4ABMA

Crystal structure of chmp4b hairpin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
79
structure length
79
Chain Sequence
GAMEQEAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTKNKRAALQALKRKKRYEKQLAQIDGTLSTIEFQREALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cc2D1A is a Regulator of Escrt-III Chmp4B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords CHARGED MULTIVESICULAR BODY PROTEIN 4B
total genus 38
structure length 79
sequence length 79
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 4abmA00
3FAVB 2B9ZA 3Q4HA 1WA8B 1WA8A 3G80A 4GZRB 3HR0A 3TXSA 4ABMA 2AZ0A 3Q4HB 4I0XB 3GWKC 2AZ2A 3FD9A 3O9OA 3OGIB 3GVMA 2KG7B 3FAVA 2VS0A 3ZBHA 4I0XA 3TXQA 4LWSA 4LWSB 2VRZA 2DE0X 2KG7A
chains in the Genus database with same CATH superfamily
4N21A 2A06H 3ICXA 1HNZB 4MTFA 2AXTZ 3HKCB 2XAHA 3UO2A 1S72V 4DUZB 2Q7HA 4P30A 3STZC 4DR3B 4DXWA 3N2GB 4I0XB 1XDCA 2JEXA 3L71H 2ZCEA 2Y0IA 3CCVV 4DV3O 3VQYA 1K92A 3L70H 5H5NA 1WB7A 1MZEA 1TUEB 1GM8A 4LR3A 1VP7A 4X9QA 1GN2A 4MTGA 3VBBA 2N04A 5LYJB 3U0ZA 2WLNA 3UCSC 2Q68A 1ZX3A 4JTCB 5A2QN 4WFEA 4MVUA 5BXZA 3RT3C 2VQEO 2QR4A 3TJTA 4EB6B 4AQYO 4OPAA 4U3JA 3IC7A 3M7MX 3ZCCA 5CBFA 4DK0A 2VWKA 3LSSA 2QTSA 2UUCO 1IDSA 2GTSA 1WA8B 5LMUO 1VF6A 3RN4A 3ETQA 2WA3A 5EC2C 3ZRWA 4B08A 1MABG 2XAQA 2DYSB 3FD9A 1XILA 2QDOA 3ZBHA 2DOSA 3L72H 1BL8A 3I5DA 1HR0B 3B40A 1Q7YW 3LNMB 3LNNA 2QWRB 4QE7A 4LFAO 4ZI7B 3SYAA 1YJNV 1LUWA 3ZX6A 4LP8A 1VMGA 1I5YA 4YHHB 4O4IB 1BS3A 1GTOA 1MG1A 4CH6A 3UO3A 3ABKC 2WLHA 1G1XB 2GDSA 1NJIW 2QKAA 3RBZA 4UCSA 4QE9A 2VRZA 1JR9A 4JAAA 3RFRA 4GCZA 1HDJA 2NLJC 3RWRD 2VQEB 3MHHC 4MVMA 3M99B 2ZNJA 4B7KA 1PV0A 2ZIMA 3ZMSA 1SQPH 2D3OW 3JCUZ 1PD3A 3ZHUA 2B1IA 4BW5A 1FXKC 1Q8IA 4I55B 3AG2C 5D5QA 5GTIZ 4A5UB 1AR4A 1FJGO 4KHPO 4LF6B 3UM7A 5L3GA 3K5LA 1H2LA 3OEHG 4O2BA 1N4CA 3WG7B 1HWYA 1MZFA 1SQVH 2YC0A 4Z1MG 3ZEDA 1Q82W 2Q69A 1EN5A 3K06A 4D7TA 3D3IA 3HKDB 5LOVB 1WPXA 1WPBA 3QG5A 3ZHQA 3APOA 5BR8O 1S76D 2JS5A 2Q0AA 3D3QA 5LHIA 3G4SV 4QIWF 2RNBA 1VQ6V 1ZSPA 5L3EA 1TUBB 3H1LH 2UXBO 2OTJV 4RWUA 4PDRA 2PYJA 5LOVA 3BEHA 1YDXA 4DV0B 3J81N 4FLZA 2GSMB 4CH5A 1H2SB 3HKDA 4MTOA 4XBFA 3W7UA 3CCEV 1G6UA 2Y4TA 5JCOA 4CZZA 3ETDA 4JV5O 1JJ2U 3DC5A 1R6KA 2IU0A 3AG3C 2C2AA 2CE4A 1W0JG 2O57A 3WFVA 3F7YC 5IY5C 4DUYO 3FAVA 3ZRVA 1Y74A 3ABKB 5LXTB 1QLEC 1BQZA 5CA0B 2EIMC 5LA6A 3BRCA 2EINC 1QCEA 4DO2A 1I94B 1EZVH 4KUMA 4YIOA 3ASOB 2Q6AA 2W6IG 4ZHQA 1W2BU 1FYJA 3WB2A 4ZI7A 1YITV 2Q67A 5B5EZ 1M1KW 1H38A 2WPDG 1BHBA 3K3WA 3APQA 2LW1A 2FB5A 1L1FA 4RAIA 3JASA 4LF9B 5FLXN 1NTZH 2ADQB 2JGDB 3FYIB 1GK9A 1SQFA 3CHXA 1QNMA 1KKDA 3CE2A 5KA6A 2KQXA 5B1NA 1GN3A 1R3KC 3SYCA 1NVPB 1Q43A 2LFRA 3H1HH 3B2EE 4K0KB 4EEQA 3CJHB 1DF5A 3ZN0A 4DV5B 5IYCO 3SPGA 5A9GA 3CMEV 3B09A 3PJSK 4J42A 1RFYA 1AP5A 4RUEA 1A32A 5B66Z 1W59A 4DV6B 5LXTA 3JALB 2B9ZA 3Q4HA 2Y69C 1CPYA 1FPOA 1VQKV 1H2NA 4X62O 3RGBA 1QR9A 3FB8C 3OTOB 1WP8A 3ZRWB 2QGNA 4LF4O 1K4CC 2WLJA 5K1XA 3IAYA 1NVPD 1F4NA 3SPJA 2XT9A 4GKKO 3E83A 2A7WA 2W0FC 1EZJA 5DEDA 1PKXA 4MS2A 3ZJZA 5JVDA 2BE3A 3GWKC 1WAZA 4B3TB 2QKSA 1F51A 3NR7A 4B3RO 1Q90D 2ZE7A 3CXCU 2NN4A 4DR7B 5CBHA 3RYIA 1TVKA 2Y4UA 2YIDA 1PNMA 5L3DA 2DWEC 1JA8A 5JJEB 3HR0A 2Y48A 1Y74B 2AZ0A 1JX9A 4DV6O 4G28B 5IJ9B 2IJKA 1VQNV 2JVDA 2A0LA 3JCZA 3TCUA 4NTXA 3OFNG 2P06A 4O2BB 3OAAG 2D2CB 4K8ZA 4YJ3A 5H6QA 3FB7C 4H44B 4E2LA 3OEEG 4FZ1A 2ZXWB 2QM4A 1JMKC 3D8CA 2P67A 1MSWD 5KMGB 4LF7O 3D36A 1PPJH 1E1RG 1SC5B 3OTOO 2IJHA 3LDCA 1VEWA 1IZ3A 1K97A 4TQDA 4X66B 3T1CA 3R66A 1FXKB 1JPXA 3ABMB 3J80N 3U10A 1S3JA 4WFAV 2Z5UA 3QO7A 5J2UA 5KHGA 2FYUH 5BMVA 1HR0O 3CP1A 2HJFC 3BA9A 4PA6A 5EBLC 2ODMA 4UB8Z 1KUQA 1URFA 1H2KA 1IBLB 1T5EA 1JVMA 1G8MA 5K1PA 4QPJA 3BFRA 5GTHZ 4UUJC 3AEIA 3CRAA 5EC1C 5LA6B 2ADPA 2Y69B 4NXNB 2YI8A 3HKEA 3TXQA 1XL4A 2L6LA 3C3SA 4JI1O 5FNVA 1R3LC 4D6TH 1DK1A 4UCRA 2LJ2A 3L73H 4ZOLA 5LP6C 3N27A 4PA7A 4MVQA 3EVKA 3T1HB 3FX7A 3ML0A 3AK3A 4DV7O 2LP7A 1P7BA 1UFIA 4KL1A 3RYHA 2YXYA 4KHPB 1DF4A 1AJPA 1AR1B 2HFEC 1RP3B 3IFXA 4I4TA 3E8GA 4WFFA 2JGDA 3F7VC 2E75B 1LR1A 4GKJO 2WA4A 4PELA 2ZXWC 5DECA 2IM9A 2Q9LA 2R9AA 1CXZB 4K35A 1GM7A 1QLEB 2HVJC 4UVAA 2AGAA 1KKCA 2RMKB 1ZL8B 4JTDB 4LFBO 4XDJA 3TETA 3EFFK 2DQ0A 2Q4PA 3ZN1A 3QO5A 3FFQA 1OCZB 4UCTA 4JGSA 2P90A 4DR1O 5B1AC 1YZBA 3CEIA 4PDMA 5JJJB 2BOCC 5CB4A 4JASA 5IYBO 2EINB 2ITDC 2ZDIC 1R3IC 4H33A 3T1HO 3AG4B 4I50B 4BWAA 5E79Z 3CX5F 3BAAA 3QVNA 2N05A 2LGQA 4J9YB 4FLUA 2YI9A 4IYIA 5LMUB 1B04A 3E8BA 2F23A 5EIBD 3DSQA 5IT9N 3TXSA 3RYFA 2LQTA 3BVOA 1XL6A 5FNVB 1K7DA 2UXCB 3JAKA 4DV2O 3T4DA 3E8HA 2R70A 4TV8B 4CC5A 2M7WA 4DR4O 1UPGA 3JARB 2DMXA 2CTRA 2JRIA 4LH7A 4H13B 1D2DA 1TUBA 5IJ0B 5CB4B 2ARHA 4DK1A 2EJRA 4G2KA 1KB9F 4JI8O 1OJHA 3X2QB 4G27B 3K58A 4FZ0A 1AR5A 1QU7A 1BMFG 1LUVA 3F5WC 1VQ4V 2B5UA 2OCCB 2CH7B 2P22C 5LYJA 1XHXA 2EILC 3DGEA 2ZD9A 4BR6A 3OM3B 1K5SA 5BY1A 4WCEV 4JPRA 3RVZA 3E22B 1Q81W 4X1IA 2Q0OC 4PDVA 3IGAC 1JCHA 1H2GA 1HNWB 3AG3B 4LF5O 4JTAB 2N74A 2FL4A 5JJNB 2WLKA 4GUNA 5C8YA 5KUMA 4AHCA 5EYPA 2E3CA 1N36O 4PI0A 1GAXA 1NT2B 3CC4V 4HNAB 1VQ7V 4KFMA 4QPKA 4DR3O 4B3TO 4W4LA 4J7ZA 1Y76A 2PUSA 4ZBMA 4B3RB 4PA4A 4YJ2B 4NKGB 3K0GA 2XAGA 4ASUG 4DR7O 1WLEA 1QLNA 4JI0O 4BW9A 1M90W 2M6YA 3RW0A 1YTFD 1B6QA 4WBNA 1UJWB 4F6RA 3CWBH 5H9CA 1N34O 2HHHO 1GRJA 1YEWA 2W0XA 4I4TB 2QM7A 2ZT9B 4AQYB 4LFCB 1K9MW 2ZNIA 4Q20A 4NR1A 4JV5B 1VIBA 1KMIZ 2GV9A 1FFXA 1JJOA 2YICA 3ZS8C 2UU9O 3CRRA 4TOIA 1N0JA 2BTQA 2RCVA 3JALA 5KAFZ 3CCJV 2H8PC 2RDCA 4FPPA 3T1YO 4DRXA 1Y76B 3JD4A 5IE9A 3SPCA 1JOYA 2AW9A 2XHBA 1EN6A 3ETEA 4FFBB 4QJFB 4YY3O 1US6A 3OMIB 2XAJA 3G80A 1JQ0A 2V4DA 5IWAB 2OIGA 4ABMA 5JH7A 1QBZA 1RM1B 1V54B 1H8EG 2RJZA 4HBNA 2JDIG 2QWOB 4DR6B 5EBWC 1BQ0A 2NNUA 4ZOLB 3CC2V 3GB7C 4MVRA 1M56C 2VQFO 5B3SC 3G67A 4IHJB 2QKCA 3DXRB 3ABLB 4WFBV 2UXDB 5KLVH 1N34B 4I5SA 1ENVA 2MW2B 3QTCA 2Q73A 4IYHA 3L74H 1XNRB 5J2TA 2YXLA 2V7QG 3OR6C 4C7UA 5GONB 4JF3A 3K9SA 4MT8A 3FKSG 4X1YA 2QWPB 2WWWA 4DR2O 3BABA 1OCOC 2IU3A 2H94A 4DYLA 2BCCH 2CK3G 2IH1C 1TAEA 3JAKB 3OE7G 4EKWA 2K9PA 1RSOA 1HNXB 5CA1A 4EB6A 1SF9A 2OWOA 1XMOB 4J11A 3G71V 1KQSU 1E79G 3I55V 2F4VO 2OTLV 3UT5B 1O9GA 2ZINA 4UFZA 3N2KA 2UXBB 2F1MA 4B3SB 2X6BA 3ABUA 2GTAA 2HKOA 1N33B 2P4VA 5GONA 3G6EV 4J9ZB 5ITZA 5IWAO 1GN4A 3SGIA 4UCVA 3E22A 1DLBA 1L0NH 1XUQA 1SQXH 3TK1A 3JD2A 1XI1A 2AHZA 4MW8A 4GX5A 4DR6O 3FB6C 2ZE6A 5B1BB 3JSNA 4LFBB 1V9PA 4J10A 2EZPA 1AJNA 4O4JB 2JJ2G 4TV9B 1VQ5V 3ZMVA 1COWG 1VQ8V 1SZTA 1S77D 4PA9A 1XNRO 1RPOA 1F23A 1R73A 1NH2D 3OMAB 1XMQO 4O4HA 4EFEA 1GM9A 1ZUQA 5JCOC 1AI6A 4DV4B 1PNLA 1NU1H 2CGOA 3IC9A 2P4KA 3SPIA 4GYCB 1GKFA 5EYPB 3JAWB 3GVMA 1WJZA 4FMTA 5B1OA 4L87A 4DUZO 5DN6G 5J9PC 3UQ8A 4J7KA 2YUAA 2FTKA 1AILA 3HKBB 2YEVA 4TSFG 4FLYA 1XHZA 1D5NA 4DV3B 2YXHA 1XMOO 3K0DA 5IYZB 1SQBH 1R6TA 3ZMTA 5EBMC 4X64O 1NR1A 2G38A 4I7ZB 4FM1A 2Y0PA 1XREA 3M8AA 2KB1A 1NTMH 1Q6IA 3H1KH 3W7SA 2F95B 3ASNC 3AG7A 4O4LA 1FAFA 4NXNO 2QA4V 2HG5C 3HB3B 3RYIB 3CCSV 2X0LA 2EULA 4X8AA 3AK1A 4WFGA 1O9HA 1KP2A 1VF5B 2DYRC 2Q8VA 4PV1B 3SJAC 3ZHVA 2ILMA 4N23A 1EM1A 3T4ZA 3J7AU 5EZYB 3K59A 4GX0A 1M5IA 5DM6V 3WG7C 4CH3A 2QTOA 4LF4B 5L3BA 2WLLB 2UXNA 3G6BA 3N2GA 4CS3A 4LC1A 5KMGA 2EIKB 3OMNB 4NVPA 1ORQC 1YJ9V 3THOA 5LBQA 4P9PA 4O2AA 1FXKA 1I94O 4BAYA 2UUBO 1CEZA 4I0XA 4X64B 4YHHO 1M56B 3RYCB 3KKYA 4NXMO 1TGOA 1P84F 2PGGA 3KG2A 5GW7A 2R72A 4O4HB 2CGNA 1NR7A 1DTOA 3VQXA 4CS4A 4WFHA 4B7EA 4X65B 4JI0B 1PP9H 4LCUC 1VF6C 4JI7O 2OCCC 3H9VA 4RQFA 2MK3A 1IURA 4DRXB 1PM9A 3S3XA 4UVBA 5C93A 2E74B 5JVDB 3K57A 1S5HC 4QGPA 2F93B 1KU9A 2QSAA 3B4SA 3RVYA 3CCMV 3SJQC 5IYZA 4LF7B 3HKCA 3K03A 4U3FH 4RO2A 2R9IA 3JAWA 4LWSA 4TQFA 1BSMA 1V55C 4LNUA 4X88A 5CBGA 2CTWA 1U97A 5HFLA 3B8MA 2EIKC 4FLVA 2PI5A 4R7CA 2JS3A 2KSDA 4GKKB 3WU2Z 1HNZO 2ETNA 4LH6A 2LW7A 3MHSC 1PL0A 4LNUB 2DWDC 5JQGA 2HJDA 3D36C 3H1JH 2DE0X 5LGTA 1FS0G 1OCCC 4KXRA 1Y67A 4UXNA 1QR8A 5IY5B 1MA1A 2ZE5A 4TV9A 3EHBB 2PF4E 3OT7A 1KD1W 4JI8B 1J95A 2ZQMA 5LL6Y 1RSOB 3CB2A 1NTKH 1AI7A 3JSLA 3OD4A 1N32O 3AG2B 4FVMA 3JD3A 1YCIA 5LGNA 3JYCA 4I55A 2CUGA 3STLC 4BIZA 5CMUA 1IBKO 3CCUV 2BSKA 2VWJA 1S0VA 4ZKIA 4DUYB 1L8DA 1AROP 2H3OA 2WAMA 5FL7G 2WLIB 1FD9A 4PJ0Z 4LF5B 3A0BZ 5HFMA 3CPWU 2E5LB 3CCRV 1JFFA 1YF2A 5KX5B 4JI3B 1N36B 4P9OA 1V54C 1FXHA 4CBCA 1CP9A 4UV8A 4GLXA 5C8YB 3X2QC 5LP6A 1Q6HA 2Z0AA 3ZHRA 1U96A 1Y66A 2ZM6O 3SYQA 1Q3EA 2EJ7A 2EZOA 4B3SO 4YIPA 4U3JB 2X6CA 5E1AC 1I5XA 1HW7A 5KHHA 3RYFB 1S5JA 4U7OA 5CA3A 4H37A 3WB1A 3O65A 5LP6B 5IDJA 2HLDG 1SZXA 3L75H 4JYYA 3K5OA 1Y4MA 3FAVB 1NQTA 4PA3A 2PI4A 3ZRSA 1THZA 4JZGA 2FKXA 4JI1B 4LF6O 2E5LO 4HYOA 2OIEA 1GMGA 3SDLA 4MVZA 1NBMG 2EIMB 2DJVA 4DV7B 3CD6V 1QHTA 3DC6A 2OT5A 1KC8W 1IXMA 3E89A 1Z2GA 5L3FA 4HZ3A 4FM0A 3K04A 3A2FA 4NTYA 4DV4O 1YI2V 1AB3A 4GX2A 1N8RW 3AG4C 3OW2U 4JYBA 5KHIA 1BT8A 2K1EA 1N0NA 4O4LB 3ZIAG 1OCOB 3H01A 2AHYA 1X4TA 5B1AB 2UXCO 4I9WA 4K3AA 5CA1B 2HP8A 5KA5A 3FB5C 4DV0O 4LFAB 2DW4A 2ZM6B 1QVGU 2YDEA 2DN9A 1ZL8A 4D7SA 1M57B 4O4JA 4TWKA 3BCCH 2CTQA 3LDDA 5EK0A 2EILB 2WLIA 1GN6A 2ZR3A 1VQOV 4DR5B 1SESA 2KG7A 4KP4A 1SQQH 3R65A 4MW3A 1Z5WA 1MSDA 3L9DA 1EFRG 1OHHG 5TISZ 2E76B 2XUMA 4K8XA 1ZAUA 1SA0B 4FLXA 4JAVA 2IJJA 2LFSA 4JI2O 4FLTA 1P7GA 1DGSA 3CRMA 4U7NA 3AG1B 1FXVA 3BY6A 3JARA 1AVMA 4PDLA 2JIZG 4IIJB 1OCRB 2WSSG 1P4RA 3K79A 2UUAB 4LF9O 1H8HG 1N33O 2JJ1G 2AZ2A 3OUSA 4X66O 4F6EA 3LSUA 4E4EA 4LF8B 4FLWA 5JH7B 4NXMB 4CC6A 1IBMO 5H2FZ 1OZ0A 1Q5OA 5EIBC 2XASA 3UKMA 3VOUA 1M57C 2EIJC 4PHZA 1VQPV 2P5OA 1Y6XA 1J5EB 3DXRA 4JAUA 1R1BA 2CAZC 5KX5A 2QEXV 3S3WA 4DV1B 2W6JG 4UCUA 1YIJV 2WLLA 5L3CA 1NZ6A 3B77A 4WBNB 3IJ4A 3TGUH 1K33A 1R6NA 3SR2C 4ZHQB 4RUFA 5KHKA 2UXXA 1FKAO 3KZIZ 4YXWG 4B3MB 1SERA 2UUAO 1XMQB 4GX1A 2LGWA 1YVWA 4X1YB 3ZMUA 4Z2WA 2UUCB 3SJCC 2YSUB 3RYCA 5IJ9A 2FMLA 4JI2B 4I50A 4HNAA 4LF8O 3KCXA 1SKVA 1XNQB 2RQ6A 3DTUB 4F6RB 2Q7EA 3A8TA 3ZMZA 2B1GA 4MSWC 2PTMA 2F43G 3QNEA 2VQFB 2P6JA 3EXAA 1J5EO 3CXHF 2JK5C 5ITZB 4NTWA 1IXBA 4J80A 3BPZA 4H0LB 3I56V 2WLMA 3SYOA 2A79B 2PYLA 2IBZH 2CTPA 4UVCA 4DR1B 2YIBD 2JGUA 5BMVB 1IBMB 3JD0A 1I08A 5KHJA 3W7TA 4OGQB 1K5QA 4J7JA 4FFKA 2QWQB 5CN0A 3P3PA 4YJ2A 4LBEC 4R50A 4LWSB 4HAMA 3SYPA 4X20A 1B06A 1YJWV 1NS1A 2X7RB 4CS2A 4DV1O 2QM8A 3C90A 3MD0A 3GWOA 4FK5C 3U11A 2IJIA 4FM2A 2ZE8A 2UU9B 1P49A 1S5LZ 2ZIOA 1NKDA 3JD1A 1D5AA 4MVSA 2V1DA 3CSXA 5KUKA 2OCHA 1M4UA 1SS3A 5CA0A 3CJHA 3WB0A 4O2AB 5J2TB 1GO3F 2GBOA 1QQCA 4CH4A 2A9HA 3CRCA 4UV9A 4I9QA 2CDYA 4BIOA 1PNKA 3AG1C 1VQMV 4BIUA 1XNQO 3CC7V 4NB5A 2OYQA 1SETA 5IYDO 2XNDG 3E35A 3A0RA 2P7TC 1SA0A 2ATKC 2Z3YA 4FIPC 1FFTB 1QVFU 4AI8A 4RQEA 2ZDIA 2BSKB 3HPLC 2YIBA 1KECA 2PY5A 1F4MA 1OCCB 4OPHA 1ZWIC 3ASOC 3E2EA 1MOFA 1XEQA 4PI2A 3MDSA 3CCQV 1MNGA 3HKEB 5LHHA 5KAIZ 3CMAV 1VARA 1BHAA 1VQ9V 1I7FA 2XTAA 4IHJA 2NR5A 1HNWO 3VQWA 1NH2B 1Z5VA 2PZSA 2QJ1A 1EN4A 2Q5ZA 3E86A 4DR2B 3QO8A 1ZLZA 3W7WA 4JI5B 2BTOA 1BCCH 4NYKA 3F5TA 4IIJA 4TUYB 3ZHTA 1FFXB 2VS0A 3LSQA 5IJ0A 3SPHA 3OGCC 4JI4B 1K34A 3C3TA 4GKJB 4IL6Z 1HNXO 1JFFB 5D5PA 1TA8A 1XQ8A 2DYSC 1W0KG 4DV5O 1RPRA 1SRYA 1MMMA 3ABLC 3B8NA 3NXSA 3OUFA 4F4LA 1F7YA 4ICGA 4Z1VA 1B3QA 3OTFA 1H2MA 1X59A 3QF7A 1WN7A 4P2ZA 3T2MA 1IBLO 2YS8A 4K0KO 1L0LH 1OV9A 4FFBA 1RM1C 4GT1A 3A0HZ 1K73W 3MAQA 1OCRC 4UB6Z 3Q4HB 2HVKC 5F2VO 1M9NA 3ABTA 1SQGA 4ZIBA 5H6RA 1YHQV 4DR5O 3JATB 1FJGB 5FPRA 1VQLV 1KBHA 3T1YB 2HHHB 2ZR2A 1WA8A 1VF7A 3ASNB 4J41A 3VQVA 4OX9O 1K8AW 2RN9A 3LDEA 1YSCA 3AK2A 4JI4O 1I0HA 4EFBA 5BR8B 4IGGA 1TVKB 2R9RB 2JEUA 1V55B 4MTXA 2UUBB 4JI5O 5J2UB 5LGUA 3CCLV 2YEVB 4JI3O 4TT3G 4X1IB 4GZRB 4DV2B 2DYRB 1Q86W 1EBOA 4X1KA 2UXDO 2EBOA 3N2KB 4X65O 4R6ZA 3ZHSA 1AI5A 2QE7G 5LHGA 4O4IA 4MVOA 4JI7B 3KCYA 3P3NA 4JI6O 2KKWA 4TUYA 2XAFA 1OCZC 1KYOF 2HR3A 3P30A 4OXSA 3OR7C 1YTFB 5JWPA 2EX3A 3K5NA 1AJQA 4JZ2A 5FPOA 4JYCA 2IW5A 4X1KB 4JYAO 3W7XA 2ITCC 3PN1A 3RYHB 4DW1A 3K08A 3BA8A 1AP6A 4R8CA 1AI4A 1XOUA 5B3SB 5LMNO 3JAMN 3LUTB 3CS5A 1LNQA 1ROPA 4B3MO 4OX9B 2BOBC 2YIAA 2HEPA 3P32A 4TV8A 3H1IH 1XBLA 2IH3C 2ZKOA 3CYOA 4AILC 1R3JC 1WP7A 2LO1A 2F4VB 1WB8A 4Q6GA 1YXBA 3E8FA 4X20B 2QWNB 4YJ3B 3FYEB 2BTQB 2XOKG 2X6AA 1N32B 2L35A 4FJCC 4IT5A 1HP8A 5AG2A 4DR4B 1NI8A 2CH7A 1GH6A 3JATA 4PD4F 1IBKB 1K3EA 4L8JA 1G4YB 3BHPA 4QNHB 4LFCO 3HKBA 4W4KA 4X89A 4JYAB 5JQGB 4X62B 4JI6B 4WF9V 3O9OA 3OGIB 2EIJB 5BZBA 2KG7B 3CRQA 2F66C 3K5MA 2GUZA 4XDKA 4XDLA 4UCOA 4DW0A 1WNSA 1BE3H 1IX9A 2A3QA 1E1QG 1ZTEA 5LMNB 1PL4A 1Q6UA 1KP3A 2Q7GA 3UT5A 3ZRXA 1K4DC 1M93A 3ABMC 1BGYH 4YY3B 3ETGA 2GUZB 5B1BC 2DQ3A 1IVSA 2GHYA 3JASB 1BZKA 3K9AA 5EZYA 3SJBC
chains in the Genus database with same CATH topology
3FAVB 2B9ZA 3Q4HA 1WA8B 1WA8A 3G80A 4GZRB 3HR0A 3TXSA 4ABMA 2AZ0A 3Q4HB 4I0XB 3GWKC 2AZ2A 3FD9A 3O9OA 3OGIB 3GVMA 2KG7B 3FAVA 2VS0A 3ZBHA 4I0XA 3TXQA 4LWSA 4LWSB 2VRZA 2DE0X 2KG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FAV B;  2B9Z A;  3Q4H A;  1WA8 B;  1WA8 A;  3G80 A;  4GZR B;  3HR0 A;  3TXS A;  4ABM A;  2AZ0 A;  3Q4H B;  4I0X B;  3GWK C;  2AZ2 A;  3FD9 A;  3O9O A;  3OGI B;  3GVM A;  2KG7 B;  3FAV A;  2VS0 A;  3ZBH A;  4I0X A;  3TXQ A;  4LWS A;  4LWS B;  2VRZ A;  2DE0 X;  2KG7 A; 
#chains in the Genus database with same CATH topology
 4N21 A;  2A06 H;  3ICX A;  1HNZ B;  4MTF A;  2AXT Z;  3HKC B;  2XAH A;  3UO2 A;  1S72 V;  4DUZ B;  2Q7H A;  4P30 A;  3STZ C;  4DR3 B;  4DXW A;  3N2G B;  4I0X B;  1XDC A;  2JEX A;  3L71 H;  2ZCE A;  2Y0I A;  3CCV V;  4DV3 O;  3VQY A;  1K92 A;  3L70 H;  5H5N A;  1WB7 A;  1MZE A;  1TUE B;  1GM8 A;  4LR3 A;  1VP7 A;  4X9Q A;  1GN2 A;  4MTG A;  3VBB A;  2N04 A;  5LYJ B;  3U0Z A;  2WLN A;  3UCS C;  2Q68 A;  1ZX3 A;  4JTC B;  5A2Q N;  4WFE A;  4MVU A;  5BXZ A;  3RT3 C;  2VQE O;  2QR4 A;  3TJT A;  4EB6 B;  4AQY O;  4OPA A;  4U3J A;  3IC7 A;  3M7M X;  3ZCC A;  5CBF A;  4DK0 A;  2VWK A;  3LSS A;  2QTS A;  2UUC O;  1IDS A;  2GTS A;  1WA8 B;  5LMU O;  1VF6 A;  3RN4 A;  3ETQ A;  2WA3 A;  5EC2 C;  3ZRW A;  4B08 A;  1MAB G;  2XAQ A;  2DYS B;  3FD9 A;  1XIL A;  2QDO A;  3ZBH A;  2DOS A;  3L72 H;  1BL8 A;  3I5D A;  1HR0 B;  3B40 A;  1Q7Y W;  3LNM B;  3LNN A;  2QWR B;  4QE7 A;  4LFA O;  4ZI7 B;  3SYA A;  1YJN V;  1LUW A;  3ZX6 A;  4LP8 A;  1VMG A;  1I5Y A;  4YHH B;  4O4I B;  1BS3 A;  1GTO A;  1MG1 A;  4CH6 A;  3UO3 A;  3ABK C;  2WLH A;  1G1X B;  2GDS A;  1NJI W;  2QKA A;  3RBZ A;  4UCS A;  4QE9 A;  2VRZ A;  1JR9 A;  4JAA A;  3RFR A;  4GCZ A;  1HDJ A;  2NLJ C;  3RWR D;  2VQE B;  3MHH C;  4MVM A;  3M99 B;  2ZNJ A;  4B7K A;  1PV0 A;  2ZIM A;  3ZMS A;  1SQP H;  2D3O W;  3JCU Z;  1PD3 A;  3ZHU A;  2B1I A;  4BW5 A;  1FXK C;  1Q8I A;  4I55 B;  3AG2 C;  5D5Q A;  5GTI Z;  4A5U B;  1AR4 A;  1FJG O;  4KHP O;  4LF6 B;  3UM7 A;  5L3G A;  3K5L A;  1H2L A;  3OEH G;  4O2B A;  1N4C A;  3WG7 B;  1HWY A;  1MZF A;  1SQV H;  2YC0 A;  4Z1M G;  3ZED A;  1Q82 W;  2Q69 A;  1EN5 A;  3K06 A;  4D7T A;  3D3I A;  3HKD B;  5LOV B;  1WPX A;  1WPB A;  3QG5 A;  3ZHQ A;  3APO A;  5BR8 O;  1S76 D;  2JS5 A;  2Q0A A;  3D3Q A;  5LHI A;  3G4S V;  4QIW F;  2RNB A;  1VQ6 V;  1ZSP A;  5L3E A;  1TUB B;  3H1L H;  2UXB O;  2OTJ V;  4RWU A;  4PDR A;  2PYJ A;  5LOV A;  3BEH A;  1YDX A;  4DV0 B;  3J81 N;  4FLZ A;  2GSM B;  4CH5 A;  1H2S B;  3HKD A;  4MTO A;  4XBF A;  3W7U A;  3CCE V;  1G6U A;  2Y4T A;  5JCO A;  4CZZ A;  3ETD A;  4JV5 O;  1JJ2 U;  3DC5 A;  1R6K A;  2IU0 A;  3AG3 C;  2C2A A;  2CE4 A;  1W0J G;  2O57 A;  3WFV A;  3F7Y C;  5IY5 C;  4DUY O;  3FAV A;  3ZRV A;  1Y74 A;  3ABK B;  5LXT B;  1QLE C;  1BQZ A;  5CA0 B;  2EIM C;  5LA6 A;  3BRC A;  2EIN C;  1QCE A;  4DO2 A;  1I94 B;  1EZV H;  4KUM A;  4YIO A;  3ASO B;  2Q6A A;  2W6I G;  4ZHQ A;  1W2B U;  1FYJ A;  3WB2 A;  4ZI7 A;  1YIT V;  2Q67 A;  5B5E Z;  1M1K W;  1H38 A;  2WPD G;  1BHB A;  3K3W A;  3APQ A;  2LW1 A;  2FB5 A;  1L1F A;  4RAI A;  3JAS A;  4LF9 B;  5FLX N;  1NTZ H;  2ADQ B;  2JGD B;  3FYI B;  1GK9 A;  1SQF A;  3CHX A;  1QNM A;  1KKD A;  3CE2 A;  5KA6 A;  2KQX A;  5B1N A;  1GN3 A;  1R3K C;  3SYC A;  1NVP B;  1Q43 A;  2LFR A;  3H1H H;  3B2E E;  4K0K B;  4EEQ A;  3CJH B;  1DF5 A;  3ZN0 A;  4DV5 B;  5IYC O;  3SPG A;  5A9G A;  3CME V;  3B09 A;  3PJS K;  4J42 A;  1RFY A;  1AP5 A;  4RUE A;  1A32 A;  5B66 Z;  1W59 A;  4DV6 B;  5LXT A;  3JAL B;  2B9Z A;  3Q4H A;  2Y69 C;  1CPY A;  1FPO A;  1VQK V;  1H2N A;  4X62 O;  3RGB A;  1QR9 A;  3FB8 C;  3OTO B;  1WP8 A;  3ZRW B;  2QGN A;  4LF4 O;  1K4C C;  2WLJ A;  5K1X A;  3IAY A;  1NVP D;  1F4N A;  3SPJ A;  2XT9 A;  4GKK O;  3E83 A;  2A7W A;  2W0F C;  1EZJ A;  5DED A;  1PKX A;  4MS2 A;  3ZJZ A;  5JVD A;  2BE3 A;  3GWK C;  1WAZ A;  4B3T B;  2QKS A;  1F51 A;  3NR7 A;  4B3R O;  1Q90 D;  2ZE7 A;  3CXC U;  2NN4 A;  4DR7 B;  5CBH A;  3RYI A;  1TVK A;  2Y4U A;  2YID A;  1PNM A;  5L3D A;  2DWE C;  1JA8 A;  5JJE B;  3HR0 A;  2Y48 A;  1Y74 B;  2AZ0 A;  1JX9 A;  4DV6 O;  4G28 B;  5IJ9 B;  2IJK A;  1VQN V;  2JVD A;  2A0L A;  3JCZ A;  3TCU A;  4NTX A;  3OFN G;  2P06 A;  4O2B B;  3OAA G;  2D2C B;  4K8Z A;  4YJ3 A;  5H6Q A;  3FB7 C;  4H44 B;  4E2L A;  3OEE G;  4FZ1 A;  2ZXW B;  2QM4 A;  1JMK C;  3D8C A;  2P67 A;  1MSW D;  5KMG B;  4LF7 O;  3D36 A;  1PPJ H;  1E1R G;  1SC5 B;  3OTO O;  2IJH A;  3LDC A;  1VEW A;  1IZ3 A;  1K97 A;  4TQD A;  4X66 B;  3T1C A;  3R66 A;  1FXK B;  1JPX A;  3ABM B;  3J80 N;  3U10 A;  1S3J A;  4WFA V;  2Z5U A;  3QO7 A;  5J2U A;  5KHG A;  2FYU H;  5BMV A;  1HR0 O;  3CP1 A;  2HJF C;  3BA9 A;  4PA6 A;  5EBL C;  2ODM A;  4UB8 Z;  1KUQ A;  1URF A;  1H2K A;  1IBL B;  1T5E A;  1JVM A;  1G8M A;  5K1P A;  4QPJ A;  3BFR A;  5GTH Z;  4UUJ C;  3AEI A;  3CRA A;  5EC1 C;  5LA6 B;  2ADP A;  2Y69 B;  4NXN B;  2YI8 A;  3HKE A;  3TXQ A;  1XL4 A;  2L6L A;  3C3S A;  4JI1 O;  5FNV A;  1R3L C;  4D6T H;  1DK1 A;  4UCR A;  2LJ2 A;  3L73 H;  4ZOL A;  5LP6 C;  3N27 A;  4PA7 A;  4MVQ A;  3EVK A;  3T1H B;  3FX7 A;  3ML0 A;  3AK3 A;  4DV7 O;  2LP7 A;  1P7B A;  1UFI A;  4KL1 A;  3RYH A;  2YXY A;  4KHP B;  1DF4 A;  1AJP A;  1AR1 B;  2HFE C;  1RP3 B;  3IFX A;  4I4T A;  3E8G A;  4WFF A;  2JGD A;  3F7V C;  2E75 B;  1LR1 A;  4GKJ O;  2WA4 A;  4PEL A;  2ZXW C;  5DEC A;  2IM9 A;  2Q9L A;  2R9A A;  1CXZ B;  4K35 A;  1GM7 A;  1QLE B;  2HVJ C;  4UVA A;  2AGA A;  1KKC A;  2RMK B;  1ZL8 B;  4JTD B;  4LFB O;  4XDJ A;  3TET A;  3EFF K;  2DQ0 A;  2Q4P A;  3ZN1 A;  3QO5 A;  3FFQ A;  1OCZ B;  4UCT A;  4JGS A;  2P90 A;  4DR1 O;  5B1A C;  1YZB A;  3CEI A;  4PDM A;  5JJJ B;  2BOC C;  5CB4 A;  4JAS A;  5IYB O;  2EIN B;  2ITD C;  2ZDI C;  1R3I C;  4H33 A;  3T1H O;  3AG4 B;  4I50 B;  4BWA A;  5E79 Z;  3CX5 F;  3BAA A;  3QVN A;  2N05 A;  2LGQ A;  4J9Y B;  4FLU A;  2YI9 A;  4IYI A;  5LMU B;  1B04 A;  3E8B A;  2F23 A;  5EIB D;  3DSQ A;  5IT9 N;  3TXS A;  3RYF A;  2LQT A;  3BVO A;  1XL6 A;  5FNV B;  1K7D A;  2UXC B;  3JAK A;  4DV2 O;  3T4D A;  3E8H A;  2R70 A;  4TV8 B;  4CC5 A;  2M7W A;  4DR4 O;  1UPG A;  3JAR B;  2DMX A;  2CTR A;  2JRI A;  4LH7 A;  4H13 B;  1D2D A;  1TUB A;  5IJ0 B;  5CB4 B;  2ARH A;  4DK1 A;  2EJR A;  4G2K A;  1KB9 F;  4JI8 O;  1OJH A;  3X2Q B;  4G27 B;  3K58 A;  4FZ0 A;  1AR5 A;  1QU7 A;  1BMF G;  1LUV A;  3F5W C;  1VQ4 V;  2B5U A;  2OCC B;  2CH7 B;  2P22 C;  5LYJ A;  1XHX A;  2EIL C;  3DGE A;  2ZD9 A;  4BR6 A;  3OM3 B;  1K5S A;  5BY1 A;  4WCE V;  4JPR A;  3RVZ A;  3E22 B;  1Q81 W;  4X1I A;  2Q0O C;  4PDV A;  3IGA C;  1JCH A;  1H2G A;  1HNW B;  3AG3 B;  4LF5 O;  4JTA B;  2N74 A;  2FL4 A;  5JJN B;  2WLK A;  4GUN A;  5C8Y A;  5KUM A;  4AHC A;  5EYP A;  2E3C A;  1N36 O;  4PI0 A;  1GAX A;  1NT2 B;  3CC4 V;  4HNA B;  1VQ7 V;  4KFM A;  4QPK A;  4DR3 O;  4B3T O;  4W4L A;  4J7Z A;  1Y76 A;  2PUS A;  4ZBM A;  4B3R B;  4PA4 A;  4YJ2 B;  4NKG B;  3K0G A;  2XAG A;  4ASU G;  4DR7 O;  1WLE A;  1QLN A;  4JI0 O;  4BW9 A;  1M90 W;  2M6Y A;  3RW0 A;  1YTF D;  1B6Q A;  4WBN A;  1UJW B;  4F6R A;  3CWB H;  5H9C A;  1N34 O;  2HHH O;  1GRJ A;  1YEW A;  2W0X A;  4I4T B;  2QM7 A;  2ZT9 B;  4AQY B;  4LFC B;  1K9M W;  2ZNI A;  4Q20 A;  4NR1 A;  4JV5 B;  1VIB A;  1KMI Z;  2GV9 A;  1FFX A;  1JJO A;  2YIC A;  3ZS8 C;  2UU9 O;  3CRR A;  4TOI A;  1N0J A;  2BTQ A;  2RCV A;  3JAL A;  5KAF Z;  3CCJ V;  2H8P C;  2RDC A;  4FPP A;  3T1Y O;  4DRX A;  1Y76 B;  3JD4 A;  5IE9 A;  3SPC A;  1JOY A;  2AW9 A;  2XHB A;  1EN6 A;  3ETE A;  4FFB B;  4QJF B;  4YY3 O;  1US6 A;  3OMI B;  2XAJ A;  3G80 A;  1JQ0 A;  2V4D A;  5IWA B;  2OIG A;  4ABM A;  5JH7 A;  1QBZ A;  1RM1 B;  1V54 B;  1H8E G;  2RJZ A;  4HBN A;  2JDI G;  2QWO B;  4DR6 B;  5EBW C;  1BQ0 A;  2NNU A;  4ZOL B;  3CC2 V;  3GB7 C;  4MVR A;  1M56 C;  2VQF O;  5B3S C;  3G67 A;  4IHJ B;  2QKC A;  3DXR B;  3ABL B;  4WFB V;  2UXD B;  5KLV H;  1N34 B;  4I5S A;  1ENV A;  2MW2 B;  3QTC A;  2Q73 A;  4IYH A;  3L74 H;  1XNR B;  5J2T A;  2YXL A;  2V7Q G;  3OR6 C;  4C7U A;  5GON B;  4JF3 A;  3K9S A;  4MT8 A;  3FKS G;  4X1Y A;  2QWP B;  2WWW A;  4DR2 O;  3BAB A;  1OCO C;  2IU3 A;  2H94 A;  4DYL A;  2BCC H;  2CK3 G;  2IH1 C;  1TAE A;  3JAK B;  3OE7 G;  4EKW A;  2K9P A;  1RSO A;  1HNX B;  5CA1 A;  4EB6 A;  1SF9 A;  2OWO A;  1XMO B;  4J11 A;  3G71 V;  1KQS U;  1E79 G;  3I55 V;  2F4V O;  2OTL V;  3UT5 B;  1O9G A;  2ZIN A;  4UFZ A;  3N2K A;  2UXB B;  2F1M A;  4B3S B;  2X6B A;  3ABU A;  2GTA A;  2HKO A;  1N33 B;  2P4V A;  5GON A;  3G6E V;  4J9Z B;  5ITZ A;  5IWA O;  1GN4 A;  3SGI A;  4UCV A;  3E22 A;  1DLB A;  1L0N H;  1XUQ A;  1SQX H;  3TK1 A;  3JD2 A;  1XI1 A;  2AHZ A;  4MW8 A;  4GX5 A;  4DR6 O;  3FB6 C;  2ZE6 A;  5B1B B;  3JSN A;  4LFB B;  1V9P A;  4J10 A;  2EZP A;  1AJN A;  4O4J B;  2JJ2 G;  4TV9 B;  1VQ5 V;  3ZMV A;  1COW G;  1VQ8 V;  1SZT A;  1S77 D;  4PA9 A;  1XNR O;  1RPO A;  1F23 A;  1R73 A;  1NH2 D;  3OMA B;  1XMQ O;  4O4H A;  4EFE A;  1GM9 A;  1ZUQ A;  5JCO C;  1AI6 A;  4DV4 B;  1PNL A;  1NU1 H;  2CGO A;  3IC9 A;  2P4K A;  3SPI A;  4GYC B;  1GKF A;  5EYP B;  3JAW B;  3GVM A;  1WJZ A;  4FMT A;  5B1O A;  4L87 A;  4DUZ O;  5DN6 G;  5J9P C;  3UQ8 A;  4J7K A;  2YUA A;  2FTK A;  1AIL A;  3HKB B;  2YEV A;  4TSF G;  4FLY A;  1XHZ A;  1D5N A;  4DV3 B;  2YXH A;  1XMO O;  3K0D A;  5IYZ B;  1SQB H;  1R6T A;  3ZMT A;  5EBM C;  4X64 O;  1NR1 A;  2G38 A;  4I7Z B;  4FM1 A;  2Y0P A;  1XRE A;  3M8A A;  2KB1 A;  1NTM H;  1Q6I A;  3H1K H;  3W7S A;  2F95 B;  3ASN C;  3AG7 A;  4O4L A;  1FAF A;  4NXN O;  2QA4 V;  2HG5 C;  3HB3 B;  3RYI B;  3CCS V;  2X0L A;  2EUL A;  4X8A A;  3AK1 A;  4WFG A;  1O9H A;  1KP2 A;  1VF5 B;  2DYR C;  2Q8V A;  4PV1 B;  3SJA C;  3ZHV A;  2ILM A;  4N23 A;  1EM1 A;  3T4Z A;  3J7A U;  5EZY B;  3K59 A;  4GX0 A;  1M5I A;  5DM6 V;  3WG7 C;  4CH3 A;  2QTO A;  4LF4 B;  5L3B A;  2WLL B;  2UXN A;  3G6B A;  3N2G A;  4CS3 A;  4LC1 A;  5KMG A;  2EIK B;  3OMN B;  4NVP A;  1ORQ C;  1YJ9 V;  3THO A;  5LBQ A;  4P9P A;  4O2A A;  1FXK A;  1I94 O;  4BAY A;  2UUB O;  1CEZ A;  4I0X A;  4X64 B;  4YHH O;  1M56 B;  3RYC B;  3KKY A;  4NXM O;  1TGO A;  1P84 F;  2PGG A;  3KG2 A;  5GW7 A;  2R72 A;  4O4H B;  2CGN A;  1NR7 A;  1DTO A;  3VQX A;  4CS4 A;  4WFH A;  4B7E A;  4X65 B;  4JI0 B;  1PP9 H;  4LCU C;  1VF6 C;  4JI7 O;  2OCC C;  3H9V A;  4RQF A;  2MK3 A;  1IUR A;  4DRX B;  1PM9 A;  3S3X A;  4UVB A;  5C93 A;  2E74 B;  5JVD B;  3K57 A;  1S5H C;  4QGP A;  2F93 B;  1KU9 A;  2QSA A;  3B4S A;  3RVY A;  3CCM V;  3SJQ C;  5IYZ A;  4LF7 B;  3HKC A;  3K03 A;  4U3F H;  4RO2 A;  2R9I A;  3JAW A;  4LWS A;  4TQF A;  1BSM A;  1V55 C;  4LNU A;  4X88 A;  5CBG A;  2CTW A;  1U97 A;  5HFL A;  3B8M A;  2EIK C;  4FLV A;  2PI5 A;  4R7C A;  2JS3 A;  2KSD A;  4GKK B;  3WU2 Z;  1HNZ O;  2ETN A;  4LH6 A;  2LW7 A;  3MHS C;  1PL0 A;  4LNU B;  2DWD C;  5JQG A;  2HJD A;  3D36 C;  3H1J H;  2DE0 X;  5LGT A;  1FS0 G;  1OCC C;  4KXR A;  1Y67 A;  4UXN A;  1QR8 A;  5IY5 B;  1MA1 A;  2ZE5 A;  4TV9 A;  3EHB B;  2PF4 E;  3OT7 A;  1KD1 W;  4JI8 B;  1J95 A;  2ZQM A;  5LL6 Y;  1RSO B;  3CB2 A;  1NTK H;  1AI7 A;  3JSL A;  3OD4 A;  1N32 O;  3AG2 B;  4FVM A;  3JD3 A;  1YCI A;  5LGN A;  3JYC A;  4I55 A;  2CUG A;  3STL C;  4BIZ A;  5CMU A;  1IBK O;  3CCU V;  2BSK A;  2VWJ A;  1S0V A;  4ZKI A;  4DUY B;  1L8D A;  1ARO P;  2H3O A;  2WAM A;  5FL7 G;  2WLI B;  1FD9 A;  4PJ0 Z;  4LF5 B;  3A0B Z;  5HFM A;  3CPW U;  2E5L B;  3CCR V;  1JFF A;  1YF2 A;  5KX5 B;  4JI3 B;  1N36 B;  4P9O A;  1V54 C;  1FXH A;  4CBC A;  1CP9 A;  4UV8 A;  4GLX A;  5C8Y B;  3X2Q C;  5LP6 A;  1Q6H A;  2Z0A A;  3ZHR A;  1U96 A;  1Y66 A;  2ZM6 O;  3SYQ A;  1Q3E A;  2EJ7 A;  2EZO A;  4B3S O;  4YIP A;  4U3J B;  2X6C A;  5E1A C;  1I5X A;  1HW7 A;  5KHH A;  3RYF B;  1S5J A;  4U7O A;  5CA3 A;  4H37 A;  3WB1 A;  3O65 A;  5LP6 B;  5IDJ A;  2HLD G;  1SZX A;  3L75 H;  4JYY A;  3K5O A;  1Y4M A;  3FAV B;  1NQT A;  4PA3 A;  2PI4 A;  3ZRS A;  1THZ A;  4JZG A;  2FKX A;  4JI1 B;  4LF6 O;  2E5L O;  4HYO A;  2OIE A;  1GMG A;  3SDL A;  4MVZ A;  1NBM G;  2EIM B;  2DJV A;  4DV7 B;  3CD6 V;  1QHT A;  3DC6 A;  2OT5 A;  1KC8 W;  1IXM A;  3E89 A;  1Z2G A;  5L3F A;  4HZ3 A;  4FM0 A;  3K04 A;  3A2F A;  4NTY A;  4DV4 O;  1YI2 V;  1AB3 A;  4GX2 A;  1N8R W;  3AG4 C;  3OW2 U;  4JYB A;  5KHI A;  1BT8 A;  2K1E A;  1N0N A;  4O4L B;  3ZIA G;  1OCO B;  3H01 A;  2AHY A;  1X4T A;  5B1A B;  2UXC O;  4I9W A;  4K3A A;  5CA1 B;  2HP8 A;  5KA5 A;  3FB5 C;  4DV0 O;  4LFA B;  2DW4 A;  2ZM6 B;  1QVG U;  2YDE A;  2DN9 A;  1ZL8 A;  4D7S A;  1M57 B;  4O4J A;  4TWK A;  3BCC H;  2CTQ A;  3LDD A;  5EK0 A;  2EIL B;  2WLI A;  1GN6 A;  2ZR3 A;  1VQO V;  4DR5 B;  1SES A;  2KG7 A;  4KP4 A;  1SQQ H;  3R65 A;  4MW3 A;  1Z5W A;  1MSD A;  3L9D A;  1EFR G;  1OHH G;  5TIS Z;  2E76 B;  2XUM A;  4K8X A;  1ZAU A;  1SA0 B;  4FLX A;  4JAV A;  2IJJ A;  2LFS A;  4JI2 O;  4FLT A;  1P7G A;  1DGS A;  3CRM A;  4U7N A;  3AG1 B;  1FXV A;  3BY6 A;  3JAR A;  1AVM A;  4PDL A;  2JIZ G;  4IIJ B;  1OCR B;  2WSS G;  1P4R A;  3K79 A;  2UUA B;  4LF9 O;  1H8H G;  1N33 O;  2JJ1 G;  2AZ2 A;  3OUS A;  4X66 O;  4F6E A;  3LSU A;  4E4E A;  4LF8 B;  4FLW A;  5JH7 B;  4NXM B;  4CC6 A;  1IBM O;  5H2F Z;  1OZ0 A;  1Q5O A;  5EIB C;  2XAS A;  3UKM A;  3VOU A;  1M57 C;  2EIJ C;  4PHZ A;  1VQP V;  2P5O A;  1Y6X A;  1J5E B;  3DXR A;  4JAU A;  1R1B A;  2CAZ C;  5KX5 A;  2QEX V;  3S3W A;  4DV1 B;  2W6J G;  4UCU A;  1YIJ V;  2WLL A;  5L3C A;  1NZ6 A;  3B77 A;  4WBN B;  3IJ4 A;  3TGU H;  1K33 A;  1R6N A;  3SR2 C;  4ZHQ B;  4RUF A;  5KHK A;  2UXX A;  1FKA O;  3KZI Z;  4YXW G;  4B3M B;  1SER A;  2UUA O;  1XMQ B;  4GX1 A;  2LGW A;  1YVW A;  4X1Y B;  3ZMU A;  4Z2W A;  2UUC B;  3SJC C;  2YSU B;  3RYC A;  5IJ9 A;  2FML A;  4JI2 B;  4I50 A;  4HNA A;  4LF8 O;  3KCX A;  1SKV A;  1XNQ B;  2RQ6 A;  3DTU B;  4F6R B;  2Q7E A;  3A8T A;  3ZMZ A;  2B1G A;  4MSW C;  2PTM A;  2F43 G;  3QNE A;  2VQF B;  2P6J A;  3EXA A;  1J5E O;  3CXH F;  2JK5 C;  5ITZ B;  4NTW A;  1IXB A;  4J80 A;  3BPZ A;  4H0L B;  3I56 V;  2WLM A;  3SYO A;  2A79 B;  2PYL A;  2IBZ H;  2CTP A;  4UVC A;  4DR1 B;  2YIB D;  2JGU A;  5BMV B;  1IBM B;  3JD0 A;  1I08 A;  5KHJ A;  3W7T A;  4OGQ B;  1K5Q A;  4J7J A;  4FFK A;  2QWQ B;  5CN0 A;  3P3P A;  4YJ2 A;  4LBE C;  4R50 A;  4LWS B;  4HAM A;  3SYP A;  4X20 A;  1B06 A;  1YJW V;  1NS1 A;  2X7R B;  4CS2 A;  4DV1 O;  2QM8 A;  3C90 A;  3MD0 A;  3GWO A;  4FK5 C;  3U11 A;  2IJI A;  4FM2 A;  2ZE8 A;  2UU9 B;  1P49 A;  1S5L Z;  2ZIO A;  1NKD A;  3JD1 A;  1D5A A;  4MVS A;  2V1D A;  3CSX A;  5KUK A;  2OCH A;  1M4U A;  1SS3 A;  5CA0 A;  3CJH A;  3WB0 A;  4O2A B;  5J2T B;  1GO3 F;  2GBO A;  1QQC A;  4CH4 A;  2A9H A;  3CRC A;  4UV9 A;  4I9Q A;  2CDY A;  4BIO A;  1PNK A;  3AG1 C;  1VQM V;  4BIU A;  1XNQ O;  3CC7 V;  4NB5 A;  2OYQ A;  1SET A;  5IYD O;  2XND G;  3E35 A;  3A0R A;  2P7T C;  1SA0 A;  2ATK C;  2Z3Y A;  4FIP C;  1FFT B;  1QVF U;  4AI8 A;  4RQE A;  2ZDI A;  2BSK B;  3HPL C;  2YIB A;  1KEC A;  2PY5 A;  1F4M A;  1OCC B;  4OPH A;  1ZWI C;  3ASO C;  3E2E A;  1MOF A;  1XEQ A;  4PI2 A;  3MDS A;  3CCQ V;  1MNG A;  3HKE B;  5LHH A;  5KAI Z;  3CMA V;  1VAR A;  1BHA A;  1VQ9 V;  1I7F A;  2XTA A;  4IHJ A;  2NR5 A;  1HNW O;  3VQW A;  1NH2 B;  1Z5V A;  2PZS A;  2QJ1 A;  1EN4 A;  2Q5Z A;  3E86 A;  4DR2 B;  3QO8 A;  1ZLZ A;  3W7W A;  4JI5 B;  2BTO A;  1BCC H;  4NYK A;  3F5T A;  4IIJ A;  4TUY B;  3ZHT A;  1FFX B;  2VS0 A;  3LSQ A;  5IJ0 A;  3SPH A;  3OGC C;  4JI4 B;  1K34 A;  3C3T A;  4GKJ B;  4IL6 Z;  1HNX O;  1JFF B;  5D5P A;  1TA8 A;  1XQ8 A;  2DYS C;  1W0K G;  4DV5 O;  1RPR A;  1SRY A;  1MMM A;  3ABL C;  3B8N A;  3NXS A;  3OUF A;  4F4L A;  1F7Y A;  4ICG A;  4Z1V A;  1B3Q A;  3OTF A;  1H2M A;  1X59 A;  3QF7 A;  1WN7 A;  4P2Z A;  3T2M A;  1IBL O;  2YS8 A;  4K0K O;  1L0L H;  1OV9 A;  4FFB A;  1RM1 C;  4GT1 A;  3A0H Z;  1K73 W;  3MAQ A;  1OCR C;  4UB6 Z;  3Q4H B;  2HVK C;  5F2V O;  1M9N A;  3ABT A;  1SQG A;  4ZIB A;  5H6R A;  1YHQ V;  4DR5 O;  3JAT B;  1FJG B;  5FPR A;  1VQL V;  1KBH A;  3T1Y B;  2HHH B;  2ZR2 A;  1WA8 A;  1VF7 A;  3ASN B;  4J41 A;  3VQV A;  4OX9 O;  1K8A W;  2RN9 A;  3LDE A;  1YSC A;  3AK2 A;  4JI4 O;  1I0H A;  4EFB A;  5BR8 B;  4IGG A;  1TVK B;  2R9R B;  2JEU A;  1V55 B;  4MTX A;  2UUB B;  4JI5 O;  5J2U B;  5LGU A;  3CCL V;  2YEV B;  4JI3 O;  4TT3 G;  4X1I B;  4GZR B;  4DV2 B;  2DYR B;  1Q86 W;  1EBO A;  4X1K A;  2UXD O;  2EBO A;  3N2K B;  4X65 O;  4R6Z A;  3ZHS A;  1AI5 A;  2QE7 G;  5LHG A;  4O4I A;  4MVO A;  4JI7 B;  3KCY A;  3P3N A;  4JI6 O;  2KKW A;  4TUY A;  2XAF A;  1OCZ C;  1KYO F;  2HR3 A;  3P30 A;  4OXS A;  3OR7 C;  1YTF B;  5JWP A;  2EX3 A;  3K5N A;  1AJQ A;  4JZ2 A;  5FPO A;  4JYC A;  2IW5 A;  4X1K B;  4JYA O;  3W7X A;  2ITC C;  3PN1 A;  3RYH B;  4DW1 A;  3K08 A;  3BA8 A;  1AP6 A;  4R8C A;  1AI4 A;  1XOU A;  5B3S B;  5LMN O;  3JAM N;  3LUT B;  3CS5 A;  1LNQ A;  1ROP A;  4B3M O;  4OX9 B;  2BOB C;  2YIA A;  2HEP A;  3P32 A;  4TV8 A;  3H1I H;  1XBL A;  2IH3 C;  2ZKO A;  3CYO A;  4AIL C;  1R3J C;  1WP7 A;  2LO1 A;  2F4V B;  1WB8 A;  4Q6G A;  1YXB A;  3E8F A;  4X20 B;  2QWN B;  4YJ3 B;  3FYE B;  2BTQ B;  2XOK G;  2X6A A;  1N32 B;  2L35 A;  4FJC C;  4IT5 A;  1HP8 A;  5AG2 A;  4DR4 B;  1NI8 A;  2CH7 A;  1GH6 A;  3JAT A;  4PD4 F;  1IBK B;  1K3E A;  4L8J A;  1G4Y B;  3BHP A;  4QNH B;  4LFC O;  3HKB A;  4W4K A;  4X89 A;  4JYA B;  5JQG B;  4X62 B;  4JI6 B;  4WF9 V;  3O9O A;  3OGI B;  2EIJ B;  5BZB A;  2KG7 B;  3CRQ A;  2F66 C;  3K5M A;  2GUZ A;  4XDK A;  4XDL A;  4UCO A;  4DW0 A;  1WNS A;  1BE3 H;  1IX9 A;  2A3Q A;  1E1Q G;  1ZTE A;  5LMN B;  1PL4 A;  1Q6U A;  1KP3 A;  2Q7G A;  3UT5 A;  3ZRX A;  1K4D C;  1M93 A;  3ABM C;  1BGY H;  4YY3 B;  3ETG A;  2GUZ B;  5B1B C;  2DQ3 A;  1IVS A;  2GHY A;  3JAS B;  1BZK A;  3K9A A;  5EZY A;  3SJB C; 
#chains in the Genus database with same CATH homology
 3FAV B;  2B9Z A;  3Q4H A;  1WA8 B;  1WA8 A;  3G80 A;  4GZR B;  3HR0 A;  3TXS A;  4ABM A;  2AZ0 A;  3Q4H B;  4I0X B;  3GWK C;  2AZ2 A;  3FD9 A;  3O9O A;  3OGI B;  3GVM A;  2KG7 B;  3FAV A;  2VS0 A;  3ZBH A;  4I0X A;  3TXQ A;  4LWS A;  4LWS B;  2VRZ A;  2DE0 X;  2KG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...