4ABMA

Crystal structure of chmp4b hairpin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
79
structure length
79
Chain Sequence
GAMEQEAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTKNKRAALQALKRKKRYEKQLAQIDGTLSTIEFQREALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHARGED MULTIVESICULAR BODY PROTEIN 4B
publication title Cc2D1A is a Regulator of Escrt-III Chmp4B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 38
structure length 79
sequence length 79
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 4abmA00
3GVMA 3HR0A 1WA8A 4I0XA 2VRZA 3O9OA 3Q4HB 2AZ0A 3GWKC 2DE0X 3FAVA 2AZ2A 4GZRB 2VS0A 2KG7B 4LWSB 1WA8B 3FD9A 3TXQA 4I0XB 2KG7A 3Q4HA 3ZBHA 3G80A 2B9ZA 3TXSA 4ABMA 3FAVB 3OGIB 4LWSA
chains in the Genus database with same CATH superfamily
4P9PA 1SQPH 2UUAO 4DV7O 1G6UA 2BCCH 2R9RB 3APOA 1JFFB 3P30A 2Q8VA 4DUYB 3TJTA 5JH7B 4MW3A 2QWQB 1YJWV 4HNAA 1B04A 2BTQB 4IYHA 5BMVB 2PYJA 4X1IB 3ZS8C 3GWOA 3BCCH 1KP3A 3G6EV 4W4LA 2ZDIC 4PJ0Z 2UXNA 1J5EO 4O4IB 2OCCC 2P67A 1COWG 1YEWA 2QA4V 2BTOA 3ZRSA 3E83A 2Y69B 1N0NA 2ODMA 2YSUB 5IWAO 2Y69C 1VQMV 4LFAB 4TUYB 1YDXA 1LNQA 1SQQH 2RQ6A 2PI4A 2OYQA 1XNRB 2FKXA 1XILA 2LJ2A 3K08A 4J9ZB 2Q0OC 5KHJA 1AR5A 3SDLA 4U7NA 2H8PC 1M4UA 2Y0IA 3OMIB 4ZIBA 5L3GA 1XMQO 3EFFK 5B1NA 4JI3B 3J80N 1JFFA 4GT1A 1XREA 5JH7A 1R6KA 3BHPA 4DR3B 1YVWA 5LGTA 2BTQA 2XTAA 1N8RW 1Q6HA 2UXBO 5BMVA 5B5EZ 1PPJH 2UXDB 4X1IA 1D5NA 2QM4A 1GH6A 4NTXA 4O4IA 3NR7A 4LF9B 4RQEA 1RPRA 2F66C 4I4TB 3K03A 3MAQA 1AI6A 2VRZA 4Z2WA 1URFA 3RT3C 3E8BA 3IGAC 2EIMC 3F5TA 3D8CA 5LYJB 1NT2B 4WCEV 2DW4A 4TUYA 1Q8IA 4GKJB 1SRYA 3ZHQA 4FLXA 3STZC 4UUJC 1NVPD 3OTOB 5JQGB 4FIPC 3SJBC 4JYAB 4JF3A 2WLIA 5KX5A 1U96A 4DR6O 1TVKB 2DQ0A 5GONB 2Y4UA 1Q82W 2YI9A 4RAIA 2R9AA 1QHTA 4EFBA 3TXSA 4O2AB 4GX1A 2Q0AA 3OR6C 4LF6O 1EN4A 1KKDA 3VQXA 2QR4A 2YI8A 4JYYA 1N36O 1KYOF 5DM6V 4JI1B 2EINB 4K0KO 4AHCA 1HNXB 3K58A 2ZINA 4JZ2A 4I4TA 4O2BA 2UUCB 4GKKO 3ABKC 3OM3B 4X1KB 4DV0O 3G71V 4UVAA 3OT7A 2Z0AA 3K5LA 1NH2B 5LYJA 2F4VO 4LFCB 4QPJA 5BXZA 5E79Z 3UCSC 1GK9A 2P6JA 5KHHA 1AI7A 3KCXA 4F4LA 5A2QN 2DYSC 4GX0A 1M56C 3IFXA 3ZN1A 5JQGA 3SYOA 4YHHB 4YIPA 3JAWA 1SERA 3ZRXA 1TVKA 3OR7C 1L0LH 5GONA 4U3JB 3B8NA 3JATB 2Y4TA 4KUMA 3ZMTA 1KBHA 2BE3A 4KHPO 4O2AA 5EBMC 3U11A 1AVMA 2NR5A 3WG7B 1Q3EA 2CTPA 4MSWC 1BHBA 3AG4B 4RQFA 1LUWA 5IJ0B 3AG3C 1IBLB 1G1XB 3CHXA 5L3EA 3FX7A 4R8CA 5BZBA 4OX9B 2RCVA 3OMAB 3ZMSA 2GSMB 1M57C 2CGOA 4X1KA 4MTOA 4PA3A 1R6NA 3BVOA 3E8FA 5JJJB 3ETDA 4JI5B 4DV1B 2JGUA 3CMEV 1JVMA 4NTWA 3E22A 3JCZA 3WU2Z 1GM9A 2LQTA 1B6QA 3L9DA 4PA7A 4HAMA 3PJSK 2FYUH 5KLVH 3SJCC 2OIEA 1B06A 2H94A 1JJ2U 4IHJB 2A06H 4CZZA 4BIZA 3P3NA 2AHYA 2EZPA 5H6QA 4FLZA 2V7QG 4U3JA 3JATA 2CE4A 4YXWG 3FB6C 4FZ1A 4AI8A 2B1GA 3ZRVA 1N4CA 4B3RO 4YY3O 3NXSA 3G67A 3EHBB 1YHQV 4I0XA 4XDJA 2H3OA 3K04A 3OTFA 1V55C 4X20B 4XDKA 2JDIG 2IM9A 5IJ0A 2ZR2A 3DC6A 4I55A 2P90A 4IIJA 3LNNA 3W7SA 3UT5B 1BL8A 2F23A 2YIBD 3FB7C 2HJDA 2DN9A 3CS5A 1K4CC 1AP6A 4HZ3A 1N34O 5LL6Y 1JMKC 4F6RB 3UKMA 2XT9A 3I5DA 4CS4A 3ETGA 3SYCA 1FPOA 3E35A 4IHJA 3CCLV 2NNUA 1XUQA 4HBNA 1S77D 2E74B 5GTHZ 1VQ9V 3K5MA 2WLJA 2P5OA 4ZOLB 2R70A 1OCZB 2HLDG 1I5XA 3JAKA 4J11A 3BAAA 5B66Z 1VIBA 2Z5UA 3DXRB 2X0LA 2ZE8A 1HR0B 5J2TB 2L35A 3W7WA 1FXKC 2O57A 4X20A 2QM8A 1DLBA 1PNMA 1GN6A 1KP2A 3MHSC 3ETQA 2Q6AA 1K8AW 4L8JA 1Y76B 2W0FC 4UXNA 5H6RA 3UT5A 1ZWIC 4FM1A 1ZL8B 4J7ZA 4UCUA 3A2FA 3OEEG 1OCCB 1H38A 3D3QA 1F23A 1PP9H 1HNZO 2JVDA 1WB7A 1LR1A 4N21A 4JGSA 1I94B 3JSNA 5LA6B 4A5UB 3F7VC 3L70H 2OTJV 1IDSA 4J80A 2EIKB 4LCUC 5EK0A 4DR5O 4B7KA 4ZOLA 2QTSA 2A7WA 2YEVB 4CH3A 4P30A 4DV4B 1YIJV 4PV1B 3IC9A 3DXRA 2Q4PA 4UFZA 5K1PA 3T1YB 2V1DA 5LMNB 4B7EA 3A0BZ 5LHGA 1VMGA 1H8EG 2UUBO 3STLC 4U3FH 3FYEB 3K5OA 5J2TA 1IXBA 2XNDG 4B3SB 4H33A 3C90A 2HG5C 1MZEA 1NTKH 1ZTEA 3K57A 1F4MA 4Q6GA 5IYDO 1Y76A 3OEHG 1VP7A 1GMGA 2EULA 2Q68A 2HKOA 4NXNB 1BS3A 1L0NH 1ZL8A 2GTAA 1ZLZA 1K5QA 3GVMA 2ZM6B 1SZXA 4DR2O 4FJCC 5EC2C 4AQYB 3CB2A 1NI8A 4JI2O 4LF5B 1K4DC 4LNUA 2HHHO 4DR4B 5DN6G 5LA6A 2QWRB 3E89A 5JJEB 1Z2GA 3FFQA 3ZMZA 3ZMUA 2QGNA 4JI8O 2E5LO 1K97A 3CSXA 1JJOA 1OCRB 2JS3A 1GTOA 1Y66A 2ZIMA 2QDOA 3FAVB 1M93A 4MVMA 4WFHA 2Q73A 1OCRC 3JAMN 1VARA 1EN6A 3GWKC 4TSFG 4JTCB 2Q7GA 4BW9A 1XEQA 3HKCB 3ASNC 4K3AA 1N32O 1N33B 1AROP 2OT5A 1XHZA 4R6ZA 1UJWB 3H1HH 4DUZB 1FAFA 5L3BA 1H2NA 1IBKO 4ZKIA 4FZ0A 3CCMV 2ZE7A 1W59A 3EVKA 3VQVA 2K9PA 4X89A 4X62O 5LGNA 2UXXA 2EX3A 2HJFC 3AK3A 1WA8B 5IDJA 3JD0A 3SJAC 4LFBB 2EILC 3B40A 1QCEA 4LH7A 1KUQA 4RUFA 1WAZA 4JV5O 2QE7G 4FM0A 1TUEB 2YIBA 1E79G 1CEZA 1HW7A 4DR7O 1NQTA 2GV9A 3FAVA 4MS2A 2IU3A 2PYLA 2JJ1G 3K59A 1XOUA 2YXLA 2ZT9B 4TWKA 1QVFU 3ABUA 3OW2U 5BY1A 3G4SV 4BW5A 3HKCA 1XMOB 1QU7A 4K35A 1DF4A 4H13B 2K1EA 3UO2A 1GAXA 5IJ9B 4DV7B 2QKAA 2EJRA 3TK1A 4FMTA 3J81N 1QNMA 1S3JA 4DV3B 2XUMA 4LF4B 4MVQA 2P4VA 2R9IA 3LDEA 1EBOA 3W7XA 4EB6B 1KQSU 1HP8A 1O9GA 2B1IA 1PL4A 2JEUA 3W7UA 4UVCA 2Y0PA 1JPXA 5LHHA 1QLEB 2ZD9A 1NH2D 1Y6XA 1CXZB 3CRMA 2OIGA 4WFGA 4FK5C 4CH4A 4TV8B 5H2FZ 1V54B 5IT9N 4FPPA 1GM8A 5H9CA 2CDYA 2VWKA 2Q9LA 5EYPB 5EBLC 1SESA 1KC8W 4FFKA 5ITZB 2LO1A 4PA4A 1QBZA 2Q7HA 4MW8A 1W2BU 1HNWO 1BT8A 2HP8A 4JI4B 2AZ0A 2HEPA 3L75H 5L3DA 1D2DA 4IGGA 2AZ2A 4GZRB 5LGUA 4LR3A 4QE9A 1AP5A 2JS5A 1AILA 3TXQA 4PI0A 3T4DA 5IJ9A 3JD1A 1XMQB 1MA1A 2ADPA 2YIAA 2WA3A 1SA0B 1OZ0A 3CP1A 4NVPA 3RVYA 4EB6A 4DRXB 4YJ3B 1BHAA 2UXBB 5CB4B 4DR1O 1XNRO 3M8AA 4CS3A 2XHBA 4WFBV 2B5UA 4U7OA 5TISZ 2KB1A 2Q69A 1QLNA 1F7YA 4NYKA 3SJQC 2X6BA 3AK1A 2X6AA 3RN4A 4TV8A 3IC7A 3BY6A 5FNVB 4BIOA 2KQXA 3BA8A 2DYRB 3O9OA 1SQGA 4BIUA 5EYPA 4X66O 2ETNA 1YF2A 2DMXA 3DGEA 3CCSV 2PI5A 5LMUO 1YZBA 2E75B 1FJGB 2UXDO 4MTFA 5KMGB 4P9OA 2P22C 4DV2B 1TA8A 1ZSPA 4CS2A 4LF9O 3WFVA 1TUBB 2HFEC 1M5IA 1SQBH 3H1LH 1GRJA 5BR8B 1SA0A 3RVZA 4IT5A 1WPBA 2A3QA 2N04A 3CCJV 4YJ3A 2UU9O 5H5NA 4GLXA 4LF7B 3T4ZA 1R6TA 4UV8A 3ZEDA 5CB4A 1BGYH 2DWDC 4PI2A 1XNQO 2JK5C 3T1HB 3OTOO 1XBLA 4K0KB 3RYIB 2IH1C 4LBEC 4B08A 1NTMH 5FL7G 3CXHF 5FNVA 1AJNA 2YC0A 4DV0B 2PTMA 2NN4A 1WNSA 3QNEA 2EINC 5IY5B 3G6BA 2IJKA 4JI7B 1HWYA 1DGSA 1TAEA 1H2SB 2DJVA 1MSDA 2FMLA 4LP8A 1H2KA 2EIJB 4FFBB 2F43G 3AG7A 3JASB 1HNXO 4FLUA 2ZKOA 4LWSB 5B3SB 1TUBA 3CEIA 1FXVA 1LUVA 4GUNA 5GW7A 5EC1C 1OCOB 3ZJZA 1AB3A 3B77A 4WFAV 4KHPB 4KFMA 4DV6O 4MVOA 2WLNA 5B1BB 1IX9A 2AHZA 4QJFB 1S5LZ 4W4KA 2B9ZA 4YHHO 3WG7C 3CWBH 1I08A 3E8HA 3SPIA 1G4YB 1K73W 5C93A 3HR0A 1Q5OA 5A9GA 2JJ2G 3AG4C 1R3KC 3RYCB 2V4DA 2D3OW 1AJPA 2CTRA 1Z5VA 3VBBA 1OHHG 2OWOA 4FFBA 2CUGA 1MMMA 5CMUA 3JASA 4LH6A 3A8TA 2UXCB 2WPDG 4L87A 2GHYA 1EM1A 2LFRA 4LWSA 5F2VO 4I7ZB 3LSSA 1IBLO 4OX9O 3J7AU 1VQLV 1SZTA 3VQWA 1YITV 1PNLA 4G27B 3X2QB 2WSSG 4DV1O 4JI5O 1HDJA 4B3TO 3OUFA 5AG2A 1Q86W 3X2QC 3L72H 4G28B 2Q5ZA 3ZHUA 3G80A 1W0JG 2WLLB 4B3RB 1PV0A 4YY3B 4JZGA 2L6LA 1UFIA 3H1KH 3CRRA 2GDSA 4OPHA 1KKCA 5D5QA 5CN0A 4NXMO 1CPYA 1SETA 4WBNB 1I0HA 3BEHA 4H37A 4DK1A 3AG1B 4LF8O 1VQ6V 2NLJC 5FPOA 1D5AA 1I7FA 4I50B 1FFXB 1N34B 3AG1C 4J9YB 5DECA 3CX5F 3DC5A 2IBZH 1FFTB 3B4SA 4FLVA 1BMFG 2W0XA 5JCOC 3BPZA 1S76D 2DOSA 1V9PA 1X4TA 1YTFB 2P7TC 3MHHC 1P7BA 2MK3A 2W6JG 2YXYA 1YI2V 1MOFA 4JPRA 2EJ7A 1BSMA 3P32A 2Z3YA 4PDLA 1OCZC 2WLLA 4IL6Z 4K8XA 4UV9A 2DE0X 5K1XA 3CD6V 4PDMA 1K7DA 1ORQC 1JCHA 2Q7EA 1IBMO 2EZOA 3BABA 1DF5A 4PDVA 5LBQA 5CBGA 4PELA 1SQVH 3UM7A 4WBNA 3ABMB 3L74H 3A0HZ 4OXSA 4JI0O 4O4HB 3LSUA 4J42A 2IJIA 5KUMA 5HFLA 2PUSA 1FFXA 1XHXA 1JR9A 3LUTB 2IW5A 2RJZA 2PY5A 1H8HG 5JCOA 4F6RA 4JI6B 3HB3B 2XAJA 4XDLA 5HFMA 1AR1B 4ICGA 1VQPV 3O65A 1OCCC 1KECA 3JSLA 2ZQMA 3HPLC 5IYCO 3N2KB 2RNBA 4DO2A 4TT3G 4ZHQB 4NB5A 1VQ5V 2EIKC 1BCCH 2JIZG 2X7RB 2UUBB 3ZIAG 3QTCA 5KHIA 1I94O 3SYQA 4FM2A 3JYCA 4G2KA 4O4JB 1WPXA 4O4HA 1ENVA 2ZE5A 2YUAA 1ZUQA 2LP7A 4GCZA 5FPRA 1GN2A 2LGQA 5E1AC 3T1YO 4B3MO 5CA1B 1SC5B 3E86A 3BRCA 3CRCA 1FYJA 3JD3A 2ZIOA 3CXCU 2HHHB 4R7CA 4UB8Z 2CAZC 4KXRA 4JTDB 3THOA 3OGCC 1VQKV 4DV5O 2E5LB 3JALB 3SPHA 1RM1B 3I55V 1I5YA 3FB5C 2ZXWB 1Q90D 5FLXN 1KMIZ 4NXNO 1MG1A 3N2KA 1RM1C 4YJ2B 2YEVA 2QWOB 1RPOA 4WF9V 1NBMG 2ZM6O 2WLHA 3QO7A 4AQYO 3D3IA 1X59A 1N32B 3ABLB 1MNGA 3JD4A 3OUSA 5B1AB 1E1RG 2A0LA 3ASOB 2VQEB 3S3WA 5B1AC 1RSOB 3H1IH 4O4JA 1IBKB 1BQZA 2ITCC 4CH6A 1SS3A 1P49A 4X64O 3TGUH 4DYLA 3QG5A 2FL4A 3SPGA 5CA1A 1N33O 4GX2A 1S0VA 4YIOA 2N74A 4JV5B 5EZYB 3H1JH 1S5HC 4DW1A 3CRAA 3JALA 2OTLV 3OE7G 2IJHA 3M7MX 1JQ0A 4X65B 1JA8A 3R66A 1SF9A 3QF7A 4PHZA 4YJ2A 3ETEA 4GYCB 3B8MA 3VOUA 1XDCA 4K8ZA 1SKVA 5IYBO 4LFBO 3C3SA 4H0LB 5JWPA 1RP3B 3P3PA 1THZA 1UPGA 3E2EA 3LSQA 2UUAB 1RSOA 2VQFO 2LW7A 2P06A 2RN9A 2LGWA 3A0RA 4D6TH 4QGPA 1XL4A 4UCVA 4UCRA 5LXTB 4FVMA 4QIWF 1XMOO 3MDSA 1SQXH 1WA8A 4QNHB 5LHIA 1PM9A 1JOYA 5KUKA 5EZYA 1J5EB 2KKWA 1QVGU 3ZCCA 4DV3O 4LF4O 5CA0B 4MTGA 1QLEC 1J95A 2ATKC 3HKDB 3FYIB 4DUYO 1EZJA 4UCOA 4OGQB 4F6EA 5IWAB 3BA9A 2ILMA 5L3CA 1NR1A 1V54C 4ZI7B 1VF6A 2OCCB 3AG2B 2QTOA 3QVNA 1HNWB 4J10A 4OPAA 4X9QA 4BAYA 3AG2C 2VWJA 1Z5WA 3UQ8A 3ICXA 1P84F 3ZN0A 5LOVB 2F1MA 5KHKA 1T5EA 2YXHA 3RYFB 4JYCA 3OGIB 2QWNB 1IVSA 4GX5A 1AR4A 5LXTA 3SGIA 4DR1B 4LFAO 4JI4O 3DTUB 4Z1MG 1L1FA 3AEIA 3PN1A 1H2MA 1MSWD 2F95B 1WLEA 2G38A 3CMAV 3DSQA 2QKSA 1VF5B 1GM7A 2WLIB 2BSKB 5KAFZ 5KX5B 3CC7V 1WP7A 2IH3C 5CA0A 5KA6A 1NKDA 4JI3O 3K5NA 3WB1A 1PKXA 3HKDA 4I9WA 4X66B 2ZDIA 4ZI7A 5LMUB 3FKSG 4DR3O 5ITZA 4MTXA 2DYRC 1ROPA 4JAUA 3K0DA 2F93B 4RO2A 2ZNJA 2EIMB 1XQ8A 4O2BB 1Y67A 3CC2V 1Q43A 2DWEC 5LOVA 3HKBB 2Q67A 3KZIZ 3RYFA 5CBHA 4DR6B 3TETA 2UU9B 2CH7B 3EXAA 2CGNA 4DRXA 1FJGO 2X6CA 4TV9B 3F5WC 1YJ9V 4CC6A 4DV2O 4GKJO 1XNQB 1YXBA 4FLTA 4LF6B 3ML0A 4RWUA 1AJQA 2JRIA 4AILC 2QWPB 4CC5A 1N36B 1VEWA 3JAWB 5IE9A 2R72A 2BSKA 4UCSA 4JYAO 5BR8O 5CA3A 3CCUV 5B1OA 1PL0A 4LC1A 4GKKB 3U0ZA 1G8MA 4J7JA 4I5SA 3K9AA 3JARB 1M9NA 4LF7O 1AI5A 1YTFD 2F4VB 1B3QA 3E8GA 2LFSA 5JVDB 5IY5C 5KMGA 3T1HO 1K3EA 1K5SA 4JAVA 4WFFA 3ABKB 1DK1A 5L3FA 4NR1A 1WB8A 4JI1O 1NZ6A 4MVSA 1XI1A 2EIJC 2ZCEA 4BR6A 3HKBA 3ZHRA 2UUCO 1A32A 2YDEA 2RMKB 4NTYA 2QEXV 5B3SC 4E2LA 4JI7O 2P4KA 3D36C 3E22B 3KKYA 1K34A 2CH7A 2A9HA 4DV6B 3RW0A 1H2LA 4CH5A 2DYSB 4TV9A 2XAHA 1M56B 4LFCO 4EEQA 1OCOC 1VQ8V 3SPCA 3RFRA 4Z1VA 2CTQA 3APQA 2PZSA 3CRQA 4PD4F 2QSAA 1M1KW 3KG2A 3RYIA 5B1BC 1QR9A 5IYZB 3ZX6A 1VQOV 4TQFA 3K0GA 2RDCA 1Q6IA 3W7TA 3JARA 4EKWA 2AW9A 1EFRG 1XL6A 3L73H 5JVDA 3AG3B 2YIDA 4I0XB 5CBFA 2JGDB 2E76B 2IU0A 5GTIZ 1M57B 3LNMB 1FS0G 4MVRA 5KHGA 2IJJA 3RWRD 4I55B 2AXTZ 1WP8A 4IIJB 1VF7A 1WJZA 3D36A 3LDCA 1YSCA 2M7WA 4NKGB 3K3WA 2PF4E 1IXMA 3CJHB 4B3TB 2QJ1A 1K92A 4PDRA 4UVBA 1PD3A 4DK0A 2UXCO 3S3XA 2CK3G 2GBOA 1O9HA 4KP4A 2YS8A 3ZHTA 3AK2A 5DEDA 4NXMB 4ZBMA 1ZAUA 2XAFA 5IYZA 4MT8A 1R1BA 3JAKB 4LF8B 2XAQA 3CCVV 3K06A 2WLMA 1NVPB 1RFYA 2MW2B 3RYCA 1P4RA 3BFRA 1V55B 4H44B 4X88A 1Y4MA 1R3LC 3CC4V 4X8AA 2JGDA 1S72V 3K9SA 1US6A 3UO3A 4FLYA 3CCQV 4QE7A 3ZRWB 4DW0A 1KD1W 4DXWA 5C8YB 3CYOA 1R3IC 4D7TA 4J7KA 1S5JA 2CTWA 2D2CB 1VQNV 3CJHA 3ZHSA 2W6IG 2HVJC 4E4EA 2C2AA 3SYAA 1NR7A 3N2GB 1H2GA 3FB8C 3SR2C 3Q4HB 3T1CA 4JAAA 1IBMB 2LW1A 2WLKA 1YCIA 2KG7B 1M90W 4JTAB 4PA9A 4JASA 1R3JC 1NJIW 4JI0B 3JD2A 3K79A 2QM7A 3U10A 2E3CA 2ARHA 1NU1H 3ABMC 4I50A 1FXKB 1HR0O 2GUZB 4ASUG 1ZX3A 1FD9A 1GKFA 1F4NA 1HNZB 1MABG 3HKEB 2OCHA 3CPWU 3ZRWA 4ABMA 1E1QG 5C8YA 4XBFA 4MVZA 4EFEA 1BE3H 3L71H 4DR5B 3I56V 5D5PA 4CBCA 5EIBD 3OAAG 1BQ0A 3N2GA 1F51A 3LDDA 2QKCA 2WA4A 3Q4HA 4X1YB 4JI6O 2ZE6A 1EN5A 1OJHA 1WN7A 4LNUB 4QPKA 2KG7A 4O4LB 5LP6B 2Y48A 3H9VA 3SYPA 1MZFA 4J41A 3CE2A 5LP6C 4IYIA 5EBWC 2HR3A 3QO8A 4I9QA 3F7YC 5KA5A 1OV9A 3RYHB 3H01A 3C3TA 1Q81W 4DV4O 3OD4A 3ZBHA 2XAGA 4PA6A 4WFEA 2XOKG 3TCUA 1FXKA 1GN4A 1KU9A 4B3MB 2ITDC 2GUZA 5LMNO 4DR2B 2HVKC 1EZVH 5J2UB 4MVUA 3WB2A 3HKEA 4JI2B 4B3SO 4HYOA 4DV5B 1VQ7V 3CCRV 2ADQB 2AGAA 3OFNG 4JI8B 2XASA 2N05A 2EBOA 1BZKA 1U97A 1AI4A 1P7GA 1FKAO 3WB0A 3VQYA 2GTSA 2ZXWC 4TOIA 4ZHQA 1SQFA 4TQDA 4X1YA 1VQ4V 2FB5A 1L8DA 3ABTA 4D7SA 3T2MA 3QO5A 2WWWA 4O4LA 5LP6A 4P2ZA 1Y74B 3GB7C 4FLWA 3FD9A 4LF5O 2YICA 4DR4O 1K9MW 1NS1A 3ABLC 1NTZH 3IAYA 1N0JA 3ASOC 2M6YA 1W0KG 3ASNB 3RYHA 4X64B 1IZ3A 1K33A 2KSDA 4X62B 1CP9A 4UCTA 4BWAA 3B09A 1DTOA 1QQCA 1Q7YW 1GO3F 4N23A 3CCEV 4RUEA 5J2UA 1TGOA 2ZR3A 1PNKA 2VQEO 1GN3A 4DUZO 4JYBA 2BOBC 5KAIZ 3MD0A 1KB9F 3N27A 3RBZA 2A79B 3ZMVA 3R65A 4DR7B 1JX9A 1FXHA 2EILB 4Q20A 3KCYA 4HNAB 1QR8A 3IJ4A 1VF6C 1Q6UA 2ZNIA 3SPJA 1Y74A 4R50A 2JEXA 2FTKA 2WAMA 3JCUZ 2BOCC 3ZHVA 2PGGA 2VQFB 4X65O 3OMNB 1YJNV 4KL1A 2DQ3A 2VS0A 5EIBC 4C7UA 1R73A 5JJNB 1IURA 3RGBA 4UB6Z 3B2EE 5J9PC 3M99B
chains in the Genus database with same CATH topology
3GVMA 3HR0A 1WA8A 4I0XA 2VRZA 3O9OA 3Q4HB 2AZ0A 3GWKC 2DE0X 3FAVA 2AZ2A 4GZRB 2VS0A 2KG7B 4LWSB 1WA8B 3FD9A 3TXQA 4I0XB 2KG7A 3Q4HA 3ZBHA 3G80A 2B9ZA 3TXSA 4ABMA 3FAVB 3OGIB 4LWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GVM A;  3HR0 A;  1WA8 A;  4I0X A;  2VRZ A;  3O9O A;  3Q4H B;  2AZ0 A;  3GWK C;  2DE0 X;  3FAV A;  2AZ2 A;  4GZR B;  2VS0 A;  2KG7 B;  4LWS B;  1WA8 B;  3FD9 A;  3TXQ A;  4I0X B;  2KG7 A;  3Q4H A;  3ZBH A;  3G80 A;  2B9Z A;  3TXS A;  4ABM A;  3FAV B;  3OGI B;  4LWS A; 
#chains in the Genus database with same CATH topology
 4P9P A;  1SQP H;  2UUA O;  4DV7 O;  1G6U A;  2BCC H;  2R9R B;  3APO A;  1JFF B;  3P30 A;  2Q8V A;  4DUY B;  3TJT A;  5JH7 B;  4MW3 A;  2QWQ B;  1YJW V;  4HNA A;  1B04 A;  2BTQ B;  4IYH A;  5BMV B;  2PYJ A;  4X1I B;  3ZS8 C;  3GWO A;  3BCC H;  1KP3 A;  3G6E V;  4W4L A;  2ZDI C;  4PJ0 Z;  2UXN A;  1J5E O;  4O4I B;  2OCC C;  2P67 A;  1COW G;  1YEW A;  2QA4 V;  2BTO A;  3ZRS A;  3E83 A;  2Y69 B;  1N0N A;  2ODM A;  2YSU B;  5IWA O;  2Y69 C;  1VQM V;  4LFA B;  4TUY B;  1YDX A;  1LNQ A;  1SQQ H;  2RQ6 A;  2PI4 A;  2OYQ A;  1XNR B;  2FKX A;  1XIL A;  2LJ2 A;  3K08 A;  4J9Z B;  2Q0O C;  5KHJ A;  1AR5 A;  3SDL A;  4U7N A;  2H8P C;  1M4U A;  2Y0I A;  3OMI B;  4ZIB A;  5L3G A;  1XMQ O;  3EFF K;  5B1N A;  4JI3 B;  3J80 N;  1JFF A;  4GT1 A;  1XRE A;  5JH7 A;  1R6K A;  3BHP A;  4DR3 B;  1YVW A;  5LGT A;  2BTQ A;  2XTA A;  1N8R W;  1Q6H A;  2UXB O;  5BMV A;  5B5E Z;  1PPJ H;  2UXD B;  4X1I A;  1D5N A;  2QM4 A;  1GH6 A;  4NTX A;  4O4I A;  3NR7 A;  4LF9 B;  4RQE A;  1RPR A;  2F66 C;  4I4T B;  3K03 A;  3MAQ A;  1AI6 A;  2VRZ A;  4Z2W A;  1URF A;  3RT3 C;  3E8B A;  3IGA C;  2EIM C;  3F5T A;  3D8C A;  5LYJ B;  1NT2 B;  4WCE V;  2DW4 A;  4TUY A;  1Q8I A;  4GKJ B;  1SRY A;  3ZHQ A;  4FLX A;  3STZ C;  4UUJ C;  1NVP D;  3OTO B;  5JQG B;  4FIP C;  3SJB C;  4JYA B;  4JF3 A;  2WLI A;  5KX5 A;  1U96 A;  4DR6 O;  1TVK B;  2DQ0 A;  5GON B;  2Y4U A;  1Q82 W;  2YI9 A;  4RAI A;  2R9A A;  1QHT A;  4EFB A;  3TXS A;  4O2A B;  4GX1 A;  2Q0A A;  3OR6 C;  4LF6 O;  1EN4 A;  1KKD A;  3VQX A;  2QR4 A;  2YI8 A;  4JYY A;  1N36 O;  1KYO F;  5DM6 V;  4JI1 B;  2EIN B;  4K0K O;  4AHC A;  1HNX B;  3K58 A;  2ZIN A;  4JZ2 A;  4I4T A;  4O2B A;  2UUC B;  4GKK O;  3ABK C;  3OM3 B;  4X1K B;  4DV0 O;  3G71 V;  4UVA A;  3OT7 A;  2Z0A A;  3K5L A;  1NH2 B;  5LYJ A;  2F4V O;  4LFC B;  4QPJ A;  5BXZ A;  5E79 Z;  3UCS C;  1GK9 A;  2P6J A;  5KHH A;  1AI7 A;  3KCX A;  4F4L A;  5A2Q N;  2DYS C;  4GX0 A;  1M56 C;  3IFX A;  3ZN1 A;  5JQG A;  3SYO A;  4YHH B;  4YIP A;  3JAW A;  1SER A;  3ZRX A;  1TVK A;  3OR7 C;  1L0L H;  5GON A;  4U3J B;  3B8N A;  3JAT B;  2Y4T A;  4KUM A;  3ZMT A;  1KBH A;  2BE3 A;  4KHP O;  4O2A A;  5EBM C;  3U11 A;  1AVM A;  2NR5 A;  3WG7 B;  1Q3E A;  2CTP A;  4MSW C;  1BHB A;  3AG4 B;  4RQF A;  1LUW A;  5IJ0 B;  3AG3 C;  1IBL B;  1G1X B;  3CHX A;  5L3E A;  3FX7 A;  4R8C A;  5BZB A;  4OX9 B;  2RCV A;  3OMA B;  3ZMS A;  2GSM B;  1M57 C;  2CGO A;  4X1K A;  4MTO A;  4PA3 A;  1R6N A;  3BVO A;  3E8F A;  5JJJ B;  3ETD A;  4JI5 B;  4DV1 B;  2JGU A;  3CME V;  1JVM A;  4NTW A;  3E22 A;  3JCZ A;  3WU2 Z;  1GM9 A;  2LQT A;  1B6Q A;  3L9D A;  4PA7 A;  4HAM A;  3PJS K;  2FYU H;  5KLV H;  3SJC C;  2OIE A;  1B06 A;  2H94 A;  1JJ2 U;  4IHJ B;  2A06 H;  4CZZ A;  4BIZ A;  3P3N A;  2AHY A;  2EZP A;  5H6Q A;  4FLZ A;  2V7Q G;  4U3J A;  3JAT A;  2CE4 A;  4YXW G;  3FB6 C;  4FZ1 A;  4AI8 A;  2B1G A;  3ZRV A;  1N4C A;  4B3R O;  4YY3 O;  3NXS A;  3G67 A;  3EHB B;  1YHQ V;  4I0X A;  4XDJ A;  2H3O A;  3K04 A;  3OTF A;  1V55 C;  4X20 B;  4XDK A;  2JDI G;  2IM9 A;  5IJ0 A;  2ZR2 A;  3DC6 A;  4I55 A;  2P90 A;  4IIJ A;  3LNN A;  3W7S A;  3UT5 B;  1BL8 A;  2F23 A;  2YIB D;  3FB7 C;  2HJD A;  2DN9 A;  3CS5 A;  1K4C C;  1AP6 A;  4HZ3 A;  1N34 O;  5LL6 Y;  1JMK C;  4F6R B;  3UKM A;  2XT9 A;  3I5D A;  4CS4 A;  3ETG A;  3SYC A;  1FPO A;  3E35 A;  4IHJ A;  3CCL V;  2NNU A;  1XUQ A;  4HBN A;  1S77 D;  2E74 B;  5GTH Z;  1VQ9 V;  3K5M A;  2WLJ A;  2P5O A;  4ZOL B;  2R70 A;  1OCZ B;  2HLD G;  1I5X A;  3JAK A;  4J11 A;  3BAA A;  5B66 Z;  1VIB A;  2Z5U A;  3DXR B;  2X0L A;  2ZE8 A;  1HR0 B;  5J2T B;  2L35 A;  3W7W A;  1FXK C;  2O57 A;  4X20 A;  2QM8 A;  1DLB A;  1PNM A;  1GN6 A;  1KP2 A;  3MHS C;  3ETQ A;  2Q6A A;  1K8A W;  4L8J A;  1Y76 B;  2W0F C;  4UXN A;  5H6R A;  3UT5 A;  1ZWI C;  4FM1 A;  1ZL8 B;  4J7Z A;  4UCU A;  3A2F A;  3OEE G;  1OCC B;  1H38 A;  3D3Q A;  1F23 A;  1PP9 H;  1HNZ O;  2JVD A;  1WB7 A;  1LR1 A;  4N21 A;  4JGS A;  1I94 B;  3JSN A;  5LA6 B;  4A5U B;  3F7V C;  3L70 H;  2OTJ V;  1IDS A;  4J80 A;  2EIK B;  4LCU C;  5EK0 A;  4DR5 O;  4B7K A;  4ZOL A;  2QTS A;  2A7W A;  2YEV B;  4CH3 A;  4P30 A;  4DV4 B;  1YIJ V;  4PV1 B;  3IC9 A;  3DXR A;  2Q4P A;  4UFZ A;  5K1P A;  3T1Y B;  2V1D A;  5LMN B;  4B7E A;  3A0B Z;  5LHG A;  1VMG A;  1H8E G;  2UUB O;  3STL C;  4U3F H;  3FYE B;  3K5O A;  5J2T A;  1IXB A;  2XND G;  4B3S B;  4H33 A;  3C90 A;  2HG5 C;  1MZE A;  1NTK H;  1ZTE A;  3K57 A;  1F4M A;  4Q6G A;  5IYD O;  1Y76 A;  3OEH G;  1VP7 A;  1GMG A;  2EUL A;  2Q68 A;  2HKO A;  4NXN B;  1BS3 A;  1L0N H;  1ZL8 A;  2GTA A;  1ZLZ A;  1K5Q A;  3GVM A;  2ZM6 B;  1SZX A;  4DR2 O;  4FJC C;  5EC2 C;  4AQY B;  3CB2 A;  1NI8 A;  4JI2 O;  4LF5 B;  1K4D C;  4LNU A;  2HHH O;  4DR4 B;  5DN6 G;  5LA6 A;  2QWR B;  3E89 A;  5JJE B;  1Z2G A;  3FFQ A;  3ZMZ A;  3ZMU A;  2QGN A;  4JI8 O;  2E5L O;  1K97 A;  3CSX A;  1JJO A;  1OCR B;  2JS3 A;  1GTO A;  1Y66 A;  2ZIM A;  2QDO A;  3FAV B;  1M93 A;  4MVM A;  4WFH A;  2Q73 A;  1OCR C;  3JAM N;  1VAR A;  1EN6 A;  3GWK C;  4TSF G;  4JTC B;  2Q7G A;  4BW9 A;  1XEQ A;  3HKC B;  3ASN C;  4K3A A;  1N32 O;  1N33 B;  1ARO P;  2OT5 A;  1XHZ A;  4R6Z A;  1UJW B;  3H1H H;  4DUZ B;  1FAF A;  5L3B A;  1H2N A;  1IBK O;  4ZKI A;  4FZ0 A;  3CCM V;  2ZE7 A;  1W59 A;  3EVK A;  3VQV A;  2K9P A;  4X89 A;  4X62 O;  5LGN A;  2UXX A;  2EX3 A;  2HJF C;  3AK3 A;  1WA8 B;  5IDJ A;  3JD0 A;  3SJA C;  4LFB B;  2EIL C;  3B40 A;  1QCE A;  4LH7 A;  1KUQ A;  4RUF A;  1WAZ A;  4JV5 O;  2QE7 G;  4FM0 A;  1TUE B;  2YIB A;  1E79 G;  1CEZ A;  1HW7 A;  4DR7 O;  1NQT A;  2GV9 A;  3FAV A;  4MS2 A;  2IU3 A;  2PYL A;  2JJ1 G;  3K59 A;  1XOU A;  2YXL A;  2ZT9 B;  4TWK A;  1QVF U;  3ABU A;  3OW2 U;  5BY1 A;  3G4S V;  4BW5 A;  3HKC A;  1XMO B;  1QU7 A;  4K35 A;  1DF4 A;  4H13 B;  2K1E A;  3UO2 A;  1GAX A;  5IJ9 B;  4DV7 B;  2QKA A;  2EJR A;  3TK1 A;  4FMT A;  3J81 N;  1QNM A;  1S3J A;  4DV3 B;  2XUM A;  4LF4 B;  4MVQ A;  2P4V A;  2R9I A;  3LDE A;  1EBO A;  3W7X A;  4EB6 B;  1KQS U;  1HP8 A;  1O9G A;  2B1I A;  1PL4 A;  2JEU A;  3W7U A;  4UVC A;  2Y0P A;  1JPX A;  5LHH A;  1QLE B;  2ZD9 A;  1NH2 D;  1Y6X A;  1CXZ B;  3CRM A;  2OIG A;  4WFG A;  4FK5 C;  4CH4 A;  4TV8 B;  5H2F Z;  1V54 B;  5IT9 N;  4FPP A;  1GM8 A;  5H9C A;  2CDY A;  2VWK A;  2Q9L A;  5EYP B;  5EBL C;  1SES A;  1KC8 W;  4FFK A;  5ITZ B;  2LO1 A;  4PA4 A;  1QBZ A;  2Q7H A;  4MW8 A;  1W2B U;  1HNW O;  1BT8 A;  2HP8 A;  4JI4 B;  2AZ0 A;  2HEP A;  3L75 H;  5L3D A;  1D2D A;  4IGG A;  2AZ2 A;  4GZR B;  5LGU A;  4LR3 A;  4QE9 A;  1AP5 A;  2JS5 A;  1AIL A;  3TXQ A;  4PI0 A;  3T4D A;  5IJ9 A;  3JD1 A;  1XMQ B;  1MA1 A;  2ADP A;  2YIA A;  2WA3 A;  1SA0 B;  1OZ0 A;  3CP1 A;  4NVP A;  3RVY A;  4EB6 A;  4DRX B;  4YJ3 B;  1BHA A;  2UXB B;  5CB4 B;  4DR1 O;  1XNR O;  3M8A A;  4CS3 A;  2XHB A;  4WFB V;  2B5U A;  4U7O A;  5TIS Z;  2KB1 A;  2Q69 A;  1QLN A;  1F7Y A;  4NYK A;  3SJQ C;  2X6B A;  3AK1 A;  2X6A A;  3RN4 A;  4TV8 A;  3IC7 A;  3BY6 A;  5FNV B;  4BIO A;  2KQX A;  3BA8 A;  2DYR B;  3O9O A;  1SQG A;  4BIU A;  5EYP A;  4X66 O;  2ETN A;  1YF2 A;  2DMX A;  3DGE A;  3CCS V;  2PI5 A;  5LMU O;  1YZB A;  2E75 B;  1FJG B;  2UXD O;  4MTF A;  5KMG B;  4P9O A;  2P22 C;  4DV2 B;  1TA8 A;  1ZSP A;  4CS2 A;  4LF9 O;  3WFV A;  1TUB B;  2HFE C;  1M5I A;  1SQB H;  3H1L H;  1GRJ A;  5BR8 B;  1SA0 A;  3RVZ A;  4IT5 A;  1WPB A;  2A3Q A;  2N04 A;  3CCJ V;  4YJ3 A;  2UU9 O;  5H5N A;  4GLX A;  4LF7 B;  3T4Z A;  1R6T A;  4UV8 A;  3ZED A;  5CB4 A;  1BGY H;  2DWD C;  4PI2 A;  1XNQ O;  2JK5 C;  3T1H B;  3OTO O;  1XBL A;  4K0K B;  3RYI B;  2IH1 C;  4LBE C;  4B08 A;  1NTM H;  5FL7 G;  3CXH F;  5FNV A;  1AJN A;  2YC0 A;  4DV0 B;  2PTM A;  2NN4 A;  1WNS A;  3QNE A;  2EIN C;  5IY5 B;  3G6B A;  2IJK A;  4JI7 B;  1HWY A;  1DGS A;  1TAE A;  1H2S B;  2DJV A;  1MSD A;  2FML A;  4LP8 A;  1H2K A;  2EIJ B;  4FFB B;  2F43 G;  3AG7 A;  3JAS B;  1HNX O;  4FLU A;  2ZKO A;  4LWS B;  5B3S B;  1TUB A;  3CEI A;  1FXV A;  1LUV A;  4GUN A;  5GW7 A;  5EC1 C;  1OCO B;  3ZJZ A;  1AB3 A;  3B77 A;  4WFA V;  4KHP B;  4KFM A;  4DV6 O;  4MVO A;  2WLN A;  5B1B B;  1IX9 A;  2AHZ A;  4QJF B;  1S5L Z;  4W4K A;  2B9Z A;  4YHH O;  3WG7 C;  3CWB H;  1I08 A;  3E8H A;  3SPI A;  1G4Y B;  1K73 W;  5C93 A;  3HR0 A;  1Q5O A;  5A9G A;  2JJ2 G;  3AG4 C;  1R3K C;  3RYC B;  2V4D A;  2D3O W;  1AJP A;  2CTR A;  1Z5V A;  3VBB A;  1OHH G;  2OWO A;  4FFB A;  2CUG A;  1MMM A;  5CMU A;  3JAS A;  4LH6 A;  3A8T A;  2UXC B;  2WPD G;  4L87 A;  2GHY A;  1EM1 A;  2LFR A;  4LWS A;  5F2V O;  4I7Z B;  3LSS A;  1IBL O;  4OX9 O;  3J7A U;  1VQL V;  1SZT A;  3VQW A;  1YIT V;  1PNL A;  4G27 B;  3X2Q B;  2WSS G;  4DV1 O;  4JI5 O;  1HDJ A;  4B3T O;  3OUF A;  5AG2 A;  1Q86 W;  3X2Q C;  3L72 H;  4G28 B;  2Q5Z A;  3ZHU A;  3G80 A;  1W0J G;  2WLL B;  4B3R B;  1PV0 A;  4YY3 B;  4JZG A;  2L6L A;  1UFI A;  3H1K H;  3CRR A;  2GDS A;  4OPH A;  1KKC A;  5D5Q A;  5CN0 A;  4NXM O;  1CPY A;  1SET A;  4WBN B;  1I0H A;  3BEH A;  4H37 A;  4DK1 A;  3AG1 B;  4LF8 O;  1VQ6 V;  2NLJ C;  5FPO A;  1D5A A;  1I7F A;  4I50 B;  1FFX B;  1N34 B;  3AG1 C;  4J9Y B;  5DEC A;  3CX5 F;  3DC5 A;  2IBZ H;  1FFT B;  3B4S A;  4FLV A;  1BMF G;  2W0X A;  5JCO C;  3BPZ A;  1S76 D;  2DOS A;  1V9P A;  1X4T A;  1YTF B;  2P7T C;  3MHH C;  1P7B A;  2MK3 A;  2W6J G;  2YXY A;  1YI2 V;  1MOF A;  4JPR A;  2EJ7 A;  1BSM A;  3P32 A;  2Z3Y A;  4PDL A;  1OCZ C;  2WLL A;  4IL6 Z;  4K8X A;  4UV9 A;  2DE0 X;  5K1X A;  3CD6 V;  4PDM A;  1K7D A;  1ORQ C;  1JCH A;  2Q7E A;  1IBM O;  2EZO A;  3BAB A;  1DF5 A;  4PDV A;  5LBQ A;  5CBG A;  4PEL A;  1SQV H;  3UM7 A;  4WBN A;  3ABM B;  3L74 H;  3A0H Z;  4OXS A;  4JI0 O;  4O4H B;  3LSU A;  4J42 A;  2IJI A;  5KUM A;  5HFL A;  2PUS A;  1FFX A;  1XHX A;  1JR9 A;  3LUT B;  2IW5 A;  2RJZ A;  2PY5 A;  1H8H G;  5JCO A;  4F6R A;  4JI6 B;  3HB3 B;  2XAJ A;  4XDL A;  5HFM A;  1AR1 B;  4ICG A;  1VQP V;  3O65 A;  1OCC C;  1KEC A;  3JSL A;  2ZQM A;  3HPL C;  5IYC O;  3N2K B;  2RNB A;  4DO2 A;  4TT3 G;  4ZHQ B;  4NB5 A;  1VQ5 V;  2EIK C;  1BCC H;  2JIZ G;  2X7R B;  2UUB B;  3ZIA G;  3QTC A;  5KHI A;  1I94 O;  3SYQ A;  4FM2 A;  3JYC A;  4G2K A;  4O4J B;  1WPX A;  4O4H A;  1ENV A;  2ZE5 A;  2YUA A;  1ZUQ A;  2LP7 A;  4GCZ A;  5FPR A;  1GN2 A;  2LGQ A;  5E1A C;  3T1Y O;  4B3M O;  5CA1 B;  1SC5 B;  3E86 A;  3BRC A;  3CRC A;  1FYJ A;  3JD3 A;  2ZIO A;  3CXC U;  2HHH B;  4R7C A;  4UB8 Z;  2CAZ C;  4KXR A;  4JTD B;  3THO A;  3OGC C;  1VQK V;  4DV5 O;  2E5L B;  3JAL B;  3SPH A;  1RM1 B;  3I55 V;  1I5Y A;  3FB5 C;  2ZXW B;  1Q90 D;  5FLX N;  1KMI Z;  4NXN O;  1MG1 A;  3N2K A;  1RM1 C;  4YJ2 B;  2YEV A;  2QWO B;  1RPO A;  4WF9 V;  1NBM G;  2ZM6 O;  2WLH A;  3QO7 A;  4AQY O;  3D3I A;  1X59 A;  1N32 B;  3ABL B;  1MNG A;  3JD4 A;  3OUS A;  5B1A B;  1E1R G;  2A0L A;  3ASO B;  2VQE B;  3S3W A;  5B1A C;  1RSO B;  3H1I H;  4O4J A;  1IBK B;  1BQZ A;  2ITC C;  4CH6 A;  1SS3 A;  1P49 A;  4X64 O;  3TGU H;  4DYL A;  3QG5 A;  2FL4 A;  3SPG A;  5CA1 A;  1N33 O;  4GX2 A;  1S0V A;  4YIO A;  2N74 A;  4JV5 B;  5EZY B;  3H1J H;  1S5H C;  4DW1 A;  3CRA A;  3JAL A;  2OTL V;  3OE7 G;  2IJH A;  3M7M X;  1JQ0 A;  4X65 B;  1JA8 A;  3R66 A;  1SF9 A;  3QF7 A;  4PHZ A;  4YJ2 A;  3ETE A;  4GYC B;  3B8M A;  3VOU A;  1XDC A;  4K8Z A;  1SKV A;  5IYB O;  4LFB O;  3C3S A;  4H0L B;  5JWP A;  1RP3 B;  3P3P A;  1THZ A;  1UPG A;  3E2E A;  3LSQ A;  2UUA B;  1RSO A;  2VQF O;  2LW7 A;  2P06 A;  2RN9 A;  2LGW A;  3A0R A;  4D6T H;  4QGP A;  1XL4 A;  4UCV A;  4UCR A;  5LXT B;  4FVM A;  4QIW F;  1XMO O;  3MDS A;  1SQX H;  1WA8 A;  4QNH B;  5LHI A;  1PM9 A;  1JOY A;  5KUK A;  5EZY A;  1J5E B;  2KKW A;  1QVG U;  3ZCC A;  4DV3 O;  4LF4 O;  5CA0 B;  4MTG A;  1QLE C;  1J95 A;  2ATK C;  3HKD B;  3FYI B;  4DUY O;  1EZJ A;  4UCO A;  4OGQ B;  4F6E A;  5IWA B;  3BA9 A;  2ILM A;  5L3C A;  1NR1 A;  1V54 C;  4ZI7 B;  1VF6 A;  2OCC B;  3AG2 B;  2QTO A;  3QVN A;  1HNW B;  4J10 A;  4OPA A;  4X9Q A;  4BAY A;  3AG2 C;  2VWJ A;  1Z5W A;  3UQ8 A;  3ICX A;  1P84 F;  3ZN0 A;  5LOV B;  2F1M A;  5KHK A;  1T5E A;  2YXH A;  3RYF B;  4JYC A;  3OGI B;  2QWN B;  1IVS A;  4GX5 A;  1AR4 A;  5LXT A;  3SGI A;  4DR1 B;  4LFA O;  4JI4 O;  3DTU B;  4Z1M G;  1L1F A;  3AEI A;  3PN1 A;  1H2M A;  1MSW D;  2F95 B;  1WLE A;  2G38 A;  3CMA V;  3DSQ A;  2QKS A;  1VF5 B;  1GM7 A;  2WLI B;  2BSK B;  5KAF Z;  5KX5 B;  3CC7 V;  1WP7 A;  2IH3 C;  5CA0 A;  5KA6 A;  1NKD A;  4JI3 O;  3K5N A;  3WB1 A;  1PKX A;  3HKD A;  4I9W A;  4X66 B;  2ZDI A;  4ZI7 A;  5LMU B;  3FKS G;  4DR3 O;  5ITZ A;  4MTX A;  2DYR C;  1ROP A;  4JAU A;  3K0D A;  2F93 B;  4RO2 A;  2ZNJ A;  2EIM B;  1XQ8 A;  4O2B B;  1Y67 A;  3CC2 V;  1Q43 A;  2DWE C;  5LOV A;  3HKB B;  2Q67 A;  3KZI Z;  3RYF A;  5CBH A;  4DR6 B;  3TET A;  2UU9 B;  2CH7 B;  3EXA A;  2CGN A;  4DRX A;  1FJG O;  2X6C A;  4TV9 B;  3F5W C;  1YJ9 V;  4CC6 A;  4DV2 O;  4GKJ O;  1XNQ B;  1YXB A;  4FLT A;  4LF6 B;  3ML0 A;  4RWU A;  1AJQ A;  2JRI A;  4AIL C;  2QWP B;  4CC5 A;  1N36 B;  1VEW A;  3JAW B;  5IE9 A;  2R72 A;  2BSK A;  4UCS A;  4JYA O;  5BR8 O;  5CA3 A;  3CCU V;  5B1O A;  1PL0 A;  4LC1 A;  4GKK B;  3U0Z A;  1G8M A;  4J7J A;  4I5S A;  3K9A A;  3JAR B;  1M9N A;  4LF7 O;  1AI5 A;  1YTF D;  2F4V B;  1B3Q A;  3E8G A;  2LFS A;  5JVD B;  5IY5 C;  5KMG A;  3T1H O;  1K3E A;  1K5S A;  4JAV A;  4WFF A;  3ABK B;  1DK1 A;  5L3F A;  4NR1 A;  1WB8 A;  4JI1 O;  1NZ6 A;  4MVS A;  1XI1 A;  2EIJ C;  2ZCE A;  4BR6 A;  3HKB A;  3ZHR A;  2UUC O;  1A32 A;  2YDE A;  2RMK B;  4NTY A;  2QEX V;  5B3S C;  4E2L A;  4JI7 O;  2P4K A;  3D36 C;  3E22 B;  3KKY A;  1K34 A;  2CH7 A;  2A9H A;  4DV6 B;  3RW0 A;  1H2L A;  4CH5 A;  2DYS B;  4TV9 A;  2XAH A;  1M56 B;  4LFC O;  4EEQ A;  1OCO C;  1VQ8 V;  3SPC A;  3RFR A;  4Z1V A;  2CTQ A;  3APQ A;  2PZS A;  3CRQ A;  4PD4 F;  2QSA A;  1M1K W;  3KG2 A;  3RYI A;  5B1B C;  1QR9 A;  5IYZ B;  3ZX6 A;  1VQO V;  4TQF A;  3K0G A;  2RDC A;  1Q6I A;  3W7T A;  3JAR A;  4EKW A;  2AW9 A;  1EFR G;  1XL6 A;  3L73 H;  5JVD A;  3AG3 B;  2YID A;  4I0X B;  5CBF A;  2JGD B;  2E76 B;  2IU0 A;  5GTI Z;  1M57 B;  3LNM B;  1FS0 G;  4MVR A;  5KHG A;  2IJJ A;  3RWR D;  4I55 B;  2AXT Z;  1WP8 A;  4IIJ B;  1VF7 A;  1WJZ A;  3D36 A;  3LDC A;  1YSC A;  2M7W A;  4NKG B;  3K3W A;  2PF4 E;  1IXM A;  3CJH B;  4B3T B;  2QJ1 A;  1K92 A;  4PDR A;  4UVB A;  1PD3 A;  4DK0 A;  2UXC O;  3S3X A;  2CK3 G;  2GBO A;  1O9H A;  4KP4 A;  2YS8 A;  3ZHT A;  3AK2 A;  5DED A;  4NXM B;  4ZBM A;  1ZAU A;  2XAF A;  5IYZ A;  4MT8 A;  1R1B A;  3JAK B;  4LF8 B;  2XAQ A;  3CCV V;  3K06 A;  2WLM A;  1NVP B;  1RFY A;  2MW2 B;  3RYC A;  1P4R A;  3BFR A;  1V55 B;  4H44 B;  4X88 A;  1Y4M A;  1R3L C;  3CC4 V;  4X8A A;  2JGD A;  1S72 V;  3K9S A;  1US6 A;  3UO3 A;  4FLY A;  3CCQ V;  4QE7 A;  3ZRW B;  4DW0 A;  1KD1 W;  4DXW A;  5C8Y B;  3CYO A;  1R3I C;  4D7T A;  4J7K A;  1S5J A;  2CTW A;  2D2C B;  1VQN V;  3CJH A;  3ZHS A;  2W6I G;  2HVJ C;  4E4E A;  2C2A A;  3SYA A;  1NR7 A;  3N2G B;  1H2G A;  3FB8 C;  3SR2 C;  3Q4H B;  3T1C A;  4JAA A;  1IBM B;  2LW1 A;  2WLK A;  1YCI A;  2KG7 B;  1M90 W;  4JTA B;  4PA9 A;  4JAS A;  1R3J C;  1NJI W;  4JI0 B;  3JD2 A;  3K79 A;  2QM7 A;  3U10 A;  2E3C A;  2ARH A;  1NU1 H;  3ABM C;  4I50 A;  1FXK B;  1HR0 O;  2GUZ B;  4ASU G;  1ZX3 A;  1FD9 A;  1GKF A;  1F4N A;  1HNZ B;  1MAB G;  3HKE B;  2OCH A;  3CPW U;  3ZRW A;  4ABM A;  1E1Q G;  5C8Y A;  4XBF A;  4MVZ A;  4EFE A;  1BE3 H;  3L71 H;  4DR5 B;  3I56 V;  5D5P A;  4CBC A;  5EIB D;  3OAA G;  1BQ0 A;  3N2G A;  1F51 A;  3LDD A;  2QKC A;  2WA4 A;  3Q4H A;  4X1Y B;  4JI6 O;  2ZE6 A;  1EN5 A;  1OJH A;  1WN7 A;  4LNU B;  4QPK A;  2KG7 A;  4O4L B;  5LP6 B;  2Y48 A;  3H9V A;  3SYP A;  1MZF A;  4J41 A;  3CE2 A;  5LP6 C;  4IYI A;  5EBW C;  2HR3 A;  3QO8 A;  4I9Q A;  3F7Y C;  5KA5 A;  1OV9 A;  3RYH B;  3H01 A;  3C3T A;  1Q81 W;  4DV4 O;  3OD4 A;  3ZBH A;  2XAG A;  4PA6 A;  4WFE A;  2XOK G;  3TCU A;  1FXK A;  1GN4 A;  1KU9 A;  4B3M B;  2ITD C;  2GUZ A;  5LMN O;  4DR2 B;  2HVK C;  1EZV H;  5J2U B;  4MVU A;  3WB2 A;  3HKE A;  4JI2 B;  4B3S O;  4HYO A;  4DV5 B;  1VQ7 V;  3CCR V;  2ADQ B;  2AGA A;  3OFN G;  4JI8 B;  2XAS A;  2N05 A;  2EBO A;  1BZK A;  1U97 A;  1AI4 A;  1P7G A;  1FKA O;  3WB0 A;  3VQY A;  2GTS A;  2ZXW C;  4TOI A;  4ZHQ A;  1SQF A;  4TQD A;  4X1Y A;  1VQ4 V;  2FB5 A;  1L8D A;  3ABT A;  4D7S A;  3T2M A;  3QO5 A;  2WWW A;  4O4L A;  5LP6 A;  4P2Z A;  1Y74 B;  3GB7 C;  4FLW A;  3FD9 A;  4LF5 O;  2YIC A;  4DR4 O;  1K9M W;  1NS1 A;  3ABL C;  1NTZ H;  3IAY A;  1N0J A;  3ASO C;  2M6Y A;  1W0K G;  3ASN B;  3RYH A;  4X64 B;  1IZ3 A;  1K33 A;  2KSD A;  4X62 B;  1CP9 A;  4UCT A;  4BWA A;  3B09 A;  1DTO A;  1QQC A;  1Q7Y W;  1GO3 F;  4N23 A;  3CCE V;  4RUE A;  5J2U A;  1TGO A;  2ZR3 A;  1PNK A;  2VQE O;  1GN3 A;  4DUZ O;  4JYB A;  2BOB C;  5KAI Z;  3MD0 A;  1KB9 F;  3N27 A;  3RBZ A;  2A79 B;  3ZMV A;  3R65 A;  4DR7 B;  1JX9 A;  1FXH A;  2EIL B;  4Q20 A;  3KCY A;  4HNA B;  1QR8 A;  3IJ4 A;  1VF6 C;  1Q6U A;  2ZNI A;  3SPJ A;  1Y74 A;  4R50 A;  2JEX A;  2FTK A;  2WAM A;  3JCU Z;  2BOC C;  3ZHV A;  2PGG A;  2VQF B;  4X65 O;  3OMN B;  1YJN V;  4KL1 A;  2DQ3 A;  2VS0 A;  5EIB C;  4C7U A;  1R73 A;  5JJN B;  1IUR A;  3RGB A;  4UB6 Z;  3B2E E;  5J9P C;  3M99 B; 
#chains in the Genus database with same CATH homology
 3GVM A;  3HR0 A;  1WA8 A;  4I0X A;  2VRZ A;  3O9O A;  3Q4H B;  2AZ0 A;  3GWK C;  2DE0 X;  3FAV A;  2AZ2 A;  4GZR B;  2VS0 A;  2KG7 B;  4LWS B;  1WA8 B;  3FD9 A;  3TXQ A;  4I0X B;  2KG7 A;  3Q4H A;  3ZBH A;  3G80 A;  2B9Z A;  3TXS A;  4ABM A;  3FAV B;  3OGI B;  4LWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...