB 3SO3A 2A7CA 1W10U 1SGEE 2GCHF 3EDXB 2P95A 4DCDA 1O5EH 1E38B 3M7TA 4DY7B 1BHXB 3SBKA 3ZYDA 4UFEH 1C5TA 5LPEA 1O2YA 4CBOA 1PPFE 3ZV9A 1JWTA 3GCTG 1YCPH 1SGYE 1LDTT 1G30B 5A0BA 1WBGB 1V2ST 1HAOH 2G51A 1O34A 4MPWA 4K1TA 2JH5D 4DIHH 1IAUA 1C5UA 4ABGA 1FAKH 1O3DA 3PMAB 2VVCA 1H1BA 3D62A 1D3PB 4FUEA 4MPVA 3UNRA 1PQ8A 3DT0H 3A8BA 3NKKA 4O97A 3GCNA 2ZQ2A 1SOTA 3U69H 1IQHA 1P05A 4GAWA 1GI6A 4JK5A 3OX7U 5HXFA 4ZXXH 5LPFA 1ESTA 1GPZA 1O2UA 1E36B 1GBFA 2PFEA 3MNSA 1W12U 1QFKH 2QA9E 1SGFG 1SL3A 2I6QA 1LTOA 1MQ6A 4GPGA 1W0ZU 5B6OA 1ZRBA 2FTMA 1A7SA 1HGTH 3MU4A 1SGCA 3HGNA 2BD7A 2QXIA 1BBRE 3RXEA 2PKAA 3Q3XA 4XBBA 1GHZA 1S6FA 4I8JA 1C9PA 4YESB 3MOCA 1UMAH 1GVLA 1A4WH 3MTYA 1O2RA 4A92A 5DO4H 1DITH 5I46H 3TIUA 4LK4A 1QL9A 1CT0E 1C5SA 1LKBA 3RXQA 3UOPA 1Y5UT 2Z9GA 4DURA 1UVPA 4CH8B 1P12E 1E37B 5FX5A 3EQ0H 1EUFA 3GOVB 3KQBA 5A0CA 1ID5H 5FBEA 3UPEA 1TPAE 2XWAA 4JZIA 2ZGXH 1QURH 4H6TA 2VINA 4Y6DA 4A1VA 1EOLA 4U2WA 4DJZB 2CV3A 1CQQA 1DPOA 2FI5E 3PV4A 1OYTH 1VCWA 1DSUA 1K1MA 2HALA 1PPEE 1UHBA 2FOAA 3ZZCA 4NZLA 1TAWA 3BF6H 1TPOA 2ODYB 4NSYA 1LCYA 5T6GA 3KQDA 1E0FD 2LNCA 3RC5A 4HGCA 3QX5H 2BZAA 1T8LA 3ZZ3A 5EQRA 3M7QA 3M5NA 1UTOA 2OLGA 2VNTA 3SNBA 1EB1H 4Q2KA 1ZTJA 1TQ0B 3LKWA 2TGDA 1EZXC 1GJ6A 6LPRA 1D6RA 1K22H 2AS9A 1HAGE 2OC8A 1OWJA 3UY9A 4X1RU 4Z0KA 1SVPA 3UWIA 2G5VA 1O3IA 4KTSA 4MDSA 3RXHA 1KYNA 3FP8E 1PPGE 3K65B 4ZROA 4U30A 2FS8A 1QRZA 4ABBA 3EA9A 4HFPB 5CHAC 1L4ZA 4YZUA 1BTPA 3QK1A 1MMJN 1TMTH 5EXNA 1DE7H 4AG1A 1C1WH 1YM0A 2C8YB 3PMHB 4R8TB 2VIDA 2ZFSA 2A1DB 2VH0A 3M5LA 1MTWA 2DUCA 1NRNH 1P10A 1JOUB 2EI6A 2NWNA 2ZTYA 1T7CA 5EODA 1THSH 2F9PA 2SGEE 2VJ1A 4YO9A 1O2IA 4D9QA 3P92A 4UFDH 1ELAA 3VXEH 1N6YA 2H5CA 1Y3UA 3MHWU 5IDKA 1P04A 3FZZA 3SU2A 1BMNH 4BOHA 1S85A 1SQTA 1T8MA 3BN9A 1GHXH 3VB6A 5F8TA 1P2OA 2Z9KA 5HYOA 1GHYH 1XUIA 5DP7A 3P8GA 4X8VH 1ZMJA 2GP9B 1O3BA 1ZMLA 1AN1E 1TX7A 2UWOA 1UCYH 2GGVB 4E06H 3A7TA 1MBQA 2XCFA 1Y5AT 1KY9A 1O2GH 2XC0A 1GMHF 4FXGH 1EKBB 2BB4A 1TA2A 1GCDA 3RXPA 2ZCKP 2F9BH 6GCHG 1O5DH 1TGSZ 1F5KU 2GV7A 2Z94A 3AVZA 3SJ9A 3F9EA 2BDHA 4INLA 2XBXA 3F9GA 4I31A 1C5VA 1XUHA 2ZGHA 2ANYA 2ANKH 2EI8A 1GBIA 1AVWA 1AKSA 2SGPE 1V2TT 3RXSA 3RMNH 2GDDA 2Y5GA 1QJ6B 2XBWA 1O2WA 4MNXA 5FPYA 4FUGA 7ESTE 3TVJB 1ANBA 2P93A 2QGRA 2OBOA 1CHOG 3KN2A 1SFQB 2C90B 1MUEB 5FCKA 3SOSA 4OS1A 1ANCA 1GVZA 5DP9A 2J9NA 2YOLA 3ESTA 3UR9A 2ZPSA 1SLUB 3FVFB 1C2IA 3HKIB 2AMPA 2Y5HA 3BTWE 2NU1E 4BXSA 2R2WU 2PTCE 4CH2B 1V2VT 5EPYA 3LPRA 1AO5A 3BTFE 4FUDA 4UE7H 1EAIA 1QTFA 4LZ1H 3LC5A 1RIWC 2H6MA 1QR3E 4ZHMU 1BJUA 1AB9B 4X8UH 1D9IA 2R3YA 1MTSA 4ZUHA 3TLOA 3BV9B 1P3EA 1EZQA 2FX4A 4GCHF 2D8WA 4ASHA 1FMGA 3S7HB 4XE4A 1OYQA 1W14U 4X0WU 1BMMH 5DP5A 1GG6C 5LGOA 1MTNC 2AERH 3H5CB 4YT7H 4X1NU 3NZIA 2Q6GA 1LPGB 2JETC 2BQ6B 4BTIB 3ELAH 1HIAB 1MZDA 1FONA 2ZGBH 1SBWA 2Z9JA 4BAKB 4H6SB 2IN2A 4BAMB 2FOCA 2W7SA 2GTBA 1KXFA 1MH0A 4KP0A 3RUOA 1J15A 3K6YA 3SN8A 2D2DA 1Z8GA 2CXVA 3LJJA 1O3CA 2HRVA 2THFB 4NFEA 5L30H 3GCTF 1VITG 3S69A 1F0RA 1C5NH 1UTPA 3RM2H 1G2LA 1XM1A 2QN5T 2Z3CA 3ZZBA 2ALPA 1N8OB 3P8FA 4ABFA 1Y59T 2AIPA 2O8MA 8LPRA 1GI8B 1GGDC 2A5IA 4AGJA 2GDEH 3A88A 1EB2A 1Z6JH 3E8LA 1QQ4A 1ETRH 3UNQA 1DWDH 4X6NA 1LMWB 2ANMH 1BQYA 3RMOH 3OYPA 1GBKA 1CE5A 1GJDB 2ANWA 1C5QA 4X8SH 3ZZ7A 1P03A 4B1TA 2A4RA 1OWIA 5K7RA 4KGAA 2ZHQH 4I8GA 3T25A 2PKSB 1DUEA 3R0FA 2C8XB 1C4U2 3O8DA 3K9XB 1GBAA 2ZHDA 4ZHLU 4I8LA 4GCHG 3T2NA 4IGDA 4NIVA 3ZZAA 2PV9B 2F9OA 2XWBI 4A1XA 1RTKA 2VB0A 1QHRB 1GHBG 8ESTE 1OWEA 4FUJA 2FODA 3UTUH 3RXGA 4IW4E 5T3HA 1AFQB 3EYDA 3A80A 4MPXA 4B2CA 1TYNA 1V2PT 2G4TA 1YPJH 4NIWA 1A5HA 1ZSKA 3RXFA 5HM9A 4ZH8A 3KNXA 3KIDU 5DP6A 2FLBH 2ZGJA 1GI3A 3QGJA 1QA7A 4ISNA 5AHGH 1MQ5A 1ZPZA 1A61H 1UK2A 1EJAA 3RC4A 3LGUA 1WQVH 1TABE 1F2SE 4DW2U 1SGIB 2Z9LA 4WXIA 2J94A 1YGCH 1P57B 3SU3A 1FUJA 4WY3A 2HVXA 4A1TA 1QBVH 1HAHH 9LPRA 1V2JT 5ETXA 1VJAU 4ISHH 1NFYA 2G52A 1MKWK 1DANH 3MO6A 1HXFH 5C1YA 3EE0B 1AY6H 4MNVA 1BMAA 2QYIA 1QRWA 2F9NA 1KXAA 1KXDA 2PHBA 2GCTB 5I25A 2J38A 1UVOA 1O5FH 3S9CA 1W3CA 1GBCA 1Z8RA 1L1JA 2AGGX 1C2GA 1NROH 1GI1A 1OXGA 1IHSH 4K1EA 2STAE 4YM9A 3U98H 3RXLA 2J95A 5JDUB 3SU0A 3FZDA 2A4OA 1BIOA 3P17H 2YNBA 5FX6A 3Q00A 1P8VC 1QL8A 4UFGH 3SNEA 1J9CH 1OWHA 4AORA 1GBMA 1P9UA 4ABEA 4IS5A 3DA9B 3SU5A 1AB9C 3STIA 2G8TA 2QIQA 1RD3B 3HKJB 1K1NA 1O3NA 1OP2A 4U32A 2ZFRH 3QZQA 2Y80A 1UTKA 4IN2A 4K5ZA 1HBTH 5A8YA 1W0YH 3PLBA 6CHAC 1KXBA 3SI4H 2KAIB 2P8OB 2C8WB 2IJOB 4CREA 1TGCA 7KMEH 4O9VA 1AUTC 1HAVA 1GMCG 1LVBA 5DPAA 4ZXYH 1C5XB 2FI4E 4CRGA 1C2FA 3KL6A 1C2KA 1FY4A 1Z1JA 1ZHPA 3PWCA 4GSOA 4UDWH 1TGNA 3MNXA 2VWNA 5F6MA 1YPLH 1TGBA 4THNH 1CO7E 1SGFA 5C1XA 1CBWB 4FU8A 4U01A 1ZOMA 1GI7B 1O2XA 2ZDNA 1HB0B 1TMUH 3F1SB 3RM0H 1QGFA 4AZ2B 1WCZA 4CRFA 2LPRA 5DP8A 1ARCA 2PR3A 3G01A 1WUNH 3V7TA 5SGAE 2AIQA 1XVOA 3MI4A 4OGYA 1AZ8A 3STJA 3A7YA 5JBAS 2OTVA 1OP0A 1S0QA 3KGPA 1L1NA 2A2QH 2FPZA 1HPGA 3LGTA 1CA8B 1EAWA 3CS0A 3FFGA 2W26A 1IQEA 1EATA 1F0UA 2SNWA 1HNEE 1O3JA 2HOBA 1M9UA 1ZYOA 3RXKA 3LGVA 3A83A 3EAJA 3DFJA 1SQAA 3RLYH 1PQAA 1KDQB 3BTDE 4Y0ZE 3UR6A 1BITA 1BTYA 1K28D 2V35A 3I77A 1BOQA 1A3BH 1UTMA 2ZU4A 1LHCH 2ZP0H 4YT6H 2GX4A 4X2VA 2QC2A 2GMTC 5F8ZA 3B23B 3QDZB 1UJ1A
chains in the Genus database with same CATH superfamily
3ZVDA 1THRH 2BVXH 1TQ7B 3DD2H 3QTVH 1AKSB 1ZHRA 1G36A 3CNRA 5LPRA 3OTPA 2AEIH 2FIRH 2Y82A 1OP8A 1YPGH 2SNVA 3M35A 5C5OA 1QRXA 3S9BA 3LH3A 3ZV8A 1SHHB 3TJVA 1SQOA 2PWXA 2GD4B 1F7ZA 1CHGA 4JMYA 5ESBA 1E34B 1GHAG 1O30A 4IC5A 5FPTA 1GMCF 1MKWH 3LJOA 2QXGA 2HNTC 2Y81A 3PLKA 1GI5A 3MH6A 1UTLM 4ABHA 3KF2A 4CRDA 3SV6A 4KELA 3LGWA 4ABIA 3A84A 2AMQA 3F6UH 1N1LA 4ESTE 2BDGA 3TK9A 1B5GH 3RXMA 4ZMAH 1J8AA 4DG4A 4KKDA 1CSOE 1GL0E 1TNHA 1OOKB 1GDQA 1B0FA 1DY8A 1EQ9A 1HJAB 1NRSH 2XBVA 5EG4A 4I8KA 1T4UH 4Y7BA 1ELVA 4ZKSU 5JPMH 1XVMA 3PMJA 4MPUA 4I33A 1RFNA 2WPDD 4A6LA 1YLCA 5DG6A 4AYVB 3GY2A 3URCA 2O8WA 2A0QB 2OUAA 1CT2E 1HDTH 3BG4B 3SU1A 2ZU2A 1D3TB 3RXDA 4D76A 3SJ8A 3SORA 1K1IA 3QUMP 2VH6A 1IQIA 2BY8X 4ABJA 3SV8A 1XKBC 1GHWH 1TPSA 1N8OC 4X8TH 1O2PA 2Q1JA 1GBBA 2XRCA 1EJMA 1FPCH 3SI3H 2DE9A 2XCNA 4J2YB 2ZDLA 3F9FA 3VEQB 2VGCC 5GJ4B 1ZTKA 1F92A 2P3FH 2P94A 1MU8B 3SUDA 1ELDE 3VGCB 1A0JA 3BEFB 2WYGA 5AVDA 3E3TA 3A8AA 3AAUA 2RDLA 5EXLA 2J4IA 1LHEH 3RXBA 3TH2H 1C1QA 3SZNA 4XBCA 5EW1H 4NWKA 2F9VA 3TH3H 2VWMA 1BJVA 3RXCA 2Z7FE 1S84A 1WQSA 1O3FA 2UUFB 4D7GA 2C8ZB 2FOEA 2ZTZA 4K8YA 2AH4X 4O3TA 4NFFA 5HMAA 1RS0A 3PROA 1SI5H 1V6DA 1O35A 1OKXA 1H8DH 1QJ1B 1PPBH 4HG6A 1O31A 1ZR0A 2O8UA 4NA9H 2AGIX 2BY7X 1UVUH 2VIOA 1AWFH 1AD8H 1LVOA 1UK4A 4ISIH 3MYWA 1FY3A 3KQCA 2YMSC 1P2KA 5EPNA 2GV6A 1K1LA 1YCPM 4E05H 3SW2B 1SSXA 3QWCH 1HAXB 2HNTF 1YP9A 2RA3A 4K69A 2QAAA 4B73A 1EX3A 2ZU5A 4X6PA 2BVRH 3GDUA 2OQ5A 4LXBH 2AMDA 4BANB 5GWZA 4AFQA 1V2RT 2FO9A 3HATH 1ZGVA 3CS7A 4X2YA 1GBLA 3O8RA 4RKJB 2CN0H 6GCHF 1MZAA 1H8IH 1P01A 3T29A 2L6OA 8KME2 3MH5A 3ZVCA 2OP9A 1GGDB 1WYKA 2A32A 3N99A 4DIIH 2EQNA 3GY5A 2RG3A 4R0IA 4ZHAA 1AVGH 1O3PB 2FOBA 2J98B 1XX9A 4OGXA 1S0RA 1PYTC 2PTNA 1EPTC 4Y8YA 1XMNB 1A2CH 1NPMA 2J34A 1EXFA 2OCVB 3E1XB 1YPEH 3LONA 6ESTA 1PPCE 4BTUB 1CHOF 2KM0A 1F5LA 3PLPA 1C2DA 3LOXA 4PROA 3HK3B 3MNBA 1BMFD 1BRCE 2ZKSA 4YLQH 4AYYB 3PM3A 4WH6A 2WPMS 1W0JD 4RI0A 4VGCC 2Y7ZA 2Y5FA 3MMGA 5GXPA 2FYQA 2A45B 1IQGA 3LT3A 1QBNA 3E0NB 3GYLB 4GVUA 3HPTB 1IQMA 1J16A 2WPKS 3OEED 4HI3A 4Y71A 4RT1A 1TMBH 4MG3A 1O3GA 4E7RG 1NFUA 3GDVA 1GI4A 3Q3KA 2A7HA 2BM2A 4FU9A 4Q80A 1NU9A 1YCPK 3A86A 4HZHA 1O5BB 1TBRH 1V2OT 2WYJA 3ZVFA 1UTJA 2CJIA 1O2SA 1CA0B 3SU4A 3UB0A 1GJ5H 1RJXB 2ZNKH 3WWFA 1JXPA 3MWIU 1G3DA 1ZZZA 5T6DA 1Q3XA 1D3DB 1V2KT 1C5RA 1WAYB 3FANA 3O8BA 1C5PA 1HCGA 3ZZ9A 1B7XB 4NA7A 4NSVA 1CU1A 1HAYB 3GICB 1UVSH 2ZPRA 3A7VA 2ILNA 1YKTA 4MQAA 2EA3A 2GVFA 2G5NA 1WV7H 2B0FA 3AAVA 5JBCS 4TWWA 1IQFA 2VWLA 3TJUA 2XC4A 3TU7H 1NC6A 1GG6B 1GJCB 5FAHA 3F2FA 3ZZ4A 2BOHB 1GJ7B 2VU8E 1H9LB 2LP6A 4TYDA 3H7OA 8GCHG 3T5FH 1GJ8B 2ZGCA 5HGGA 4SGBE 3UUZA 3E90B 4FUFA 1C2EA 1DWCH 1HV7A 1FX0B 2OQUA 3DCLA 1TNLA 3NRLA 3W94A 2CMYA 4TPIZ 4ACBA 1W7GH 1GJAB 3TGJE 2K8IA 3CP7A 1K2I1 4AFZA 2BX3A 2V6NA 2ZO3H 3DHKH 4YOJA 1AQ7A 3K2UA 1SGQE 2KCYA 4M7GA 3ENSB 2R0LA 3AK5A 4RSPA 4XBDA 7GCHF 2WPHS 4MNWA 1VJ9U 4I86A 5GDSH 1V3XA 1P11E 3N7OA 3M61U 1O36A 8GCHF 4WF8A 1LVYA 1PQ5A 4JZFH 4JK6A 2CHAC 1V2LT 1KLIH 1C5YB 2HLCA 1QJ7B 3ZVEA 2BMGB 1MTVA 1XKAC 2ZWLH 3VB4A 3RP2A 1IQNA 2TBSA 4B2BA 1DX5M 1P0SH 1ORFA 2F4LA 2A4QA 1O2KA 4OS6A 4KTCA 2W7UA 1VR1H 3SV9A 5E0GA 5E8EH 2B7DH 2BQ7B 2GT8A 1TB6H 3ZIAD 1C5ZB 3T26A 5AFYH 2H9EH 5C17A 1JRTA 1L4DA 3MFJA 3F9HA 3NUMA 1TGTA 5ESTE 2H9HA 3BG8A 2JH6D 1BTUA 2SGDE 3UOUA 1O37A 5KECA 3QN7A 1K1JA 3RXVA 1MD8A 1DLKB 3U8OH 4D9RA 1HLTH 1T8NA 4P02A 4UD9H 1ZMNA 3P70B 1UO6A 5GIBA 5L2ZH 1FJSA 3RXJA 2TRMA 2WV4A 1ZJKA 1T32A 1C1VH 3L3TA 4GLYA 2W5EA 1TALA 2FS9A 1DDJA 2P3TB 1T31A 3TJNA 1J14A 1TRYA 1DVAH 1FLEE 2WUBA 1SB1H 1F0SA 1HFDA 1MCVA 2ZPQA 4B76A 3PTBA 2ZG0H 1GI9B 3BSQA 2J2UA 2PUXB 4TSFD 3MU0A 3H7TA 1ETTH 2NU4E 1ZPCA 3T27A 1WDIA 1O32A 2IPQX 1Z8IB 5EXMA 3RXAA 1EPTB 1TFXA 2BD8A 1D4PB 2FDAA 1ZTLA 1O5CB 4MTBA 1DICA 5EW2H 4WJG2 2XTTB 2D1JA 4E7NA 4TY7A 1FIZA 3D65E 3W95A 4ZKNU 2JDID 3OU0A 1HYLA 2B8OH 1VGCC 3VB7A 3E16B 3QO6A 3SV7A 1NTPA 2Y6TA 1W13U 2WPJS 1OX1A 1EP5A 4DVAU 3E0PB 2J5UA 1HAZB 2LELA 1AU8A 1C5WB 2JKHA 2ZF0H 2BXTH 4CR5A 1EAUA 3K6ZA 5EU8A 3SNDA 4CRAA 3LC3A 1A5GH 1ELFA 2VIPA 1IQJA 1QB6A 3PYHA 3A7WA 4JZEH 1MKXH 1AMHA 4Q4LA 1SGDE 1FI8A 2ESTE 3UQOA 4WMFA 1CT4E 3Q3YA 3SJOA 4UONA 2QXJA 3PV2A 5C0TA 1C5MD 1BCUH 3SJIA 3RC6A 1YPKH 2BQWB 2XOKD 2OXSA 4MVNA 3DUXH 2FLRH 1YWUA 3DSPA 1GCTC 1L0ZA 2A7JA 1TNKA 3T28A 2D26C 3MU5A 4UFFH 3RXIA 2V3MA 1Y3XA 4NA8A 2ZFQH 3AW0A 1GJBB 1BMLA 1ZRKA 4WMEA 1TRNA 1THPB 3Q76A 1C1OA 1V2UT 2Q6FA 1QNJA 2ZU1A 2RCEA 3U1JB 1BB0B 4I8HA 4M9FA 1EOJA 1KSNA 1GDNA 1IQLA 1T4VH 5A0AE 3N7DA 1G3CA 1KIGH 2XC5A 2WHXA 3ZZ8A 4JYUH 1MBMA 4MNYA 4O3UA 1UHBB 5LH8A 2PGQB 2QV1A 1ABIH 1LO6A 2A5AA 2CF8H 6CHAB 1QB1A 5CMXH 3P6ZB 3OSYA 4YTAA 1GMDF 2BY9X 1P09A 4P00A 2V0BA 1LHGH 4AOQA 1V2WT 3PB1E 4AX9H 2ZFTA 1BTZA 2R2MB 1DWEH 1GHVH 2V3HH 1OSSA 4GHQA 4WH8A 1GL1A 1ZSJA 3UWJH 3UIRA 4D7FA 2PKAB 1TOMH 1UCYE 3NCLA 5C0UA 1S6LA 3F68H 2ODPA 1OWKA 4A5TS 1AUJA 4WWYA 4IMZA 3ATMA 4WMDA 1CGHA 2Z3DA 2OC1A 1JMOH 1VCQA 3SHAH 4AG2A 1BBRH 5JBTA 1KLTA 2J97A 2BD4A 1O2QA 1S5SA 3ODFA 1W2KH 5DP4A 3OY6U 1O2ZA 1A5IA 2XNDD 1V2NT 2BD5A 3GCHC 3UQVA 4LZ4B 3GY7A 2FZZA 4NCYA 5E0HA 1HRTH 4F4OC 1JRSA 3EA8A 2BDBA 3KYGA 2VWOA 5L6NH 3E6PH 1PPHE 1FY8E 1TNIA 3RMMH 2A31A 1O3AA 1EFRD 3SQHE 2PW8H 3ZZ6A 3LIWA 2FOHA 2UUJB 1K1PA 4X6OA 1SMFE 1GDUA 2QF3A 3BTME 1QA0A 4Q7XA 1HXEH 3TK5A 3A81A 2G81E 1TE0A 3RXUA 1DUAA 1O0DH 2FI3E 2PGBB 1X7AC 1C2MA 2JIZD 3LH1A 3MQKC 4TWYA 3S7KB 2ODQA 2GCTC 2G55A 2H1UA 1AFQC 1TBZH 5CHAB 1YC0A 3PO1B 3SGAE 2ZDVH 3BIVH 4XOJA 2ZHFH 2TGPZ 1YYY1 2OBQA 3BEUA 3FAOA 3GY8A 9ESTA 5EQQA 5J4SA 2QCYA 1ANDA 2ZCHP 5G4BA 5FL7D 3BTGE 2TGAA 3BTQE 3NK8A 1N6XA 5F03A 1WTHD 1WOFA 5GPIB 2ZHEH 1KXCA 4NIYA 1EASA 3LU9B 1HIAA 2ZQ1A 1NFXA 1Y3YA 1NFWA 3A7ZA 3FN8A 5EOKA 1BTXA 1YF4A 1SHYA 1FNIA 2PSXA 5JB9S 1SG8B 1AWHB 1Z71A 1ZSLA 1O38A 2I6SA 4YXWD 2WUCA 3Q77A 2UUKB 2FTLE 2JETB 1TIOA 1NBME 3O8CA 1UTQA 1OHHD 3ATKA 1JIMA 1IQKA 1CBWC 3TGKE 1GBEA 3RLWH 4YOGA 1NESE 3A7XA 4QT8C 1TA6A 3SGBE 1XXDA 5A8ZA 2O9QA 2ZFPH 1S82A 2B5TB 1O3LA 1Z7KA 4ISOA 1C5LH 2R0KA 3VGCC 1MTUA 1A0HB 3AASA 5GCHF 4FUIA 3RU4E 1SPJA 3SUEA 2YMSD 1G2MA 3A89A 2ZDKA 1MABB 4CBNA 4Y8ZA 3MH4A 1C1PA 1FXYA 3M37A 4NWLA 1TWXB 1LPZB 3RDZA 1D6WA 3TITA 1GJ4H 5FBIA 1BRBE 5BPEA 1GI2A 3GISB 2PKSC 4Y10E 3ZZDA 1GBJA 2V7QD 3M3SA 5DKMA 3MO9A 4YOIA 2QY0B 3ATLA 4IC6A 3TNTA 5GCHG 1NM6A 4BAHB 2XNIA 1NY22 2BXUH 4CHAB 5HKKD 4Y76A 1BRUP 1FZZA 4JZDH 4XFQA 3PRBA 2UWLA 1Q31A 4FUCA 4CHAC 2AYWA 1MU6B 4NG9H 2BDAA 4BXWA 2KAIA 3SNCA 1FY5A 3MU8A 4FVBA 4CRCA 1O2MA 1TLDA 2HWLB 3RXRA 1PFXC 5C2ZA 1O3MA 1SC8U 1C1TA 1YPMH 2XW9A 1U6QA 3SHCH 1Y3VA 2A4GA 2ZFFH 3UREA 4H4FA 1ZLRA 1H9IE 1RTLA 4NGAH 4F49A 4X2XA 2BYAX 2EC9H 1UCYK 3DSGA 2CGAA 1VCPA 2BTCE 3BTEE 1GI0A 2HGTH 3GY4A 3UNSA 2JH0D 1TRMA 4SGAE 1YBWA 2G00A 2NU3E 1T8OA 1XXFA 1HJ9A 1MTNB 1W8BH 1DSTA 2H2ZA 2ZECA 3OE7D 4NIXA 3NWUA 1MAYA 1SLWB 2QF0A 1O2OA 2GZ7A 2M5TA 4K1SA 3MO3A 3RU4T 1GJ9B 1WSSH 4Q63A 3KCGH 1VITH 1DOJA 4J1YA 5EJLA 1XUKA 1HAVB 3U28C 3GY6A 4GHTA 3VB3A 5C1UA 1SGTA 1BTWA 3RXOA 2GKVE 4ABAA 2BY5X 2GCHG 1AIXH 4X1PU 4AFSA 1TX8A 5K0HA 5F8XA 2Q6DA 1S6HA 1C1UH 4VGCB 3SYJA 3SV2H 1KTTB 1A0LA 1GCTB 4OS4A 1BZXE 1EAXA 3WW7A 5BRRE 3D49H 1RGQA 4Z6AH 1CA0C 1NU7B 2OD3B 4OS2A 3FP7E 4Y8XA 2ZTXA 4JCNA 5AFZH 3SUGA 4ACAA 1G32B 4K2YA 3LGYA 1Q2WA 4DOQA 1V2QT 5EIYA 2RA0A 1AE5A 1LVMA 4AN7A 1SGRE 2FXRA 1BRAA 2W3KA 3QGNB 4FU7A 2L74A 1K21H 4Q7ZA 1UTNA 1QQUA 1C2LA 1NRPH 1PQ7A 5F53A 2PUQH 2VVVA 3ZVAA 4XSKU 1ANEA 2R9PA 5E2PA 1C4V2 1IOEA 4BAQB 2BDCA 4ZAEA 4CR9A 4X1QU 1MAXA 1FIWA 1ZPBA 2ULLA 2M2AA 4INHA 1G3EA 3RMLH 1JBUH 3S0NA 1A1RA 1SLXB 2BDIA 2VIQA 3HGPA 1CVWH 1HJAC 4K3JA 1VGCB 1ELGA 1O2NA 3ODDA 2XBYA 4RKOB 2WSSD 4IMQA 3M36A 1PPZA 1ACBE 1HJ8A 2FP7B 3M3VA 4MLFB 3SNAA 1KLJH 4DT7B 2FOGA 1FAXA 1XUJA 1ARBA 1SGNE 3L33A 3TPIZ 4FUHA 1SLVB 1MD7A 3U8RH 3DFLA 4GUXA 5HIZA 4FOUC 1EP6A 3OY5U 3BEIB 1S83A 1Y3WA 1C1MA 4Y0YE 3E91A 2BLOA 1DWBH 2H5DA 1GMHG 1P06A 3GS9A 3OTJE 1H9HE 2ZA5A 2ZIQH 5FXLA 3TH4H 1SOZA 1NS3A 1G3BA 1NO9H 2VGCB 4B6EA 1BDAA 1Z6EA 4A7IB 1NRQH 2HPQH 1SKYE 2FEQH 2OC0A 2TIOA 2PLXA 1GBTA 1C1SA 7LPRA 1ZGIA 4I7YH 1SR5C 1A3EH 4AB9A 4ABDA 2O8LA 3QTOH 5TJXA 4JYTA 3R3GB 3U9AH 2WINI 5T1VA 1L1GA 3ZVBA 3ZVGA 3TGIE 4CRBA 3PWBA 2UUYA 2F91A 4RN6A 1AHTH 2JJ1D 5JB8S 1DT2A 4KTUA 3V13A 2TGTA 1PJPA 4XDEA 2WV5A 2GZ8A 1C1NA 3IWMA 5DP3A 1LHFH 1O3OA 2TPIZ 2VBCA 2AGEX 1C4Y2 2FWWA 5A09A 4B71A 4Q7YA 2KX4A 1C2HA 1W7XH 1DLEA 1O3HA 3SU6A 2BVSH 4FUBA 2OINA 2SGFE 2XXLA 1UVTH 2YMSB 1ELEE 1NT1A 1O33A 3FO8D 4X2WA 2FESH 2F9UA 1Y5BT 2SFAA 5HM2A 3EE7A 1SFIA 1EZSC 1VZQH 1QL7A 3A8CA 2ZU3A 5FCRA 2O8TA 5C67A 4ASUD 2K0QA 1GBHA 5C5NA 4OS7A 1DFPA 1SGPE 3VXFH 3TJOA 4AFUA 1FY1A 5ABWA 1FDPA 2PSYA 1P2NA 5JBBS 1TNGA 3L6PA 3BTHE 3ATIA 5C20A 2BOKA 1C9TA 1HUTH 3C1KA 4UEHH 2GT7A 4Y7AA 2ASUB 4OS5A 3FP6E 3ITIA 5JYIA 2K1QA 3EA7A 1TNJA 2STBE 2DE8A 1FN8A 1AI8H 3RXTA 2AFQB 3IG6B 1NN6A 2Z3EA 1ABJH 3JZ1B 3DSOA 1O2TA 3M3TA 2VIWA 1AGJA 2P16A 1G9IE 1BUIA 3ZZ5A 3MH7A 1V2MT 3UFAA 1NBMD 1H8ED 3EGKH 1DY9A 5C3NA 1GHAF 3B8JA 2FM2A 3M7UA 3SGQE 4H42U 2NU2E 5DJ7A 4AB8A 2BD3A 1HAIH 4INKA 3P95A 3VG8A 2A5KA 4ZKOU 3TNSA 3BG4C 1O2VA 5E2OA 3SJKA 2Z6BD 3T62A 2ZEBA 1Z1IA 4O03A 4WXVA 1RXPA 1VITF 5H4IB 4X1SU 1ELBA 1UK3A 3GDSA 2QF4A 1MCTA 1ELTA 2WPIS 1BTHH 3MU1A 1G37A 3CENA 1LQDB 2V3OH 3HK6B 5DSFA 2W6JD 3RU4D 2FOFA 4TY6A 1ESAA 5A2MH 4Y11E 1RTFB 4YLUA 3P8OA 2GJGA 1P2JA 1W11U 3BTKE 1MKXK 5E0JA 1KTSB 1KDQA 3NPSA 3V12A 3I78A 5EQSA 2KCOA 1QY6A 3B9FH 3GCHB 2HVYB 3P8NA 1AFEH 3KEEA 5DGJA 2NU0E 1LKAA 1EJNA 1S81A 2CHAB 1XUGA 1O5AB 1LQEA 4X6MA 1JIRA 1ZJDA 1H4WA 2IOTA 5FHTA 3JZ2B 2VIVA 5IK2D 2BHGA 2XYAA 2F83A 1DS2E 1FV9A 1BBRK 4B75A 2R3UA 1F5RA 1IHTH 1D3QB 1O3KA 1WTGH 2B9LA 4F55A 2WPLS 2A2XH 1XUFA 3GYMA 1K1OA 4LOYH 3IITA 3A8DA 2ZDMA 5EGMA 1P9SA 1GBDA 1EPTA 2P8OC 4D8NA 1RRKA 1C2JA 2F3CE 1GMDG 3BIUH 3C27B 4AC9A 3SQEE 3S9AA 1NRRH 5CE1A 2ZC9H 1GWAA 1DXWA 1YLDA 2P3UB 3PMBB 2EI7A 1B0EA 4TPYA 1YPHE 4JZ1A 1FQ3A 1QCPA 1P2MA 4XRNA 1FPHH 1EZUC 1WU1A 3A87A 1OPHB 1RIWB 4AGKA 1KXEA 2BLVA 1E35B 3PTNA 1GVKB 2ZI2H 4IN1A 4NZQA 3BTTE 3QLPH 1TX6A 2H9TH 1K9OE 1ZHMA 1O2JA 4B74A 3M5MA 1L2EA 1TOCB 3AW1A 2YNAA 4IBLH 1CGIE 5FPSA 1AE8H 3TK6A 3MNCA 1F0TA 3U8TH 3V3MA 2SGQE 1LPKB 1C5OH 2J92A 1BHXF 2ALVA 3URDA 2ZZUH 1P3CA 4ZKRU 2BDYA 2VVUA 1BT7A 2OC7A 2BY6X 2BLWA 2Y7XA 2ZDAH 3SUFA 2SGAA 3A82A 1W0KD 4K60A 1LHDH 1P02A 5PTPA 3VPKA 5A8XA 1INCA 5T6FA 2QXHA 2FMJA 2Z9IA 3I29A 5TCCA 4BNRA 2CF9H 7GCHG 2HNTE 1QIXB 2C3SA 1QBOA 2EEKA 3NXPA 5DK1A 1OS8A 1P2QA 2FOMB 2PP6A 1C1RA 3ATWA 1OWDA 4BTTB 2G4UA 5AF9H 3PV5A 2C93B 1Y8TA 2GMTB 2BZ6H 3U1IB 3ZYEA 2ZCLP 1O3EA 3WY8A 1YPHC 4K8BA 1GHBF 1O5GH 2BD2A 2IPHA 3A85A 5TCAA 3VFEA 1HAPH 1PYTD 2FYRA 3GCOA 2UWPA 3OEHD 4ISLA 2C4FH 1O2HA 3D23A 1DXPA 4Y79A 1E79D 2BD9A 2HPPH 2FX6A 4DGJA 4HTCH 1AZZA 1Z8JB 2GZ9A 1QB9A 4FVDA 3VB5A 3V0XA 1J17T 4I32A 4JYVH 1TPPA 2CK3D 3PO1C 1O39A 3QZRA 4B6FA 1CGJE 2BX4A 1ETSH 1FN6A 2P59A 1TONA 1AVXA 1ESBA 1BA8B 4WVPE 1TBQH 3M5OA 5IYTA 1NZQH 5J4QA 3LDXH 1DM4B 3LGIA 4B2AA 5L2YH 3KHVA 1A46H 2BLQA 3GY3A 2W3IA 1ELCA 1O2LA 1P2IA 3KQEA 1UW7A 2ZHWH 4BAOB 3SO3A 2A7CA 1W10U 1SGEE 2GCHF 3EDXB 2P95A 4DCDA 1O5EH 1E38B 3M7TA 4DY7B 1BHXB 3SBKA 3ZYDA 4UFEH 1E1QD 1C5TA 5LPEA 1O2YA 4CBOA 1PPFE 3ZV9A 1JWTA 3GCTG 1YCPH 1SGYE 1LDTT 1G30B 5A0BA 1WBGB 3FOAA 1V2ST 1HAOH 2KFWA 2G51A 1O34A 4MPWA 2KR7A 4K1TA 2JH5D 4DIHH 1IAUA 1C5UA 1YY3A 4ABGA 1FAKH 1YLNA 1O3DA 3PMAB 2VVCA 1H1BA 3D62A 1D3PB 4FUEA 4MPVA 3UNRA 3SZEA 1PQ8A 3DT0H 3A8BA 3NKKA 4O97A 3GCNA 2ZQ2A 1SOTA 3U69H 1IQHA 1P05A 4GAWA 1GI6A 4JK5A 3OX7U 2JJ2D 5HXFA 4ZXXH 5LPFA 2AHME 1ESTA 1GPZA 1O2UA 2WZQA 1E36B 1GBFA 2PFEA 3MNSA 1W12U 1QFKH 2QA9E 1SGFG 1SL3A 2I6QA 1LTOA 1H8HD 2IJD1 1MQ6A 4GPGA 1W0ZU 5B6OA 1ZRBA 2FTMA 1A7SA 3W1EA 1HGTH 3MU4A 1SGCA 3HGNA 2BD7A 2QXIA 1BBRE 3RXEA 2PKAA 3Q3XA 4XBBA 1GHZA 1S6FA 5GNDA 4I8JA 4XD7D 1WXRA 1C9PA 4YESB 3MOCA 1UMAH 3F0OA 1GVLA 1A4WH 3MTYA 1O2RA 4A92A 5DO4H 1DITH 3H09A 5I46H 3TIUA 4LK4A 1QL9A 1CT0E 1C5SA 1LKBA 3RXQA 3UOPA 1Y5UT 2Z9GA 4DURA 1UVPA 3F0PA 4CH8B 1P12E 1E37B 5FX5A 3EQ0H 1EUFA 3GOVB 3KQBA 5A0CA 1ID5H 5FBEA 3UPEA 1TPAE 2XWAA 4JZIA 2ZGXH 1QURH 4H6TA 2VINA 4Y6DA 4A1VA 1EOLA 4U2WA 4DJZB 2CV3A 1CQQA 1DPOA 2FI5E 3PV4A 1OYTH 1VCWA 1DSUA 1K1MA 2HALA 1PPEE 1UHBA 2FOAA 3ZZCA 4NZLA 1TAWA 3BF6H 1TPOA 2ODYB 4NSYA 1LCYA 5T6GA 3KQDA 4Z1MD 1E0FD 2LNCA 3RC5A 4HGCA 3QX5H 2BZAA 1T8LA 4OM9A 3ZZ3A 5EQRA 3M7QA 3M5NA 1UTOA 2OLGA 2VNTA 3SNBA 1EB1H 4Q2KA 1ZTJA 1TQ0B 3LKWA 5C94A 2TGDA 2RDEA 1EZXC 1GJ6A 6LPRA 1D6RA 1K22H 2AS9A 1HAGE 2OC8A 5EJZA 3KQ5A 1OWJA 2J98A 4X1RU 3UY9A 4Z0KA 1SVPA 3UWIA 2G5VA 1O3IA 4KTSA 4MDSA 3RXHA 1KYNA 3FP8E 1PPGE 1E1RD 3K65B 4ZROA 4U30A 2FS8A 1QRZA 4ABBA 3EA9A 4HFPB 5CHAC 1L4ZA 4YZUA 1BTPA 3QK1A 1MMJN 1TMTH 5EXNA 1DE7H 4AG1A 1C1WH 1YM0A 2C8YB 3PMHB 4R8TB 2VIDA 2ZFSA 5B6LA 2A1DB 2VH0A 3M5LA 1MTWA 2DUCA 1NRNH 3KYFA 1P10A 5KEDA 1JOUB 2EI6A 2NWNA 2ZTYA 1T7CA 1QZ8A 1THSH 5EODA 2F9PA 2SGEE 2VJ1A 4YO9A 1O2IA 4D9QA 3P92A 4UFDH 1ELAA 3VXEH 1N6YA 2H5CA 1Y3UA 3MHWU 5IDKA 1P04A 3FZZA 3SU2A 1BMNH 4BOHA 1S85A 1SQTA 1T8MA 3BN9A 1GHXH 3VB6A 5F8TA 1P2OA 2Z9KA 5HYOA 1GHYH 1XUIA 5DP7A 3P8GA 4X8VH 1ZMJA 2GP9B 1O3BA 1ZMLA 1AN1E 1TX7A 2UWOA 1UCYH 2GGVB 4E06H 3A7TA 1MBQA 2XCFA 1Y5AT 1KY9A 2QE7D 1O2GH 2XC0A 1GMHF 4FXGH 1EKBB 2BB4A 1TA2A 1K0HA 1GCDA 3RXPA 2ZCKP 2F9BH 6GCHG 3F3BA 1O5DH 1TGSZ 1F5KU 2GV7A 2Z94A 3AVZA 3SJ9A 3F9EA 2BDHA 4INLA 3F2HA 2XBXA 3F9GA 4I31A 1C5VA 1XUHA 2ZGHA 2ANYA 2ANKH 2EI8A 1GBIA 1AVWA 1AKSA 2SGPE 1V2TT 3RXSA 3RMNH 2GDDA 2Y5GA 1QJ6B 2XBWA 1O2WA 4MNXA 5FPYA 4FUGA 7ESTE 3TVJB 1ANBA 2P93A 2QGRA 2OBOA 1CHOG 3WWBA 3KN2A 1SFQB 2C90B 1MUEB 5CHBA 5FCKA 3SOSA 4OS1A 1ANCA 1GVZA 5DP9A 2J9NA 2YOLA 3ESTA 3UR9A 2ZPSA 1SLUB 3FVFB 1C2IA 3HKIB 2AMPA 2Y5HA 3BTWE 2NU1E 4BXSA 2R2WU 2PTCE 4CH2B 1V2VT 5EPYA 3LPRA 1AO5A 3BTFE 4FUDA 4UE7H 1EAIA 1QTFA 4LZ1H 3LC5A 1RIWC 2H6MA 1QR3E 4ZHMU 1BJUA 1AB9B 4X8UH 1D9IA 2R3YA 1MTSA 4ZUHA 3TLOA 3BV9B 1P3EA 1EZQA 2FX4A 4GCHF 2D8WA 4ASHA 1FMGA 3S7HB 4XE4A 1OYQA 1W14U 2OK5A 4X0WU 1BMMH 5DP5A 1GG6C 5LGOA 1MTNC 2AERH 3H5CB 4YT7H 4X1NU 3NZIA 2Q6GA 1LPGB 2JETC 2BQ6B 4BTIB 5DN6D 3ELAH 1HIAB 1MZDA 1FONA 2ZGBH 1SBWA 2Z9JA 4BAKB 4H6SB 3N7EA 2IN2A 4BAMB 2FOCA 2W7SA 2QF5A 2GTBA 1KXFA 1MH0A 4KP0A 3RUOA 1J15A 3K6YA 3SN8A 2D2DA 1Z8GA 2CXVA 3LJJA 1O3CA 2HRVA 2THFB 4NFEA 5L30H 1SQRA 3GCTF 1VITG 3S69A 1F0RA 1C5NH 4DT4A 1UTPA 3RM2H 1G2LA 1XM1A 2KCAA 2QN5T 2Z3CA 3ZZBA 2ALPA 1N8OB 3P8FA 4ABFA 2F43B 2W6ID 1Y59T 2KZ4A 2AIPA 2O8MA 8LPRA 1GI8B 3UAIC 1GGDC 2A5IA 4AGJA 2GDEH 3A88A 1EB2A 1Z6JH 3E8LA 1QQ4A 1ETRH 3UNQA 1DWDH 4X6NA 1LMWB 2ANMH 1BQYA 3RMOH 3OYPA 1GBKA 1CE5A 1GJDB 2ANWA 1C5QA 4X8SH 3ZZ7A 1P03A 4B1TA 2A4RA 1OWIA 5K7RA 4KGAA 2ZHQH 4I8GA 3T25A 2PKSB 1DUEA 3R0FA 2C8XB 1C4U2 3O8DA 3K9XB 1GBAA 2ZHDA 4ZHLU 4I8LA 4GCHG 3T2NA 4IGDA 4NIVA 3ZZAA 2PV9B 2F9OA 2XWBI 4A1XA 2EY4C 1RTKA 2VB0A 1QHRB 1GHBG 8ESTE 3OFND 1OWEA 4FUJA 2FODA 3UTUH 3RXGA 4IW4E 5HIYA 5T3HA 2RFKC 1AFQB 3EYDA 3A80A 4MPXA 4B2CA 1TYNA 1V2PT 2G4TA 5KGOA 1YPJH 4NIWA 1A5HA 1KMHB 1ZSKA 3F2GA 3RXFA 5HM9A 4ZH8A 3KNXA 3KIDU 5DP6A 2FLBH 2ZGJA 1GI3A 3QGJA 1QA7A 4ISNA 5AHGH 1MQ5A 1ZPZA 1A61H 1UK2A 1EJAA 3RC4A 1COWD 3LGUA 1WQVH 4RT0A 1TABE 1F2SE 4DW2U 1SGIB 2Z9LA 4WXIA 2J94A 1YGCH 1P57B 3SU3A 1FUJA 4WY3A 2HVXA 4A1TA 1QBVH 5CDFE 1HAHH 9LPRA 1V2JT 5ETXA 1VJAU 4ISHH 1NFYA 2G52A 1MKWK 1DANH 3MO6A 1HXFH 5C1YA 3EE0B 1AY6H 4MNVA 1BMAA 2QYIA 1QRWA 2F9NA 1KXAA 1KXDA 4F48B 2PHBA 2GCTB 5I25A 2J38A 1UVOA 1O5FH 3S9CA 1W3CA 1GBCA 1Z8RA 1L1JA 2AGGX 1C2GA 1NROH 1GI1A 1OXGA 1IHSH 4K1EA 2STAE 4YM9A 3U98H 3RXLA 2J95A 5JDUB 3SU0A 3FZDA 2A4OA 1BIOA 3P17H 2YNBA 5FX6A 3Q00A 1P8VC 1QL8A 4UFGH 3SNEA 1J9CH 1OWHA 4AORA 1GBMA 1P9UA 3PRDA 4ABEA 4IS5A 3DA9B 3SU5A 1AB9C 3STIA 2G8TA 2QIQA 1RD3B 3HKJB 1K1NA 1O3NA 1OP2A 4U32A 2ZFRH 2KCPA 3QZQA 2Y80A 1UTKA 4IN2A 4K5ZA 1HBTH 5A8YA 1W0YH 3PLBA 6CHAC 1KXBA 3SI4H 2KAIB 2P8OB 2C8WB 2IJOB 4CREA 1TGCA 3FKSD 7KMEH 4O9VA 1AUTC 1HAVA 1GMCG 1LVBA 5DPAA 4ZXYH 1C5XB 2FI4E 4CRGA 1C2FA 3KL6A 1C2KA 1FY4A 1Z1JA 1ZHPA 3PWCA 4GSOA 4UDWH 1TGNA 3MNXA 2VWNA 5F6MA 1YPLH 1TGBA 4THNH 1CO7E 1SGFA 5C1XA 1CBWB 4FU8A 4U01A 4TT3D 1ZOMA 1GI7B 1O2XA 2ZDNA 1HB0B 1TMUH 3F1SB 3RM0H 1QGFA 4AZ2B 1WCZA 4CRFA 2LPRA 5DP8A 1ARCA 2PR3A 3G01A 1WUNH 3V7TA 5SGAE 2AIQA 1XVOA 3MI4A 4OGYA 1AZ8A 4FETA 3STJA 3A7YA 5JBAS 2OTVA 1OP0A 1S0QA 3KGPA 1L1NA 2A2QH 2FPZA 1HPGA 2WV9A 3LGTA 1CA8B 1EAWA 3CS0A 3FFGA 2W26A 1IQEA 5EJ1A 1EATA 1F0UA 2SNWA 4ZCNA 1VKYA 1HNEE 1O3JA 2HOBA 1M9UA 1ZYOA 3RXKA 3LGVA 3A83A 3EAJA 3DFJA 1SQAA 3RLYH 1PQAA 1KDQB 3BTDE 4Y0ZE 3UR6A 1BITA 2HLDD 3OAAD 1BTYA 1K28D 2V35A 3I77A 1BOQA 1A3BH 1UTMA 2ZU4A 1LHCH 2ZP0H 4YT6H 2GX4A 4X2VA 2QC2A 2GMTC 5F8ZA 3B23B 3QDZB 1UJ1A
chains in the Genus database with same CATH topology
3ZVDA 1THRH 2BVXH 1TQ7B 3DD2H 3QTVH 1AKSB 1ZHRA 1G36A 5LPRA 2AEIH 2FIRH 2Y82A 1OP8A 1YPGH 2SNVA 3M35A 5C5OA 1QRXA 3S9BA 3LH3A 3ZV8A 1SHHB 3TJVA 1SQOA 2PWXA 2GD4B 1F7ZA 1CHGA 4JMYA 5ESBA 1E34B 1GHAG 1O30A 4IC5A 5FPTA 1GMCF 1MKWH 3LJOA 2QXGA 2HNTC 2Y81A 3PLKA 1GI5A 3MH6A 1UTLM 4ABHA 3KF2A 4CRDA 3SV6A 4KELA 3LGWA 4ABIA 3A84A 2AMQA 3F6UH 1N1LA 4ESTE 2BDGA 3TK9A 1B5GH 3RXMA 4ZMAH 1J8AA 4DG4A 4KKDA 1CSOE 1GL0E 1TNHA 1OOKB 1GDQA 1B0FA 1DY8A 1EQ9A 1HJAB 1NRSH 2XBVA 5EG4A 4I8KA 1T4UH 4Y7BA 1ELVA 4ZKSU 5JPMH 1XVMA 3PMJA 4MPUA 4I33A 1RFNA 4A6LA 1YLCA 5DG6A 4AYVB 3GY2A 3URCA 2O8WA 2A0QB 2OUAA 1CT2E 1HDTH 3BG4B 3SU1A 2ZU2A 1D3TB 3RXDA 4D76A 3SJ8A 3SORA 1K1IA 3QUMP 2VH6A 1IQIA 2BY8X 4ABJA 3SV8A 1XKBC 1GHWH 1TPSA 1N8OC 4X8TH 1O2PA 2Q1JA 1GBBA 2XRCA 1EJMA 1FPCH 3SI3H 2DE9A 2XCNA 4J2YB 2ZDLA 3F9FA 3VEQB 2VGCC 5GJ4B 1ZTKA 1F92A 2P3FH 2P94A 1MU8B 3SUDA 1ELDE 3VGCB 1A0JA 3BEFB 2WYGA 5AVDA 3E3TA 3A8AA 3AAUA 2RDLA 5EXLA 2J4IA 1LHEH 3RXBA 3TH2H 1C1QA 3SZNA 4XBCA 5EW1H 4NWKA 2F9VA 3TH3H 2VWMA 1BJVA 3RXCA 2Z7FE 1S84A 1WQSA 1O3FA 2UUFB 4D7GA 2C8ZB 2FOEA 2ZTZA 4K8YA 2AH4X 4O3TA 4NFFA 5HMAA 1RS0A 3PROA 1SI5H 1V6DA 1O35A 1OKXA 1H8DH 1QJ1B 1PPBH 1O31A 1ZR0A 2O8UA 4NA9H 2AGIX 2BY7X 1UVUH 2VIOA 1AWFH 1AD8H 1LVOA 1UK4A 4ISIH 3MYWA 1FY3A 3KQCA 1P2KA 5EPNA 2GV6A 1K1LA 1YCPM 4E05H 3SW2B 1SSXA 3QWCH 1HAXB 2HNTF 1YP9A 2RA3A 4K69A 2QAAA 4B73A 1EX3A 2ZU5A 4X6PA 2BVRH 3GDUA 2OQ5A 4LXBH 2AMDA 4BANB 5GWZA 4AFQA 1V2RT 2FO9A 3HATH 1ZGVA 3CS7A 4X2YA 1GBLA 3O8RA 4RKJB 2CN0H 6GCHF 1MZAA 1H8IH 1P01A 3T29A 8KME2 3MH5A 3ZVCA 2OP9A 1GGDB 1WYKA 2A32A 4DIIH 3GY5A 2RG3A 4R0IA 4ZHAA 1AVGH 1O3PB 2FOBA 1XX9A 4OGXA 1S0RA 1PYTC 2PTNA 1EPTC 4Y8YA 1XMNB 1A2CH 1NPMA 2J34A 1EXFA 2OCVB 3E1XB 1YPEH 3LONA 6ESTA 1PPCE 4BTUB 1CHOF 1F5LA 3PLPA 1C2DA 3LOXA 4PROA 3HK3B 3MNBA 1BRCE 2ZKSA 4YLQH 4AYYB 3PM3A 4WH6A 2WPMS 4VGCC 2Y7ZA 2Y5FA 3MMGA 5GXPA 2FYQA 2A45B 1IQGA 3LT3A 1QBNA 3E0NB 3GYLB 4GVUA 3HPTB 1IQMA 1J16A 2WPKS 4HI3A 4Y71A 1TMBH 4MG3A 1O3GA 4E7RG 1NFUA 3GDVA 1GI4A 3Q3KA 2A7HA 2BM2A 4FU9A 4Q80A 1NU9A 1YCPK 3A86A 4HZHA 1O5BB 1TBRH 2WYJA 1V2OT 3ZVFA 1UTJA 2CJIA 1O2SA 1CA0B 3SU4A 1GJ5H 1RJXB 2ZNKH 1JXPA 3MWIU 1G3DA 1ZZZA 5T6DA 1Q3XA 1D3DB 1V2KT 1C5RA 1WAYB 3FANA 3O8BA 1C5PA 1HCGA 3ZZ9A 1B7XB 4NA7A 4NSVA 1CU1A 1HAYB 3GICB 1UVSH 2ZPRA 3A7VA 2ILNA 1YKTA 4MQAA 2EA3A 2GVFA 2G5NA 1WV7H 2B0FA 3AAVA 5JBCS 4TWWA 1IQFA 2VWLA 3TJUA 2XC4A 3TU7H 1NC6A 1GG6B 1GJCB 5FAHA 3ZZ4A 2BOHB 1GJ7B 2VU8E 1H9LB 4TYDA 3H7OA 8GCHG 3T5FH 1GJ8B 2ZGCA 5HGGA 4SGBE 3UUZA 3E90B 4FUFA 1C2EA 1DWCH 1HV7A 2OQUA 1TNLA 3W94A 2CMYA 4TPIZ 1W7GH 1GJAB 3TGJE 3CP7A 1K2I1 4AFZA 2BX3A 2V6NA 2ZO3H 3DHKH 4YOJA 1AQ7A 3K2UA 1SGQE 4M7GA 3ENSB 2R0LA 4RSPA 4XBDA 7GCHF 2WPHS 4MNWA 1VJ9U 5GDSH 1V3XA 1P11E 3N7OA 3M61U 1O36A 8GCHF 4WF8A 1LVYA 1PQ5A 4JZFH 4JK6A 2CHAC 1V2LT 1KLIH 1C5YB 2HLCA 1QJ7B 3ZVEA 2BMGB 1MTVA 1XKAC 2ZWLH 3VB4A 3RP2A 1IQNA 2TBSA 4B2BA 1DX5M 1P0SH 1ORFA 2A4QA 1O2KA 4OS6A 4KTCA 2W7UA 1VR1H 3SV9A 5E0GA 5E8EH 2B7DH 2BQ7B 2GT8A 1TB6H 1C5ZB 3T26A 5AFYH 2H9EH 1JRTA 1L4DA 3MFJA 3F9HA 3NUMA 1TGTA 5ESTE 2H9HA 3BG8A 2JH6D 1BTUA 2SGDE 3UOUA 1O37A 3QN7A 1K1JA 3RXVA 1MD8A 1DLKB 3U8OH 4D9RA 1HLTH 1T8NA 4UD9H 1ZMNA 3P70B 1UO6A 5GIBA 5L2ZH 1FJSA 3RXJA 2TRMA 2WV4A 1ZJKA 1T32A 1C1VH 3L3TA 4GLYA 2W5EA 1TALA 2FS9A 1DDJA 2P3TB 1T31A 3TJNA 1J14A 1TRYA 2WUBA 1DVAH 1FLEE 1SB1H 1F0SA 1HFDA 1MCVA 2ZPQA 4B76A 3PTBA 2ZG0H 1GI9B 3BSQA 2J2UA 2PUXB 3MU0A 3H7TA 1ETTH 2NU4E 1ZPCA 3T27A 1O32A 1Z8IB 5EXMA 3RXAA 1EPTB 1TFXA 2BD8A 1D4PB 2FDAA 1ZTLA 1O5CB 4MTBA 1DICA 5EW2H 4WJG2 2XTTB 2D1JA 4E7NA 4TY7A 1FIZA 3D65E 3W95A 4ZKNU 3OU0A 1HYLA 2B8OH 1VGCC 3VB7A 3E16B 3QO6A 3SV7A 1NTPA 2Y6TA 1W13U 2WPJS 1OX1A 1EP5A 4DVAU 3E0PB 1HAZB 1AU8A 1C5WB 2JKHA 2ZF0H 2BXTH 4CR5A 1EAUA 3K6ZA 5EU8A 3SNDA 4CRAA 3LC3A 1A5GH 1ELFA 2VIPA 1IQJA 1QB6A 3PYHA 3A7WA 4JZEH 1MKXH 1AMHA 1SGDE 1FI8A 2ESTE 3UQOA 4WMFA 1CT4E 3Q3YA 3SJOA 4UONA 2QXJA 1C5MD 1BCUH 3SJIA 3RC6A 1YPKH 2BQWB 2OXSA 4MVNA 3DUXH 2FLRH 1GCTC 1L0ZA 2A7JA 1TNKA 3T28A 2D26C 3MU5A 4UFFH 3RXIA 1Y3XA 4NA8A 2ZFQH 3AW0A 1GJBB 1BMLA 1ZRKA 4WMEA 1TRNA 1THPB 3Q76A 1C1OA 1V2UT 2Q6FA 1QNJA 2ZU1A 2RCEA 3U1JB 1BB0B 4I8HA 1EOJA 1KSNA 1GDNA 1IQLA 1T4VH 5A0AE 1G3CA 1KIGH 2XC5A 3ZZ8A 4JYUH 1MBMA 4MNYA 4O3UA 1UHBB 5LH8A 2PGQB 2QV1A 1ABIH 1LO6A 2A5AA 2CF8H 6CHAB 1QB1A 5CMXH 3P6ZB 3OSYA 4YTAA 1GMDF 2BY9X 1P09A 2V0BA 1LHGH 4AOQA 1V2WT 3PB1E 4AX9H 2ZFTA 1BTZA 2R2MB 1DWEH 1GHVH 2V3HH 1OSSA 4GHQA 4WH8A 1GL1A 1ZSJA 3UWJH 3UIRA 4D7FA 2PKAB 1TOMH 1UCYE 3NCLA 3F68H 2ODPA 1OWKA 4A5TS 1AUJA 4WWYA 4IMZA 3ATMA 4WMDA 1CGHA 2Z3DA 2OC1A 1JMOH 1VCQA 3SHAH 4AG2A 1BBRH 5JBTA 1KLTA 2BD4A 1O2QA 1S5SA 3ODFA 1W2KH 5DP4A 3OY6U 1O2ZA 1A5IA 1V2NT 2BD5A 3GCHC 3UQVA 4LZ4B 3GY7A 2FZZA 4NCYA 5E0HA 1HRTH 4F4OC 1JRSA 3EA8A 2BDBA 2VWOA 5L6NH 3E6PH 1PPHE 1FY8E 1TNIA 3RMMH 2A31A 1O3AA 3SQHE 2PW8H 3ZZ6A 3LIWA 2FOHA 2UUJB 1K1PA 4X6OA 1SMFE 1GDUA 2QF3A 3BTME 1QA0A 4Q7XA 1HXEH 3TK5A 3A81A 2G81E 1TE0A 3RXUA 1DUAA 1O0DH 2FI3E 2PGBB 1X7AC 1C2MA 3LH1A 4TWYA 3S7KB 2ODQA 2GCTC 2G55A 2H1UA 1AFQC 1TBZH 5CHAB 1YC0A 3PO1B 3SGAE 2ZDVH 3BIVH 4XOJA 2ZHFH 2TGPZ 1YYY1 2OBQA 3BEUA 3FAOA 3GY8A 9ESTA 5EQQA 5J4SA 2QCYA 1ANDA 2ZCHP 5G4BA 3BTGE 2TGAA 3BTQE 3NK8A 1N6XA 5F03A 1WTHD 1WOFA 5GPIB 2ZHEH 1KXCA 4NIYA 1EASA 3LU9B 1HIAA 2ZQ1A 1NFXA 1Y3YA 1NFWA 3A7ZA 5EOKA 1BTXA 1YF4A 1SHYA 1FNIA 2PSXA 5JB9S 1SG8B 1AWHB 1Z71A 1ZSLA 1O38A 2I6SA 2WUCA 3Q77A 2UUKB 2FTLE 2JETB 1TIOA 3O8CA 1UTQA 3ATKA 1JIMA 1IQKA 1CBWC 3TGKE 1GBEA 3RLWH 4YOGA 1NESE 3A7XA 4QT8C 1TA6A 3SGBE 1XXDA 5A8ZA 2O9QA 2ZFPH 1S82A 2B5TB 1O3LA 1Z7KA 4ISOA 1C5LH 2R0KA 3VGCC 1MTUA 1A0HB 3AASA 5GCHF 4FUIA 3RU4E 1SPJA 3SUEA 1G2MA 3A89A 2ZDKA 4CBNA 4Y8ZA 3MH4A 1C1PA 1FXYA 3M37A 4NWLA 1TWXB 1LPZB 3RDZA 1D6WA 3TITA 1GJ4H 5FBIA 1BRBE 5BPEA 1GI2A 3GISB 2PKSC 4Y10E 3ZZDA 1GBJA 3M3SA 5DKMA 3MO9A 4YOIA 2QY0B 3ATLA 4IC6A 3TNTA 5GCHG 1NM6A 4BAHB 2XNIA 1NY22 2BXUH 4CHAB 4Y76A 1BRUP 1FZZA 4JZDH 4XFQA 2UWLA 1Q31A 4FUCA 4CHAC 2AYWA 1MU6B 4NG9H 2BDAA 4BXWA 2KAIA 3SNCA 1FY5A 3MU8A 4FVBA 4CRCA 1O2MA 1TLDA 2HWLB 3RXRA 1PFXC 5C2ZA 1O3MA 1SC8U 1C1TA 1YPMH 2XW9A 1U6QA 3SHCH 1Y3VA 2A4GA 2ZFFH 3UREA 4H4FA 1ZLRA 1H9IE 1RTLA 4NGAH 4F49A 4X2XA 2BYAX 2EC9H 1UCYK 2CGAA 1VCPA 2BTCE 3BTEE 1GI0A 2HGTH 3GY4A 3UNSA 2JH0D 1TRMA 4SGAE 1YBWA 2G00A 2NU3E 1T8OA 1XXFA 1HJ9A 1MTNB 1W8BH 1DSTA 2H2ZA 2ZECA 4NIXA 3NWUA 1MAYA 1SLWB 2QF0A 1O2OA 2GZ7A 2M5TA 4K1SA 3MO3A 3RU4T 1GJ9B 1WSSH 3KCGH 1VITH 1DOJA 4J1YA 1XUKA 1HAVB 3GY6A 4GHTA 3VB3A 5C1UA 1SGTA 1BTWA 3RXOA 2GKVE 4ABAA 2BY5X 2GCHG 1AIXH 4X1PU 4AFSA 1TX8A 5K0HA 5F8XA 2Q6DA 1S6HA 1C1UH 4VGCB 3SV2H 1KTTB 1A0LA 1GCTB 4OS4A 1BZXE 1EAXA 5BRRE 3D49H 1RGQA 4Z6AH 1CA0C 1NU7B 2OD3B 4OS2A 3FP7E 4Y8XA 2ZTXA 4JCNA 5AFZH 3SUGA 1G32B 4K2YA 3LGYA 1Q2WA 4DOQA 1V2QT 2RA0A 1AE5A 1LVMA 4AN7A 1SGRE 2FXRA 1BRAA 2W3KA 3QGNB 4FU7A 1K21H 4Q7ZA 1UTNA 1QQUA 1C2LA 1NRPH 1PQ7A 2PUQH 2VVVA 3ZVAA 4XSKU 1ANEA 2R9PA 5E2PA 1C4V2 1IOEA 4BAQB 2BDCA 4ZAEA 4CR9A 4X1QU 1MAXA 1FIWA 1ZPBA 2ULLA 3RMLH 4INHA 1G3EA 1JBUH 3S0NA 1A1RA 1SLXB 2BDIA 2VIQA 3HGPA 1CVWH 1HJAC 4K3JA 1VGCB 1ELGA 1O2NA 3ODDA 2XBYA 4RKOB 4IMQA 3M36A 1PPZA 1ACBE 1HJ8A 2FP7B 3M3VA 4MLFB 3SNAA 1KLJH 4DT7B 2FOGA 1FAXA 1XUJA 1ARBA 1SGNE 3L33A 3TPIZ 4FUHA 1SLVB 1MD7A 3U8RH 3DFLA 4GUXA 1EP6A 3OY5U 3BEIB 1S83A 1Y3WA 1C1MA 4Y0YE 3E91A 2BLOA 1DWBH 2H5DA 1GMHG 1P06A 3OTJE 1H9HE 2ZA5A 2ZIQH 5FXLA 3TH4H 1SOZA 1NS3A 1G3BA 1NO9H 2VGCB 1BDAA 1Z6EA 4A7IB 1NRQH 2HPQH 2FEQH 2OC0A 2TIOA 2PLXA 1GBTA 1C1SA 7LPRA 1ZGIA 4I7YH 1SR5C 1A3EH 4AB9A 4ABDA 2O8LA 3QTOH 5TJXA 4JYTA 3R3GB 3U9AH 2WINI 1L1GA 3ZVBA 3ZVGA 3TGIE 4CRBA 3PWBA 2UUYA 2F91A 4RN6A 1AHTH 5JB8S 1DT2A 4KTUA 3V13A 2TGTA 1PJPA 4XDEA 2WV5A 2GZ8A 1C1NA 3IWMA 5DP3A 1LHFH 1O3OA 2TPIZ 2AGEX 1C4Y2 2FWWA 5A09A 4B71A 4Q7YA 1C2HA 1W7XH 1DLEA 1O3HA 3SU6A 2BVSH 4FUBA 2OINA 2SGFE 2XXLA 1UVTH 1ELEE 1NT1A 1O33A 4X2WA 2FESH 2F9UA 1Y5BT 2SFAA 5HM2A