4ABMA

Crystal structure of chmp4b hairpin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
79
structure length
79
Chain Sequence
GAMEQEAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTKNKRAALQALKRKKRYEKQLAQIDGTLSTIEFQREALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHARGED MULTIVESICULAR BODY PROTEIN 4B
publication title Cc2D1A is a Regulator of Escrt-III Chmp4B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 38
structure length 79
sequence length 79
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 4abmA00
3FAVA 2VRZA 3G80A 2B9ZA 3TXQA 4I0XB 4ABMA 3Q4HA 4GZRB 4LWSB 1WA8B 3ZBHA 3GVMA 2KG7B 2VS0A 3HR0A 2AZ2A 4I0XA 2AZ0A 1WA8A 4LWSA 3FAVB 3O9OA 2KG7A 3GWKC 3TXSA 2DE0X 3Q4HB 3OGIB 3FD9A
chains in the Genus database with same CATH superfamily
2CH7A 1F23A 3ETDA 3K58A 1VEWA 4GX1A 3OE7G 3CCEV 2W0FC 3CSXA 1AJPA 5IJ9B 1AJNA 2W6JG 3CC4V 3WG7B 2EINC 5JH7B 4JI8O 1AI7A 2WSSG 4GKJB 3ZHSA 1XQ8A 3CE2A 3AK3A 2XNDG 2YXYA 1S3JA 1IZ3A 3K0DA 4IYHA 3I55V 2UUCB 1Y4MA 1V54C 1FXKC 5CA1A 2WA4A 1R6TA 5KAFZ 2Q4PA 3ETEA 3ZS8C 1A32A 3UO3A 4IHJB 1WA8B 5KUKA 1N36O 2R72A 1RFYA 4CBCA 2MK3A 1TAEA 4QPJA 1KECA 4J7ZA 2F93B 2Q73A 2YSUB 4MVQA 4YJ2A 3WU2Z 1PNMA 2AXTZ 2YIDA 4JI6O 1AR4A 4X1KB 1OCCC 1ROPA 3TETA 2YS8A 5DM6V 3M99B 1WN7A 1BZKA 2QTOA 1WLEA 3JCZA 2H8PC 2QWNB 5GW7A 2EIKC 1VF7A 2M6YA 3X2QB 1JCHA 2X0LA 3KZIZ 3BVOA 3FB7C 1Q7YW 4IIJA 5LHGA 1GN6A 1JX9A 1QHTA 3CCMV 3D8CA 3APQA 2UXCO 3LDDA 2V4DA 1VQ6V 4DV3O 2JRIA 4A5UB 2GV9A 4TUYB 1T5EA 1ZX3A 3RYCA 2V7QG 4X64B 1PNLA 2EULA 5B1AB 2DYRB 3UT5A 1COWG 2LJ2A 1GTOA 4I5SA 1PL4A 5CN0A 4J10A 2UU9B 5EBWC 4LFBO 3CJHA 3SYQA 3ASOB 3JAWA 2VRZA 4E4EA 4JAAA 2A7WA 4PDVA 1PPJH 5EZYA 2JGDA 5ITZB 1FPOA 3UO2A 2IBZH 3RYIB 1S77D 3DTUB 4O4HB 2NR5A 5FL7G 1N32O 5KUMA 1XUQA 3G6EV 4CS3A 1WAZA 4FK5C 4P30A 2Q68A 3T1HB 4RUEA 4DW0A 4B3MB 4EEQA 2WLNA 1L1FA 3GWOA 3ZMTA 4MTXA 4WFEA 1BHAA 3E89A 5KHHA 1Q6IA 1NKDA 4JI8B 4TV8A 5KHJA 2QWRB 1FS0G 2Y69B 1YVWA 3E8BA 4XDKA 3K06A 3JD3A 3RBZA 1RSOA 1FFXB 4J11A 2A0LA 4I4TA 1JJ2U 2ITDC 5LP6A 4R50A 3I5DA 3SR2C 4NXMO 1KKDA 2Y48A 1YITV 3TXQA 1VQMV 3L9DA 1H2GA 2OCCC 3JALA 3KCYA 2YDEA 2ADPA 5D5PA 4I0XA 3BCCH 4ICGA 4JI0O 5KX5B 5BR8O 1N36B 3CD6V 4I50A 1UJWB 2CH7B 2HVKC 1VQNV 3N2GA 3IFXA 5KHKA 4J80A 4YXWG 1QCEA 4LC1A 3L74H 4LWSB 4JI6B 3A2FA 5JJEB 2Q8VA 1SC5B 2CGNA 4JI7O 5LGTA 1I0HA 4FLVA 2EBOA 4H33A 1SQGA 2W0XA 1WB7A 3OMIB 4PI2A 1ZTEA 1SESA 3H1IH 1Z5WA 4GZRB 3ZHUA 2CTWA 1OHHG 1GN3A 3WB0A 1SKVA 1M57B 1Y67A 4YJ2B 3D3IA 3ZEDA 2UXCB 2AW9A 4DV3B 4DK1A 2AHYA 3ABKC 2NN4A 3WG7C 1XILA 1JFFA 1PV0A 3W7SA 1YI2V 4B7KA 1QU7A 1LUVA 2F1MA 4JYCA 2ZNIA 4IYIA 1XEQA 1DGSA 5FNVB 2XT9A 3SYAA 2HKOA 4LP8A 4NTXA 4LF9O 4LFBB 2ZINA 4DR7O 2DOSA 1QR9A 1VP7A 2DE0X 5BZBA 2OT5A 4IIJB 2IJHA 5EBLC 4BIZA 1H38A 1NI8A 2UUAO 3JCUZ 2N04A 2EJRA 3FFQA 5BMVB 3ABLC 1M4UA 2D3OW 2Q6AA 4X20A 1K33A 5K1XA 2F95B 3G6BA 3IC9A 4ZBMA 2FKXA 4FLTA 1KC8W 3UT5B 4JYAO 2LGQA 1GN4A 3C90A 4WFGA 2AHZA 1QBZA 3DXRA 4MTFA 4WF9V 3ZHRA 1Q81W 1HNZO 1AI6A 5HFMA 4DR2O 3CRRA 1D5NA 1S5JA 4I55A 3X2QC 3JAWB 3TCUA 5EZYB 1K34A 2JGDB 1SQBH 2Y4UA 2MW2B 4JZ2A 1JJOA 4HNAB 4NXMB 1E79G 3ZMZA 5CBGA 4JAVA 4G27B 2OTLV 3OTFA 4JI3B 1SF9A 3SPJA 3CRMA 3FB5C 3K9AA 5IJ9A 1F4MA 4JI0B 5BR8B 3O9OA 5JCOA 5JH7A 4W4KA 2EIMC 2DYRC 2E75B 2WA3A 5LHHA 1VMGA 2QGNA 4MTOA 5LXTB 2ARHA 3KCXA 5B1NA 4CC5A 5CBHA 3T1YO 4DV6O 2E3CA 3HR0A 3A0BZ 5GONB 1RM1C 5J9PC 4EB6A 4UVBA 1RSOB 4IHJA 1AI5A 2Q7EA 1HP8A 5LP6B 1US6A 3CHXA 2P67A 2HFEC 2WWWA 4JI7B 3P3NA 5FLXN 3OEHG 1EFRG 3FD9A 3SJCC 4LF8O 3JALB 1ZAUA 3P30A 2B9ZA 1IBMO 2QWQB 1GN2A 4FLYA 4FJCC 4MVSA 2DJVA 1GK9A 1Q6HA 4R8CA 4GKJO 1ENVA 2PTMA 3E35A 2KSDA 3FAVB 2FTKA 3HKBB 3LDEA 1SZTA 4UFZA 4LFAO 1V55B 2UXBB 4DO2A 3L71H 3CCUV 3BY6A 1KQSU 2ATKC 2YXLA 1YSCA 1M9NA 3G4SV 1KP3A 2DQ0A 2R70A 4C7UA 3ZHQA 5KA6A 1NS1A 4LF9B 3OR7C 4DR7B 5LGUA 3W7XA 2VQFO 3W7WA 1I94B 2ZCEA 2K9PA 4P9PA 3BAAA 2OIGA 4TUYA 3OAAG 2UUAB 4WFBV 2OYQA 5B3SB 2IW5A 1WJZA 4CC6A 1QNMA 3U11A 1FJGO 2LP7A 1ZSPA 4GYCB 3RWRD 2GDSA 3M7MX 2DWEC 5TISZ 1MG1A 4JAUA 4GX5A 4JYAB 3N27A 5L3DA 4DV7O 4DR6O 1H2MA 3ETQA 4FLUA 4JV5O 4RWUA 1PNKA 4DK0A 2PF4E 3L73H 3RYIA 4DUZO 4DR2B 4O4HA 1AR5A 4G2KA 1FKAO 4J9ZB 1GMGA 1FFTB 4FZ0A 3FYEB 3H1KH 4LH7A 2ITCC 1XNRO 2Z5UA 3AG4B 4JASA 4UVCA 1QLEC 3AK2A 2V1DA 4ZHQA 4F6RA 1QVFU 4JI1O 1FXVA 3WB1A 4LCUC 1YIJV 1JVMA 3DXRB 1CPYA 3QTCA 1BL8A 2C2AA 1SZXA 1HWYA 4PDLA 4I55B 3CCVV 3CRCA 4JI4O 1TUEB 2JIZG 3OEEG 3T1YB 4DV6B 1BSMA 1K3EA 5KA5A 1L0NH 4QNHB 5EBMC 5C8YB 5JWPA 3PN1A 1NJIW 4G28B 4JYYA 1I08A 4LF8B 2BE3A 4QE9A 1IBMB 3K5LA 1SS3A 1PL0A 2RMKB 2Z0AA 4EFEA 3ASNB 2CK3G 4LWSA 3SPGA 1NR7A 1BMFG 2EILB 1G4YB 5IY5B 1XHXA 3CS5A 3JD1A 1VQ4V 3WB2A 3K03A 1X4TA 4LFAB 4ABMA 3FB8C 1SA0B 1K97A 2WLJA 2ZDIA 4EB6B 3F7YC 3OW2U 2DMXA 4O4LA 5JQGB 1M56B 2RDCA 1NBMG 2XAFA 2ZR2A 3GWKC 2QM4A 1WNSA 4PI0A 2P06A 3DGEA 3QO8A 4ZOLA 2M7WA 4FFKA 3HPLC 3E8FA 2VQFB 2EZOA 4KL1A 2KKWA 3K59A 1WP8A 1MSWD 4K8ZA 4UXNA 5DECA 4O2BB 3GB7C 2QM8A 4X1YA 2CDYA 1W59A 1FJGB 5FNVA 3SPHA 2LFRA 1E1QG 4N23A 4DYLA 3RYFA 1GAXA 3ZMVA 3CXHF 3ZRXA 3OTOB 1GO3F 4DV7B 3HKDA 4DR6B 5LP6C 5J2TB 2YIAA 4DR5O 5BMVA 3K79A 4JV5B 2R9RB 4TV9B 2A3QA 4DUZB 1GM9A 2CUGA 1BQZA 3CXCU 2Q5ZA 1BHBA 4UCVA 3OT7A 4BR6A 4MS2A 3B40A 2IH1C 1XNRB 2PI4A 4YJ3A 3QO7A 2P90A 3H1LH 4LNUB 1N4CA 3M8AA 4QGPA 2QR4A 2P5OA 5KHIA 3PJSK 4J42A 5LYJB 2BTQB 4JI1B 1SQPH 5K1PA 1IDSA 1W0JG 3Q4HB 2IM9A 4OGQB 2DWDC 3AG3B 3SYOA 1ORQC 5IJ0B 3U0ZA 3K57A 1NH2B 3B8NA 3QVNA 3QNEA 1DTOA 1Q82W 4Q6GA 2PY5A 4JI4B 4HNAA 2VQEO 1IVSA 4NB5A 3ZHVA 1S0VA 4MW8A 5B1BB 2AGAA 5IE9A 3RVZA 3G67A 3SYCA 5L3CA 1VIBA 5BY1A 4ZHQB 4F6RB 3D3QA 2L35A 1SQFA 1EN5A 1VF5B 3JD2A 5LXTA 3JARB 1NVPB 1NTZH 3AG2B 4PDMA 1YEWA 4GT1A 3HKCA 3ZHTA 1NZ6A 3CCQV 3F5TA 1KD1W 2X6AA 2JVDA 2HG5C 1E1RG 5GONA 1N34B 3ZRWA 1EZJA 1R6NA 2F4VO 2WPDG 4DV5O 1HR0O 3IGAC 4J7KA 4JI3O 1P84F 5LMUO 4ZIBA 4KP4A 5LA6A 3E86A 2UXXA 1YCIA 2H94A 5H9CA 4O4JA 4B08A 3AG4C 2A06H 3FAVA 4X62O 3ABUA 4H44B 4Z1VA 2JJ1G 3HKBA 4FFBA 5BXZA 4J7JA 1GM8A 4RO2A 1XDCA 5EYPA 3K08A 1H8EG 3EFFK 1URFA 4FZ1A 1S5HC 1NTMH 2ZXWB 1BT8A 2X6BA 1HW7A 3R65A 2Q0OC 1WPBA 4IGGA 3E2EA 2EJ7A 5LHIA 3CPWU 4DV0O 2WLKA 2FL4A 4O4LB 3RVYA 4MVOA 1YJNV 1VQLV 3APOA 2D2CB 3E22A 3OFNG 4WCEV 2JDIG 4BW9A 4ZOLB 4OX9O 4DR5B 2P22C 2JJ2G 2CE4A 3U10A 5E79Z 1DF5A 4YIOA 2UXBO 3TJTA 3EHBB 4TSFG 5JCOC 4PDRA 4TQFA 2XAHA 2WLIB 2VS0A 2AZ2A 4X1YB 3RGBA 2LW1A 4PELA 1ZUQA 3CCRV 3O65A 4P2ZA 3P3PA 3ETGA 3RYFB 1D2DA 1THZA 2HLDG 3AG1B 4R6ZA 3D36A 2ZE7A 1VQPV 1W2BU 1I94O 2LO1A 5F2VO 4DW1A 3HKDB 1OCRB 1MA1A 4BIUA 2R9IA 5KMGB 5IYZA 4MVMA 1UPGA 1MOFA 1M56C 3CRQA 1N33O 4CH5A 1EM1A 4TQDA 2E5LO 2XOKG 4LF4O 2VQEB 4NR1A 2R9AA 4JI2O 1R1BA 3OMAB 4PA6A 5CB4A 2GUZA 4YJ3B 4WFFA 4PA3A 1PM9A 3SPCA 2ODMA 3NXSA 4GX2A 1B6QA 3VQXA 4WBNA 1K7DA 2BOBC 1V9PA 2E76B 1F51A 3MDSA 5AG2A 1WB8A 4Q20A 3A0HZ 5A9GA 2ETNA 1K9MW 1V54B 1R6KA 5C8YA 2UXDO 1BS3A 2F4VB 4DV5B 1WPXA 1Y6XA 4B7EA 1HR0B 1K8AW 1AVMA 3CWBH 4X66O 1YTFB 2QWOB 2NLJC 1Y66A 5LMUB 1BQ0A 1KP2A 3C3TA 3LNMB 4HBNA 4DV2O 2VWJA 5LOVB 3WFVA 4NYKA 4MVRA 1CEZA 5B1AC 1XBLA 3CCLV 1CP9A 3JASA 1R73A 4X62B 3A0RA 1IURA 2ZQMA 3JD4A 3HKCB 2QDOA 4J41A 1I5YA 4GCZA 3FYIB 1SA0A 3ASOC 1SQXH 3ZRWB 3KG2A 1IX9A 2Y0PA 4JTCB 1XHZA 3AG3C 5JQGA 4XBFA 3FB6C 5CMUA 4O4IA 1KUQA 4BWAA 2GHYA 4RUFA 3UCSC 4TT3G 3SJQC 2KQXA 4GKKO 4DV0B 1SQQH 5CA0A 2E74B 1H8HG 1M93A 5LA6B 2WLLA 1NVPD 1VQKV 3B2EE 1G8MA 4O4JB 4O2BA 4XDLA 4OX9B 1RP3B 1K92A 4FFBB 5EYPB 1ZWIC 3AG2C 2F43G 1XMOO 1U97A 2Y69C 1IBKO 4CZZA 1KB9F 4FM1A 2ZE8A 4W4LA 3STZC 1YJ9V 3JSNA 2EX3A 5J2TA 4B3SO 2RJZA 4AHCA 4MVUA 4ZI7A 4TV9A 5DEDA 4E2LA 3E22B 4DRXB 1FXHA 2LFSA 2ZNJA 1AILA 4K35A 3G71V 4PA4A 1F7YA 2P7TC 4U3JB 1YZBA 1QR8A 1VF6A 3IJ4A 1N33B 1B04A 4EFBA 1Q3EA 1NTKH 1P49A 3JYCA 4PJ0Z 2E5LB 4LNUA 4JZGA 4LF4B 4JI2B 1TVKB 1AP6A 5LYJA 1WP7A 2ZR3A 3UQ8A 2BTQA 2YIBA 1JQ0A 3G80A 3OMNB 4UVAA 4IL6Z 1B3QA 3Q4HA 4CS2A 2RQ6A 3SPIA 5IWAO 3OTOO 1HNXO 4QIWF 1H2SB 3SYPA 1W0KG 2KG7B 2BOCC 1SQVH 4RAIA 2Y0IA 4FM2A 5IJ0A 3H1HH 3W7TA 2ZDIC 2BCCH 4JYBA 2QA4V 2Q67A 3FX7A 3CX5F 3QO5A 3ICXA 5IYZB 2VWKA 5A2QN 1NR1A 1Q5OA 4X65O 3RW0A 2UUBO 2K1EA 2EZPA 1R3IC 1M57C 4YHHO 2UXDB 3ZRVA 4JGSA 3IAYA 2YI8A 4OXSA 1TA8A 1MABG 1R3KC 2B5UA 2QE7G 5LGNA 5B66Z 2Q0AA 2YUAA 4X66B 3TK1A 4DR1O 5CB4B 2GUZB 3CMEV 3E8HA 4DV2B 3JARA 4I7ZB 4DR4O 1MMMA 2Q9LA 4FLZA 4JI5O 4QE7A 4WBNB 2H3OA 3SGIA 3OUFA 4NKGB 4X1IA 1DLBA 1X59A 2F23A 3ZMSA 4YY3O 4HZ3A 4IT5A 3AG1C 3K0GA 3H01A 1XI1A 2YC0A 3THOA 4WFAV 1DF4A 1K73W 3DC5A 2ZM6O 1TUBA 1OCOB 2RNBA 4JF3A 4KFMA 5LMNO 2CTQA 5L3BA 3T4ZA 3TGUH 3CYOA 1VQ9V 1IXBA 1MZEA 4GUNA 4XDJA 2JK5C 5D5QA 4GKKB 4EKWA 4DV4O 4D6TH 5EK0A 1N34O 2CAZC 2GTSA 4RQFA 3QF7A 3BEHA 3JASB 4JTAB 4O2AA 2KB1A 5J2UB 1KMIZ 1RPRA 3ABKB 2QEXV 2WAMA 2LW7A 3OR6C 4LBEC 4B3TO 1XMOB 4LR3A 1YTFD 1KBHA 1IBKB 4KUMA 3L75H 2ZE6A 2LGWA 4O4IB 1K5SA 4HAMA 2ILMA 4ZKIA 5LBQA 4B3SB 4TWKA 5CA0B 5IT9N 3ABTA 2WLLB 1P7GA 2Q69A 4PHZA 5JVDA 2A79B 3UKMA 4K3AA 4LF5B 4WFHA 4DR3B 3ABLB 4K0KO 5L3EA 3UM7A 2WLIA 3OM3B 2HP8A 4U3FH 3ABMB 3LSQA 3ZRSA 1VQ7V 1FAFA 3ZN1A 3JAMN 5KLVH 1M90W 4Z1MG 1R3JC 4FM0A 2FYUH 2IH3C 2JS5A 1FYJA 5IWAB 1HNXB 3L70H 4AILC 2IU3A 5KMGA 1MSDA 3HKEB 1SERA 2PYLA 4ZI7B 2ZT9B 3LSUA 4UCOA 2WLHA 3JATB 5CA3A 4X9QA 3E83A 1OZ0A 3RFRA 2PZSA 4LF6O 4DV1O 4CH3A 4X65B 3BHPA 2UUBB 3S3WA 4YHHB 2AZ0A 2IJKA 3LDCA 5H6RA 2XTAA 2P6JA 1Q90D 2HJDA 2PUSA 3K5NA 4DR1B 2L6LA 1JOYA 1V55C 5C93A 2Z3YA 2YXHA 3KKYA 3SJBC 4DR4B 1AP5A 1Y76B 2EIMB 3B77A 1JA8A 3P32A 3JAKB 1G1XB 3K9SA 2JS3A 4JI5B 2ZIOA 1FXKA 1UFIA 2XAJA 2YI9A 1OCZB 3OUSA 1EN4A 3VQVA 3K04A 4YY3B 3RYHB 1RM1B 1K4DC 2YEVA 4PV1B 3HB3B 5H6QA 1EN6A 3ML0A 1Z2GA 2ZM6B 5LOVA 4R7CA 1ZL8B 5B3SC 3CP1A 3CCJV 5LMNB 4JTDB 2BTOA 3ZBHA 1BCCH 4MSWC 3K3WA 4D7TA 3N2KB 1N0NA 1J5EO 1NQTA 3MHSC 3JSLA 4DV4B 2EIJB 4FMTA 2QSAA 1OJHA 4OPAA 1LUWA 3BFRA 4PA7A 5B5EZ 4X88A 4H13B 4X1IB 4KHPO 4HYOA 4FPPA 2JEUA 2DYSB 3D36C 2JGUA 2XHBA 4B3TB 1TUBB 1J95A 1XL4A 3OGCC 1Q8IA 3VBBA 4H37A 3VQWA 5FPRA 3SDLA 4X89A 4DUYO 1IBLO 3CEIA 2DW4A 3DSQA 5GTIZ 4F6EA 3JD0A 1HNWO 3B4SA 1TGOA 5H5NA 4O2AB 2QKCA 2X7RB 4K0KB 4NTYA 3SJAC 4UB8Z 3BABA 5IYDO 1AR1B 4FLXA 2BSKA 4CH4A 2OCHA 4UCSA 2DN9A 4B3RO 2IU0A 4NVPA 4N21A 1LR1A 3FKSG 1SRYA 2NNUA 1XMQO 3ZN0A 5KAIZ 3EVKA 4DRXA 2OTJV 4L87A 5CA1B 3LSSA 1YF2A 1YXBA 1OCOC 4I9QA 4U3JA 1S76D 3R66A 3OGIB 1M5IA 1AI4A 1NT2B 3BRCA 5JVDB 2CGOA 3C3SA 4BAYA 1Y74A 1TVKA 3ASNC 3RN4A 4LF6B 4DV1B 1N0JA 4FLWA 1Q43A 1GRJA 1N8RW 4I9WA 2EILC 1VQOV 1QLEB 3J80N 5JJNB 5IY5C 2KG7A 2GBOA 1VQ8V 2ADQB 1M1KW 2Q7HA 4TOIA 1Q6UA 4AQYO 2XAGA 3EXAA 4K8XA 4BW5A 1YHQV 1P7BA 3MD0A 2HEPA 4NXNO 1H2LA 1K4CC 3BA8A 4CH6A 5CBFA 4PA9A 4LFCO 5B1OA 2HJFC 4F4LA 2GTAA 1VQ5V 2IJIA 2PGGA 1L0LH 5HFLA 3ZX6A 1AROP 1QVGU 1YJWV 1JPXA 3H1JH 3W7UA 1MZFA 1N32B 4MW3A 2EINB 3RYCB 1J5EB 1AB3A 3ABMC 3CC2V 4QPKA 3IC7A 4D7SA 4FVMA 3TXSA 3A8TA 1D5AA 4YIPA 3RT3C 2Q7GA 2HHHO 4U7OA 1XNQO 2WLMA 3AEIA 1FXKB 3B09A 3LUTB 4KHPB 3CJHB 3VOUA 3MAQA 2B1IA 2FMLA 1Q86W 2YEVB 1O9GA 1OV9A 1NU1H 3STLC 2YIBD 4LF7O 3DC6A 3ZMUA 1QQCA 5IYBO 5IYCO 1I5XA 1VF6C 2XASA 2QJ1A 3CC7V 2FB5A 1PD3A 1LNQA 3LNNA 2PI5A 2LQTA 2GSMB 1NH2D 2IJJA 2RN9A 2HVJC 5J2UA 1K5QA 4DUYB 1IBLB 1KU9A 1FD9A 1JR9A 1OCCB 4UCTA 3B8MA 4U7NA 1HNWB 1ZLZA 2QTSA 4UV9A 3BA9A 1DK1A 3CCSV 3T1CA 4UUJC 1O9HA 2EIKB 2UXNA 3K5OA 5JJJB 1U96A 4TV8B 2CTRA 2A9HA 4L8JA 4RQEA 1OCZC 3S3XA 4UV8A 4B3RB 2QWPB 2CTPA 5EIBD 4OPHA 2P4VA 1WA8A 4MT8A 5B1BC 1XMQB 4I4TB 3NR7A 2XUMA 2G38A 3E8GA 2ZKOA 3T4DA 4I0XB 5EIBC 4LH6A 4CS4A 4I50B 2EIJC 2X6CA 5GTHZ 1PKXA 3N2GB 1BE3H 4X1KA 5DN6G 2PYJA 2UUCO 2BSKB 5E1AC 3CRAA 1YDXA 1KKCA 4J9YB 3HKEA 2DYSC 4QJFB 2HR3A 4AQYB 1KYOF 3JATA 2W6IG 4LF5O 1EZVH 4DR3O 4NXNB 2N05A 4MVZA 3L72H 4FIPC 4PD4F 2QM7A 4LFCB 3T2MA 3OD4A 3F5WC 1Y74B 4X8AA 2N74A 2RCVA 4BIOA 1Z5VA 3BPZA 3ZIAG 1XREA 5L3GA 5KHGA 1S72V 2OWOA 4DXWA 1Y76A 4UB6Z 1R3LC 2ZXWC 2O57A 3JAKA 1GM7A 3F7VC 2F66C 2JEXA 1JFFB 3MHHC 1B06A 5L3FA 4JPRA 3RYHA 5IDJA 4KXRA 3AK1A 1VARA 1S5LZ 2B1GA 2HHHB 1CXZB 1IXMA 1F4NA 2DQ3A 1XNQB 1G6UA 1EBOA 1L8DA 5EC2C 1XL6A 1ZL8A 5ITZA 1GKFA 2ZIMA 1HNZB 2OCCB 3I56V 1XOUA 1P4RA 3H9VA 2OIEA 3N2KA 5LL6Y 4UCRA 4X64O 1RPOA 4UCUA 4LF7B 4ASUG 5H2FZ 3K5MA 2QKSA 3CB2A 1H2NA 3QG5A 4X20B 3VQYA 4MTGA 1GH6A 5EC1C 2UU9O 1PP9H 2ZD9A 3CMAV 4P9OA 2P4KA 3ZJZA 1AJQA 1H2KA 3J81N 3J7AU 1SETA 2XAQA 2Y4TA 1HDJA 1OCRC 1I7FA 2ZE5A 4NTWA 5FPOA 4AI8A 1FFXA 2YICA 3GVMA 2QKAA 1MNGA 1JMKC 3ZCCA 4H0LB 1BGYH 1QLNA 3T1HO 4B3MO 5KX5A 3AG7A 4Z2WA 4GX0A 4GLXA
chains in the Genus database with same CATH topology
3FAVA 2VRZA 3G80A 2B9ZA 3TXQA 4I0XB 4ABMA 3Q4HA 4GZRB 4LWSB 1WA8B 3ZBHA 3GVMA 2KG7B 2VS0A 3HR0A 2AZ2A 4I0XA 2AZ0A 1WA8A 4LWSA 3FAVB 3O9OA 2KG7A 3GWKC 3TXSA 2DE0X 3Q4HB 3OGIB 3FD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FAV A;  2VRZ A;  3G80 A;  2B9Z A;  3TXQ A;  4I0X B;  4ABM A;  3Q4H A;  4GZR B;  4LWS B;  1WA8 B;  3ZBH A;  3GVM A;  2KG7 B;  2VS0 A;  3HR0 A;  2AZ2 A;  4I0X A;  2AZ0 A;  1WA8 A;  4LWS A;  3FAV B;  3O9O A;  2KG7 A;  3GWK C;  3TXS A;  2DE0 X;  3Q4H B;  3OGI B;  3FD9 A; 
#chains in the Genus database with same CATH topology
 2CH7 A;  1F23 A;  3ETD A;  3K58 A;  1VEW A;  4GX1 A;  3OE7 G;  3CCE V;  2W0F C;  3CSX A;  1AJP A;  5IJ9 B;  1AJN A;  2W6J G;  3CC4 V;  3WG7 B;  2EIN C;  5JH7 B;  4JI8 O;  1AI7 A;  2WSS G;  4GKJ B;  3ZHS A;  1XQ8 A;  3CE2 A;  3AK3 A;  2XND G;  2YXY A;  1S3J A;  1IZ3 A;  3K0D A;  4IYH A;  3I55 V;  2UUC B;  1Y4M A;  1V54 C;  1FXK C;  5CA1 A;  2WA4 A;  1R6T A;  5KAF Z;  2Q4P A;  3ETE A;  3ZS8 C;  1A32 A;  3UO3 A;  4IHJ B;  1WA8 B;  5KUK A;  1N36 O;  2R72 A;  1RFY A;  4CBC A;  2MK3 A;  1TAE A;  4QPJ A;  1KEC A;  4J7Z A;  2F93 B;  2Q73 A;  2YSU B;  4MVQ A;  4YJ2 A;  3WU2 Z;  1PNM A;  2AXT Z;  2YID A;  4JI6 O;  1AR4 A;  4X1K B;  1OCC C;  1ROP A;  3TET A;  2YS8 A;  5DM6 V;  3M99 B;  1WN7 A;  1BZK A;  2QTO A;  1WLE A;  3JCZ A;  2H8P C;  2QWN B;  5GW7 A;  2EIK C;  1VF7 A;  2M6Y A;  3X2Q B;  1JCH A;  2X0L A;  3KZI Z;  3BVO A;  3FB7 C;  1Q7Y W;  4IIJ A;  5LHG A;  1GN6 A;  1JX9 A;  1QHT A;  3CCM V;  3D8C A;  3APQ A;  2UXC O;  3LDD A;  2V4D A;  1VQ6 V;  4DV3 O;  2JRI A;  4A5U B;  2GV9 A;  4TUY B;  1T5E A;  1ZX3 A;  3RYC A;  2V7Q G;  4X64 B;  1PNL A;  2EUL A;  5B1A B;  2DYR B;  3UT5 A;  1COW G;  2LJ2 A;  1GTO A;  4I5S A;  1PL4 A;  5CN0 A;  4J10 A;  2UU9 B;  5EBW C;  4LFB O;  3CJH A;  3SYQ A;  3ASO B;  3JAW A;  2VRZ A;  4E4E A;  4JAA A;  2A7W A;  4PDV A;  1PPJ H;  5EZY A;  2JGD A;  5ITZ B;  1FPO A;  3UO2 A;  2IBZ H;  3RYI B;  1S77 D;  3DTU B;  4O4H B;  2NR5 A;  5FL7 G;  1N32 O;  5KUM A;  1XUQ A;  3G6E V;  4CS3 A;  1WAZ A;  4FK5 C;  4P30 A;  2Q68 A;  3T1H B;  4RUE A;  4DW0 A;  4B3M B;  4EEQ A;  2WLN A;  1L1F A;  3GWO A;  3ZMT A;  4MTX A;  4WFE A;  1BHA A;  3E89 A;  5KHH A;  1Q6I A;  1NKD A;  4JI8 B;  4TV8 A;  5KHJ A;  2QWR B;  1FS0 G;  2Y69 B;  1YVW A;  3E8B A;  4XDK A;  3K06 A;  3JD3 A;  3RBZ A;  1RSO A;  1FFX B;  4J11 A;  2A0L A;  4I4T A;  1JJ2 U;  2ITD C;  5LP6 A;  4R50 A;  3I5D A;  3SR2 C;  4NXM O;  1KKD A;  2Y48 A;  1YIT V;  3TXQ A;  1VQM V;  3L9D A;  1H2G A;  2OCC C;  3JAL A;  3KCY A;  2YDE A;  2ADP A;  5D5P A;  4I0X A;  3BCC H;  4ICG A;  4JI0 O;  5KX5 B;  5BR8 O;  1N36 B;  3CD6 V;  4I50 A;  1UJW B;  2CH7 B;  2HVK C;  1VQN V;  3N2G A;  3IFX A;  5KHK A;  4J80 A;  4YXW G;  1QCE A;  4LC1 A;  3L74 H;  4LWS B;  4JI6 B;  3A2F A;  5JJE B;  2Q8V A;  1SC5 B;  2CGN A;  4JI7 O;  5LGT A;  1I0H A;  4FLV A;  2EBO A;  4H33 A;  1SQG A;  2W0X A;  1WB7 A;  3OMI B;  4PI2 A;  1ZTE A;  1SES A;  3H1I H;  1Z5W A;  4GZR B;  3ZHU A;  2CTW A;  1OHH G;  1GN3 A;  3WB0 A;  1SKV A;  1M57 B;  1Y67 A;  4YJ2 B;  3D3I A;  3ZED A;  2UXC B;  2AW9 A;  4DV3 B;  4DK1 A;  2AHY A;  3ABK C;  2NN4 A;  3WG7 C;  1XIL A;  1JFF A;  1PV0 A;  3W7S A;  1YI2 V;  4B7K A;  1QU7 A;  1LUV A;  2F1M A;  4JYC A;  2ZNI A;  4IYI A;  1XEQ A;  1DGS A;  5FNV B;  2XT9 A;  3SYA A;  2HKO A;  4LP8 A;  4NTX A;  4LF9 O;  4LFB B;  2ZIN A;  4DR7 O;  2DOS A;  1QR9 A;  1VP7 A;  2DE0 X;  5BZB A;  2OT5 A;  4IIJ B;  2IJH A;  5EBL C;  4BIZ A;  1H38 A;  1NI8 A;  2UUA O;  3JCU Z;  2N04 A;  2EJR A;  3FFQ A;  5BMV B;  3ABL C;  1M4U A;  2D3O W;  2Q6A A;  4X20 A;  1K33 A;  5K1X A;  2F95 B;  3G6B A;  3IC9 A;  4ZBM A;  2FKX A;  4FLT A;  1KC8 W;  3UT5 B;  4JYA O;  2LGQ A;  1GN4 A;  3C90 A;  4WFG A;  2AHZ A;  1QBZ A;  3DXR A;  4MTF A;  4WF9 V;  3ZHR A;  1Q81 W;  1HNZ O;  1AI6 A;  5HFM A;  4DR2 O;  3CRR A;  1D5N A;  1S5J A;  4I55 A;  3X2Q C;  3JAW B;  3TCU A;  5EZY B;  1K34 A;  2JGD B;  1SQB H;  2Y4U A;  2MW2 B;  4JZ2 A;  1JJO A;  4HNA B;  4NXM B;  1E79 G;  3ZMZ A;  5CBG A;  4JAV A;  4G27 B;  2OTL V;  3OTF A;  4JI3 B;  1SF9 A;  3SPJ A;  3CRM A;  3FB5 C;  3K9A A;  5IJ9 A;  1F4M A;  4JI0 B;  5BR8 B;  3O9O A;  5JCO A;  5JH7 A;  4W4K A;  2EIM C;  2DYR C;  2E75 B;  2WA3 A;  5LHH A;  1VMG A;  2QGN A;  4MTO A;  5LXT B;  2ARH A;  3KCX A;  5B1N A;  4CC5 A;  5CBH A;  3T1Y O;  4DV6 O;  2E3C A;  3HR0 A;  3A0B Z;  5GON B;  1RM1 C;  5J9P C;  4EB6 A;  4UVB A;  1RSO B;  4IHJ A;  1AI5 A;  2Q7E A;  1HP8 A;  5LP6 B;  1US6 A;  3CHX A;  2P67 A;  2HFE C;  2WWW A;  4JI7 B;  3P3N A;  5FLX N;  3OEH G;  1EFR G;  3FD9 A;  3SJC C;  4LF8 O;  3JAL B;  1ZAU A;  3P30 A;  2B9Z A;  1IBM O;  2QWQ B;  1GN2 A;  4FLY A;  4FJC C;  4MVS A;  2DJV A;  1GK9 A;  1Q6H A;  4R8C A;  4GKJ O;  1ENV A;  2PTM A;  3E35 A;  2KSD A;  3FAV B;  2FTK A;  3HKB B;  3LDE A;  1SZT A;  4UFZ A;  4LFA O;  1V55 B;  2UXB B;  4DO2 A;  3L71 H;  3CCU V;  3BY6 A;  1KQS U;  2ATK C;  2YXL A;  1YSC A;  1M9N A;  3G4S V;  1KP3 A;  2DQ0 A;  2R70 A;  4C7U A;  3ZHQ A;  5KA6 A;  1NS1 A;  4LF9 B;  3OR7 C;  4DR7 B;  5LGU A;  3W7X A;  2VQF O;  3W7W A;  1I94 B;  2ZCE A;  2K9P A;  4P9P A;  3BAA A;  2OIG A;  4TUY A;  3OAA G;  2UUA B;  4WFB V;  2OYQ A;  5B3S B;  2IW5 A;  1WJZ A;  4CC6 A;  1QNM A;  3U11 A;  1FJG O;  2LP7 A;  1ZSP A;  4GYC B;  3RWR D;  2GDS A;  3M7M X;  2DWE C;  5TIS Z;  1MG1 A;  4JAU A;  4GX5 A;  4JYA B;  3N27 A;  5L3D A;  4DV7 O;  4DR6 O;  1H2M A;  3ETQ A;  4FLU A;  4JV5 O;  4RWU A;  1PNK A;  4DK0 A;  2PF4 E;  3L73 H;  3RYI A;  4DUZ O;  4DR2 B;  4O4H A;  1AR5 A;  4G2K A;  1FKA O;  4J9Z B;  1GMG A;  1FFT B;  4FZ0 A;  3FYE B;  3H1K H;  4LH7 A;  2ITC C;  1XNR O;  2Z5U A;  3AG4 B;  4JAS A;  4UVC A;  1QLE C;  3AK2 A;  2V1D A;  4ZHQ A;  4F6R A;  1QVF U;  4JI1 O;  1FXV A;  3WB1 A;  4LCU C;  1YIJ V;  1JVM A;  3DXR B;  1CPY A;  3QTC A;  1BL8 A;  2C2A A;  1SZX A;  1HWY A;  4PDL A;  4I55 B;  3CCV V;  3CRC A;  4JI4 O;  1TUE B;  2JIZ G;  3OEE G;  3T1Y B;  4DV6 B;  1BSM A;  1K3E A;  5KA5 A;  1L0N H;  4QNH B;  5EBM C;  5C8Y B;  5JWP A;  3PN1 A;  1NJI W;  4G28 B;  4JYY A;  1I08 A;  4LF8 B;  2BE3 A;  4QE9 A;  1IBM B;  3K5L A;  1SS3 A;  1PL0 A;  2RMK B;  2Z0A A;  4EFE A;  3ASN B;  2CK3 G;  4LWS A;  3SPG A;  1NR7 A;  1BMF G;  2EIL B;  1G4Y B;  5IY5 B;  1XHX A;  3CS5 A;  3JD1 A;  1VQ4 V;  3WB2 A;  3K03 A;  1X4T A;  4LFA B;  4ABM A;  3FB8 C;  1SA0 B;  1K97 A;  2WLJ A;  2ZDI A;  4EB6 B;  3F7Y C;  3OW2 U;  2DMX A;  4O4L A;  5JQG B;  1M56 B;  2RDC A;  1NBM G;  2XAF A;  2ZR2 A;  3GWK C;  2QM4 A;  1WNS A;  4PI0 A;  2P06 A;  3DGE A;  3QO8 A;  4ZOL A;  2M7W A;  4FFK A;  3HPL C;  3E8F A;  2VQF B;  2EZO A;  4KL1 A;  2KKW A;  3K59 A;  1WP8 A;  1MSW D;  4K8Z A;  4UXN A;  5DEC A;  4O2B B;  3GB7 C;  2QM8 A;  4X1Y A;  2CDY A;  1W59 A;  1FJG B;  5FNV A;  3SPH A;  2LFR A;  1E1Q G;  4N23 A;  4DYL A;  3RYF A;  1GAX A;  3ZMV A;  3CXH F;  3ZRX A;  3OTO B;  1GO3 F;  4DV7 B;  3HKD A;  4DR6 B;  5LP6 C;  5J2T B;  2YIA A;  4DR5 O;  5BMV A;  3K79 A;  4JV5 B;  2R9R B;  4TV9 B;  2A3Q A;  4DUZ B;  1GM9 A;  2CUG A;  1BQZ A;  3CXC U;  2Q5Z A;  1BHB A;  4UCV A;  3OT7 A;  4BR6 A;  4MS2 A;  3B40 A;  2IH1 C;  1XNR B;  2PI4 A;  4YJ3 A;  3QO7 A;  2P90 A;  3H1L H;  4LNU B;  1N4C A;  3M8A A;  4QGP A;  2QR4 A;  2P5O A;  5KHI A;  3PJS K;  4J42 A;  5LYJ B;  2BTQ B;  4JI1 B;  1SQP H;  5K1P A;  1IDS A;  1W0J G;  3Q4H B;  2IM9 A;  4OGQ B;  2DWD C;  3AG3 B;  3SYO A;  1ORQ C;  5IJ0 B;  3U0Z A;  3K57 A;  1NH2 B;  3B8N A;  3QVN A;  3QNE A;  1DTO A;  1Q82 W;  4Q6G A;  2PY5 A;  4JI4 B;  4HNA A;  2VQE O;  1IVS A;  4NB5 A;  3ZHV A;  1S0V A;  4MW8 A;  5B1B B;  2AGA A;  5IE9 A;  3RVZ A;  3G67 A;  3SYC A;  5L3C A;  1VIB A;  5BY1 A;  4ZHQ B;  4F6R B;  3D3Q A;  2L35 A;  1SQF A;  1EN5 A;  1VF5 B;  3JD2 A;  5LXT A;  3JAR B;  1NVP B;  1NTZ H;  3AG2 B;  4PDM A;  1YEW A;  4GT1 A;  3HKC A;  3ZHT A;  1NZ6 A;  3CCQ V;  3F5T A;  1KD1 W;  2X6A A;  2JVD A;  2HG5 C;  1E1R G;  5GON A;  1N34 B;  3ZRW A;  1EZJ A;  1R6N A;  2F4V O;  2WPD G;  4DV5 O;  1HR0 O;  3IGA C;  4J7K A;  4JI3 O;  1P84 F;  5LMU O;  4ZIB A;  4KP4 A;  5LA6 A;  3E86 A;  2UXX A;  1YCI A;  2H94 A;  5H9C A;  4O4J A;  4B08 A;  3AG4 C;  2A06 H;  3FAV A;  4X62 O;  3ABU A;  4H44 B;  4Z1V A;  2JJ1 G;  3HKB A;  4FFB A;  5BXZ A;  4J7J A;  1GM8 A;  4RO2 A;  1XDC A;  5EYP A;  3K08 A;  1H8E G;  3EFF K;  1URF A;  4FZ1 A;  1S5H C;  1NTM H;  2ZXW B;  1BT8 A;  2X6B A;  1HW7 A;  3R65 A;  2Q0O C;  1WPB A;  4IGG A;  3E2E A;  2EJ7 A;  5LHI A;  3CPW U;  4DV0 O;  2WLK A;  2FL4 A;  4O4L B;  3RVY A;  4MVO A;  1YJN V;  1VQL V;  3APO A;  2D2C B;  3E22 A;  3OFN G;  4WCE V;  2JDI G;  4BW9 A;  4ZOL B;  4OX9 O;  4DR5 B;  2P22 C;  2JJ2 G;  2CE4 A;  3U10 A;  5E79 Z;  1DF5 A;  4YIO A;  2UXB O;  3TJT A;  3EHB B;  4TSF G;  5JCO C;  4PDR A;  4TQF A;  2XAH A;  2WLI B;  2VS0 A;  2AZ2 A;  4X1Y B;  3RGB A;  2LW1 A;  4PEL A;  1ZUQ A;  3CCR V;  3O65 A;  4P2Z A;  3P3P A;  3ETG A;  3RYF B;  1D2D A;  1THZ A;  2HLD G;  3AG1 B;  4R6Z A;  3D36 A;  2ZE7 A;  1VQP V;  1W2B U;  1I94 O;  2LO1 A;  5F2V O;  4DW1 A;  3HKD B;  1OCR B;  1MA1 A;  4BIU A;  2R9I A;  5KMG B;  5IYZ A;  4MVM A;  1UPG A;  1MOF A;  1M56 C;  3CRQ A;  1N33 O;  4CH5 A;  1EM1 A;  4TQD A;  2E5L O;  2XOK G;  4LF4 O;  2VQE B;  4NR1 A;  2R9A A;  4JI2 O;  1R1B A;  3OMA B;  4PA6 A;  5CB4 A;  2GUZ A;  4YJ3 B;  4WFF A;  4PA3 A;  1PM9 A;  3SPC A;  2ODM A;  3NXS A;  4GX2 A;  1B6Q A;  3VQX A;  4WBN A;  1K7D A;  2BOB C;  1V9P A;  2E76 B;  1F51 A;  3MDS A;  5AG2 A;  1WB8 A;  4Q20 A;  3A0H Z;  5A9G A;  2ETN A;  1K9M W;  1V54 B;  1R6K A;  5C8Y A;  2UXD O;  1BS3 A;  2F4V B;  4DV5 B;  1WPX A;  1Y6X A;  4B7E A;  1HR0 B;  1K8A W;  1AVM A;  3CWB H;  4X66 O;  1YTF B;  2QWO B;  2NLJ C;  1Y66 A;  5LMU B;  1BQ0 A;  1KP2 A;  3C3T A;  3LNM B;  4HBN A;  4DV2 O;  2VWJ A;  5LOV B;  3WFV A;  4NYK A;  4MVR A;  1CEZ A;  5B1A C;  1XBL A;  3CCL V;  1CP9 A;  3JAS A;  1R73 A;  4X62 B;  3A0R A;  1IUR A;  2ZQM A;  3JD4 A;  3HKC B;  2QDO A;  4J41 A;  1I5Y A;  4GCZ A;  3FYI B;  1SA0 A;  3ASO C;  1SQX H;  3ZRW B;  3KG2 A;  1IX9 A;  2Y0P A;  4JTC B;  1XHZ A;  3AG3 C;  5JQG A;  4XBF A;  3FB6 C;  5CMU A;  4O4I A;  1KUQ A;  4BWA A;  2GHY A;  4RUF A;  3UCS C;  4TT3 G;  3SJQ C;  2KQX A;  4GKK O;  4DV0 B;  1SQQ H;  5CA0 A;  2E74 B;  1H8H G;  1M93 A;  5LA6 B;  2WLL A;  1NVP D;  1VQK V;  3B2E E;  1G8M A;  4O4J B;  4O2B A;  4XDL A;  4OX9 B;  1RP3 B;  1K92 A;  4FFB B;  5EYP B;  1ZWI C;  3AG2 C;  2F43 G;  1XMO O;  1U97 A;  2Y69 C;  1IBK O;  4CZZ A;  1KB9 F;  4FM1 A;  2ZE8 A;  4W4L A;  3STZ C;  1YJ9 V;  3JSN A;  2EX3 A;  5J2T A;  4B3S O;  2RJZ A;  4AHC A;  4MVU A;  4ZI7 A;  4TV9 A;  5DED A;  4E2L A;  3E22 B;  4DRX B;  1FXH A;  2LFS A;  2ZNJ A;  1AIL A;  4K35 A;  3G71 V;  4PA4 A;  1F7Y A;  2P7T C;  4U3J B;  1YZB A;  1QR8 A;  1VF6 A;  3IJ4 A;  1N33 B;  1B04 A;  4EFB A;  1Q3E A;  1NTK H;  1P49 A;  3JYC A;  4PJ0 Z;  2E5L B;  4LNU A;  4JZG A;  4LF4 B;  4JI2 B;  1TVK B;  1AP6 A;  5LYJ A;  1WP7 A;  2ZR3 A;  3UQ8 A;  2BTQ A;  2YIB A;  1JQ0 A;  3G80 A;  3OMN B;  4UVA A;  4IL6 Z;  1B3Q A;  3Q4H A;  4CS2 A;  2RQ6 A;  3SPI A;  5IWA O;  3OTO O;  1HNX O;  4QIW F;  1H2S B;  3SYP A;  1W0K G;  2KG7 B;  2BOC C;  1SQV H;  4RAI A;  2Y0I A;  4FM2 A;  5IJ0 A;  3H1H H;  3W7T A;  2ZDI C;  2BCC H;  4JYB A;  2QA4 V;  2Q67 A;  3FX7 A;  3CX5 F;  3QO5 A;  3ICX A;  5IYZ B;  2VWK A;  5A2Q N;  1NR1 A;  1Q5O A;  4X65 O;  3RW0 A;  2UUB O;  2K1E A;  2EZP A;  1R3I C;  1M57 C;  4YHH O;  2UXD B;  3ZRV A;  4JGS A;  3IAY A;  2YI8 A;  4OXS A;  1TA8 A;  1MAB G;  1R3K C;  2B5U A;  2QE7 G;  5LGN A;  5B66 Z;  2Q0A A;  2YUA A;  4X66 B;  3TK1 A;  4DR1 O;  5CB4 B;  2GUZ B;  3CME V;  3E8H A;  4DV2 B;  3JAR A;  4I7Z B;  4DR4 O;  1MMM A;  2Q9L A;  4FLZ A;  4JI5 O;  4QE7 A;  4WBN B;  2H3O A;  3SGI A;  3OUF A;  4NKG B;  4X1I A;  1DLB A;  1X59 A;  2F23 A;  3ZMS A;  4YY3 O;  4HZ3 A;  4IT5 A;  3AG1 C;  3K0G A;  3H01 A;  1XI1 A;  2YC0 A;  3THO A;  4WFA V;  1DF4 A;  1K73 W;  3DC5 A;  2ZM6 O;  1TUB A;  1OCO B;  2RNB A;  4JF3 A;  4KFM A;  5LMN O;  2CTQ A;  5L3B A;  3T4Z A;  3TGU H;  3CYO A;  1VQ9 V;  1IXB A;  1MZE A;  4GUN A;  4XDJ A;  2JK5 C;  5D5Q A;  4GKK B;  4EKW A;  4DV4 O;  4D6T H;  5EK0 A;  1N34 O;  2CAZ C;  2GTS A;  4RQF A;  3QF7 A;  3BEH A;  3JAS B;  4JTA B;  4O2A A;  2KB1 A;  5J2U B;  1KMI Z;  1RPR A;  3ABK B;  2QEX V;  2WAM A;  2LW7 A;  3OR6 C;  4LBE C;  4B3T O;  1XMO B;  4LR3 A;  1YTF D;  1KBH A;  1IBK B;  4KUM A;  3L75 H;  2ZE6 A;  2LGW A;  4O4I B;  1K5S A;  4HAM A;  2ILM A;  4ZKI A;  5LBQ A;  4B3S B;  4TWK A;  5CA0 B;  5IT9 N;  3ABT A;  2WLL B;  1P7G A;  2Q69 A;  4PHZ A;  5JVD A;  2A79 B;  3UKM A;  4K3A A;  4LF5 B;  4WFH A;  4DR3 B;  3ABL B;  4K0K O;  5L3E A;  3UM7 A;  2WLI A;  3OM3 B;  2HP8 A;  4U3F H;  3ABM B;  3LSQ A;  3ZRS A;  1VQ7 V;  1FAF A;  3ZN1 A;  3JAM N;  5KLV H;  1M90 W;  4Z1M G;  1R3J C;  4FM0 A;  2FYU H;  2IH3 C;  2JS5 A;  1FYJ A;  5IWA B;  1HNX B;  3L70 H;  4AIL C;  2IU3 A;  5KMG A;  1MSD A;  3HKE B;  1SER A;  2PYL A;  4ZI7 B;  2ZT9 B;  3LSU A;  4UCO A;  2WLH A;  3JAT B;  5CA3 A;  4X9Q A;  3E83 A;  1OZ0 A;  3RFR A;  2PZS A;  4LF6 O;  4DV1 O;  4CH3 A;  4X65 B;  3BHP A;  2UUB B;  3S3W A;  4YHH B;  2AZ0 A;  2IJK A;  3LDC A;  5H6R A;  2XTA A;  2P6J A;  1Q90 D;  2HJD A;  2PUS A;  3K5N A;  4DR1 B;  2L6L A;  1JOY A;  1V55 C;  5C93 A;  2Z3Y A;  2YXH A;  3KKY A;  3SJB C;  4DR4 B;  1AP5 A;  1Y76 B;  2EIM B;  3B77 A;  1JA8 A;  3P32 A;  3JAK B;  1G1X B;  3K9S A;  2JS3 A;  4JI5 B;  2ZIO A;  1FXK A;  1UFI A;  2XAJ A;  2YI9 A;  1OCZ B;  3OUS A;  1EN4 A;  3VQV A;  3K04 A;  4YY3 B;  3RYH B;  1RM1 B;  1K4D C;  2YEV A;  4PV1 B;  3HB3 B;  5H6Q A;  1EN6 A;  3ML0 A;  1Z2G A;  2ZM6 B;  5LOV A;  4R7C A;  1ZL8 B;  5B3S C;  3CP1 A;  3CCJ V;  5LMN B;  4JTD B;  2BTO A;  3ZBH A;  1BCC H;  4MSW C;  3K3W A;  4D7T A;  3N2K B;  1N0N A;  1J5E O;  1NQT A;  3MHS C;  3JSL A;  4DV4 B;  2EIJ B;  4FMT A;  2QSA A;  1OJH A;  4OPA A;  1LUW A;  3BFR A;  4PA7 A;  5B5E Z;  4X88 A;  4H13 B;  4X1I B;  4KHP O;  4HYO A;  4FPP A;  2JEU A;  2DYS B;  3D36 C;  2JGU A;  2XHB A;  4B3T B;  1TUB B;  1J95 A;  1XL4 A;  3OGC C;  1Q8I A;  3VBB A;  4H37 A;  3VQW A;  5FPR A;  3SDL A;  4X89 A;  4DUY O;  1IBL O;  3CEI A;  2DW4 A;  3DSQ A;  5GTI Z;  4F6E A;  3JD0 A;  1HNW O;  3B4S A;  1TGO A;  5H5N A;  4O2A B;  2QKC A;  2X7R B;  4K0K B;  4NTY A;  3SJA C;  4UB8 Z;  3BAB A;  5IYD O;  1AR1 B;  4FLX A;  2BSK A;  4CH4 A;  2OCH A;  4UCS A;  2DN9 A;  4B3R O;  2IU0 A;  4NVP A;  4N21 A;  1LR1 A;  3FKS G;  1SRY A;  2NNU A;  1XMQ O;  3ZN0 A;  5KAI Z;  3EVK A;  4DRX A;  2OTJ V;  4L87 A;  5CA1 B;  3LSS A;  1YF2 A;  1YXB A;  1OCO C;  4I9Q A;  4U3J A;  1S76 D;  3R66 A;  3OGI B;  1M5I A;  1AI4 A;  1NT2 B;  3BRC A;  5JVD B;  2CGO A;  3C3S A;  4BAY A;  1Y74 A;  1TVK A;  3ASN C;  3RN4 A;  4LF6 B;  4DV1 B;  1N0J A;  4FLW A;  1Q43 A;  1GRJ A;  1N8R W;  4I9W A;  2EIL C;  1VQO V;  1QLE B;  3J80 N;  5JJN B;  5IY5 C;  2KG7 A;  2GBO A;  1VQ8 V;  2ADQ B;  1M1K W;  2Q7H A;  4TOI A;  1Q6U A;  4AQY O;  2XAG A;  3EXA A;  4K8X A;  4BW5 A;  1YHQ V;  1P7B A;  3MD0 A;  2HEP A;  4NXN O;  1H2L A;  1K4C C;  3BA8 A;  4CH6 A;  5CBF A;  4PA9 A;  4LFC O;  5B1O A;  2HJF C;  4F4L A;  2GTA A;  1VQ5 V;  2IJI A;  2PGG A;  1L0L H;  5HFL A;  3ZX6 A;  1ARO P;  1QVG U;  1YJW V;  1JPX A;  3H1J H;  3W7U A;  1MZF A;  1N32 B;  4MW3 A;  2EIN B;  3RYC B;  1J5E B;  1AB3 A;  3ABM C;  3CC2 V;  4QPK A;  3IC7 A;  4D7S A;  4FVM A;  3TXS A;  3A8T A;  1D5A A;  4YIP A;  3RT3 C;  2Q7G A;  2HHH O;  4U7O A;  1XNQ O;  2WLM A;  3AEI A;  1FXK B;  3B09 A;  3LUT B;  4KHP B;  3CJH B;  3VOU A;  3MAQ A;  2B1I A;  2FML A;  1Q86 W;  2YEV B;  1O9G A;  1OV9 A;  1NU1 H;  3STL C;  2YIB D;  4LF7 O;  3DC6 A;  3ZMU A;  1QQC A;  5IYB O;  5IYC O;  1I5X A;  1VF6 C;  2XAS A;  2QJ1 A;  3CC7 V;  2FB5 A;  1PD3 A;  1LNQ A;  3LNN A;  2PI5 A;  2LQT A;  2GSM B;  1NH2 D;  2IJJ A;  2RN9 A;  2HVJ C;  5J2U A;  1K5Q A;  4DUY B;  1IBL B;  1KU9 A;  1FD9 A;  1JR9 A;  1OCC B;  4UCT A;  3B8M A;  4U7N A;  1HNW B;  1ZLZ A;  2QTS A;  4UV9 A;  3BA9 A;  1DK1 A;  3CCS V;  3T1C A;  4UUJ C;  1O9H A;  2EIK B;  2UXN A;  3K5O A;  5JJJ B;  1U96 A;  4TV8 B;  2CTR A;  2A9H A;  4L8J A;  4RQE A;  1OCZ C;  3S3X A;  4UV8 A;  4B3R B;  2QWP B;  2CTP A;  5EIB D;  4OPH A;  2P4V A;  1WA8 A;  4MT8 A;  5B1B C;  1XMQ B;  4I4T B;  3NR7 A;  2XUM A;  2G38 A;  3E8G A;  2ZKO A;  3T4D A;  4I0X B;  5EIB C;  4LH6 A;  4CS4 A;  4I50 B;  2EIJ C;  2X6C A;  5GTH Z;  1PKX A;  3N2G B;  1BE3 H;  4X1K A;  5DN6 G;  2PYJ A;  2UUC O;  2BSK B;  5E1A C;  3CRA A;  1YDX A;  1KKC A;  4J9Y B;  3HKE A;  2DYS C;  4QJF B;  2HR3 A;  4AQY B;  1KYO F;  3JAT A;  2W6I G;  4LF5 O;  1EZV H;  4DR3 O;  4NXN B;  2N05 A;  4MVZ A;  3L72 H;  4FIP C;  4PD4 F;  2QM7 A;  4LFC B;  3T2M A;  3OD4 A;  3F5W C;  1Y74 B;  4X8A A;  2N74 A;  2RCV A;  4BIO A;  1Z5V A;  3BPZ A;  3ZIA G;  1XRE A;  5L3G A;  5KHG A;  1S72 V;  2OWO A;  4DXW A;  1Y76 A;  4UB6 Z;  1R3L C;  2ZXW C;  2O57 A;  3JAK A;  1GM7 A;  3F7V C;  2F66 C;  2JEX A;  1JFF B;  3MHH C;  1B06 A;  5L3F A;  4JPR A;  3RYH A;  5IDJ A;  4KXR A;  3AK1 A;  1VAR A;  1S5L Z;  2B1G A;  2HHH B;  1CXZ B;  1IXM A;  1F4N A;  2DQ3 A;  1XNQ B;  1G6U A;  1EBO A;  1L8D A;  5EC2 C;  1XL6 A;  1ZL8 A;  5ITZ A;  1GKF A;  2ZIM A;  1HNZ B;  2OCC B;  3I56 V;  1XOU A;  1P4R A;  3H9V A;  2OIE A;  3N2K A;  5LL6 Y;  4UCR A;  4X64 O;  1RPO A;  4UCU A;  4LF7 B;  4ASU G;  5H2F Z;  3K5M A;  2QKS A;  3CB2 A;  1H2N A;  3QG5 A;  4X20 B;  3VQY A;  4MTG A;  1GH6 A;  5EC1 C;  2UU9 O;  1PP9 H;  2ZD9 A;  3CMA V;  4P9O A;  2P4K A;  3ZJZ A;  1AJQ A;  1H2K A;  3J81 N;  3J7A U;  1SET A;  2XAQ A;  2Y4T A;  1HDJ A;  1OCR C;  1I7F A;  2ZE5 A;  4NTW A;  5FPO A;  4AI8 A;  1FFX A;  2YIC A;  3GVM A;  2QKA A;  1MNG A;  1JMK C;  3ZCC A;  4H0L B;  1BGY H;  1QLN A;  3T1H O;  4B3M O;  5KX5 A;  3AG7 A;  4Z2W A;  4GX0 A;  4GLX A; 
#chains in the Genus database with same CATH homology
 3FAV A;  2VRZ A;  3G80 A;  2B9Z A;  3TXQ A;  4I0X B;  4ABM A;  3Q4H A;  4GZR B;  4LWS B;  1WA8 B;  3ZBH A;  3GVM A;  2KG7 B;  2VS0 A;  3HR0 A;  2AZ2 A;  4I0X A;  2AZ0 A;  1WA8 A;  4LWS A;  3FAV B;  3O9O A;  2KG7 A;  3GWK C;  3TXS A;  2DE0 X;  3Q4H B;  3OGI B;  3FD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...