4ABKA

Human parp14 (artd8, bal2) - macro domain 3 in complex with adenosine- 5-diphosphoribose
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
182
structure length
182
Chain Sequence
MFYGTVSSPDSGVYEMKIGSIIFQVASGDITKEEADVIVNSTSNSFNLKAGVSKAILECAGQNVERECSQQAQQRKNDYIITGGGFLRCKNIIHVIGGNDVKSSVSSVLQECEKKNYSSICLPAIGTGNAKQHPDKVAEAIIDAIEDFVQKGSAQSVKKVKVVIFLPQVLDVFYANMKKREG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Recognition of Mono-Adp-Ribosylated Artd10 Substrates by Artd8 Macrodomains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords POLY [ADP-RIBOSE] POLYMERASE 14
total genus 69
structure length 182
sequence length 182
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4abkA00
1VHUA 3JRUA 3Q6ZA 3VFQA 4J5QA 4JCAA 1BLLE 1ZR3A 4X2TA 4ABLA 3IJ3A 4IQYA 5CBMA 3IIDA 3V45A 3EWRA 4R6TA 4J4ZA 3KR5A 5CB3A 3SIGA 3PEIA 4K3NA 3EJGA 3EJFA 4UMLA 3GQOA 5FSXA 3KQXA 4R76A 3EWOA 2EEEA 1LAMA 4ABKA 2L8RA 2BFRA 3SIIA 1YD9A 4ETJA 2J9AA 1TXZA 2LGRA 3H8EA 4TU0A 5FSUA 4J5RA 1LANA 4GVWA 4JGKA 3SIHA 2FAVA 5DUSA 1GYTA 1TY8A 4KYBA 4KSIA 1SPVA 3EW5A 2DX6A 4K0CA 4GVVA 1ZR5A 5FSVA 4JVVA 2XD7A 1LAPA 5AILA 5CMSA 5E3BA 3V2BA 2EWBA 4J5SA 1HJZA 2BFQA 2FXKA 4ZX9A 5CB5A 3KQZA 4ZYQA 5FSZA 4ZY0A 4ZY1A 2ACFA 3JZTA 4ESSA 4JLLA 3H8GA 4D86A 5HIHA 3EKEA 4ETKA 3GPGA 3KZWA 3SIJA 3EWQA 1BPNA 3KR4A 3ETIA 2VRIA 3Q71A 4ZI6A 3GQEA 5FSYA 4ZX8A 1BPMA 4GUAA 3GPOA 4ZY2A 3EWPA 2AFCA 3T8WA 1NJRA 2FG1A 5D8NA 1LCPA 2X47A 4R7MA 3H8FA 3IIFA 3GPQA 5HOLA
chains in the Genus database with same CATH superfamily
1VHUA 3JRUA 3Q6ZA 3VFQA 4J5QA 4JCAA 1BLLE 1ZR3A 4X2TA 4ABLA 3IJ3A 4IQYA 5CBMA 3IIDA 3V45A 3EWRA 4R6TA 4J4ZA 3KR5A 5CB3A 3SIGA 2RNKA 3PEIA 4K3NA 3EJGA 3EJFA 4UMLA 3GQOA 5FSXA 3KQXA 4R76A 3EWOA 2EEEA 1LAMA 4ABKA 2L8RA 2BFRA 3SIIA 1YD9A 4ETJA 2J9AA 1TXZA 2LGRA 3H8EA 4TU0A 5FSUA 4J5RA 1LANA 4GVWA 4JGKA 3SIHA 2FAVA 5DUSA 2JZFA 1GYTA 1TY8A 4KYBA 2JZEA 4KSIA 1SPVA 3EW5A 2DX6A 4K0CA 4GVVA 1ZR5A 5FSVA 4JVVA 2XD7A 1LAPA 5AILA 5CMSA 5E3BA 3V2BA 2EWBA 4J5SA 1HJZA 2BFQA 2FXKA 4ZX9A 5CB5A 3KQZA 4ZYQA 5FSZA 4ZY0A 4ZY1A 2ACFA 3JZTA 4ESSA 4JLLA 3H8GA 4D86A 5HIHA 3EKEA 4ETKA 3GPGA 3KZWA 3SIJA 3EWQA 1BPNA 3KR4A 3ETIA 2VRIA 3Q71A 2JZDA 4ZI6A 3GQEA 2KQVA 5FSYA 4ZX8A 1BPMA 2W2GA 4GUAA 3GPOA 4ZY2A 2WCTA 3EWPA 2AFCA 3T8WA 1NJRA 2FG1A 5D8NA 1LCPA 2X47A 4R7MA 3H8FA 3IIFA 3GPQA 5HOLA
chains in the Genus database with same CATH topology
1VHUA 3JRUA 3Q6ZA 3VFQA 4J5QA 4JCAA 1BLLE 1ZR3A 4X2TA 4ABLA 3IJ3A 4IQYA 5CBMA 3IIDA 3V45A 3EWRA 4R6TA 4J4ZA 3KR5A 5CB3A 3SIGA 3PEIA 4K3NA 3EJGA 3EJFA 4UMLA 3GQOA 5FSXA 3KQXA 4R76A 3EWOA 2EEEA 1LAMA 4ABKA 2L8RA 2BFRA 3SIIA 1YD9A 4ETJA 2J9AA 1TXZA 2LGRA 3H8EA 4TU0A 5FSUA 4J5RA 1LANA 4GVWA 4JGKA 3SIHA 2FAVA 5DUSA 1GYTA 1TY8A 4KYBA 4KSIA 1SPVA 3EW5A 2DX6A 4K0CA 4GVVA 1ZR5A 5FSVA 4JVVA 2XD7A 1LAPA 5AILA 5CMSA 5E3BA 3V2BA 2EWBA 4J5SA 1HJZA 2BFQA 2FXKA 4ZX9A 5CB5A 3KQZA 4ZYQA 5FSZA 4ZY0A 4ZY1A 2ACFA 3JZTA 4ESSA 4JLLA 3H8GA 4D86A 5HIHA 3EKEA 4ETKA 3GPGA 3KZWA 3SIJA 3EWQA 1BPNA 3KR4A 3ETIA 2VRIA 3Q71A 4ZI6A 3GQEA 5FSYA 4ZX8A 1BPMA 4GUAA 3GPOA 4ZY2A 3EWPA 2AFCA 3T8WA 1NJRA 2FG1A 5D8NA 1LCPA 2X47A 4R7MA 3H8FA 3IIFA 3GPQA 5HOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VHU A;  3JRU A;  3Q6Z A;  3VFQ A;  4J5Q A;  4JCA A;  1BLL E;  1ZR3 A;  4X2T A;  4ABL A;  3IJ3 A;  4IQY A;  5CBM A;  3IID A;  3V45 A;  3EWR A;  4R6T A;  4J4Z A;  3KR5 A;  5CB3 A;  3SIG A;  3PEI A;  4K3N A;  3EJG A;  3EJF A;  4UML A;  3GQO A;  5FSX A;  3KQX A;  4R76 A;  3EWO A;  2EEE A;  1LAM A;  4ABK A;  2L8R A;  2BFR A;  3SII A;  1YD9 A;  4ETJ A;  2J9A A;  1TXZ A;  2LGR A;  3H8E A;  4TU0 A;  5FSU A;  4J5R A;  1LAN A;  4GVW A;  4JGK A;  3SIH A;  2FAV A;  5DUS A;  1GYT A;  1TY8 A;  4KYB A;  4KSI A;  1SPV A;  3EW5 A;  2DX6 A;  4K0C A;  4GVV A;  1ZR5 A;  5FSV A;  4JVV A;  2XD7 A;  1LAP A;  5AIL A;  5CMS A;  5E3B A;  3V2B A;  2EWB A;  4J5S A;  1HJZ A;  2BFQ A;  2FXK A;  4ZX9 A;  5CB5 A;  3KQZ A;  4ZYQ A;  5FSZ A;  4ZY0 A;  4ZY1 A;  2ACF A;  3JZT A;  4ESS A;  4JLL A;  3H8G A;  4D86 A;  5HIH A;  3EKE A;  4ETK A;  3GPG A;  3KZW A;  3SIJ A;  3EWQ A;  1BPN A;  3KR4 A;  3ETI A;  2VRI A;  3Q71 A;  4ZI6 A;  3GQE A;  5FSY A;  4ZX8 A;  1BPM A;  4GUA A;  3GPO A;  4ZY2 A;  3EWP A;  2AFC A;  3T8W A;  1NJR A;  2FG1 A;  5D8N A;  1LCP A;  2X47 A;  4R7M A;  3H8F A;  3IIF A;  3GPQ A;  5HOL A; 
#chains in the Genus database with same CATH topology
 1VHU A;  3JRU A;  3Q6Z A;  3VFQ A;  4J5Q A;  4JCA A;  1BLL E;  1ZR3 A;  4X2T A;  4ABL A;  3IJ3 A;  4IQY A;  5CBM A;  3IID A;  3V45 A;  3EWR A;  4R6T A;  4J4Z A;  3KR5 A;  5CB3 A;  3SIG A;  2RNK A;  3PEI A;  4K3N A;  3EJG A;  3EJF A;  4UML A;  3GQO A;  5FSX A;  3KQX A;  4R76 A;  3EWO A;  2EEE A;  1LAM A;  4ABK A;  2L8R A;  2BFR A;  3SII A;  1YD9 A;  4ETJ A;  2J9A A;  1TXZ A;  2LGR A;  3H8E A;  4TU0 A;  5FSU A;  4J5R A;  1LAN A;  4GVW A;  4JGK A;  3SIH A;  2FAV A;  5DUS A;  2JZF A;  1GYT A;  1TY8 A;  4KYB A;  2JZE A;  4KSI A;  1SPV A;  3EW5 A;  2DX6 A;  4K0C A;  4GVV A;  1ZR5 A;  5FSV A;  4JVV A;  2XD7 A;  1LAP A;  5AIL A;  5CMS A;  5E3B A;  3V2B A;  2EWB A;  4J5S A;  1HJZ A;  2BFQ A;  2FXK A;  4ZX9 A;  5CB5 A;  3KQZ A;  4ZYQ A;  5FSZ A;  4ZY0 A;  4ZY1 A;  2ACF A;  3JZT A;  4ESS A;  4JLL A;  3H8G A;  4D86 A;  5HIH A;  3EKE A;  4ETK A;  3GPG A;  3KZW A;  3SIJ A;  3EWQ A;  1BPN A;  3KR4 A;  3ETI A;  2VRI A;  3Q71 A;  2JZD A;  4ZI6 A;  3GQE A;  2KQV A;  5FSY A;  4ZX8 A;  1BPM A;  2W2G A;  4GUA A;  3GPO A;  4ZY2 A;  2WCT A;  3EWP A;  2AFC A;  3T8W A;  1NJR A;  2FG1 A;  5D8N A;  1LCP A;  2X47 A;  4R7M A;  3H8F A;  3IIF A;  3GPQ A;  5HOL A; 
#chains in the Genus database with same CATH homology
 1VHU A;  3JRU A;  3Q6Z A;  3VFQ A;  4J5Q A;  4JCA A;  1BLL E;  1ZR3 A;  4X2T A;  4ABL A;  3IJ3 A;  4IQY A;  5CBM A;  3IID A;  3V45 A;  3EWR A;  4R6T A;  4J4Z A;  3KR5 A;  5CB3 A;  3SIG A;  3PEI A;  4K3N A;  3EJG A;  3EJF A;  4UML A;  3GQO A;  5FSX A;  3KQX A;  4R76 A;  3EWO A;  2EEE A;  1LAM A;  4ABK A;  2L8R A;  2BFR A;  3SII A;  1YD9 A;  4ETJ A;  2J9A A;  1TXZ A;  2LGR A;  3H8E A;  4TU0 A;  5FSU A;  4J5R A;  1LAN A;  4GVW A;  4JGK A;  3SIH A;  2FAV A;  5DUS A;  1GYT A;  1TY8 A;  4KYB A;  4KSI A;  1SPV A;  3EW5 A;  2DX6 A;  4K0C A;  4GVV A;  1ZR5 A;  5FSV A;  4JVV A;  2XD7 A;  1LAP A;  5AIL A;  5CMS A;  5E3B A;  3V2B A;  2EWB A;  4J5S A;  1HJZ A;  2BFQ A;  2FXK A;  4ZX9 A;  5CB5 A;  3KQZ A;  4ZYQ A;  5FSZ A;  4ZY0 A;  4ZY1 A;  2ACF A;  3JZT A;  4ESS A;  4JLL A;  3H8G A;  4D86 A;  5HIH A;  3EKE A;  4ETK A;  3GPG A;  3KZW A;  3SIJ A;  3EWQ A;  1BPN A;  3KR4 A;  3ETI A;  2VRI A;  3Q71 A;  4ZI6 A;  3GQE A;  5FSY A;  4ZX8 A;  1BPM A;  4GUA A;  3GPO A;  4ZY2 A;  3EWP A;  2AFC A;  3T8W A;  1NJR A;  2FG1 A;  5D8N A;  1LCP A;  2X47 A;  4R7M A;  3H8F A;  3IIF A;  3GPQ A;  5HOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...