4ABKA

Human parp14 (artd8, bal2) - macro domain 3 in complex with adenosine- 5-diphosphoribose
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
182
structure length
182
Chain Sequence
MFYGTVSSPDSGVYEMKIGSIIFQVASGDITKEEADVIVNSTSNSFNLKAGVSKAILECAGQNVERECSQQAQQRKNDYIITGGGFLRCKNIIHVIGGNDVKSSVSSVLQECEKKNYSSICLPAIGTGNAKQHPDKVAEAIIDAIEDFVQKGSAQSVKKVKVVIFLPQVLDVFYANMKKREG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POLY [ADP-RIBOSE] POLYMERASE 14
publication title Recognition of Mono-Adp-Ribosylated Artd10 Substrates by Artd8 Macrodomains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 69
structure length 182
sequence length 182
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4abkA00
5AILA 2BFRA 2EEEA 3EKEA 2FAVA 3KQZA 1ZR3A 5D8NA 2LGRA 4R6TA 2X47A 1TY8A 3V45A 1LCPA 3IJ3A 1LANA 3GPGA 3VFQA 2BFQA 3KZWA 5CBMA 3SIJA 3SIGA 2ACFA 2EWBA 5FSVA 1SPVA 1TXZA 5FSUA 4ZY0A 1BPMA 2DX6A 4ZX8A 1LAMA 4J5QA 4GVVA 3IIDA 2VRIA 2AFCA 4X2TA 4ZY2A 4GVWA 3EJGA 1VHUA 3GPOA 3Q6ZA 4K3NA 4ESSA 3EWQA 2XD7A 3EWRA 1ZR5A 4ETKA 4ZI6A 4ETJA 3KR4A 3EJFA 4ZX9A 4KYBA 3IIFA 4J5RA 4JCAA 1BLLE 1YD9A 3EWOA 3EWPA 4IQYA 4ABKA 3SIHA 4KSIA 4ZYQA 5FSXA 4ABLA 3GQOA 5DUSA 1NJRA 2L8RA 2FXKA 3T8WA 5FSZA 3PEIA 3ETIA 5HIHA 4JVVA 3V2BA 1BPNA 4ZY1A 5HOLA 4JGKA 3JRUA 4J4ZA 3H8EA 5FSYA 5CB3A 3GPQA 2J9AA 4GUAA 3Q71A 1LAPA 3EW5A 4JLLA 5CMSA 4D86A 3JZTA 3H8FA 5E3BA 4R76A 4R7MA 4UMLA 3GQEA 5CB5A 4K0CA 3H8GA 3SIIA 4J5SA 4TU0A 3KQXA 1GYTA 1HJZA 2FG1A 3KR5A
chains in the Genus database with same CATH superfamily
5AILA 2BFRA 2EEEA 3EKEA 2FAVA 3KQZA 1ZR3A 5D8NA 2LGRA 4R6TA 2X47A 1TY8A 3V45A 1LCPA 3IJ3A 1LANA 2W2GA 3GPGA 3VFQA 2BFQA 3KZWA 5CBMA 3SIJA 3SIGA 2ACFA 2EWBA 5FSVA 1SPVA 1TXZA 5FSUA 4ZY0A 1BPMA 2DX6A 4ZX8A 1LAMA 4J5QA 4GVVA 3IIDA 2VRIA 2AFCA 4X2TA 4ZY2A 4GVWA 3EJGA 1VHUA 3GPOA 3Q6ZA 4K3NA 4ESSA 3EWQA 2XD7A 2KQVA 2JZDA 3EWRA 1ZR5A 4ETKA 4ZI6A 4ETJA 3KR4A 3EJFA 4ZX9A 4KYBA 2RNKA 3IIFA 4J5RA 4JCAA 1BLLE 1YD9A 3EWOA 3EWPA 4IQYA 4ABKA 3SIHA 4KSIA 4ZYQA 5FSXA 4ABLA 3GQOA 5DUSA 1NJRA 2L8RA 2FXKA 3T8WA 5FSZA 3PEIA 3ETIA 5HIHA 4JVVA 3V2BA 1BPNA 4ZY1A 5HOLA 2WCTA 4JGKA 3JRUA 4J4ZA 3H8EA 5FSYA 5CB3A 3GPQA 2J9AA 4GUAA 3Q71A 1LAPA 2JZEA 3EW5A 4JLLA 5CMSA 4D86A 2JZFA 3JZTA 3H8FA 5E3BA 4R76A 4R7MA 4UMLA 3GQEA 5CB5A 4K0CA 3H8GA 3SIIA 4J5SA 4TU0A 3KQXA 1GYTA 1HJZA 2FG1A 3KR5A
chains in the Genus database with same CATH topology
5AILA 2BFRA 2EEEA 3EKEA 2FAVA 3KQZA 1ZR3A 5D8NA 2LGRA 4R6TA 2X47A 1TY8A 3V45A 1LCPA 3IJ3A 1LANA 3GPGA 3VFQA 2BFQA 3KZWA 5CBMA 3SIJA 3SIGA 2ACFA 2EWBA 5FSVA 1SPVA 1TXZA 5FSUA 4ZY0A 1BPMA 2DX6A 4ZX8A 1LAMA 4J5QA 4GVVA 3IIDA 2VRIA 2AFCA 4X2TA 4ZY2A 4GVWA 3EJGA 1VHUA 3GPOA 3Q6ZA 4K3NA 4ESSA 3EWQA 2XD7A 3EWRA 1ZR5A 4ETKA 4ZI6A 4ETJA 3KR4A 3EJFA 4ZX9A 4KYBA 3IIFA 4J5RA 4JCAA 1BLLE 1YD9A 3EWOA 3EWPA 4IQYA 4ABKA 3SIHA 4KSIA 4ZYQA 5FSXA 4ABLA 3GQOA 5DUSA 1NJRA 2L8RA 2FXKA 3T8WA 5FSZA 3PEIA 3ETIA 5HIHA 4JVVA 3V2BA 1BPNA 4ZY1A 5HOLA 4JGKA 3JRUA 4J4ZA 3H8EA 5FSYA 5CB3A 3GPQA 2J9AA 4GUAA 3Q71A 1LAPA 3EW5A 4JLLA 5CMSA 4D86A 3JZTA 3H8FA 5E3BA 4R76A 4R7MA 4UMLA 3GQEA 5CB5A 4K0CA 3H8GA 3SIIA 4J5SA 4TU0A 3KQXA 1GYTA 1HJZA 2FG1A 3KR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AIL A;  2BFR A;  2EEE A;  3EKE A;  2FAV A;  3KQZ A;  1ZR3 A;  5D8N A;  2LGR A;  4R6T A;  2X47 A;  1TY8 A;  3V45 A;  1LCP A;  3IJ3 A;  1LAN A;  3GPG A;  3VFQ A;  2BFQ A;  3KZW A;  5CBM A;  3SIJ A;  3SIG A;  2ACF A;  2EWB A;  5FSV A;  1SPV A;  1TXZ A;  5FSU A;  4ZY0 A;  1BPM A;  2DX6 A;  4ZX8 A;  1LAM A;  4J5Q A;  4GVV A;  3IID A;  2VRI A;  2AFC A;  4X2T A;  4ZY2 A;  4GVW A;  3EJG A;  1VHU A;  3GPO A;  3Q6Z A;  4K3N A;  4ESS A;  3EWQ A;  2XD7 A;  3EWR A;  1ZR5 A;  4ETK A;  4ZI6 A;  4ETJ A;  3KR4 A;  3EJF A;  4ZX9 A;  4KYB A;  3IIF A;  4J5R A;  4JCA A;  1BLL E;  1YD9 A;  3EWO A;  3EWP A;  4IQY A;  4ABK A;  3SIH A;  4KSI A;  4ZYQ A;  5FSX A;  4ABL A;  3GQO A;  5DUS A;  1NJR A;  2L8R A;  2FXK A;  3T8W A;  5FSZ A;  3PEI A;  3ETI A;  5HIH A;  4JVV A;  3V2B A;  1BPN A;  4ZY1 A;  5HOL A;  4JGK A;  3JRU A;  4J4Z A;  3H8E A;  5FSY A;  5CB3 A;  3GPQ A;  2J9A A;  4GUA A;  3Q71 A;  1LAP A;  3EW5 A;  4JLL A;  5CMS A;  4D86 A;  3JZT A;  3H8F A;  5E3B A;  4R76 A;  4R7M A;  4UML A;  3GQE A;  5CB5 A;  4K0C A;  3H8G A;  3SII A;  4J5S A;  4TU0 A;  3KQX A;  1GYT A;  1HJZ A;  2FG1 A;  3KR5 A; 
#chains in the Genus database with same CATH topology
 5AIL A;  2BFR A;  2EEE A;  3EKE A;  2FAV A;  3KQZ A;  1ZR3 A;  5D8N A;  2LGR A;  4R6T A;  2X47 A;  1TY8 A;  3V45 A;  1LCP A;  3IJ3 A;  1LAN A;  2W2G A;  3GPG A;  3VFQ A;  2BFQ A;  3KZW A;  5CBM A;  3SIJ A;  3SIG A;  2ACF A;  2EWB A;  5FSV A;  1SPV A;  1TXZ A;  5FSU A;  4ZY0 A;  1BPM A;  2DX6 A;  4ZX8 A;  1LAM A;  4J5Q A;  4GVV A;  3IID A;  2VRI A;  2AFC A;  4X2T A;  4ZY2 A;  4GVW A;  3EJG A;  1VHU A;  3GPO A;  3Q6Z A;  4K3N A;  4ESS A;  3EWQ A;  2XD7 A;  2KQV A;  2JZD A;  3EWR A;  1ZR5 A;  4ETK A;  4ZI6 A;  4ETJ A;  3KR4 A;  3EJF A;  4ZX9 A;  4KYB A;  2RNK A;  3IIF A;  4J5R A;  4JCA A;  1BLL E;  1YD9 A;  3EWO A;  3EWP A;  4IQY A;  4ABK A;  3SIH A;  4KSI A;  4ZYQ A;  5FSX A;  4ABL A;  3GQO A;  5DUS A;  1NJR A;  2L8R A;  2FXK A;  3T8W A;  5FSZ A;  3PEI A;  3ETI A;  5HIH A;  4JVV A;  3V2B A;  1BPN A;  4ZY1 A;  5HOL A;  2WCT A;  4JGK A;  3JRU A;  4J4Z A;  3H8E A;  5FSY A;  5CB3 A;  3GPQ A;  2J9A A;  4GUA A;  3Q71 A;  1LAP A;  2JZE A;  3EW5 A;  4JLL A;  5CMS A;  4D86 A;  2JZF A;  3JZT A;  3H8F A;  5E3B A;  4R76 A;  4R7M A;  4UML A;  3GQE A;  5CB5 A;  4K0C A;  3H8G A;  3SII A;  4J5S A;  4TU0 A;  3KQX A;  1GYT A;  1HJZ A;  2FG1 A;  3KR5 A; 
#chains in the Genus database with same CATH homology
 5AIL A;  2BFR A;  2EEE A;  3EKE A;  2FAV A;  3KQZ A;  1ZR3 A;  5D8N A;  2LGR A;  4R6T A;  2X47 A;  1TY8 A;  3V45 A;  1LCP A;  3IJ3 A;  1LAN A;  3GPG A;  3VFQ A;  2BFQ A;  3KZW A;  5CBM A;  3SIJ A;  3SIG A;  2ACF A;  2EWB A;  5FSV A;  1SPV A;  1TXZ A;  5FSU A;  4ZY0 A;  1BPM A;  2DX6 A;  4ZX8 A;  1LAM A;  4J5Q A;  4GVV A;  3IID A;  2VRI A;  2AFC A;  4X2T A;  4ZY2 A;  4GVW A;  3EJG A;  1VHU A;  3GPO A;  3Q6Z A;  4K3N A;  4ESS A;  3EWQ A;  2XD7 A;  3EWR A;  1ZR5 A;  4ETK A;  4ZI6 A;  4ETJ A;  3KR4 A;  3EJF A;  4ZX9 A;  4KYB A;  3IIF A;  4J5R A;  4JCA A;  1BLL E;  1YD9 A;  3EWO A;  3EWP A;  4IQY A;  4ABK A;  3SIH A;  4KSI A;  4ZYQ A;  5FSX A;  4ABL A;  3GQO A;  5DUS A;  1NJR A;  2L8R A;  2FXK A;  3T8W A;  5FSZ A;  3PEI A;  3ETI A;  5HIH A;  4JVV A;  3V2B A;  1BPN A;  4ZY1 A;  5HOL A;  4JGK A;  3JRU A;  4J4Z A;  3H8E A;  5FSY A;  5CB3 A;  3GPQ A;  2J9A A;  4GUA A;  3Q71 A;  1LAP A;  3EW5 A;  4JLL A;  5CMS A;  4D86 A;  3JZT A;  3H8F A;  5E3B A;  4R76 A;  4R7M A;  4UML A;  3GQE A;  5CB5 A;  4K0C A;  3H8G A;  3SII A;  4J5S A;  4TU0 A;  3KQX A;  1GYT A;  1HJZ A;  2FG1 A;  3KR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...