4ABMA

Crystal structure of chmp4b hairpin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
79
structure length
79
Chain Sequence
b'GAMEQEAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTKNKRAALQALKRKKRYEKQLAQIDGTLSTIEFQREALE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHARGED MULTIVESICULAR BODY PROTEIN 4B
publication title Cc2D1A is a Regulator of Escrt-III Chmp4B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 38
structure length 79
sequence length 79
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 4abmA00
3TXSA 3HR0A 4LWSB 4I0XB 3FAVA 3GWKC 2AZ2A 2VS0A 4ABMA 1WA8B 3Q4HA 2AZ0A 3G80A 3GVMA 4GZRB 3OGIB 2KG7A 3FAVB 2DE0X 3Q4HB 4LWSA 4I0XA 2VRZA 3O9OA 3FD9A 1WA8A 2B9ZA 3TXQA 3ZBHA 2KG7B
chains in the Genus database with same CATH superfamily
1NI8A 3CC2V 2EIJB 2KQXA 3E22B 2JGDB 4PJ0Z 2Q0OC 4GKJB 3HKDA 3CP1A 1T5EA 1JX9A 4UVAA 1NS1A 2XAHA 1QVGU 1AP5A 4J7JA 4CH3A 3ZRVA 4X66B 2QWPB 4CBCA 3L73H 4MS2A 5JVDB 4O4HA 3ASOB 2FL4A 3BEHA 4JI2O 1RP3B 3C3SA 4GT1A 3G4SV 5H6RA 1XNRB 1OCRB 1J95A 2E5LO 1I94B 1PL0A 3SYOA 3B8MA 4LNUB 4TV8B 1IVSA 3LSQA 4ZI7B 1JR9A 5C8YB 5JH7B 1BHBA 2RMKB 3D8CA 4I50B 1V54B 1SZXA 1KP2A 4NB5A 5EBMC 4EB6B 3OR6C 1H8EG 3PJSK 2AGAA 2Y0IA 4YHHB 1JQ0A 4DR2O 2DQ0A 2YICA 2CUGA 2FTKA 2K1EA 2O57A 3JALA 4FFBB 4QE7A 1HNWB 1H8HG 1KKDA 3TXQA 4UCRA 4JAUA 1RSOA 1ENVA 2WWWA 4MVMA 1LUVA 4ASUG 4CH5A 3ZEDA 4JI0B 3HKEA 3JARA 1KBHA 4O2BB 5IY5B 4KL1A 5GONA 4J7ZA 3RYIA 4YXWG 3JD1A 1HW7A 1F4NA 3ICXA 2XAQA 3AG1C 2UXDO 1YJNV 4DV6B 2EIMC 1VQLV 1GMGA 1OHHG 1PP9H 3MHSC 4B3SB 3ZHUA 1WJZA 5CA1A 4FLVA 3T1YO 4KHPB 2QGNA 3SPHA 5J2UA 2EULA 2IJKA 1Z5WA 4FZ1A 1IBLO 3D36A 1XHZA 5EC1C 2IH1C 2FB5A 1SQBH 2L35A 2BTQA 5DECA 3BA8A 4IHJB 3K3WA 2ZE8A 4FZ0A 2ZIMA 1CPYA 3JATA 3CCEV 4LF6B 1AROP 1US6A 3ABKC 4DW1A 4YJ2B 4JYAB 5KHJA 4JPRA 3RYHA 2AXTZ 4X64O 1JA8A 1VF7A 4HBNA 1KECA 1BQZA 1AJQA 2D2CB 1V55C 2ETNA 5LOVB 3UT5A 4EFEA 2A06H 4UVBA 1FD9A 1B6QA 3QO8A 2VQEO 1COWG 3ZN0A 4NXMO 4LR3A 2EILB 4JYYA 5IJ0A 2X6AA 1VQNV 4QIWF 1E79G 1V9PA 4YJ3B 1ZSPA 5J2TA 1O9HA 4JTCB 1EN5A 4KXRA 3ZX6A 4CC5A 2ZDIA 2QWRB 4X65O 1G1XB 1OCZC 2YS8A 4FLTA 3KKYA 3RGBA 2YSUB 4LFCO 4DRXB 4F6RA 3SPCA 1K4DC 1FFXA 2ARHA 4X62O 1Q86W 4DR7O 4CS2A 2R9AA 5FPRA 1S77D 3FYIB 3ABLC 5KAFZ 3G6EV 4X1KA 5JCOC 2B9ZA 3LDEA 2B1IA 2YEVB 3OMNB 5F2VO 1D5NA 4X9QA 5L3GA 1RM1C 5BZBA 4QPKA 4JI7O 2WLLB 3R66A 4K0KB 3RBZA 1GN4A 3ML0A 2DN9A 2P4VA 4OXSA 1S72V 1D5AA 3E8HA 3E22A 3UO2A 5EZYB 2JGDA 4JTDB 1FS0G 2F93B 1R3IC 3STLC 1NZ6A 2GTSA 2YC0A 1F51A 5D5QA 5BXZA 5IWAB 1QR9A 2WA3A 5JVDA 1OCCC 2RJZA 2GUZB 3OUFA 1SQXH 4R7CA 1IDSA 3VBBA 3CCQV 4LF9B 1V55B 4G27B 2EZOA 5H5NA 3SJAC 3N27A 4LNUA 4TV8A 1K8AW 3ZMZA 4WFEA 4ZI7A 5C8YA 4XDLA 5JH7A 2Q67A 4FFKA 5KA6A 4JI6B 2CTRA 4I50A 5B1BB 3BA9A 4GKKO 2OCHA 2PI5A 2YXHA 5IYBO 4EB6A 1L8DA 1K5QA 2R9IA 1K73W 2QTOA 1JCHA 3UQ8A 1DGSA 4AILC 2JS5A 1I08A 3RT3C 2Y69C 3B09A 4FFBA 3PN1A 2ZE6A 2ADQB 2QR4A 2KG7A 1OCOB 2Y0PA 3ZN1A 5KLVH 2Q68A 2UXNA 3OTOB 1R73A 3RVYA 2JJ2G 1TA8A 2DWDC 1MMMA 3ABLB 1W0JG 2ZINA 5B3SB 2L6LA 4O2BA 3BFRA 4UCVA 5K1PA 5E1AC 2GBOA 2OTJV 1H2SB 3WB2A 1Y67A 2A7WA 2LW7A 4C7UA 3O9OA 2UU9O 3B4SA 3D3QA 1JOYA 1AP6A 4GCZA 4JF3A 1K9MW 4DV1O 1VQOV 2XT9A 1Q5OA 1RFYA 1WN7A 1JJOA 3CE2A 1BQ0A 1KB9F 1YXBA 4OX9O 3AG2B 4PA3A 2UUBO 1XDCA 2WLNA 1WP8A 3CCRV 3LDCA 5KMGA 3ZMTA 4P9OA 1IBKB 3CS5A 4UCUA 2ODMA 4Z2WA 2KSDA 3NR7A 4JV5B 1OCCB 1VQPV 1GK9A 4PDMA 1Q81W 3JARB 2GSMB 3JYCA 4IHJA 1IXBA 4MW3A 3RYIB 3ZIAG 1VIBA 5LXTA 1YZBA 3ZHSA 2ZE5A 4J9ZB 4YIOA 1R3JC 2JVDA 2UUAO 2PYJA 4P30A 5IDJA 1S76D 2F1MA 1XI1A 3L71H 4YJ2A 2P67A 3WFVA 1R6NA 5JJJB 1IURA 3RYCB 1I7FA 4B3MO 3SYAA 4JI2B 5L3FA 3E8FA 5CA1B 4LH7A 5LOVA 1JMKC 1Q6UA 4B3TB 3CCMV 3UKMA 1BGYH 5J2UB 4LFBO 3U10A 4A5UB 3T4DA 3JCZA 4OPAA 4O4LB 5B1NA 1K7DA 5LA6B 3EVKA 4AHCA 3K08A 2LQTA 2YIAA 1FXKC 2C2AA 3LNMB 3LDDA 4YJ3A 2IJJA 4FM2A 1B06A 2CE4A 2E74B 3VQXA 2PZSA 4FK5C 4ABMA 4EEQA 3ETEA 4DR2B 4Q6GA 3LSUA 5JJEB 1AI5A 5D5PA 2AHYA 2CGOA 4G28B 3A2FA 3RFRA 1R3LC 4NVPA 4DRXA 3JD4A 1M1KW 4GUNA 1MZFA 3IC7A 2OWOA 4B3RO 3AG3B 2NN4A 1OJHA 5KUKA 2R9RB 5LP6C 4JI5B 5CA3A 1IXMA 2UXBB 2Q6AA 1PD3A 3NXSA 1HNXO 2F4VO 3RWRD 1HWYA 3JAMN 2YEVA 4DR6O 4RO2A 4DXWA 3E35A 5KHIA 3A0BZ 2UXCB 1SKVA 3QO5A 5EIBC 2DJVA 1BCCH 2A3QA 1XMQO 1TVKA 2WLLA 3OEHG 1DF4A 2Z5UA 1Q3EA 1YIJV 3BCCH 2YXYA 3DTUB 4UV9A 1ZLZA 2BE3A 4EKWA 2EIKC 4I7ZB 1VF6C 1PNKA 3W7UA 4DV4B 3X2QC 1BS3A 1YF2A 2CDYA 1B3QA 1GM8A 1AILA 1NJIW 1VQ5V 2OIGA 4LP8A 5GTIZ 3JAWB 4NKGB 3ZRSA 2HKOA 5A9GA 2JEUA 3IJ4A 4AQYB 2VS0A 2F43G 4X1KB 4MVOA 2VWJA 4JI4O 1UJWB 2GTAA 3J81N 1EBOA 2OTLV 3JSNA 3RYFA 3B2EE 1BE3H 1LNQA 1ZX3A 3P32A 3FD9A 4JI3B 1H2LA 4DR1O 4DV5B 3HPLC 2PF4E 3E86A 4JI1O 3CMEV 3CCSV 1ZWIC 4GZRB 2GV9A 4W4KA 2HHHB 1YDXA 3CC4V 1F7YA 1RPRA 2YDEA 4MTFA 3HR0A 3BY6A 2X6CA 3GWKC 4JZ2A 2E76B 4I9WA 5E79Z 2DE0X 3F5TA 1GN2A 2WSSG 2JRIA 1QCEA 4IYIA 4DYLA 3ZBHA 4DV2B 3ZS8C 5KA5A 3FFQA 1P4RA 4O4JB 3CCJV 1KU9A 4LF8O 2W0FC 1Q90D 3CX5F 1GO3F 4NR1A 3TGUH 3B77A 3I56V 1H2GA 1GM7A 3ZMVA 4QNHB 1VQ6V 1BT8A 3E2EA 3E89A 1XNQO 3X2QB 4DW0A 1XBLA 1O9GA 2ZCEA 1NH2B 2KG7B 4JI7B 4LC1A 3K5NA 4LWSB 4K8ZA 4LF4O 1WLEA 1SQFA 1KC8W 2RQ6A 4J7KA 4TQDA 1VP7A 1WB7A 3OM3B 2E75B 1N32B 1P7GA 1R6TA 2V7QG 4UCOA 1M57C 4NYKA 2QJ1A 4PA7A 4DV7O 4MVUA 2QTSA 2JK5C 3QF7A 4J41A 3VOUA 4E2LA 1Z5VA 2Q73A 1D2DA 3LSSA 3T1CA 3K9SA 3A0HZ 3ZRWA 5IYDO 4ZHQB 1KKCA 4J42A 1ZL8B 3RYCA 5LMNO 1N33B 2QWNB 4CS3A 5IYCO 2P7TC 1WPBA 4WBNB 1MABG 2QSAA 3WB0A 4U7OA 1FJGO 4J11A 1AR4A 1XHXA 2M7WA 4BW5A 5KMGB 4LF7O 4O4LA 1K33A 5LA6A 2ZNJA 4OPHA 2K9PA 1FXHA 2H8PC 1N4CA 1S5LZ 2B5UA 1YTFD 1KYOF 2YXLA 2PTMA 4YY3O 2UXXA 1YI2V 1N34B 3BVOA 5LXTB 1FXVA 3M99B 5CN0A 2UUCO 1XMOO 2EZPA 4I55A 3TK1A 4RAIA 2V4DA 4WFAV 5CBGA 4LFAO 5LMUB 4CC6A 1IBMO 4WFGA 2WLIA 1Y74A 5H9CA 4DUZB 5BR8O 1VEWA 5J9PC 1BSMA 2FYUH 1VARA 4I9QA 3CRQA 2HEPA 3DXRB 5L3BA 4NXNO 1AVMA 1JJ2U 4LF5B 3CWBH 5B5EZ 3H1JH 3K5LA 1UFIA 5LYJA 1N36B 2XUMA 2Q7GA 2NNUA 2XTAA 1BL8A 4GKJO 4NTXA 1OZ0A 4O2AB 2LFSA 3MDSA 1M57B 3AK2A 3QG5A 4F4LA 4MVZA 3ZHRA 3K0GA 3MHHC 4DUYB 5B1AC 5EIBD 2CH7B 3AG1B 3JAWA 1XNRO 1L1FA 1DTOA 4D7TA 2EIMB 5ITZB 1I94O 2N74A 1XQ8A 4NTYA 4DV0B 1F4MA 4N23A 3OAAG 2X7RB 3T4ZA 1G8MA 5HFLA 4DR4B 4I0XB 4DO2A 1I0HA 2XAFA 1U96A 1Y66A 2NR5A 3KCYA 2EINC 1TVKB 4N21A 4JASA 1VQ8V 3K59A 1QHTA 2ZR2A 3IFXA 3P30A 4H0LB 4B7EA 3U0ZA 1IZ3A 1SC5B 3VQYA 4YHHO 2ADPA 1ZUQA 1FXKA 4X88A 5LL6Y 2IU0A 2A9HA 3RN4A 1HNWO 1GN3A 1MG1A 1JFFA 3CMAV 2ZKOA 1HNZB 2EBOA 4LFBB 4H13B 1K3EA 1NBMG 1F23A 1P49A 3ABKB 2P4KA 1MZEA 3K0DA 2ZM6B 4JI0O 2YI8A 2XNDG 4D7SA 2HP8A 1S0VA 1W2BU 2RCVA 3A8TA 3RYFB 4DV3B 4DV6O 1M56C 1PNLA 1M93A 2DYRC 4FLYA 1PNMA 4B3SO 3K79A 5B66Z 3K58A 4CZZA 5LGTA 4ZOLB 4O4JA 1J5EB 2X6BA 4KHPO 1Q43A 1BHAA 3CXCU 4IT5A 3CCLV 2OT5A 3OE7G 4PA4A 1K92A 1TUEB 1VF6A 4P9PA 4NTWA 2PI4A 2GDSA 2CTQA 3ZHQA 5KHHA 1XILA 1OCZB 3G71V 5B1AB 5GTHZ 4LWSA 4J9YB 4WFBV 3F7YC 1FFTB 4LBEC 3L70H 1EM1A 1XL6A 3ABUA 4JAVA 3CSXA 3D36C 3AG7A 3G67A 3ZRXA 4DR5O 4LF6O 2RNBA 3FYEB 3HB3B 1X4TA 4JYAO 4GX0A 3OD4A 3K57A 2ZT9B 4Q20A 3CRMA 1RM1B 2ITDC 4UXNA 5DEDA 3T1HB 1AI4A 4ZHQA 5EYPB 2XOKG 1ZL8A 4JI8B 1SF9A 4UB8Z 5IJ9B 1DLBA 2R72A 2ZXWC 4H37A 4WBNA 3EFFK 4PA6A 4TOIA 3CB2A 2HFEC 2H94A 1QU7A 2E3CA 4DK1A 2EJ7A 2F23A 3FKSG 3A0RA 1QLEC 1PM9A 2AZ2A 4X89A 2G38A 4O4IB 3SPIA 2QM8A 2YIBD 4BIUA 3KG2A 3I55V 3ZRWB 1M56B 2DYRB 3SJBC 1XEQA 5IYZB 1SQPH 2KKWA 3TJTA 4WFFA 2N05A 2XAGA 2LGWA 2EJRA 3I5DA 2E5LB 2Y4UA 1VQKV 1P7BA 2DOSA 1PPJH 1MOFA 5HFMA 1H38A 5DN6G 2DMXA 4B08A 3DXRA 1NKDA 4K0KO 1EZJA 1G4YB 2Y69B 3S3WA 3OMIB 4FIPC 4J80A 4ZKIA 3K03A 1WB8A 1URFA 4U3JB 3SJCC 3IGAC 3W7WA 5CA0B 4LF8B 5FPOA 3DGEA 4O2AA 4B7KA 1YVWA 4X1IB 4I55B 3CXHF 2PYLA 2LFRA 4MTXA 1GTOA 1SA0B 1P84F 3H9VA 1LUWA 5IWAO 2EIJC 2WLIB 1Y74B 1GN6A 3UO3A 1YCIA 4PDLA 3K06A 3L72H 2CH7A 4LF4B 1YITV 4LF9O 1HP8A 5ITZA 1KD1W 4RWUA 1JVMA 3CCVV 2LJ2A 3OR7C 4KUMA 4RQEA 4JI6O 2ZXWB 5C93A 4I0XA 1MSWD 1YEWA 2UXDB 1OCRC 1OV9A 2ZE7A 5LYJB 2PGGA 1ZTEA 1CXZB 2CTWA 2ZNIA 4KFMA 3VQVA 5LMNB 1GAXA 4UCTA 1V54C 2QKAA 2IM9A 3T1YB 4XBFA 2ITCC 2VRZA 1IBLB 4K8XA 2BOBC 5IE9A 4F6EA 1XREA 2BTOA 2WAMA 2DYSC 1I5YA 1NT2B 3R65A 3WU2Z 5B1OA 3RW0A 3BRCA 1YTFB 2LW1A 1Q82W 5LGNA 3VQWA 1LR1A 2X0LA 3C90A 3E83A 2UUCB 2JJ1G 4EFBA 4LCUC 2OIEA 1AR1B 3FB6C 2N04A 4FVMA 5EBLC 3EHBB 4X64B 1FXKB 3SYCA 4JAAA 5IY5C 1AJNA 1XUQA 2AZ0A 4ZOLA 4FMTA 2WLKA 5KUMA 3STZC 1JFFB 1KMIZ 4TWKA 1QVFU 1Q6HA 4U7NA 1K4CC 4NXNB 1A32A 1ROPA 3KZIZ 1IBKO 2VQEB 3TCUA 4NXMB 2VQFO 3K04A 4HNAB 2HLDG 4IGGA 3S3XA 5BMVB 4JV5O 1M4UA 3OEEG 4K35A 1WA8B 3H1HH 3CC7V 4UFZA 2ZQMA 3GVMA 2WPDG 5LP6B 2ATKC 1EZVH 3W7XA 3ETQA 2Q0AA 2V1DA 3FX7A 2YIDA 4RUEA 5JCOA 5L3CA 4X65B 2CTPA 2W6IG 1AB3A 3JD3A 1I5XA 1NTKH 4LFCB 1NVPD 2IJHA 4IIJB 4X62B 4PV1B 4DR7B 4UV8A 5KAIZ 4B3TO 5EYPA 3QVNA 2IBZH 4UB6Z 5IJ9A 1QNMA 1K97A 1HR0O 2EIKB 2YI9A 3WG7C 1H2NA 1L0LH 1JPXA 4I4TB 2AW9A 2XHBA 4BR6A 1SQGA 2AHZA 3APOA 5FL7G 4MTOA 3L9DA 2PUSA 4OGQB 3ZHTA 3TETA 4FLXA 5CMUA 5JQGB 2DYSB 4JGSA 1MNGA 4FLUA 2JIZG 3H1KH 2EILC 1ORQC 2DWEC 4P2ZA 4O4IA 5EK0A 4DR3O 2Q8VA 1N8RW 4PHZA 2VWKA 1QLNA 3JSLA 2WLHA 2YUAA 2HR3A 5LHIA 3L74H 2ILMA 3JD0A 5CB4B 4JI5O 2GHYA 2MW2B 4CS4A 5IYZA 2UXBO 5JJNB 3HKBB 3U11A 1M5IA 4ZIBA 4LH6A 2QWQB 3FB7C 1NR7A 2UXCO 2Q69A 1VMGA 3CJHB 2F95B 2BSKA 1CEZA 1Y76B 4Z1MG 2Q7EA 4JTAB 4KP4A 5JWPA 3CCUV 4I5SA 2DQ3A 3G80A 4GX2A 4X20B 3SPJA 4GKKB 1R3KC 1YJ9V 3N2KB 4DV4O 4U3JA 1NR1A 1TUBB 2KB1A 5CA0A 3H1IH 3BABA 4GYCB 2QDOA 4X1YB 1B04A 1CP9A 3ETDA 4X1IA 5FNVB 5LHHA 3SPGA 3CRCA 3BPZA 3TXSA 1SA0A 5KHGA 2QWOB 2BCCH 1MSDA 4AQYO 1K5SA 3OUSA 1YSCA 3ZJZA 3Q4HB 4UUJC 4DR5B 3FB5C 1SERA 3OW2U 3GB7C 1NU1H 4JI3O 3WG7B 4YIPA 4BAYA 3CPWU 4DV5O 5TISZ 1SZTA 2Q4PA 4PI2A 1KP3A 1Q6IA 4K3AA 2Z0AA 2UU9B 5LGUA 5FLXN 5H6QA 1QQCA 1SESA 2OYQA 1S5JA 2HHHO 4U3FH 2RN9A 1MA1A 4DV1B 4JZGA 4X66O 3SYQA 4PELA 1NTMH 1WP7A 3N2GB 4OX9B 2UUBB 5B1BC 2RDCA 1N0JA 1K34A 3SGIA 3ABTA 4TUYB 4D6TH 5GW7A 2A0LA 3FAVB 3CD6V 1FYJA 5H2FZ 1ZAUA 2Y48A 2ZR3A 4FM1A 1QR8A 1VF5B 5BY1A 1Q8IA 3L75H 4QJFB 1H2KA 4DV2O 1OCOC 4R8CA 2QKSA 2UUAB 1BMFG 2QA4V 3THOA 4FM0A 2EX3A 3ZMSA 2B1GA 3FB8C 1AI7A 3JAKB 3QNEA 4B3MB 4W4LA 3DC5A 4MVSA 5B3SC 5K1XA 1L0NH 1W0KG 3QO7A 1FAFA 1NH2D 4CH4A 1NQTA 4QE9A 3JASB 2Q9LA 1E1QG 1PL4A 4G2KA 4PD4F 1G6UA 4TV9B 4GLXA 1N32O 2HJFC 4HZ3A 4HNAA 5BMVA 3C3TA 2OCCC 2P90A 3B8NA 2P5OA 1SETA 1BZKA 4BWAA 3CRRA 2W6JG 1WA8A 3AG2C 4FLZA 3F5WC 4PDVA 1WNSA 3BAAA 5LP6A 4AI8A 3D3IA 3P3PA 4UVCA 4GX5A 5KX5B 2QE7G 1SRYA 3DSQA 5IT9N 2FMLA 1N33O 1EFRG 1N0NA 4XDJA 4B3RB 2JEXA 4IIJA 4MT8A 2BOCC 4TT3G 1SS3A 1Y4MA 1HNXB 2F4VB 3BHPA 2DW4A 3O65A 4DR6B 1YHQV 3HKCB 4I4TA 1SQQH 4PDRA 1Z2GA 3J80N 4IYHA 1HDJA 3W7SA 2FKXA 1XMQB 2CAZC 3SYPA 2WA4A 1N34O 1GH6A 3HKDB 3APQA 2MK3A 5JQGA 1E1RG 4E4EA 3K9AA 5LMUO 1X59A 2P22C 5DM6V 3H01A 4MW8A 4O4HB 3ABMC 3OGIB 4DUZO 1DF5A 1R1BA 2EINB 1FKAO 4QGPA 3OT7A 5EBWC 2CK3G 2WLJA 3K5MA 5CB4A 3CEIA 1FPOA 4UCSA 3E8BA 5AG2A 3M7MX 3HKBA 3SR2C 2Z3YA 1W59A 4JI4B 4LF5O 3WB1A 3OMAB 3CJHA 5A2QN 3AK3A 1M90W 4TQFA 1DK1A 1Y76A 3AG3C 2Q5ZA 1N36O 5EC2C 4WFHA 3B40A 2M6YA 2P06A 3E8GA 4PA9A 4DR1B 1GKFA 1AI6A 3JCUZ 1XOUA 4X20A 5LHGA 2OCCB 3ZCCA 4JI1B 1AR5A 1KQSU 3N2KA 3JALB 2JGUA 3ZMUA 1TUBA 3AK1A 3AG4C 4DUYO 4X1YA 4Z1VA 3K5OA 3OGCC 3CHXA 1RSOB 5FNVA 3UM7A 4CH6A 3IAYA 2Q7HA 3J7AU 4H33A 2VQFB 2WLMA 3SDLA 3HKEB 5KHKA 2IW5A 4DV0O 3IC9A 5CBFA 4WCEV 4JYBA 5GONB 2ZDIC 2LGQA 4DR4O 2LP7A 3Q4HA 2BSKB 2XAJA 2H3OA 1TAEA 4FLWA 2F66C 1VQ9V 1RPOA 1Y6XA 4L8JA 5LBQA 3P3NA 1NVPB 3RVZA 3ASNC 3UCSC 1XL4A 3ETGA 4IL6Z 1R6KA 1S3JA 4XDKA 4R50A 4TSFG 2ZD9A 2HG5C 1HNZO 4R6ZA 2IU3A 1PV0A 1HR0B 3CYOA 5L3EA 4MVQA 3MD0A 1WPXA 1VQ7V 2JS3A 2W0XA 1XNQB 3N2GA 4QPJA 2ZM6O 4BW9A 4J10A 2BTQB 2HVJC 1U97A 2NLJC 3ABMB 1IX9A 2ZIOA 4BIZA 4TUYA 3KCXA 4HYOA 3JATB 2HVKC 4RQFA 3FAVA 3CRAA 4DV3O 1KUQA 4ICGA 3OFNG 4DV7B 3QTCA 3W7TA 4FPPA 2LO1A 1PKXA 4HAMA 1AJPA 3OTFA 3RYHB 3ASOC 4ZBMA 2QKCA 4DR3B 1TGOA 1EN4A 2P6JA 2YIBA 1J5EO 2QEXV 3UT5B 3H1LH 1EN6A 3JAKA 4BIOA 2XASA 1YJWV 2QM7A 3AEIA 4MSWC 1QLEB 2IJIA 4RUFA 1GM9A 1THZA 3EXAA 1FJGB 4FJCC 5IJ0B 3LUTB 3JASA 3AG4B 2A79B 1S5HC 2IH3C 1WAZA 4JYCA 4TV9A 4LF7B 4MVRA 5J2TB 3LNNA 3OTOO 1SQVH 3M8AA 1UPGA 2JDIG 1QBZA 3G6BA 3ZHVA 4PI0A 3MAQA 1GRJA 4YY3B 5EZYA 1Q7YW 4X8AA 2R70A 4WF9V 3SJQC 4F6RB 1XMOB 3T2MA 1FFXB 1M9NA 2QM4A 4L87A 4GX1A 4LFAB 3T1HO 5CBHA 1NTZH 5KX5A 1IBMB 4JI8O 4MTGA 2HJDA 2GUZA 1VQMV 1VQ4V 1H2MA 3GWOA 2PY5A 3JD2A 5BR8B 3ASNB 4DK0A 2D3OW 3DC6A 2CGNA 4H44B 3F7VC 2Y4TA 3HKCA 5L3DA
chains in the Genus database with same CATH topology
3TXSA 3HR0A 4LWSB 4I0XB 3FAVA 3GWKC 2AZ2A 2VS0A 4ABMA 1WA8B 3Q4HA 2AZ0A 3G80A 3GVMA 4GZRB 3OGIB 2KG7A 3FAVB 2DE0X 3Q4HB 4LWSA 4I0XA 2VRZA 3O9OA 3FD9A 1WA8A 2B9ZA 3TXQA 3ZBHA 2KG7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TXS A;  3HR0 A;  4LWS B;  4I0X B;  3FAV A;  3GWK C;  2AZ2 A;  2VS0 A;  4ABM A;  1WA8 B;  3Q4H A;  2AZ0 A;  3G80 A;  3GVM A;  4GZR B;  3OGI B;  2KG7 A;  3FAV B;  2DE0 X;  3Q4H B;  4LWS A;  4I0X A;  2VRZ A;  3O9O A;  3FD9 A;  1WA8 A;  2B9Z A;  3TXQ A;  3ZBH A;  2KG7 B; 
#chains in the Genus database with same CATH topology
 1NI8 A;  3CC2 V;  2EIJ B;  2KQX A;  3E22 B;  2JGD B;  4PJ0 Z;  2Q0O C;  4GKJ B;  3HKD A;  3CP1 A;  1T5E A;  1JX9 A;  4UVA A;  1NS1 A;  2XAH A;  1QVG U;  1AP5 A;  4J7J A;  4CH3 A;  3ZRV A;  4X66 B;  2QWP B;  4CBC A;  3L73 H;  4MS2 A;  5JVD B;  4O4H A;  3ASO B;  2FL4 A;  3BEH A;  4JI2 O;  1RP3 B;  3C3S A;  4GT1 A;  3G4S V;  5H6R A;  1XNR B;  1OCR B;  1J95 A;  2E5L O;  1I94 B;  1PL0 A;  3SYO A;  3B8M A;  4LNU B;  4TV8 B;  1IVS A;  3LSQ A;  4ZI7 B;  1JR9 A;  5C8Y B;  5JH7 B;  1BHB A;  2RMK B;  3D8C A;  4I50 B;  1V54 B;  1SZX A;  1KP2 A;  4NB5 A;  5EBM C;  4EB6 B;  3OR6 C;  1H8E G;  3PJS K;  2AGA A;  2Y0I A;  4YHH B;  1JQ0 A;  4DR2 O;  2DQ0 A;  2YIC A;  2CUG A;  2FTK A;  2K1E A;  2O57 A;  3JAL A;  4FFB B;  4QE7 A;  1HNW B;  1H8H G;  1KKD A;  3TXQ A;  4UCR A;  4JAU A;  1RSO A;  1ENV A;  2WWW A;  4MVM A;  1LUV A;  4ASU G;  4CH5 A;  3ZED A;  4JI0 B;  3HKE A;  3JAR A;  1KBH A;  4O2B B;  5IY5 B;  4KL1 A;  5GON A;  4J7Z A;  3RYI A;  4YXW G;  3JD1 A;  1HW7 A;  1F4N A;  3ICX A;  2XAQ A;  3AG1 C;  2UXD O;  1YJN V;  4DV6 B;  2EIM C;  1VQL V;  1GMG A;  1OHH G;  1PP9 H;  3MHS C;  4B3S B;  3ZHU A;  1WJZ A;  5CA1 A;  4FLV A;  3T1Y O;  4KHP B;  2QGN A;  3SPH A;  5J2U A;  2EUL A;  2IJK A;  1Z5W A;  4FZ1 A;  1IBL O;  3D36 A;  1XHZ A;  5EC1 C;  2IH1 C;  2FB5 A;  1SQB H;  2L35 A;  2BTQ A;  5DEC A;  3BA8 A;  4IHJ B;  3K3W A;  2ZE8 A;  4FZ0 A;  2ZIM A;  1CPY A;  3JAT A;  3CCE V;  4LF6 B;  1ARO P;  1US6 A;  3ABK C;  4DW1 A;  4YJ2 B;  4JYA B;  5KHJ A;  4JPR A;  3RYH A;  2AXT Z;  4X64 O;  1JA8 A;  1VF7 A;  4HBN A;  1KEC A;  1BQZ A;  1AJQ A;  2D2C B;  1V55 C;  2ETN A;  5LOV B;  3UT5 A;  4EFE A;  2A06 H;  4UVB A;  1FD9 A;  1B6Q A;  3QO8 A;  2VQE O;  1COW G;  3ZN0 A;  4NXM O;  4LR3 A;  2EIL B;  4JYY A;  5IJ0 A;  2X6A A;  1VQN V;  4QIW F;  1E79 G;  1V9P A;  4YJ3 B;  1ZSP A;  5J2T A;  1O9H A;  4JTC B;  1EN5 A;  4KXR A;  3ZX6 A;  4CC5 A;  2ZDI A;  2QWR B;  4X65 O;  1G1X B;  1OCZ C;  2YS8 A;  4FLT A;  3KKY A;  3RGB A;  2YSU B;  4LFC O;  4DRX B;  4F6R A;  3SPC A;  1K4D C;  1FFX A;  2ARH A;  4X62 O;  1Q86 W;  4DR7 O;  4CS2 A;  2R9A A;  5FPR A;  1S77 D;  3FYI B;  3ABL C;  5KAF Z;  3G6E V;  4X1K A;  5JCO C;  2B9Z A;  3LDE A;  2B1I A;  2YEV B;  3OMN B;  5F2V O;  1D5N A;  4X9Q A;  5L3G A;  1RM1 C;  5BZB A;  4QPK A;  4JI7 O;  2WLL B;  3R66 A;  4K0K B;  3RBZ A;  1GN4 A;  3ML0 A;  2DN9 A;  2P4V A;  4OXS A;  1S72 V;  1D5A A;  3E8H A;  3E22 A;  3UO2 A;  5EZY B;  2JGD A;  4JTD B;  1FS0 G;  2F93 B;  1R3I C;  3STL C;  1NZ6 A;  2GTS A;  2YC0 A;  1F51 A;  5D5Q A;  5BXZ A;  5IWA B;  1QR9 A;  2WA3 A;  5JVD A;  1OCC C;  2RJZ A;  2GUZ B;  3OUF A;  1SQX H;  4R7C A;  1IDS A;  3VBB A;  3CCQ V;  4LF9 B;  1V55 B;  4G27 B;  2EZO A;  5H5N A;  3SJA C;  3N27 A;  4LNU A;  4TV8 A;  1K8A W;  3ZMZ A;  4WFE A;  4ZI7 A;  5C8Y A;  4XDL A;  5JH7 A;  2Q67 A;  4FFK A;  5KA6 A;  4JI6 B;  2CTR A;  4I50 A;  5B1B B;  3BA9 A;  4GKK O;  2OCH A;  2PI5 A;  2YXH A;  5IYB O;  4EB6 A;  1L8D A;  1K5Q A;  2R9I A;  1K73 W;  2QTO A;  1JCH A;  3UQ8 A;  1DGS A;  4AIL C;  2JS5 A;  1I08 A;  3RT3 C;  2Y69 C;  3B09 A;  4FFB A;  3PN1 A;  2ZE6 A;  2ADQ B;  2QR4 A;  2KG7 A;  1OCO B;  2Y0P A;  3ZN1 A;  5KLV H;  2Q68 A;  2UXN A;  3OTO B;  1R73 A;  3RVY A;  2JJ2 G;  1TA8 A;  2DWD C;  1MMM A;  3ABL B;  1W0J G;  2ZIN A;  5B3S B;  2L6L A;  4O2B A;  3BFR A;  4UCV A;  5K1P A;  5E1A C;  2GBO A;  2OTJ V;  1H2S B;  3WB2 A;  1Y67 A;  2A7W A;  2LW7 A;  4C7U A;  3O9O A;  2UU9 O;  3B4S A;  3D3Q A;  1JOY A;  1AP6 A;  4GCZ A;  4JF3 A;  1K9M W;  4DV1 O;  1VQO V;  2XT9 A;  1Q5O A;  1RFY A;  1WN7 A;  1JJO A;  3CE2 A;  1BQ0 A;  1KB9 F;  1YXB A;  4OX9 O;  3AG2 B;  4PA3 A;  2UUB O;  1XDC A;  2WLN A;  1WP8 A;  3CCR V;  3LDC A;  5KMG A;  3ZMT A;  4P9O A;  1IBK B;  3CS5 A;  4UCU A;  2ODM A;  4Z2W A;  2KSD A;  3NR7 A;  4JV5 B;  1OCC B;  1VQP V;  1GK9 A;  4PDM A;  1Q81 W;  3JAR B;  2GSM B;  3JYC A;  4IHJ A;  1IXB A;  4MW3 A;  3RYI B;  3ZIA G;  1VIB A;  5LXT A;  1YZB A;  3ZHS A;  2ZE5 A;  4J9Z B;  4YIO A;  1R3J C;  2JVD A;  2UUA O;  2PYJ A;  4P30 A;  5IDJ A;  1S76 D;  2F1M A;  1XI1 A;  3L71 H;  4YJ2 A;  2P67 A;  3WFV A;  1R6N A;  5JJJ B;  1IUR A;  3RYC B;  1I7F A;  4B3M O;  3SYA A;  4JI2 B;  5L3F A;  3E8F A;  5CA1 B;  4LH7 A;  5LOV A;  1JMK C;  1Q6U A;  4B3T B;  3CCM V;  3UKM A;  1BGY H;  5J2U B;  4LFB O;  3U10 A;  4A5U B;  3T4D A;  3JCZ A;  4OPA A;  4O4L B;  5B1N A;  1K7D A;  5LA6 B;  3EVK A;  4AHC A;  3K08 A;  2LQT A;  2YIA A;  1FXK C;  2C2A A;  3LNM B;  3LDD A;  4YJ3 A;  2IJJ A;  4FM2 A;  1B06 A;  2CE4 A;  2E74 B;  3VQX A;  2PZS A;  4FK5 C;  4ABM A;  4EEQ A;  3ETE A;  4DR2 B;  4Q6G A;  3LSU A;  5JJE B;  1AI5 A;  5D5P A;  2AHY A;  2CGO A;  4G28 B;  3A2F A;  3RFR A;  1R3L C;  4NVP A;  4DRX A;  3JD4 A;  1M1K W;  4GUN A;  1MZF A;  3IC7 A;  2OWO A;  4B3R O;  3AG3 B;  2NN4 A;  1OJH A;  5KUK A;  2R9R B;  5LP6 C;  4JI5 B;  5CA3 A;  1IXM A;  2UXB B;  2Q6A A;  1PD3 A;  3NXS A;  1HNX O;  2F4V O;  3RWR D;  1HWY A;  3JAM N;  2YEV A;  4DR6 O;  4RO2 A;  4DXW A;  3E35 A;  5KHI A;  3A0B Z;  2UXC B;  1SKV A;  3QO5 A;  5EIB C;  2DJV A;  1BCC H;  2A3Q A;  1XMQ O;  1TVK A;  2WLL A;  3OEH G;  1DF4 A;  2Z5U A;  1Q3E A;  1YIJ V;  3BCC H;  2YXY A;  3DTU B;  4UV9 A;  1ZLZ A;  2BE3 A;  4EKW A;  2EIK C;  4I7Z B;  1VF6 C;  1PNK A;  3W7U A;  4DV4 B;  3X2Q C;  1BS3 A;  1YF2 A;  2CDY A;  1B3Q A;  1GM8 A;  1AIL A;  1NJI W;  1VQ5 V;  2OIG A;  4LP8 A;  5GTI Z;  3JAW B;  4NKG B;  3ZRS A;  2HKO A;  5A9G A;  2JEU A;  3IJ4 A;  4AQY B;  2VS0 A;  2F43 G;  4X1K B;  4MVO A;  2VWJ A;  4JI4 O;  1UJW B;  2GTA A;  3J81 N;  1EBO A;  2OTL V;  3JSN A;  3RYF A;  3B2E E;  1BE3 H;  1LNQ A;  1ZX3 A;  3P32 A;  3FD9 A;  4JI3 B;  1H2L A;  4DR1 O;  4DV5 B;  3HPL C;  2PF4 E;  3E86 A;  4JI1 O;  3CME V;  3CCS V;  1ZWI C;  4GZR B;  2GV9 A;  4W4K A;  2HHH B;  1YDX A;  3CC4 V;  1F7Y A;  1RPR A;  2YDE A;  4MTF A;  3HR0 A;  3BY6 A;  2X6C A;  3GWK C;  4JZ2 A;  2E76 B;  4I9W A;  5E79 Z;  2DE0 X;  3F5T A;  1GN2 A;  2WSS G;  2JRI A;  1QCE A;  4IYI A;  4DYL A;  3ZBH A;  4DV2 B;  3ZS8 C;  5KA5 A;  3FFQ A;  1P4R A;  4O4J B;  3CCJ V;  1KU9 A;  4LF8 O;  2W0F C;  1Q90 D;  3CX5 F;  1GO3 F;  4NR1 A;  3TGU H;  3B77 A;  3I56 V;  1H2G A;  1GM7 A;  3ZMV A;  4QNH B;  1VQ6 V;  1BT8 A;  3E2E A;  3E89 A;  1XNQ O;  3X2Q B;  4DW0 A;  1XBL A;  1O9G A;  2ZCE A;  1NH2 B;  2KG7 B;  4JI7 B;  4LC1 A;  3K5N A;  4LWS B;  4K8Z A;  4LF4 O;  1WLE A;  1SQF A;  1KC8 W;  2RQ6 A;  4J7K A;  4TQD A;  1VP7 A;  1WB7 A;  3OM3 B;  2E75 B;  1N32 B;  1P7G A;  1R6T A;  2V7Q G;  4UCO A;  1M57 C;  4NYK A;  2QJ1 A;  4PA7 A;  4DV7 O;  4MVU A;  2QTS A;  2JK5 C;  3QF7 A;  4J41 A;  3VOU A;  4E2L A;  1Z5V A;  2Q73 A;  1D2D A;  3LSS A;  3T1C A;  3K9S A;  3A0H Z;  3ZRW A;  5IYD O;  4ZHQ B;  1KKC A;  4J42 A;  1ZL8 B;  3RYC A;  5LMN O;  1N33 B;  2QWN B;  4CS3 A;  5IYC O;  2P7T C;  1WPB A;  4WBN B;  1MAB G;  2QSA A;  3WB0 A;  4U7O A;  1FJG O;  4J11 A;  1AR4 A;  1XHX A;  2M7W A;  4BW5 A;  5KMG B;  4LF7 O;  4O4L A;  1K33 A;  5LA6 A;  2ZNJ A;  4OPH A;  2K9P A;  1FXH A;  2H8P C;  1N4C A;  1S5L Z;  2B5U A;  1YTF D;  1KYO F;  2YXL A;  2PTM A;  4YY3 O;  2UXX A;  1YI2 V;  1N34 B;  3BVO A;  5LXT B;  1FXV A;  3M99 B;  5CN0 A;  2UUC O;  1XMO O;  2EZP A;  4I55 A;  3TK1 A;  4RAI A;  2V4D A;  4WFA V;  5CBG A;  4LFA O;  5LMU B;  4CC6 A;  1IBM O;  4WFG A;  2WLI A;  1Y74 A;  5H9C A;  4DUZ B;  5BR8 O;  1VEW A;  5J9P C;  1BSM A;  2FYU H;  1VAR A;  4I9Q A;  3CRQ A;  2HEP A;  3DXR B;  5L3B A;  4NXN O;  1AVM A;  1JJ2 U;  4LF5 B;  3CWB H;  5B5E Z;  3H1J H;  3K5L A;  1UFI A;  5LYJ A;  1N36 B;  2XUM A;  2Q7G A;  2NNU A;  2XTA A;  1BL8 A;  4GKJ O;  4NTX A;  1OZ0 A;  4O2A B;  2LFS A;  3MDS A;  1M57 B;  3AK2 A;  3QG5 A;  4F4L A;  4MVZ A;  3ZHR A;  3K0G A;  3MHH C;  4DUY B;  5B1A C;  5EIB D;  2CH7 B;  3AG1 B;  3JAW A;  1XNR O;  1L1F A;  1DTO A;  4D7T A;  2EIM B;  5ITZ B;  1I94 O;  2N74 A;  1XQ8 A;  4NTY A;  4DV0 B;  1F4M A;  4N23 A;  3OAA G;  2X7R B;  3T4Z A;  1G8M A;  5HFL A;  4DR4 B;  4I0X B;  4DO2 A;  1I0H A;  2XAF A;  1U96 A;  1Y66 A;  2NR5 A;  3KCY A;  2EIN C;  1TVK B;  4N21 A;  4JAS A;  1VQ8 V;  3K59 A;  1QHT A;  2ZR2 A;  3IFX A;  3P30 A;  4H0L B;  4B7E A;  3U0Z A;  1IZ3 A;  1SC5 B;  3VQY A;  4YHH O;  2ADP A;  1ZUQ A;  1FXK A;  4X88 A;  5LL6 Y;  2IU0 A;  2A9H A;  3RN4 A;  1HNW O;  1GN3 A;  1MG1 A;  1JFF A;  3CMA V;  2ZKO A;  1HNZ B;  2EBO A;  4LFB B;  4H13 B;  1K3E A;  1NBM G;  1F23 A;  1P49 A;  3ABK B;  2P4K A;  1MZE A;  3K0D A;  2ZM6 B;  4JI0 O;  2YI8 A;  2XND G;  4D7S A;  2HP8 A;  1S0V A;  1W2B U;  2RCV A;  3A8T A;  3RYF B;  4DV3 B;  4DV6 O;  1M56 C;  1PNL A;  1M93 A;  2DYR C;  4FLY A;  1PNM A;  4B3S O;  3K79 A;  5B66 Z;  3K58 A;  4CZZ A;  5LGT A;  4ZOL B;  4O4J A;  1J5E B;  2X6B A;  4KHP O;  1Q43 A;  1BHA A;  3CXC U;  4IT5 A;  3CCL V;  2OT5 A;  3OE7 G;  4PA4 A;  1K92 A;  1TUE B;  1VF6 A;  4P9P A;  4NTW A;  2PI4 A;  2GDS A;  2CTQ A;  3ZHQ A;  5KHH A;  1XIL A;  1OCZ B;  3G71 V;  5B1A B;  5GTH Z;  4LWS A;  4J9Y B;  4WFB V;  3F7Y C;  1FFT B;  4LBE C;  3L70 H;  1EM1 A;  1XL6 A;  3ABU A;  4JAV A;  3CSX A;  3D36 C;  3AG7 A;  3G67 A;  3ZRX A;  4DR5 O;  4LF6 O;  2RNB A;  3FYE B;  3HB3 B;  1X4T A;  4JYA O;  4GX0 A;  3OD4 A;  3K57 A;  2ZT9 B;  4Q20 A;  3CRM A;  1RM1 B;  2ITD C;  4UXN A;  5DED A;  3T1H B;  1AI4 A;  4ZHQ A;  5EYP B;  2XOK G;  1ZL8 A;  4JI8 B;  1SF9 A;  4UB8 Z;  5IJ9 B;  1DLB A;  2R72 A;  2ZXW C;  4H37 A;  4WBN A;  3EFF K;  4PA6 A;  4TOI A;  3CB2 A;  2HFE C;  2H94 A;  1QU7 A;  2E3C A;  4DK1 A;  2EJ7 A;  2F23 A;  3FKS G;  3A0R A;  1QLE C;  1PM9 A;  2AZ2 A;  4X89 A;  2G38 A;  4O4I B;  3SPI A;  2QM8 A;  2YIB D;  4BIU A;  3KG2 A;  3I55 V;  3ZRW B;  1M56 B;  2DYR B;  3SJB C;  1XEQ A;  5IYZ B;  1SQP H;  2KKW A;  3TJT A;  4WFF A;  2N05 A;  2XAG A;  2LGW A;  2EJR A;  3I5D A;  2E5L B;  2Y4U A;  1VQK V;  1P7B A;  2DOS A;  1PPJ H;  1MOF A;  5HFM A;  1H38 A;  5DN6 G;  2DMX A;  4B08 A;  3DXR A;  1NKD A;  4K0K O;  1EZJ A;  1G4Y B;  2Y69 B;  3S3W A;  3OMI B;  4FIP C;  4J80 A;  4ZKI A;  3K03 A;  1WB8 A;  1URF A;  4U3J B;  3SJC C;  3IGA C;  3W7W A;  5CA0 B;  4LF8 B;  5FPO A;  3DGE A;  4O2A A;  4B7K A;  1YVW A;  4X1I B;  4I55 B;  3CXH F;  2PYL A;  2LFR A;  4MTX A;  1GTO A;  1SA0 B;  1P84 F;  3H9V A;  1LUW A;  5IWA O;  2EIJ C;  2WLI B;  1Y74 B;  1GN6 A;  3UO3 A;  1YCI A;  4PDL A;  3K06 A;  3L72 H;  2CH7 A;  4LF4 B;  1YIT V;  4LF9 O;  1HP8 A;  5ITZ A;  1KD1 W;  4RWU A;  1JVM A;  3CCV V;  2LJ2 A;  3OR7 C;  4KUM A;  4RQE A;  4JI6 O;  2ZXW B;  5C93 A;  4I0X A;  1MSW D;  1YEW A;  2UXD B;  1OCR C;  1OV9 A;  2ZE7 A;  5LYJ B;  2PGG A;  1ZTE A;  1CXZ B;  2CTW A;  2ZNI A;  4KFM A;  3VQV A;  5LMN B;  1GAX A;  4UCT A;  1V54 C;  2QKA A;  2IM9 A;  3T1Y B;  4XBF A;  2ITC C;  2VRZ A;  1IBL B;  4K8X A;  2BOB C;  5IE9 A;  4F6E A;  1XRE A;  2BTO A;  2WAM A;  2DYS C;  1I5Y A;  1NT2 B;  3R65 A;  3WU2 Z;  5B1O A;  3RW0 A;  3BRC A;  1YTF B;  2LW1 A;  1Q82 W;  5LGN A;  3VQW A;  1LR1 A;  2X0L A;  3C90 A;  3E83 A;  2UUC B;  2JJ1 G;  4EFB A;  4LCU C;  2OIE A;  1AR1 B;  3FB6 C;  2N04 A;  4FVM A;  5EBL C;  3EHB B;  4X64 B;  1FXK B;  3SYC A;  4JAA A;  5IY5 C;  1AJN A;  1XUQ A;  2AZ0 A;  4ZOL A;  4FMT A;  2WLK A;  5KUM A;  3STZ C;  1JFF B;  1KMI Z;  4TWK A;  1QVF U;  1Q6H A;  4U7N A;  1K4C C;  4NXN B;  1A32 A;  1ROP A;  3KZI Z;  1IBK O;  2VQE B;  3TCU A;  4NXM B;  2VQF O;  3K04 A;  4HNA B;  2HLD G;  4IGG A;  3S3X A;  5BMV B;  4JV5 O;  1M4U A;  3OEE G;  4K35 A;  1WA8 B;  3H1H H;  3CC7 V;  4UFZ A;  2ZQM A;  3GVM A;  2WPD G;  5LP6 B;  2ATK C;  1EZV H;  3W7X A;  3ETQ A;  2Q0A A;  2V1D A;  3FX7 A;  2YID A;  4RUE A;  5JCO A;  5L3C A;  4X65 B;  2CTP A;  2W6I G;  1AB3 A;  3JD3 A;  1I5X A;  1NTK H;  4LFC B;  1NVP D;  2IJH A;  4IIJ B;  4X62 B;  4PV1 B;  4DR7 B;  4UV8 A;  5KAI Z;  4B3T O;  5EYP A;  3QVN A;  2IBZ H;  4UB6 Z;  5IJ9 A;  1QNM A;  1K97 A;  1HR0 O;  2EIK B;  2YI9 A;  3WG7 C;  1H2N A;  1L0L H;  1JPX A;  4I4T B;  2AW9 A;  2XHB A;  4BR6 A;  1SQG A;  2AHZ A;  3APO A;  5FL7 G;  4MTO A;  3L9D A;  2PUS A;  4OGQ B;  3ZHT A;  3TET A;  4FLX A;  5CMU A;  5JQG B;  2DYS B;  4JGS A;  1MNG A;  4FLU A;  2JIZ G;  3H1K H;  2EIL C;  1ORQ C;  2DWE C;  4P2Z A;  4O4I A;  5EK0 A;  4DR3 O;  2Q8V A;  1N8R W;  4PHZ A;  2VWK A;  1QLN A;  3JSL A;  2WLH A;  2YUA A;  2HR3 A;  5LHI A;  3L74 H;  2ILM A;  3JD0 A;  5CB4 B;  4JI5 O;  2GHY A;  2MW2 B;  4CS4 A;  5IYZ A;  2UXB O;  5JJN B;  3HKB B;  3U11 A;  1M5I A;  4ZIB A;  4LH6 A;  2QWQ B;  3FB7 C;  1NR7 A;  2UXC O;  2Q69 A;  1VMG A;  3CJH B;  2F95 B;  2BSK A;  1CEZ A;  1Y76 B;  4Z1M G;  2Q7E A;  4JTA B;  4KP4 A;  5JWP A;  3CCU V;  4I5S A;  2DQ3 A;  3G80 A;  4GX2 A;  4X20 B;  3SPJ A;  4GKK B;  1R3K C;  1YJ9 V;  3N2K B;  4DV4 O;  4U3J A;  1NR1 A;  1TUB B;  2KB1 A;  5CA0 A;  3H1I H;  3BAB A;  4GYC B;  2QDO A;  4X1Y B;  1B04 A;  1CP9 A;  3ETD A;  4X1I A;  5FNV B;  5LHH A;  3SPG A;  3CRC A;  3BPZ A;  3TXS A;  1SA0 A;  5KHG A;  2QWO B;  2BCC H;  1MSD A;  4AQY O;  1K5S A;  3OUS A;  1YSC A;  3ZJZ A;  3Q4H B;  4UUJ C;  4DR5 B;  3FB5 C;  1SER A;  3OW2 U;  3GB7 C;  1NU1 H;  4JI3 O;  3WG7 B;  4YIP A;  4BAY A;  3CPW U;  4DV5 O;  5TIS Z;  1SZT A;  2Q4P A;  4PI2 A;  1KP3 A;  1Q6I A;  4K3A A;  2Z0A A;  2UU9 B;  5LGU A;  5FLX N;  5H6Q A;  1QQC A;  1SES A;  2OYQ A;  1S5J A;  2HHH O;  4U3F H;  2RN9 A;  1MA1 A;  4DV1 B;  4JZG A;  4X66 O;  3SYQ A;  4PEL A;  1NTM H;  1WP7 A;  3N2G B;  4OX9 B;  2UUB B;  5B1B C;  2RDC A;  1N0J A;  1K34 A;  3SGI A;  3ABT A;  4TUY B;  4D6T H;  5GW7 A;  2A0L A;  3FAV B;  3CD6 V;  1FYJ A;  5H2F Z;  1ZAU A;  2Y48 A;  2ZR3 A;  4FM1 A;  1QR8 A;  1VF5 B;  5BY1 A;  1Q8I A;  3L75 H;  4QJF B;  1H2K A;  4DV2 O;  1OCO C;  4R8C A;  2QKS A;  2UUA B;  1BMF G;  2QA4 V;  3THO A;  4FM0 A;  2EX3 A;  3ZMS A;  2B1G A;  3FB8 C;  1AI7 A;  3JAK B;  3QNE A;  4B3M B;  4W4L A;  3DC5 A;  4MVS A;  5B3S C;  5K1X A;  1L0N H;  1W0K G;  3QO7 A;  1FAF A;  1NH2 D;  4CH4 A;  1NQT A;  4QE9 A;  3JAS B;  2Q9L A;  1E1Q G;  1PL4 A;  4G2K A;  4PD4 F;  1G6U A;  4TV9 B;  4GLX A;  1N32 O;  2HJF C;  4HZ3 A;  4HNA A;  5BMV A;  3C3T A;  2OCC C;  2P90 A;  3B8N A;  2P5O A;  1SET A;  1BZK A;  4BWA A;  3CRR A;  2W6J G;  1WA8 A;  3AG2 C;  4FLZ A;  3F5W C;  4PDV A;  1WNS A;  3BAA A;  5LP6 A;  4AI8 A;  3D3I A;  3P3P A;  4UVC A;  4GX5 A;  5KX5 B;  2QE7 G;  1SRY A;  3DSQ A;  5IT9 N;  2FML A;  1N33 O;  1EFR G;  1N0N A;  4XDJ A;  4B3R B;  2JEX A;  4IIJ A;  4MT8 A;  2BOC C;  4TT3 G;  1SS3 A;  1Y4M A;  1HNX B;  2F4V B;  3BHP A;  2DW4 A;  3O65 A;  4DR6 B;  1YHQ V;  3HKC B;  4I4T A;  1SQQ H;  4PDR A;  1Z2G A;  3J80 N;  4IYH A;  1HDJ A;  3W7S A;  2FKX A;  1XMQ B;  2CAZ C;  3SYP A;  2WA4 A;  1N34 O;  1GH6 A;  3HKD B;  3APQ A;  2MK3 A;  5JQG A;  1E1R G;  4E4E A;  3K9A A;  5LMU O;  1X59 A;  2P22 C;  5DM6 V;  3H01 A;  4MW8 A;  4O4H B;  3ABM C;  3OGI B;  4DUZ O;  1DF5 A;  1R1B A;  2EIN B;  1FKA O;  4QGP A;  3OT7 A;  5EBW C;  2CK3 G;  2WLJ A;  3K5M A;  5CB4 A;  3CEI A;  1FPO A;  4UCS A;  3E8B A;  5AG2 A;  3M7M X;  3HKB A;  3SR2 C;  2Z3Y A;  1W59 A;  4JI4 B;  4LF5 O;  3WB1 A;  3OMA B;  3CJH A;  5A2Q N;  3AK3 A;  1M90 W;  4TQF A;  1DK1 A;  1Y76 A;  3AG3 C;  2Q5Z A;  1N36 O;  5EC2 C;  4WFH A;  3B40 A;  2M6Y A;  2P06 A;  3E8G A;  4PA9 A;  4DR1 B;  1GKF A;  1AI6 A;  3JCU Z;  1XOU A;  4X20 A;  5LHG A;  2OCC B;  3ZCC A;  4JI1 B;  1AR5 A;  1KQS U;  3N2K A;  3JAL B;  2JGU A;  3ZMU A;  1TUB A;  3AK1 A;  3AG4 C;  4DUY O;  4X1Y A;  4Z1V A;  3K5O A;  3OGC C;  3CHX A;  1RSO B;  5FNV A;  3UM7 A;  4CH6 A;  3IAY A;  2Q7H A;  3J7A U;  4H33 A;  2VQF B;  2WLM A;  3SDL A;  3HKE B;  5KHK A;  2IW5 A;  4DV0 O;  3IC9 A;  5CBF A;  4WCE V;  4JYB A;  5GON B;  2ZDI C;  2LGQ A;  4DR4 O;  2LP7 A;  3Q4H A;  2BSK B;  2XAJ A;  2H3O A;  1TAE A;  4FLW A;  2F66 C;  1VQ9 V;  1RPO A;  1Y6X A;  4L8J A;  5LBQ A;  3P3N A;  1NVP B;  3RVZ A;  3ASN C;  3UCS C;  1XL4 A;  3ETG A;  4IL6 Z;  1R6K A;  1S3J A;  4XDK A;  4R50 A;  4TSF G;  2ZD9 A;  2HG5 C;  1HNZ O;  4R6Z A;  2IU3 A;  1PV0 A;  1HR0 B;  3CYO A;  5L3E A;  4MVQ A;  3MD0 A;  1WPX A;  1VQ7 V;  2JS3 A;  2W0X A;  1XNQ B;  3N2G A;  4QPJ A;  2ZM6 O;  4BW9 A;  4J10 A;  2BTQ B;  2HVJ C;  1U97 A;  2NLJ C;  3ABM B;  1IX9 A;  2ZIO A;  4BIZ A;  4TUY A;  3KCX A;  4HYO A;  3JAT B;  2HVK C;  4RQF A;  3FAV A;  3CRA A;  4DV3 O;  1KUQ A;  4ICG A;  3OFN G;  4DV7 B;  3QTC A;  3W7T A;  4FPP A;  2LO1 A;  1PKX A;  4HAM A;  1AJP A;  3OTF A;  3RYH B;  3ASO C;  4ZBM A;  2QKC A;  4DR3 B;  1TGO A;  1EN4 A;  2P6J A;  2YIB A;  1J5E O;  2QEX V;  3UT5 B;  3H1L H;  1EN6 A;  3JAK A;  4BIO A;  2XAS A;  1YJW V;  2QM7 A;  3AEI A;  4MSW C;  1QLE B;  2IJI A;  4RUF A;  1GM9 A;  1THZ A;  3EXA A;  1FJG B;  4FJC C;  5IJ0 B;  3LUT B;  3JAS A;  3AG4 B;  2A79 B;  1S5H C;  2IH3 C;  1WAZ A;  4JYC A;  4TV9 A;  4LF7 B;  4MVR A;  5J2T B;  3LNN A;  3OTO O;  1SQV H;  3M8A A;  1UPG A;  2JDI G;  1QBZ A;  3G6B A;  3ZHV A;  4PI0 A;  3MAQ A;  1GRJ A;  4YY3 B;  5EZY A;  1Q7Y W;  4X8A A;  2R70 A;  4WF9 V;  3SJQ C;  4F6R B;  1XMO B;  3T2M A;  1FFX B;  1M9N A;  2QM4 A;  4L87 A;  4GX1 A;  4LFA B;  3T1H O;  5CBH A;  1NTZ H;  5KX5 A;  1IBM B;  4JI8 O;  4MTG A;  2HJD A;  2GUZ A;  1VQM V;  1VQ4 V;  1H2M A;  3GWO A;  2PY5 A;  3JD2 A;  5BR8 B;  3ASN B;  4DK0 A;  2D3O W;  3DC6 A;  2CGN A;  4H44 B;  3F7V C;  2Y4T A;  3HKC A;  5L3D A; 
#chains in the Genus database with same CATH homology
 3TXS A;  3HR0 A;  4LWS B;  4I0X B;  3FAV A;  3GWK C;  2AZ2 A;  2VS0 A;  4ABM A;  1WA8 B;  3Q4H A;  2AZ0 A;  3G80 A;  3GVM A;  4GZR B;  3OGI B;  2KG7 A;  3FAV B;  2DE0 X;  3Q4H B;  4LWS A;  4I0X A;  2VRZ A;  3O9O A;  3FD9 A;  1WA8 A;  2B9Z A;  3TXQ A;  3ZBH A;  2KG7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...