4ABKA

Human parp14 (artd8, bal2) - macro domain 3 in complex with adenosine- 5-diphosphoribose
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
182
structure length
182
Chain Sequence
MFYGTVSSPDSGVYEMKIGSIIFQVASGDITKEEADVIVNSTSNSFNLKAGVSKAILECAGQNVERECSQQAQQRKNDYIITGGGFLRCKNIIHVIGGNDVKSSVSSVLQECEKKNYSSICLPAIGTGNAKQHPDKVAEAIIDAIEDFVQKGSAQSVKKVKVVIFLPQVLDVFYANMKKREG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Recognition of Mono-Adp-Ribosylated Artd10 Substrates by Artd8 Macrodomains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords POLY [ADP-RIBOSE] POLYMERASE 14
total genus 69
structure length 182
sequence length 182
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4abkA00
5FSXA 4J5SA 2EEEA 4TU0A 3Q6ZA 4IQYA 2FXKA 5HIHA 3H8GA 3EJFA 4J5RA 3SIJA 1TY8A 4ZY0A 3EWQA 2AFCA 4JGKA 5CB5A 4ZYQA 3PEIA 3ETIA 4JCAA 4ABLA 1LAPA 1NJRA 4JVVA 4K0CA 3EWRA 3GPOA 1ZR3A 2VRIA 3EWPA 2J9AA 2FAVA 4ABKA 2EWBA 5FSYA 4ETKA 5CB3A 1LANA 2L8RA 5FSVA 4ZX9A 4JLLA 5CMSA 3V45A 3JZTA 4R7MA 2DX6A 3JRUA 3EW5A 4ETJA 4R76A 3KR4A 3IIFA 1ZR5A 3SIGA 2ACFA 4K3NA 3KR5A 3KZWA 3IJ3A 3GPQA 4X2TA 5FSUA 5DUSA 4ZX8A 3VFQA 2LGRA 4UMLA 2X47A 4KSIA 3EJGA 3KQZA 4ZY2A 3GQEA 3KQXA 5E3BA 2BFRA 1SPVA 1VHUA 4ZY1A 1BPNA 1YD9A 3GQOA 3EKEA 4ESSA 3T8WA 1LAMA 5HOLA 2BFQA 4J5QA 1HJZA 4GUAA 3V2BA 3H8FA 1BPMA 4D86A 3SIIA 3H8EA 1GYTA 4GVWA 3SIHA 5CBMA 1LCPA 3EWOA 5AILA 3IIDA 5FSZA 4R6TA 1TXZA 3GPGA 5D8NA 2XD7A 4GVVA 4KYBA 4J4ZA 2FG1A 1BLLE 3Q71A 4ZI6A
chains in the Genus database with same CATH superfamily
5FSXA 4J5SA 2EEEA 4TU0A 3Q6ZA 4IQYA 2JZEA 2FXKA 5HIHA 3H8GA 3EJFA 4J5RA 3SIJA 1TY8A 4ZY0A 3EWQA 2AFCA 4JGKA 5CB5A 4ZYQA 3PEIA 3ETIA 4JCAA 4ABLA 1LAPA 1NJRA 4JVVA 4K0CA 3EWRA 3GPOA 1ZR3A 2VRIA 3EWPA 2J9AA 2FAVA 2JZFA 4ABKA 2EWBA 5FSYA 4ETKA 2JZDA 5CB3A 2RNKA 1LANA 2L8RA 5FSVA 4ZX9A 4JLLA 5CMSA 3V45A 3JZTA 2DX6A 4R7MA 3JRUA 3EW5A 4ETJA 4R76A 3KR4A 2KQVA 3IIFA 1ZR5A 3SIGA 2ACFA 4K3NA 3KR5A 3KZWA 2WCTA 3IJ3A 3GPQA 4X2TA 5FSUA 5DUSA 4ZX8A 3VFQA 2LGRA 4UMLA 2X47A 4KSIA 2W2GA 3EJGA 3KQZA 4ZY2A 3GQEA 3KQXA 5E3BA 2BFRA 1SPVA 1VHUA 4ZY1A 1BPNA 1YD9A 3GQOA 3EKEA 4ESSA 3T8WA 1LAMA 5HOLA 2BFQA 4J5QA 1HJZA 4GUAA 3V2BA 3H8FA 1BPMA 4D86A 3SIIA 3H8EA 1GYTA 4GVWA 3SIHA 5CBMA 1LCPA 3EWOA 5AILA 3IIDA 5FSZA 4R6TA 1TXZA 3GPGA 5D8NA 2XD7A 4GVVA 4KYBA 4J4ZA 2FG1A 1BLLE 3Q71A 4ZI6A
chains in the Genus database with same CATH topology
5FSXA 4J5SA 2EEEA 4TU0A 3Q6ZA 4IQYA 2FXKA 5HIHA 3H8GA 3EJFA 4J5RA 3SIJA 1TY8A 4ZY0A 3EWQA 2AFCA 4JGKA 5CB5A 4ZYQA 3PEIA 3ETIA 4JCAA 4ABLA 1LAPA 1NJRA 4JVVA 4K0CA 3EWRA 3GPOA 1ZR3A 2VRIA 3EWPA 2J9AA 2FAVA 4ABKA 2EWBA 5FSYA 4ETKA 5CB3A 1LANA 2L8RA 5FSVA 4ZX9A 4JLLA 5CMSA 3V45A 3JZTA 4R7MA 2DX6A 3JRUA 3EW5A 4ETJA 4R76A 3KR4A 3IIFA 1ZR5A 3SIGA 2ACFA 4K3NA 3KR5A 3KZWA 3IJ3A 3GPQA 4X2TA 5FSUA 5DUSA 4ZX8A 3VFQA 2LGRA 4UMLA 2X47A 4KSIA 3EJGA 3KQZA 4ZY2A 3GQEA 3KQXA 5E3BA 2BFRA 1SPVA 1VHUA 4ZY1A 1BPNA 1YD9A 3GQOA 3EKEA 4ESSA 3T8WA 1LAMA 5HOLA 2BFQA 4J5QA 1HJZA 4GUAA 3V2BA 3H8FA 1BPMA 4D86A 3SIIA 3H8EA 1GYTA 4GVWA 3SIHA 5CBMA 1LCPA 3EWOA 5AILA 3IIDA 5FSZA 4R6TA 1TXZA 3GPGA 5D8NA 2XD7A 4GVVA 4KYBA 4J4ZA 2FG1A 1BLLE 3Q71A 4ZI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FSX A;  4J5S A;  2EEE A;  4TU0 A;  3Q6Z A;  4IQY A;  2FXK A;  5HIH A;  3H8G A;  3EJF A;  4J5R A;  3SIJ A;  1TY8 A;  4ZY0 A;  3EWQ A;  2AFC A;  4JGK A;  5CB5 A;  4ZYQ A;  3PEI A;  3ETI A;  4JCA A;  4ABL A;  1LAP A;  1NJR A;  4JVV A;  4K0C A;  3EWR A;  3GPO A;  1ZR3 A;  2VRI A;  3EWP A;  2J9A A;  2FAV A;  4ABK A;  2EWB A;  5FSY A;  4ETK A;  5CB3 A;  1LAN A;  2L8R A;  5FSV A;  4ZX9 A;  4JLL A;  5CMS A;  3V45 A;  3JZT A;  4R7M A;  2DX6 A;  3JRU A;  3EW5 A;  4ETJ A;  4R76 A;  3KR4 A;  3IIF A;  1ZR5 A;  3SIG A;  2ACF A;  4K3N A;  3KR5 A;  3KZW A;  3IJ3 A;  3GPQ A;  4X2T A;  5FSU A;  5DUS A;  4ZX8 A;  3VFQ A;  2LGR A;  4UML A;  2X47 A;  4KSI A;  3EJG A;  3KQZ A;  4ZY2 A;  3GQE A;  3KQX A;  5E3B A;  2BFR A;  1SPV A;  1VHU A;  4ZY1 A;  1BPN A;  1YD9 A;  3GQO A;  3EKE A;  4ESS A;  3T8W A;  1LAM A;  5HOL A;  2BFQ A;  4J5Q A;  1HJZ A;  4GUA A;  3V2B A;  3H8F A;  1BPM A;  4D86 A;  3SII A;  3H8E A;  1GYT A;  4GVW A;  3SIH A;  5CBM A;  1LCP A;  3EWO A;  5AIL A;  3IID A;  5FSZ A;  4R6T A;  1TXZ A;  3GPG A;  5D8N A;  2XD7 A;  4GVV A;  4KYB A;  4J4Z A;  2FG1 A;  1BLL E;  3Q71 A;  4ZI6 A; 
#chains in the Genus database with same CATH topology
 5FSX A;  4J5S A;  2EEE A;  4TU0 A;  3Q6Z A;  4IQY A;  2JZE A;  2FXK A;  5HIH A;  3H8G A;  3EJF A;  4J5R A;  3SIJ A;  1TY8 A;  4ZY0 A;  3EWQ A;  2AFC A;  4JGK A;  5CB5 A;  4ZYQ A;  3PEI A;  3ETI A;  4JCA A;  4ABL A;  1LAP A;  1NJR A;  4JVV A;  4K0C A;  3EWR A;  3GPO A;  1ZR3 A;  2VRI A;  3EWP A;  2J9A A;  2FAV A;  2JZF A;  4ABK A;  2EWB A;  5FSY A;  4ETK A;  2JZD A;  5CB3 A;  2RNK A;  1LAN A;  2L8R A;  5FSV A;  4ZX9 A;  4JLL A;  5CMS A;  3V45 A;  3JZT A;  2DX6 A;  4R7M A;  3JRU A;  3EW5 A;  4ETJ A;  4R76 A;  3KR4 A;  2KQV A;  3IIF A;  1ZR5 A;  3SIG A;  2ACF A;  4K3N A;  3KR5 A;  3KZW A;  2WCT A;  3IJ3 A;  3GPQ A;  4X2T A;  5FSU A;  5DUS A;  4ZX8 A;  3VFQ A;  2LGR A;  4UML A;  2X47 A;  4KSI A;  2W2G A;  3EJG A;  3KQZ A;  4ZY2 A;  3GQE A;  3KQX A;  5E3B A;  2BFR A;  1SPV A;  1VHU A;  4ZY1 A;  1BPN A;  1YD9 A;  3GQO A;  3EKE A;  4ESS A;  3T8W A;  1LAM A;  5HOL A;  2BFQ A;  4J5Q A;  1HJZ A;  4GUA A;  3V2B A;  3H8F A;  1BPM A;  4D86 A;  3SII A;  3H8E A;  1GYT A;  4GVW A;  3SIH A;  5CBM A;  1LCP A;  3EWO A;  5AIL A;  3IID A;  5FSZ A;  4R6T A;  1TXZ A;  3GPG A;  5D8N A;  2XD7 A;  4GVV A;  4KYB A;  4J4Z A;  2FG1 A;  1BLL E;  3Q71 A;  4ZI6 A; 
#chains in the Genus database with same CATH homology
 5FSX A;  4J5S A;  2EEE A;  4TU0 A;  3Q6Z A;  4IQY A;  2FXK A;  5HIH A;  3H8G A;  3EJF A;  4J5R A;  3SIJ A;  1TY8 A;  4ZY0 A;  3EWQ A;  2AFC A;  4JGK A;  5CB5 A;  4ZYQ A;  3PEI A;  3ETI A;  4JCA A;  4ABL A;  1LAP A;  1NJR A;  4JVV A;  4K0C A;  3EWR A;  3GPO A;  1ZR3 A;  2VRI A;  3EWP A;  2J9A A;  2FAV A;  4ABK A;  2EWB A;  5FSY A;  4ETK A;  5CB3 A;  1LAN A;  2L8R A;  5FSV A;  4ZX9 A;  4JLL A;  5CMS A;  3V45 A;  3JZT A;  4R7M A;  2DX6 A;  3JRU A;  3EW5 A;  4ETJ A;  4R76 A;  3KR4 A;  3IIF A;  1ZR5 A;  3SIG A;  2ACF A;  4K3N A;  3KR5 A;  3KZW A;  3IJ3 A;  3GPQ A;  4X2T A;  5FSU A;  5DUS A;  4ZX8 A;  3VFQ A;  2LGR A;  4UML A;  2X47 A;  4KSI A;  3EJG A;  3KQZ A;  4ZY2 A;  3GQE A;  3KQX A;  5E3B A;  2BFR A;  1SPV A;  1VHU A;  4ZY1 A;  1BPN A;  1YD9 A;  3GQO A;  3EKE A;  4ESS A;  3T8W A;  1LAM A;  5HOL A;  2BFQ A;  4J5Q A;  1HJZ A;  4GUA A;  3V2B A;  3H8F A;  1BPM A;  4D86 A;  3SII A;  3H8E A;  1GYT A;  4GVW A;  3SIH A;  5CBM A;  1LCP A;  3EWO A;  5AIL A;  3IID A;  5FSZ A;  4R6T A;  1TXZ A;  3GPG A;  5D8N A;  2XD7 A;  4GVV A;  4KYB A;  4J4Z A;  2FG1 A;  1BLL E;  3Q71 A;  4ZI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...