4ABTA

Crystal structure of type iif restriction endonuclease ngomiv with cognate uncleaved dna
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
286
structure length
286
Chain Sequence
MQPLFTQERRIFHKKLLDGNILATNNRGVVSNADGSNTRSFNIAKGIADLLHSETVSERLPGQTSGNAFEAICSEFVQSAFEKLQHIRPGDWNVKQVGSRNRLEIARYQQYAHLTALAKAAEENPELAAALGSDYTITPDIIVTRNLIADAEINRNEFLVDENIATYASLRAGNGNMPLLHASISCKWTIRSDRAQNARSEGLNLVRNRKGRLPHIVVVTAEPTPSRISSIALGTGEIDCVYHFALYELEQILQSLNYEDALDLFYIMVNGKRLKDISDLPLDLAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Type Iif Restriction Endonuclease Ngomiv with Cognate Uncleaved DNA
rcsb
source organism Neisseria gonorrhoeae
molecule tags Hydrolase/dna
molecule keywords TYPE-2 RESTRICTION ENZYME NGOMIV
total genus 97
structure length 286
sequence length 286
chains with identical sequence B
ec nomenclature ec 3.1.21.4: Type II site-specific deoxyribonuclease.
pdb deposition date 2011-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09015 NgoMIV_restric NgoMIV restriction enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Type-2 restriction enzyme NgoMIV 4abtA00
1FIUA 4ABTA
chains in the Genus database with same CATH superfamily
2HV9A 1LLDA 2P1ZA 2DHDA 3I6YA 3L8MA 2Z5LA 4C4TA 1I4LD 3H9EO 3QLVC 4BB9A 8AT1A 2HL6A 2R6FA 4WOJA 2ONZA 3X2SA 5GIPE 3COSA 1VPTA 5SYAA 1E59A 1I5OA 4PXYA 1NVUQ 1RHUA 1U6KA 2VJBA 3H11A 2GZMA 3KEFA 5EFOA 3MZ0A 3X1WA 4RTJA 1WTAA 2NYRA 4GR4A 5JDIA 4WL0A 3OX2A 5JV5A 1I2BA 3CLRC 2BFDA 1V7PC 3CGGA 4IJ5A 3ZVMA 2AN5A 1HURA 1JQ5A 1CJBA 3AMVA 5G1OA 2G88A 2R0QC 5U9CA 4N7JA 3BIXA 1PIWA 1AXRA 1IEVA 3DO8A 5CHYA 2V65A 3LT4A 3LP5A 1PEDA 3D7RA 1Z75A 4L07A 4YLGA 4Z0NA 3ZEAA 2IBSA 3TS1A 1JQAA 2FSUA 4AS1A 5HCUA 2HU8A 1DXOA 2C4TA 2D2VA 2RAUA 3ZWMA 4F4IA 3NT2A 1XZIA 3QG1A 4KFRA 4WNIA 3S7TA 4ZJUA 1HLPA 1W36D 2HRQA 1M7GA 2DR3A 1FLAA 2P90A 2IYVA 2XVXA 4NR0A 3ZKWA 3SYMA 1II9A 1SCDA 3PDWA 2GBFA 3PTZA 2IH2A 3MMNA 3DR3A 2G09A 2BMWA 3O4JA 1E0KA 1IJFA 3RU7A 2GVZC 2WWHA 4MGHA 5DSXA 3DXXA 3R76A 4YR7A 4TWRA 3UV3A 3R3JA 1DKMA 2HXSA 3EXHA 3H83A 3WJ2A 3V3KA 4QQ8A 3HCFA 5K51A 3MYYA 2JKYA 1XNGA 2Z5VA 3ANMA 3N53A 2B9VA 4N3AA 3WRYA 3PQ7A 4ITVA 4KHPB 2N75A 3RS5A 1J23A 4B2IA 2V58A 3K0FA 3AFGA 1VL0A 2G06A 3X1DA 3O4IA 5LP6A 1JQDA 1OKKA 1ZBDA 2LD4A 3BCUA 3COJA 2XCSB 3AVOA 3QVGB 2WIJA 2YUIA 1X9HA 2QMYA 4K9KA 4CV3A 4HWPA 1FNBA 2WWWA 2CLDX 3C4VA 3Q41A 4G4SO 4GBJA 2O7VA 2ZCUA 3OFND 4I6GA 2D13A 5EUQB 4L8WB 3FYDA 1NW8A 5EIXA 1T1JA 1OFVA 2YVQA 5KQRA 3OOSA 2FUNB 4EZEA 2BZ1A 3C1UA 2QTZA 4J43A 4RW0A 2I2FA 4E2YA 3OF5A 2NZJA 3G59A 1CY1A 2PFGA 4P98A 3W04A 1Y7PA 4F3RA 3HJBA 2PUAA 1OHHA 4JOBA 2PUBA 1AQ6A 2TMDA 4ZAGA 2A8YA 4FGSA 2C97A 2F3TA 1I01A 1ECCA 4AUKA 1GNQA 4K9RA 3ZHYA 4I8XA 3ZCRA 3BPSA 4MA0A 4REQA 4LEIA 3IB3A 3G0BA 1IOLA 3AUJB 1C4XA 1XA0A 4GX0A 4FMPA 2EX4A 4WASA 3VJKA 3RIEA 5DBIA 4BO1A 2HZBA 3WWEA 1JG4A 2JGIA 1KFJB 3PQ2A 4LBYA 4OGFA 1JI0A 4PINA 3SNKA 4C2AA 1GKLA 1YFZA 2J1LA 1YDHA 5JWOA 1MQAA 3E7DA 2OL4A 4LYDA 3AEQB 4MUFA 3HABA 4LMAA 1UPXA 2QLFA 4LXHA 3UT5B 3SIXA 4BOYA 1F4VA 1N8SA 1YBVA 4CMKA 1Q16A 2C3UA 1PNVA 4Q34A 2YFKA 2WJPA 4FC6A 4NU6A 2G8LA 4BVAA 3U4DA 2QR5A 2ATEA 4C5BA 4MS3A 5TNXA 4N01A 5KDLA 5I4KA 3WIBA 4YRNA 1IQ0A 5M29A 4KMOA 5A2GA 2YVUA 3EIEA 4QARA 5E7QA 3EVZA 1QO0A 1NV8A 3OETA 1XMVA 1U0GA 1ZUIA 1XZMA 1I1QB 4YCLA 2FEPA 4EYGA 3QYJA 1OF1A 3ZDXB 1B93A 4DDTA 3DM5A 4Y6GB 1KSFX 2XTMA 1VG1A 2LKDA 2CLKB 3I6MA 3EVBA 5EJ2A 1SXJB 1ZP6A 2DWCA 1VSUA 2BEVA 3IODA 1YVEI 3THXB 2PAFA 3OIVA 3D0RA 1JFVA 5K6AC 5CUQA 5D00A 4RTPA 2JLUA 3A11A 2IH4A 4HZIA 2I7VA 1MENA 1Y0BA 2V5AA 3O93A 4QWMA 3DBRA 4RVCA 5CLFA 3GDGA 3U4QA 3PSAA 2XMRA 4MKRA 3UHAA 5A4KA 1TKAA 2EFEB 1OPRA 4P3KA 4PEVA 2FEXA 2VT2A 2ZDQA 1G42A 3C87A 1K7EB 1M8KA 1QO0D 2F00A 1EK5A 3HFJA 3QV1A 4R05A 4RMGA 4KQ2A 4NVRA 3UG6A 4B2LA 4BO2A 3PLNA 4EARA 2YWRA 3F3YA 2BFPA 1H3NA 3HY6A 1N8TA 2DFNA 2ZT7A 1F12A 1PDWA 3B3AA 4MWEA 3IMFA 4BO8A 1SG0A 3A1CA 2VLBA 4OQYA 1CYEA 2FWBA 1HE2A 2XA1A 1ZKMA 4CM6A 1IOVA 5B1HA 4H1TA 2P67A 3SY8A 1G4HA 2BKLA 4MPRA 2F43B 2PMKA 4UM5A 1VHLA 4E30A 5C35A 1JXMA 4JI4B 3AJ9A 2J9FA 2O14A 4ZA2A 2B20A 3D3KA 3M89A 4E6EA 4TQAA 4YJKA 3TW4A 1CUCA 5ESXA 4Z8YA 2BGJA 1K08A 2ZJOA 2VTDA 3PWKA 2A1TR 2H4FA 5IH3A 3ZCTA 2MYNA 2OKGA 1N0UA 4AN0A 3LK7A 5G1NA 6YASA 3WAGA 3HG7A 5MFZA 3STUA 3TIVA 3LBFA 2ONJA 3DLCA 2OBBA 3U7RA 1WDWB 3FR8A 4RTRA 1F4PA 1DHRA 1X7DA 1RXEA 2VHYA 3KJHA 4U39A 3ELYA 4HN4B 2IHYA 5DX8A 3I8OA 3WLMA 2B8JA 2DAPA 2OCGA 2PH5A 5K3BA 3EQ2A 2HK8A 3W77A 3OTIA 1E6UA 3I2GA 1YQEA 4UTOA 3SE0A 1B41A 1VKNA 2VP6A 4MIYA 1E9CA 2LCFA 4TSFD 5AKLA 2G4LA 1EESA 2V7QA 1A9PA 1RJ9A 4AKHA 2L42A 2WSYB 4F6CA 3JZIA 5FNVB 4G81A 1BROA 2BGUA 1OXXK 3IQWA 2M6SA 4YJHA 2OGUA 3FWZA 4F60A 1IPEA 5I7WA 3GT7A 1D8TA 2FWJA 2ZJZA 1WCV1 1QIGA 3I2JA 1O77A 3QOWA 1ZH8A 4QDZA 5BSMA 1GR1A 5C8DA 3GGOA 3EBPA 3IJPA 1Z5NA 1DJQA 2XUHA 5CJ2A 4JP8A 3RSSA 5HJ5A 1XZEA 2PS1A 2H07A 4CIWA 1GVNB 1CB7A 4QYMA 1V4VA 3G9QA 3QM1A 1VMEA 3SFTA 4KU4A 5IAOA 3IE1A 3BMCA 1J0XO 5JPIA 3ILXA 5ALDA 1E8DA 4CDRA 1AXEA 3GJ6A 5CA0B 2FFRA 3NO4A 5FI3A 4BFLA 4JLVA 1P17A 1QB8A 2O4UX 2PO7A 1QK4A 3K0FB 3PC6A 4WK0B 1PEYA 3E0XA 3NVMB 3FYSA 5T3UA 3JR3A 3I73A 2OGTA 2VK4A 4JP5A 4DMGA 3K73O 2V7EA 3R2JA 3CX4A 1Q6ZA 1YJXA 3PWTA 5F2EA 4OIMA 5FL7A 5IAKA 4DHEA 4YRAA 1KH2A 4AICA 4UDYX 1WUIS 4K9DA 4M1EA 2C99A 1JLRA 8ATCA 4IKPA 4Z99A 1M0TA 5T6MA 3SEQA 1BE0A 3S29A 3OJXA 5IKEA 1UK9A 3OZUA 1B0AA 3RYHA 4UREA 4RTNA 1ZISA 2A4KA 2PY6A 1JB9A 3HWRA 3R0XA 2PCLA 2YXLA 2YN4A 1CERA 4XDYA 3R24A 3PFWO 4YXWD 5I51A 1KEEA 4EP1A 2DX7A 2R8YA 1YK1A 4JSYA 3NBFA 2R66A 3HZHA 2FZ4A 4KPUB 1XTVA 3W2EA 1FB5A 2CL7X 2HPVA 3BJZA 1KO5A 1GPNA 5DYIA 2W8BB 2VYNA 4MCHA 3Q7SA 4BECA 1ZDMA 1I1NA 5DJ5A 2I4MA 4E7OA 1F17A 3Q9NA 1JYSA 1P1CA 2CKMA 4BX0A 4PFQA 1GG9A 1XZLA 4LUCA 5C4MA 1OIVA 3FFAA 4CM8A 3LX6A 4XX0B 2XT9A 4C30A 3KCNA 1W25A 2CWWA 1VKHA 1IONA 5JVDB 1PLKA 3PFKA 3T3MB 3UT5A 4ON9A 2Y2UA 2CL5A 3ENWA 3KAPA 2G8NA 4NJEB 1DBWA 4E5DA 1HSOA 3H9CA 3R7SA 2XE4A 1IG0A 1FS5A 2O50A 3LDHA 2YOFA 1RM5A 2VAMA 2FE1A 3I23A 4XUEA 5KVCA 4MW4A 5E6RA 3G2IA 1DP4A 1CD5A 1B15A 3IPRA 3P9PA 4HD8A 4NS4A 1TTQB 2Q4EA 1YQ9A 2P4HX 3CRZA 1BDHA 3HVJA 4DCCA 4XGRA 1FFXA 2UDPA 1MOZA 4OSEA 4HLNA 5JJLA 2PTGA 4FW8A 2AE1A 1JMKC 2IPNA 1AA6A 1Y6ZA 4EG6A 1XMSA 4PAQA 1WB5A 3OIWA 3T5GA 3GPIA 2Q3HA 3QI2A 3AB8A 4LJ9A 8MHTA 4K88A 4HWTA 1EFRA 3DNFA 1Y1LA 2GO1A 4OB6A 1RPAA 2GEVA 4MUIA 3V4VB 4IKEA 1DNPA 2J4DA 1NMQA 2JHPA 4XASA 2FHSA 3RQSA 3TPCA 3CVUA 3E81A 3WVNA 1HNZB 4WLOA 3SN6A 3T5PA 4DJJA 2I91A 2XCTB 2C9ZA 2QRQA 3VMFA 3NUGA 4G5YA 4C07A 2ZYRA 1VI2A 4P0TA 3ROXA 2NUBA 3EAQA 4BQSA 2BDUA 4KL8S 4JBHA 2AF4C 5EMNA 2Z6AA 2Q0QA 5TS3A 4O4LF 3QMPA 1TJNA 1C5KA 3QKIA 1T8PA 2JIRA 1QJ4A 4XUDA 2EOAA 2O2EA 1MX1A 2K7ZA 3AP3A 4LSGA 4UHDA 5FAXA 1XAJA 3WKCA 3ZBUA 1QIIA 4BDTA 4PGFA 4CDMA 1E7MA 3OCCA 1UDAA 5IAAA 5J5VA 3S99A 1PEKE 4JUFA 4L74A 2Z56A 3W1WA 2ZR0A 2GXSA 4LJAA 2DR0A 5K3SA 1PJBA 1Y6QA 4PR0A 1YB6A 3QHAA 3OU7A 3HLYA 3E70C 5KTKA 3X2FA 2JDIA 4BLWA 2WFLB 4YUZA 1USUA 4TMVA 3R5TA 4X7BA 1OV4A 1OGJA 4HDMB 3FOFC 3AFIA 3CC8A 1MIOA 1JHUA 3M6LA 3FSEA 1D2CA 1UK6A 2MR6A 5JY1A 2J9RA 2V7GA 3COWA 2I2WA 3OA0A 1XTJA 4R0NA 4YTEA 2AOUB 4N54A 5DFAA 4AS3A 1QAQA 3NXKA 3LC7O 1QS0B 5FPHA 4HBGA 3MGBA 2VDWB 3Q3IA 4B4OA 2PXHA 1NSTA 1E1CA 3DB2A 5B4VA 1W0CA 1WWKA 2WYWA 1WTCA 1YDWA 3JQ9A 3LKVA 4ZAWA 1HG0A 4GPTA 1MO6A 4J3FA 5JCOC 2IFTA 13PKA 5DASA 1MQSA 1W4CA 5EPEA 2YJ4A 4Z7QB 3GLKA 2BEUB 3QE4A 1OUMA 2JFBA 3MT9A 1TIKA 3IUPA 3NJ4A 3EZLA 1DKPA 4JI8B 3GD5A 3LPAA 4ARZA 2JG3A 5K8JB 5K0SA 1UFQA 2JAQA 4DIDA 5HFAA 4TYNA 1TM5E 1TGYA 1ZCZA 4ZGBA 4RKEA 1QHEA 1R9MA 2O05A 4TL7A 3V4FA 4IGFA 2ODAA 4PYIA 4C9BA 3FDFA 3AF1A 1IZ9A 3DVRX 1JUDA 5CHEA 2EWMA 4FCTA 2WE8A 2FGJA 1Z37A 2HJSA 4EF6A 2ACWA 4L3OA 3IERA 1GZUA 2YXBA 5BN1A 3S1AA 4BX3A 4CU5A 3DD1A 4I14A 4D9NA 1UMBB 4EDHA 1FNSA 2P79A 4YMWA 3IB6A 2OBYA 2YN2A 4BQNA 1YXMA 2VPZA 1OKKD 2W6JA 3R0JA 2V7UA 3ROPA 2Q5HA 1BGXT 4AF6A 1NWHA 4GC5A 2FI1A 1MV8A 3P45A 3ZY5A 4CODB 2CXQA 4I1PA 1KL7A 4DZTA 4Q3OA 2HHLA 1XEWX 1XLVA 1HKUA 2VS1A 2W48A 2X5OA 3IJRA 5EHGA 4CKYA 2C5SA 4U8GA 3V1LA 4OGWA 1B14A 1BGWA 4HUQA 3DLPX 1EWYA 2W71A 1J6UA 3E03A 3NM4A 3EOBI 4EO9A 3WL5A 1KRHA 1Q0SA 4TQUS 5EOVA 2D2XA 5EJIA 2XD9A 1YDEA 5GZ1A 1N2IA 2EF0A 2DY0A 1NTRA 1NAHA 1R15A 2W6IA 1Y9JA 2JVIA 2IZ0A 1VBMA 3N2KA 4FIZA 1MAHA 2AXQA 4RPGA 4D82A 4KVZA 2LCQA 4YRZA 5GOTA 1NQVA 1QX4A 1BVHA 4IDPA 1H23A 3FB1A 3TQIA 1QQ5A 4FJ0A 3AH8A 2PJZA 4FFBA 1VLLA 2H8KA 2K2WA 3AYXB 4YP7A 5JBIA 4HUTA 2I80A 5BSUA 4FHGA 4J8PA 5FBZA 4ARUA 3FSJX 1I1HA 4TLBA 4AF7A 2BBSA 4ZCLA 4U6QA 2JGDA 5DWQA 3HK2A 1O5TA 3WC4A 1YR6A 7AT1A 1XN1A 4NJMA 4B8YA 1V39A 4RADA 3NB0A 1UJCA 4MH0R 4D9HA 3T15A 1RCFA 2L2QA 3O1LA 4QWWA 2PM8A 4F21A 5BYJA 3ITDA 2ZWMA 2HWUA 2PS3A 1XDUA 1ISJA 1GGMA 1ZM9A 1JLMA 3K3PA 4HDNB 5EHQA 3SYKA 4RX1A 3ZE7A 3VTKA 1Y3HA 4RV4A 4B48A 3ZWXA 3M1IA 3CZ4A 4CV0A 5IN5A 4A10A 4EZBA 3RRNA 1C3LA 5KMGB 2QXTA 3IQFA 4X94A 3ZE0B 5KYUA 2JLAA 4CUKA 1M34B 3UMSA 4OJMX 1Q11A 3GJRA 4HDRA 2ZROA 2UUPA 1RKXA 4JQYA 1XD2A 2ZBEA 1XQYA 4E3WA 2XITA 1BS1A 1JF8A 2ALJA 1QMPA 4XRGA 2VXOA 3UJBA 1NM5A 3LWBA 2Z8YA 4QGFA 3A2LA 5KYGA 2YCBA 1ODKA 5BSWA 5DXJA 1JFFA 4F2PA 3DDNA 2GM5A 5K0GA 1U2RA 4J4BA 4U2DA 2AG5A 2FRDC 4GUAA 5H8WA 2HCJB 3LUAA 9ABPA 3AZQA 3DBIA 3EUFA 1JW9B 4JVMA 5BSHA 2WYHA 1KZ7B 2D5BA 4IIXA 4CIXA 2BEWA 3A2KA 3TSCA 1V2HE 4IOKA 3V9AA 4I6EA 1SQSA 1J42A 2P9CA 2QL6A 4G1MB 4RACA 4UKDA 2ZFUA 2VHQA 4BV3A 1N36B 1KYXA 1VJCA 4O2BF 4KXUA 4NCAA 3PZRA 4MV8A 3HJTA 4M9ZA 4MR7B 4RK7A 3ZHCA 3JQDA 3H4IA 3Q0TA 5LUBA 3UCXA 1UQUA 2X8BA 4HS9A 1KY3A 3DUFA 3DP7A 2PQ2A 1JIQA 1Z7EA 2TMGA 1OYYA 1P72A 3UUGA 3C3XA 3W3AH 1WHTB 3OM9A 5C8XA 5CJPA 2CXUA 1J70A 2RJOA 3A6HA 2QAGB 4I3GA 4O4IF 2AVDA 1VIYA 3B3GA 4HDNA 2AFIE 5BR7A 5ESDA 1M10A 3DAHA 3HB7A 3KB6A 3GAFA 3QMVA 5KHLB 4KR0A 3MJEA 1JAYA 4BV9A 1RAHA 5EXTA 1DJNA 3UUWA 3W1VA 3A27A 3IELA 3CZCA 1EFVB 3Q12A 5JISA 3L0PA 1WNTA 2FF7A 4P3OA 1MVOA 1Y5NA 3W4KA 4CKEB 4CMCA 1E2UA 1VFNA 2CF5A 2AYZA 4M8SA 5EMMA 4UTNA 5BV7A 2BTQB 5EHZA 1P45A 2QZZA 3SKVA 4WXMA 2NTJA 1VL2A 4ZIRA 4IDOA 3C3KA 2IZ5A 4K1XA 2DH6A 3T0IA 1LJ8A 4ZEOA 1E3WB 1H8HA 1J99A 3TX6A 3FWNA 3RHTA 3UAXA 4YMTA 2O2HA 5F77A 5K6RA 1X15A 3TLXA 5KHAA 5DLPA 1IN7A 2WP0A 1QFSA 3CUVA 1YTLA 2C1ZA 4NECA 2JIZA 2ZRCA 2ZTUA 1ONNA 2QHXA 2YTZA 1ZD1A 2B1QA 2V7XA 4M8LA 3X1KA 2NPOA 5AT1A 3N8NA 2OXTA 3GVCA 2ZE8A 2SKCA 1ZD8A 4LFCB 5IDYA 4CL3A 3F5FA 1A3CA 1NIPA 3AWDA 3CE9A 1QQBA 1IHXA 2ZSFA 1Y5IA 4MV7A 5HBGA 5JTTA 1RBZA 3P19A 4B3GA 4INZA 3BL5A 4EHDA 3HADA 3OC0A 4KC0A 4ALKA 5JDCC 5D3QA 1YC5A 1PR1A 2Y2VA 4AN4A 3SZOA 2QX8A 1T9GS 1T5BA 3ZS9A 4AJLA 3HO8A 2QQ0A 4MCIA 2BHLA 5F78A 3U7FB 3WG9A 1DDOA 2NSHA 3B6ZA 2PWYA 5IJWA 2H51A 1A96A 4M53A 3RC8A 1M2OA 1UBSB 5GZ6A 3FWKA 1KF0A 1ZH2A 2VF2A 3FSGA 1ITZA 2HA4A 4ECEA 2JA1A 2OO5C 3EVAA 1Q6YA 2CLIB 1OA1A 1OROA 3FG9A 3JRXA 3DFUA 3NVDA 3OJFA 4UUPA 1ZOPA 3E35A 1G21E 2E1RA 1HGXA 5JCXA 4M9SA 5D5PA 2J5QA 4EVIA 3PX7A 1FVHA 2GDJA 3H97A 4P5DA 1ZOOA 4PW0A 1NL3A 5IF3A 3O4GA 4MQEA 1P77A 3CR3C 1I2AA 3V34A 3L01A 3PIDA 2LCIA 3CTPA 1J8YF 3ISJA 2AUMA 1GUBA 3C98A 3G02A 4F4FA 2DLCX 1WUHS 4G3XA 1NATA 2DUWA 1QHSA 1YB5A 3AYZB 3N9IA 4KIGA 4NI5A 1F6DA 5HIIA 5LC1A 3ZWCA 2P40A 1AF7A 3DR5A 2JS7A 3G8DA 3HPQA 2OQVA 2D62A 2GPYA 2IUTA 2XYQA 3LLSA 3OBBA 3ROGA 5IDXA 2G71A 5K0TA 2O06A 2J30A 3GEDA 5MHTA 2Q3DA 4G01B 1UPTA 1EQAA 2XR1A 2JGKA 3DEJA 2P9TA 2X58A 5CA0A 4YUVA 1QE5A 1ML3A 4HSGA 4PZDA 5BSRA 2XNKA 3FCCA 5ETJA 3LCJA 2P3OA 3TOCA 2QT9A 1P9NA 2O3SA 1Z0UA 4TWJA 4LF8B 2PKYX 2FGKA 1QAOA 1ZGHA 4GPZA 4LZOA 4G4SP 4PLPA 4Q4CA 3O8OB 2CLMB 4MIKA 4OU4A 3K5WA 4CKWB 3MRSA 1P2GA 3D0OA 4W5HA 3RREA 3SJ7A 3HDGA 3I2FA 1P4AA 2VWHA 4CM9A 4D9CA 1YRAA 3L9XA 3EWIA 4Z4FA 2H9IA 3UB4A 3A0RB 3SZ3A 2NQ2C 1YR8A 2Q1UA 3PICA 3R0ZA 1IFXA 4DZRA 4BN0A 3QYFA 4AUNA 3WGUA 1TJ3A 2CVZA 2E2WA 4BTLA 4LJ7A 1IG3A 2V6MA 3EMVA 3I9KA 3PE6A 4UU8A 1HL3A 3QTTA 1SCUA 4OLFA 4HS4A 1E94E 3WFJA 1Z33A 5BMVB 2H5JA 3HWSA 4O0LA 1YL6A 5JE8A 3EXG2 3H5RA 1T8SA 5FOVA 4DQUA 4WBNB 1NW6A 2WWGA 1MFZA 2IRWA 3IQIX 4JMLA 2AQ8A 1IXRC 3OY7A 4KAFA 3DPIA 3LY7A 3UJ7A 4A73A 3KR2A 4W1QA 4DLYA 1PL6A 4NE2A 3ND9A 3T7KA 1JQ3A 1L8AA 2WYIA 2JHAA 2CUKA 2OXRA 2QVBA 3AEZA 2RAPA 1GAEO 4TUYB 4D9KA 1U81A 1LA2A 2IOFK 3GGCA 1OX5A 3GRAA 5BW4A 4B83A 1KI8A 1UIRA 2DBYA 1XHLA 3AONB 3DWEX 4GRDA 2BGNA 1M2JA 4F72A 2D5AA 2PN1A 1ZFNA 2HIMA 1E2NA 4KSYA 3GWGA 3BQNB 2W2KA 4Q48A 3DZJA 4AKIA 3ETJA 4NPAA 1WQ3A 2JCYA 3KD2A 4URVR 5T4FA 4LX0A 4UE2A 4LKRA 1WOMA 3U3MA 1RHKA 4X92A 4BZZA 1PJQA 4TYQA 2NU7A 2J8ZA 1L4UA 3KLNA 2B5WA 2FPUA 5EJ5A 2YXEA 2V74B 4RCYA 4DY6A 5K2OA 1JZQA 3IPAA 1QNFA 1JKXA 1S2GA 4PSDA 5TR9A 2QT1A 5JECA 5IM4F 1GU1A 1PGPA 1Y3IA 2QR2A 4WV3A 5JVDA 1ADBA 1GXSB 2HA3A 2ZXFA 4CMBA 4GE0A 1JHPA 3LV8A 1A9SA 3AC0A 4JBIA 1Z06A 3DZFA 4B3TB 4EYEA 1EK6A 2I3DA 5C4GB 3VR0A 4KEAA 3B5IA 3RS2A 4DY4A 3DW3X 3PPWA 5KWVA 4HWKA 4LGVA 4O2AB 1GUAA 3BIFA 4H4EA 1DC3A 1MNQA 1S01A 3LQ1A 2AB0A 3PXXA 3EA5A 1EZ4A 1BS9A 1QG0A 3I92A 3PT9A 4GVLA 4KXWA 3TCXB 2A1UA 1UMKA 2H63A 3TZBA 3QLEA 1LVUA 1TT5A 2BMJA 4MXDA 5IDQA 1U7XA 1WS6A 1ZXLA 4B32A 2DM6A 3O7WA 1G64A 2RGEA 4C76A 1JWLA 5KINB 1QH1A 3DOHA 4GR5A 4X66B 2A30A 2B37A 2XNCA 3SSOA 2H3HA 3QKSB 1QRDA 2E89A 5HQJA 5G0WA 1BJRE 5L3QA 1YKFA 1F20A 1FSPA 4FKMA 1GO2A 3OEED 4BKRA 5ADVA 4N5IX 5CDHA 5IXYA 3GDHA 2QM3A 2ZIFA 3NM5A 3FKQA 3SYTA 2DG2A 5IUNC 3W8FA 4AVYA 1JEDA 3OSUA 1UJ4A 4IJWA 3EEIA 2GFHA 3MJFA 3DE5X 1GL9B 3N6XA 4WGGA 1DARA 2B36A 1P80A 5B3JA 4B3XA 3TNLA 1U7HA 3N86A 5JZVA 1S8FA 2ADMA 2VN8A 8GPBA 1JE0A 4E14A 3T5MA 1ILEA 4RGQA 1F6BA 1QGUB 1T1IA 3DFIA 3IVGA 1Z5WA 3WO0A 2UVPB 2Z8YM 4E3ZA 2ZYHA 1CDOA 1FTWA 4QGSA 3BBLA 4M9CA 1KJ9A 1Y34E 1Y5RA 1Q91A 3DEZA 3E53A 2VNJA 2O1XA 1L4EA 3TMYA 3DMNA 2HDNB 3K0CA 3N2ZB 4DWWA 1DCMA 1IY0A 3I12A 4RANA 3ESYA 2B4TO 3I4CA 4PYOA 4TROA 4FHDA 4B33A 1COWD 4Q6WA 4GLBA 1UZMA 3GDOA 4M88A 4MUGA 4OHUA 1Z2PX 3BQMB 3H3XA 4B40A 1YCDA 3IVRA 1N2GA 2JFOA 1AKMA 3E1GA 2PJUA 2XVYA 4ZRNA 3C6QA 2G67A 3JWJA 4ZT2A 4EY4A 4MZDA 5JJ5A 3VVLA 4CLEA 2MINA 2CXNA 1UDXA 5JYBA 3RAFC 2YY5A 3F1KA 4D0SA 1XPRA 1RABA 3CPSA 2Q9BA 1QCDA 2BRUA 3DYVA 2AFHB 1YDFA 4FLMA 5DGDA 3RQIA 3VNBA 3RVDA 1C30B 3MSXA 4XSHA 5JAUA 1OLOA 2EW1A 3EBLA 3B12A 5JQGA 1P2VA 3D31A 1PJ4A 1U8TA 4DXAA 3R6GA 2D59A 4F96A 3IUMA 3CIOA 1FXUA 2PLRA 3WTCA 4EPTA 1PBTA 2YFQA 5I45A 2C84A 3CVXA 3TW8B 2CMHA 3E2PA 2WJIA 4Z1MD 5E9WA 1CF4A 1R16A 4II7A 1LQTA 1JSRA 2G9VA 2WFMA 3TRJA 4FFWA 1GJRA 3WIOA 4CUJA 1B8OA 2OFOA 3DJFA 3QSYA 3M6IA 3W5DA 3I3OA 6PFKA 4X1YA 3UAZA 1MX3A 1WW3A 1MRNA 4WDRA 2GGSA 4IYJA 2WU4A 4WNAB 1PU2A 2NZYA 4QASA 3EWNA 1CVRA 1E79A 2C98A 5EKSA 3TUJC 1LDBA 2GCGA 4TTAA 5EWMA 4JQOA 3DTVA 4QL3A 2R3SA 1L6IA 5CP8A 3ST7A 4GSLA 4R71A 1KWKA 3ID6C 4QUKA 3ZWPA 1GGKA 4RE5A 2P4QA 2Q21A 4OBBA 4Y6SA 5H5JA 1PT6A 3WK4A 1ZK4A 1G5RA 4ID3A 2YY7A 4KYVA 5JH7A 3D3JA 4QT4A 3UATA 5J1SB 5IF9A 3X1XA 1RWMA 2PSEA 3MAGA 2JLBA 1IC6A 4HLUC 1KFKB 3M4JA 3N2GA 1UT5A 3KYBA 4L16A 1ZRHA 3ZYCA 4B0OA 1SVUA 1CR0A 1L7XA 1TM2A 4OP1A 3F97A 1U3TA 1UBNA 1Z8DA 2BI4A 3HNOA 5BRNA 3RVPA 3X43A 4RIEA 5CA0F 1FTSA 5IVDA 1TO6A 2PVSA 4DDMA 1HDOA 2QYSA 3ZGVA 1C8LA 3EQZA 2Q3EA 1UEJA 3FUUA 4L7QA 5AMXA 3KNZA 5F5XA 5IM5A 4LV8B 4CQJA 2I6UA 1B6RA 3OWOA 1DQZA 4EA7A 1P33A 5AM1A 4XPZA 5DZSA 2OOKA 1KSHA 1U9YA 4U7TB 4UW9A 1P7YA 1XZGA 1KIMA 1T5DX 2C03A 2PKCA 2GR9A 2PRJA 1H2AS 3BTUA 4EEKA 3LT1A 3RROA 5CDSA 2CLFB 2QD5A 1S3GA 3HJUA 3NQ41 2NZ8A 2VSYA 3NWBA 4E08A 1XAIA 4A15A 1L4GA 2GB4A 4FMBB 2Q7DA 4YRGA 2OBNA 3PSHA 5GVRA 2XSZA 4KV9A 5FO1A 4U7FA 4Z7OB 4IIHA 2ZE6A 2F4NA 5AVOA 1G20A 1UOQA 3C1TA 1ESDA 1Q2UA 3GFVA 2WIGA 4XGQA 4M1YA 4N4AA 3MTEA 4B76A 2I5PO 2YZ2A 2VP9A 4IUCS 4TTRA 1ODFA 5DM2A 2OAEA 3H87A 1Y8QA 5JAQA 2QY9A 4KGDA 2HIHA 3PXDA 4QLAA 5DMXA 4OKNA 3ZCPA 3O8QA 1CR4A 4B81A 3ZWYA 5EERA 1N5DA 3QEJA 1W52X 3EIHA 5AM2A 3LVQE 4BNUA 1JHQA 2OLEA 3IALA 3DUFB 2I9PA 2R7MA 4OQPA 3RADC 2G17A 2DULA 3UMFA 1X87A 2D7CA 3I5UA 3LGXA 1EB9A 3K1JA 2WTUA 4F93B 3UH0A 4MWZA 4MR9B 1QBKC 4FCWA 1WZUA 2H2AA 4BL5A 1AMUA 3H1AA 3WHPA 2D5IA 3C1OA 3AR2A 4G6ZA 4N7BA 1QG4A 4NCKA 5IJ0B 2GM9A 5C8VA 4B47A 3D9QX 1G4UR 3VOSA 1RKVA 4YEDA 4ZI7F 4JROA 1O6ZA 4Y2RA 3QXJA 1RD4A 2Q6VA 2QUAA 1AN9A 4OQMA 3PX2A 4FTWA 2OXEA 2I67A 4RK6A 4KTVE 3ZNQA 1G7RA 1JPUA 1GR0A 4CGZA 2MSNA 1WZNA 1KYYA 2QN9A 1M2WA 3IE2A 1VA5A 3A2NA 3PC8A 3MVEA 1GV0A 1WSAA 4KSBA 4DR6B 4R0MA 3AF6A 1NVXQ 1RQNA 2QLBA 3NEJA 1Y4SA 3OQPA 3EULA 1HWYA 4OVKA 4HKTA 4Q4HA 1VJDA 2LIVA 5AKKA 3OJOA 2NXEA 4UU0A 3U4CA 3QOYA 4HB4A 3LC0A 1ISIA 1AIPA 1AK9A 1HSZA 1P2SA 1CUSA 3FYTA 3HCOA 4HZUB 4MJLA 4ZVSA 5J4YA 3T41A 1DQNA 1K7XB 2CHQA 2VNKA 2A5YB 2HREA 4IICA 4QT0A 5U4XA 5KKCA 4MEJA 2XMBA 1ADJA 1S89A 1E4YA 2Z58A 1O94D 3M9XA 4RZSA 3GJ7A 4EENA 1ZZEA 2FN8A 1DX4A 3EGDA 3OA2A 5BN5B 1Y98A 2A88A 2HWWA 4O2LA 1HY3A 3K05A 4AECA 4F06A 1P8JA 1CTQA 1M6NA 1RI3A 2I6SA 4QPNA 4CU2A 3KQKA 2PIAA 1QDLB 5GJWC 2YRXA 2B5OA 3MUNA 1XYVA 3K6JA 1QO7A 3PXAA 4N1AA 3ZHTA 2L19A 2EIHA 2HTEA 3EZ2A 2UYYA 3AKCA 1NJ1A 3H13A 4WZAB 4CBVA 5A62A 3LJKA 3FBGA 1Q95A 2NVUB 4LS3A 5JD3A 3S2EA 4GFDA 1G18A 1R1DA 2WTAA 2BFDB 3NEYA 3PNPA 4YRFA 1LQ2A 3NTVA 2PO5A 3AHJA 4MRSA 1DAFA 3E9ZA 3T12A 4QQRA 3VH1A 2LUOA 3QEMB 2FNAA 3UAYA 5G1PA 2LE0A 2PSSA 2PX3A 4OXNA 5GGYA 4HH1A 2H16A 4W5WA 1W1UA 4XAQA 1U2QA 2JFZA 3PC2A 5KJFA 4S0XA 3PTAA 1ID8A 2WM9B 4ZHQB 1O96A 4FEAA 3QTBA 4JC0A 3JPWA 4UEWA 2ZJBA 1YVUA 5A7GA 3THYB 1SZCA 3M6UA 5TIIA 2G3YA 1AZSC 1QTRA 5B3LA 4MI1A 1QH8A 5TQ0A 2HO4A 2B6HA 2YZGA 3QVJA 4BC0A 1G8MA 2CXOA 2NV0A 2JL1A 3EHDA 4L8VA 4AJJA 1I4EB 2X22A 4AJNA 2I33A 1E3SA 2O8DB 3U80A 2ZIXA 3QU9A 1BMFD 3N3AC 3TQRA 2NU8A 3C7AA 4IDAA 4B4DA 5E7IA 4D6XA 2BFAA 5JSKA 1ZUHA 5HZHA 2G77B 2FMKA 3QVVA 2QM0A 3PUIA 1Z4PX 1GYQA 1SIBE 1SUFA 2YS7A 3PQ6A 1BVYF 4N0QA 4UXHA 3R3SA 1Y3AA 2R84A 5AOVA 1C14A 3P2OA 1RRPA 1OYOA 4DCOA 3BRWD 5L4SA 3T5AA 1HT2E 4XWKA 2C9CA 1PJ3A 1N1MA 1U1GA 2ILVA 2P7IA 2VK1A 1ZCAA 1B43A 2JVKA 1FTQA 1ZIOA 2ZRAA 4IHJA 4TKMA 3L4KA 5DHPA 3AR8A 2YYAA 2GEUA 2SKDA 3C43A 2FY8A 2X6RA 2CF6A 4WZAA 4BFYA 2Y93A 5EMLA 3N2EA 3OZEA 3ZD7A 1ZEMA 4GMKA 4IPTA 2W4MA 3UJ3X 1GCIA 4ZOLB 3TR6A 4DUPA 1KC1A 1EGHA 2RBEA 3BT7A 4F9FA 4I50A 4ZI7B 3OZDA 1M6VB 1XWFA 3WK7A 1YE8A 4BCCA 4BEWA 1IL0A 1CNFA 1L9KA 2OKCA 3FPEA 3OFSA 5BV1A 2J45A 2OB1A 5LYJB 4JYMA 4OQLA 3WIDA 4ZDJA 1XZ8A 1PGNA 5IWAB 1FFBA 1U3CA 5CIQA 3QI7A 1KJ8A 4R54A 1HZZC 5SYNA 1NC3A 4IINA 1DOHA 2BMVA 1KYVA 1D6NA 2VCEA 1C9KA 3DF9A 2YIDA 1HQYE 4B6OA 3HNRA 3N0RA 4HDSA 1V25A 4L27A 4PX3A 1E7YA 5AI9A 2A58A 4DLXA 3EXEA 4E12A 1NR5A 2QBYA 1VKRA 5K20A 1P5RA 2VT3A 2XB6A 3C41J 4QGHA 1E1LA 3GP3A 3SOPA 5J4KA 5IU6A 5KOYA 1C50A 2N9UA 2P11A 3MAAC 3W7AA 2FDCA 3QUQA 2J3EA 3IILA 1GD1O 1JU3A 3AR4A 3BWVA 3OZ7A 4KZKA 4ZGGA 3RG2A 3SQDA 4EDFA 2XCOA 1IHUA 1GKIA 4UHFA 2VF4X 3URKA 1EZZA 2JBAB 3H8JA 3QLJA 2QE7A 4EHFA 1TD1A 4LZPA 5CB8A 5FV7A 1XPOA 3GJSA 1PR6A 5GGXA 1JYEA 2H11A 4D5GA 4FFSA 1NXVA 3T4XA 4G1BA 3GRFA 4HLUA 2WJHA 3A70A 1QK5A 4KQIA 5I9TA 2JARA 4ZODA 4NF2A 4AP6A 3VR5A 2FWRA 1M73E 2CHEA 3V7NA 4YECA 1AZTA 3MWKA 4OO3A 4F9GA 4EI9A 5J4VA 1LW6E 1U3VA 2P6NA 1M8GA 3F9RA 1K2VN 2YHIA 2F9MA 3IPCA 3OIFA 4X0EA 4HQ6A 5ALNA 2PX4A 4E32A 1BX3A 3PXUA 5HGXA 1VYTA 1CPYA 3RE1A 2ZS9A 3PGA1 5ICGA 1KEUA 3AGQA 2GTIA 2W9XA 1XNHA 5HFJA 2KSQA 4B3RB 3CHYA 2A59A 4OHFA 2Z30A 3EOAI 1HZJA 2PD6A 3ENVA 2RHOA 3JAWA 4G9BA 2JKVA 4PZUA 5D3MA 4D3XA 1E0AA 1QNLA 3BJIC 4NPHA 4R01A 4FWTA 2W90A 5H70A 2WVGA 2X4IA 4D98A 2NO5A 2ZVQX 3A9SA 3MOGA 1S3FA 1GNTA 3PK0A 3TM4A 1LVHA 2IZ1A 4W5NA 3GNSA 1BWQA 1CJSA 2H2HA 2HRZA 2O1SA 1V43A 2Y1CA 1ZX1A 4JD5A 3NRCA 2HA7A 4A23A 3ADOA 3ER9A 2HUPA 2XXBA 5A4MS 4V3BA 3IRUA 1AF4A 1G5QA 3DL7A 4PLYA 2Y0BA 3EPHA 2BRUC 4NULA 4DDHA 4RE6A 1RIFA 4ZU3A 2CD7A 3DMFA 2RHDA 5FBHA 4QNNA 1VJRA 3PEFA 4HWSA 3WB1A 3QH4A 5K01A 2I2DA 4WOBA 3IEUA 3VFDA 4LCJA 1DUVG 1N0IA 1J2EA 3ELBA 5L3QB 5F3WB 4RSMA 2XGSA 1J8DA 3BYZA 4DXDA 1W5TA 3EY9A 3GT3A 3K2BA 4P81A 5LDHA 5MN5A 4U9IS 2Y1WA 4GRIA 2NSLA 2KE5A 1ZK2A 4DVJA 4F85A 3QQ5A 4W7SA 1I4WA 4CCYB 2BFEB 2R6CA 4MVJH 3WFIA 4HSEA 3JATA 3VTAA 2MJLA 3M1LA 2C2BA 3D2CA 3JYHA 3V5NA 4K6KA 1XZJA 4II3A 1VGVA 1ATZA 3AKZA 2ZSBA 3GFQA 1IZZA 1GPJA 2D6FA 1V16B 3M81A 1LC3A 3DBRB 5C8ZA 1RLIA 1JU9A 1WM1A 3VH2A 5CFZA 2BTEA 3OZWA 1GZSA 4TXLA 1NPYA 1WZ2A 4OHKA 2PT6A 3PUHA 1DTWA 1X1EA 1FRNA 4HGZA 4BNGA 4BVBA 1KAGA 3SDZA 2Q41A 3DXZA 1AH2A 3HPRA 1LS6A 2O2CA 3KU4A 3P5SA 3CE6A 4TKVA 3NC4A 3B6KA 4GQBA 4RESA 2FETA 4UTXA 1IOWA 4FQ7A 5IK2A 3AG5A 2VPYA 3INNA 2ZI7A 2BR5A 1CJTC 4P83A 4DJDC 2ECKA 3C74A 4IQFA 2RBKA 1V5IA 1Y7IA 3K31A 5HS4A 2IP2A 4LWOA 4IS3A 3L06A 3GMIA 3G7SA 3SBXA 3WGJA 3ZUPA 4BKPA 1UJ2A 4E1VA 5K03A 1SA0A 1XJ0A 2XNSA 2I4NA 221PA 3GLUA 1PWZA 4J2TA 4PQFA 2JI4A 3SVLA 3U5ZB 4WY2A 4NZ9A 3ZV5A 3DKKA 3D2LA 3BWYA 2FZWA 3QWBA 4LXQA 3H4TA 3WI7A 3HDVA 5ED4A 4JNCA 1DWPA 2V4MA 3V33A 2O0MA 1J9ZA 3V3TA 1XMIA 5H81A 5T4BA 4XWOA 2AZ4A 1KE1A 4QTUB 3KEQA 3R3YA 2OPHA 2UAGA 3HN6A 2PV0A 4CF5A 3EARA 1WCYA 1PSWA 3IR7A 5BMOA 3JWIA 4AP9A 5AD1A 1TLFA 1BHSA 4EKNB 4CTJA 5ALGA 3LPDA 3RS4A 1DIRA 1RC1A 2BISA 3G2MA 2IE8A 3CZ9A 4HAXA 3GRVA 2FPPB 1PZEA 4CKBB 1ZNWA 3F7MA 3KSBC 1P0FA 1RAEA 2GZ2A 3LUFA 3KQMA 5DYWA 4GPD1 3STYA 1B1CA 3AM4A 5DM70 1I3MA 4MCAA 4HX5A 4ARSA 1MIHA 3E3MA 3U3DA 1PJ2A 1WMFA 3QJGA 3QXGA 4RZUA 4IDGA 3E61A 4Y6QA 2FN3A 5LLTA 1H6DA 3LWZA 1AC5A 3KFLA 4B3DA 3TZEA 3CWZA 2X0DA 3KC2A 5AP9A 3K2IA 1H0HA 4JLDA 2LDBA 4GLJA 4KBFA 4BO7A 1FMCA 5CW2A 4YJ3A 2GAFA 1RQGA 1ENOA 1RRVA 1QDUA 2BVNA 3N2GB 5EE1A 2RGDA 1K5DA 4Q12A 5EZSA 1TTHA 3EF1A 3IQHX 4KPGA 1MO5A 5JVDF 3NH9A 4HH3C 2PUDA 4OQNA 1DLJA 3RK4A 4ZALA 1VJ1A 2AEFA 4NY1A 3RBAA 3GLSA 1OTXA 5KSZA 4W5TA 1DAMA 3WY9A 2E18A 1XEWY 4FGKA 4ML3A 4C05A 2UUBB 3RARA 2WJGA 4Y7CA 3KJXA 3UWOA 1YH3A 2C5HA 5L7YA 2YRFA 4W1RA 3NEAA 3FMGA 4DC0A 4IHJF 3UA3A 2VF8A 3I9MA 3IV7A 4GZ5A 1E7SA 1WSDA 4C4AA 3HB4X 3ZHBA 1EK2A 1BHJA 1GN9A 4BS9A 1AGPA 3BS4A 4EAQA 3TX2A 4EELA 3DE1X 4X20A 1S96A 1B23P 3EK2A 4PANA 4XSVA 3JQ7B 5C7OO 2C5AA 1SHLA 1W87A 5KAPA 4S1VA 3BK1A 1IMJA 1KI6A 3KJZA 5AI4A 2QTRA 1PK8A 4ZO6A 3U31A 1X7XB 1MW8X 4YBZA 2QVGA 1IEQA 1JG7A 3IKJA 1P1HA 3R7LA 1L4YA 3NHZA 3ZVRA 1FY2A 1MMFB 2ZKLA 4B3CA 1QCZA 2ZU6A 1GQRA 1STOA 2W8BA 4GEGA 4RK0A 2O2GA 2YJ6A 3GVHA 3I4FA 3AETB 2NUAA 3NKFA 1TPYA 2IUFA 3NIWA 4J0CA 3TL6A 3ZDEA 4AY2A 4LXXA 2QP9X 1ZC4A 2A5FA 1DWOA 1ZNXA 4YRJA 4CM8B 2XD4A 1HKHA 4QAJA 1G21B 2ST1A 1ZOSA 3C6ZA 4QVGA 4XLTA 4DC1A 2VDMB 5KQLA 2B6NA 4HDKB 4N5MA 3H75A 3JALA 2BFNA 4RVNA 3KQVA 5FEUA 1MFPA 4WACA 2IXDA 2BM0A 3BBPA 5IHPA 1A9XB 2FE4A 1PZXA 3F8SA 4QUJA 5JG7A 2FWNA 5IMSA 3LWNA 2XNHA 3DE0X 2C2MA 3EEOA 1DJMA 2POQX 1XRJA 1WXEA 1DRWA 1SULA 1SOUA 3E8MA 3QA3E 4W63A 4F97A 3B6EA 2H9YA 1DHTA 1YS2X 4I50F 5EWJA 4JB3A 3OHPA 4DCVA 2WHXA 4Q66C 2OESA 4MIOA 3K0KA 2Z9DA 4X44A 4A5OA 2Q27A 4KO3S 1KKMA 2WU0A 4DPKA 4IIJF 1FUEA 3RD5A 3CINA 2XNDD 3UOAB 2BZ0A 4KBGA 5FRDA 1NA5A 4UNQA 1JPNA 3BDIA 4X90A 3QOFA 5JQGF 1T9KA 2XZOA 2Y1DA 3DDSA 3CCBA 1T36B 4K81B 4M86A 3W8NA 3WNQA 3ZD9A 2QJRA 5HNKA 3AT1A 4GR9A 2H18A 3W3AA 4PS0A 3UUFA 4D56A 5A5FA 3GL9A 2VPTA 3S5UA 3DKRA 1W59A 5LN1A 3TCNA 5KQGA 1X3SA 1YNOA 1NRWA 4DC9A 2ENUA 3QUTA 4PC3A 4DMRA 1VI6A 2ZIUB 1XQWA 1MXHA 5I48A 4EI7A 2HA5A 2F3PA 1FNMA 1B00A 2PQMA 3M5WA 1UJ5A 1T9BA 4UEOA 3GZJA 2PZMA 3GCWA 1V95A 2QYTA 3U4HA 1JBKA 3KT3A 4P5PA 2OWDA 4DJAA 3K15A 4C0LA 2AHOA 4TV9F 3TVDA 3WL8A 1M2EA 4E5SA 5KS2A 3IC5A 4ZVMA 5L7WA 3DTVD 3FTNA 4G86A 4NU5A 4RJ2A 1E5LA 4QJIA 3KQWA 2D1YA 1UDCA 3GG9A 4UTPA 4NARA 4FT4A 3GLFE 3VNQA 3GPLA 1OT3A 4O63O 3BZWA 4NYJR 3C4QA 3QNWA 3UN1A 3AO0B 1OXBB 4DNFA 5F7OA 4QTTB 1YOVB 3SG0A 4EWLA 1FPMA 5EXEA 4QXOA 4UULA 3CSUA 1XALA 1GDTA 2QJOA 1SBNE 3RU3A 1JHXA 2R9VA 5D3ZA 4WIAA 3K9NA 5H0IA 1G66A 1QCYA 2VA9A 2GN1A 4QHTA 3Q7TA 1LD3A 3BFPA 2UVDA 4YUWA 1B42A 1Q15A 2VSNA 3M8KA 1EUDB 5GP1A 3V8QA 2O7NA 2QS9A 3V1KA 1UL1X 1UBMS 1TM4E 4GAEA 1G5PA 1ZGGA 2A6PA 3LBYA 3G1UA 4PBTA 2BHSA 5BQXA 4OK3A 2ZJ4A 1LUAA 2BMAA 3O8BA 3QLVA 1Y8ZA 3QU7A 4DADA 2VSFA 3UC5A 5KVAA 3IULA 4CMEC 4MUXA 1C2YA 2POCA 4ZVVA 2X23A 4QPZA 2P4EA 3N39C 5EYPB 2JEZA 4GKVA 2VDQB 4G8DA 1DTSA 1FNDA 4L15A 4QEKA 5FCDA 3DT8A 1ZN9A 4YP9A 3EVGA 3H5WA 1MH9A 3EMKA 1WY5A 4EEZA 4KWTA 3GU3A 3V8NA 5DN6D 5EIEA 5IBCA 2G08A 3I9FA 5ITZA 2UYGA 3B7GA 4G9EA 3OECA 2GCNA 3PB3A 3VX3A 4ETMA 2F55A 5DYGA 5JCZA 1CWUA 1E1RD 2AE2A 1S4MA 5C7YA 1GA4A 3TTTA 1D4AA 4QPPA 3WQRA 3DZCA 1Z6QA 3KTOA 3OPYB 3V00A 4YCAA 2BC9A 2WHQA 4DRXB 4GYYA 1NFFA 2NU9B 1ENZA 2H29A 1H5NA 4FLEA 4JAVC 5BRAA 1F0NA 1HM5A 1BZYA 1Q3HA 2IU4A 4YQEA 3IBYA 1POWA 1NI3A 1EXWA 2B9EA 1C7EA 2V7VA 1KI7A 3BL8A 4RLSA 1VKJA 4PIMA 4ETIA 2RB4A 5THKA 2FVYA 3HGTA 5BURA 2ZBUA 3CNQS 2WB2A 1UOOA 1BWSA 2NV2B 3C6MA 4K6HA 3NBZC 3IO5A 2P9HA 1UDBA 4DJEC 3IMKA 1EMDA 4HUQB 1N5RA 3QIVA 4I46A 4OFZA 4JUBA 2QZJA 4U7DA 1ZJ5A 1CB0A 3Q7EA 4NZYA 4CHGA 3BWXA 1CHNA 1MUUA 1X1CA 5DBFA 1EFVA 2JGMA 5KZMB 4OUKX 1M1NB 4QFCA 1SIUA 3Q4GA 4C7JA 2RD2A 2O0LA 5LBIA 1JEQA 1L1EA 1L2TA 5IKOA 5B4UA 1UC9A 3PI6A 2BIFA 1YRQA 5E38A 1UDRA 5TJ9A 4MGEA 5E0OA 5ADHA 4RVUA 1KJWA 3EY4A 4W1PA 4BCDA 3TEFA 4F0JA 1JN0A 1WG8A 3VOTA 3R41A 5H9WA 2AEJA 2OORC 4MVJE 4BP8A 5BR8B 3R6LA 3B1KA 4IOMA 1Q50A 3CONA 2VAVA 1JX6A 4LJ8A 1ZGJA 3H9QA 4K5QA 5FDFA 5K4HA 3F5DA 2GARA 4YT5A 2IH5A 2J7PD 3OZIA 5D51S 1JJAA 2AFIB 3ANNA 2AR9A 1ZHHA 2QR3A 3HJGA 4ER0A 1D2MA 4ZEVA 1QFJA 1WVIA 3GROA 3SK0A 2J41A 4HFRA 4TTVA 1RI5A 3K0BA 5F9MA 1MCZA 2YFYA 4HH0A 3VPCA 1OA0A 1QZZA 1M6VA 1ECGA 3IBGA 5JS1A 3WKAA 4WLEA 2C07A 2BFCA 4GXQA 3I4LA 5AESA 1VBFA 2IOFA 4AO7A 3NTLA 4B6RA 1JSXA 4L73A 4UCFA 3I1JA 3OT1B 2QKYA 3TTWA 4ND8A 1OJLA 2DCMA 1EUZA 4Q05A 3MLEA 4EFMA 4IGAA 3I2IA 1Y6RA 2I4IA 3Q1KA 4H9GA 5HIMA 5LXTF 4Q4AB 5KJ1A 4DYDA 3OZVA 1AQNA 3U3RA 4P9NA 4G65A 2VDVE 4RSGA 5AOAA 2R4TA 3H1EA 2IU3A 3HBMA 2YX1A 4NEHB 3TXXA 4CIBA 1VE7A 1SCQA 1GTRA 1X14A 3CN9A 1P7WA 1XDWA 2DYKA 4EPRA 4UMDA 2EW8A 3T7DA 3JQGA 3GPCA 2BUBA 3L7DA 4MS4A 5TARA 5D01A 3EUAA 4HQRA 4J4TA 4S12A 1YB2A 3K72B 3L4BC 5EMJA 4JOSA 3VJRA 1GEEA 2AJLI 2PX6A 2IQ5A 3IUQA 1BRTA 1XDDA 2DETA 1P0QA 2ZIAA 4GG1A 4XGKA 3V8BA 4BQOA 3IEVA 3L8HA 1TK2A 1T3GA 2JLSA 3QK7A 1KRXA 4DV3B 1XKXA 4ROSA 4HATA 5A3RA 5LZ5A 1FDWA 4FVTA 2Y8EA 3VOAA 4ALLA 3IBCA 1QUFA 4YMUA 1TMKA 1TECE 5DBOA 2CJWB 2HRDA 5A06A 3D3WB 2J7KA 2E87A 4EJ6A 1GAXA 1J0EA 1OAOA 1JILA 1S4QA 4JBNA 4A27A 2J0UB 3PRJA 1WPGA 2HXYA 1CRWG 2EL9A 2BCJQ 1O94A 4ZDIA 5E9JA 3E27A 2B4QA 4NE7A 1O95A 1BHO1 1S2DA 2H0QA 4MGKR 4XEHA 4Y2YA 5M2QA 1QPZA 4PRKA 3K70C 4IXWA 1CVIA 2YW2A 5CLHA 1KZ6A 2AGVA 1SQFA 4XLLA 4BMDA 3TDNA 2D7JA 2H2FA 4NH0A 1C3VA 1F8UA 3T5TA 3VI3B 1VIMA 2VOJA 4H7FA 4ZIRB 1WKVA 2GPSA 1XNQB 1ZMRA 4DARA 1R3DA 2ZBRA 1EHIA 3ECAA 4D3YA 1RWPA 1J33A 1Z4KA 3ESXA 3V8EA 2Q29A 3T1OA 2ZYVX 4I2NA 1WVGA 2PVPA 3AGPA 3Q11A 2N3ZA 1Z83A 3Q9SA 4ZO8A 2EJWA 2PZJA 4UFPA 2ZZMA 4OHXA 4AQYB 2RH5A 1O0BA 1SXIA 3VRHA 4XIGS 1CY4A 4EI2A 3K4PA 4KQKA 1D1QA 2UKDA 1UMDA 3T7AA 3OTOB 2GETA 2PKXA 5EEHA 1JT9A 2W8ZA 2Z2ZA 5TMEA 4NCIA 5GM2A 2Y66A 3II6X 1BCSB 3BJMA 1V11A 3C3BA 3OPYA 1LPMA 4FJ2A 5DYNA 5LBTA 3B1VA 3BXHA 5AW0A 5HQTA 4G1CA 4OREX 5KIAA 3OUZA 5B1DA 4BE4A 3F0TA 4UXIA 5BUSA 2HMWA 3BWMA 3GLHE 4PNZA 3DE7X 3KKLA 2PZGA 4ZQGA 2HT1A 1I13A 4MPPA 4FT2A 3OC6A 1V9LA 2PS9A 1TYZA 2QVLA 5HF8A 1P2UA 3NYIA 3IV6A 3HKBA 5LWHA 1R3UA 2OB2A 4RPHA 2QXYA 1JE1A 2W6ID 2CUTA 3IBTA 3K8YA 3TIFA 4EBBA 4PSVA 1KOGA 2G0AA 4EG0A 2BYTA 3E1KA 1C0PA 4F8YA 1WUKS 3IOYA 4PQRA 3E0QA 2PGNA 3CUYA 7ABPA 4P3XA 3VKFA 5EJEA 3Q3VA 2OV8A 2Y0EA 1OZFA 1NQ5A 1Y3DE 3G0OA 4R8VA 3TZKA 4BZWA 1GG8A 1ZUWA 4DN6A 3T1NA 4P0QB 1P29A 1R6VA 2I54A 3MTBA 3STHA 3C3MA 3LE8A 3LMKA 4GMFA 4B73A 5KSOA 1JGTA 1IUPA 2Y1KA 4V0RA 3H65A 2B3TA 3WLSA 4EB0A 1UFOA 2IZ6A 4HRYA 2MIIA 2J5XA 3L5KA 4K03A 5KX5F 2CKDA 2QT0A 2XDWA 3I1IA 5DTQA 4NL4H 2V0GA 4Y2QA 2NO0A 3FB4A 5CAEA 4ACBA 1RCTE 5HBRA 3VKWA 1UKZA 2PYDA 4HRXA 4M49A 4H7DA 5FBQB 3B7PA 2JGNA 4GQAA 4LOIA 5EXPA 1DFHA 4R1TA 4Z9AA 1ZMBA 4DV0B 3OX4A 2FOIA 3KV3O 4FX2A 1EVZA 5PNTA 4AMBA 3U44B 2EQ5A 2W58A 3IH5A 4V2UA 3AHCA 1TVCA 4KX3A 4QELA 4RV5A 1BXGA 4KE7A 1PFYA 4N3NA 4Q3LA 1DI0A 2OZLA 4JP3A 4OPMA 1SVOA 4CDGA 1XZHA 5G0SA 2IYOA 1FXWF 5H4GA 3GFTA 2O0KA 3O95A 5E1DA 4WW0A 4Q39A 2FEWB 3VNVA 4KACA 5ERGB 1SK8A 4BO3A 1A5SB 2EARA 1XMOB 3VKGA 2X7HA 2YIJA 3CISA 5KVVA 2I4LA 2ATXA 3CEHA 2JC3A 1Q17A 1SVIA 1UMCA 1ZM7A 2BR4A 3ES9A 4NKRA 3SSAA 2BMFA 2VAWA 1T15A 4U7PB 4CIDA 1ZJ4A 2JFWA 3HRIA 1N2SA 2HADA 3ZHUA 3QKSA 4QECA 5K3CA 2F2TA 5FUXA 4CN9A 5BQ3A 1BD3A 1OPXA 2JIZD 3N2KB 1ZG3A 3GMDA 3ICPA 3D6FA 4XIFA 2DBRA 3WK8A 1IBCA 1REQA 4JMPA 2BJVA 5IT5A 2O8BB 2EP5A 5HF6A 4KN9S 3U60B 2IZOA 4ALNA 2ZM6B 3F74A 3KQNA 3LP6A 2BUCA 3F8WA 4ETWA 2GI4A 1JG1A 3I72A 4BB6A 4TXHA 5D6NA 4XYBA 1F7UA 2QG9A 1XCJA 4TV9A 1EEXB 1GRQA 1RBQA 4UDXX 4M89A 5AXBA 1PJZA 3WGYA 3GQVA 1R4NB 2IA5A 3AKYA 4RDHA 4RD6A 4YJHB 4DLVA 2VCHA 5CFOA 4NCBA 1QBGA 3WGVA 2Q2QA 4Y9UA 1I9GA 1Z5UA 2C9BA 3NVKI 3KKKA 2H2IA 3S2ZA 1YASA 3HUDA 3T3DA 3B3JA 3AU9A 1ZI6A 3LX8A 5JXIA 3I0ZA 4OB7A 2CLSA 2O3QA 1HI9A 1X74A 1C81A 3ROTA 1KQNA 3F9CA 3RWOA 2Z4TA 3ZHXA 4CW7A 1B6SA 1BCRB 3RFXA 1AHIA 4YQFA 1Z62A 3AUFA 1RI2A 3TSWA 4Q03A 1R9GA 3FYHA 2MOKA 2HJVA 3G2QA 4MVJM 5DE3A 1O87A 2M9MA 2VTBB 1SXHA 1X7HA 3KJQA 5ER9A 3LDUA 5IMBA 1U1DA 2GRAA 3OCJA 1QOQB 3AK4A 3RJ5A 3P1JA 1E2MA 1CQZA 1RC8A 3CNOA 1O0CA 1E8NA 2QPLA 5COQA 5LB4A 4CVNA 1EDBA 4OMCA 5AW4A 1JHAA 2EJVA 1UKYA 2AD5A 3Q3EA 1FU8A 3N8DA 1VOTA 4R7GA 1CIPA 3W9YA 4TKUB 3OFNA 2A9PA 4C3VA 3EC1A 3EVTA 3WBFA 1H8EA 4BUJA 4NEGA 5IRCD 3K8OE 1LLFA 5EJ4A 1X1QA 2QLTA 1OZAA 4EABA 1ZMOA 3RUCA 2BMEA 3ORHA 2PKQP 3TKLA 2D8AA 1IBRA 2J3DA 3EE6A 3OFVA 5FWNA 4YP5A 5LA6B 3AM3A 1DRUA 3VPAA 5SYMA 4EMBA 5AUNB 4A92A 2C57A 4MK4A 5BN3B 4ENTA 4FZVA 3G85A 3MUOA 4MYTA 1P4GA 2DJ5A 3DLBA 4MKGA 3SM9A 2UUCB 2QTFA 5EUBA 2PGOA 3R4CA 5GONA 4QG7A 4RULA 4B6PA 1WUTA 1B8VA 1GPAA 4C0BA 1DEXA 3O8DA 3RSOA 5SY4A 1KRWA 4LF9B 3OCYA 2GHTA 4MPJA 2HEIA 1RWKA 1T36A 3FD8A 2X42A 5IJ0A 4HAIA 2RGCA 3BK2A 1PR5A 4YCDA 3SX0A 1ZICA 1IJKA 4BZPA 1OLXA 3IP7A 2BGGA 1P7CA 3BB4A 4L9SA 3RTDA 3UJHA 2R6DA 2BI7A 5FTNA 3FMFA 2VATA 3JQ9C 4Q37A 1EE1A 5KVQA 2GF9A 2CL0X 3EZXA 2EU8A 2EKZA 4LQDA 3GRYA 2Z3ZA 4TMKA 3WLIA 3CVWA 1DKLA 1S8AA 2IW3A 2YFHA 3WR5A 4C29A 2P9FA 3FTEA 1IPHA 1NOJA 1OZ0A 3A3YA 3WMXA 3ASYA 2W4IA 3CBGA 4J7CA 5KTTA 3A9UA 4DBVO 1X42A 2R7KA 4E5YA 1J00A 1NVDA 16PKA 5P21A 4KQWA 4TUYF 4YB8A 4HX2A 1FVXA 3TD9A 3BKXA 2SBTA 1X9IA 1Z6PA 3CUKA 3U1BA 2ZI5A 3RAPR 2P0EA 5ECDA 3UMYA 1DOZA 3ANYB 1KO1A 1PL8A 2XCUA 2QZSA 2AUTA 3L43A 1CK4A 4OIFA 4G0WA 1RPNA 1K8ZB 4NBSA 3ICOA 2EVWX 5KOIA 4XFDA 4LTDA 1UBHS 5DT2A 4CFSA 3HFGA 2QMEA 1US8B 5IVPA 1CEQA 4D5EA 5E4YA 3HXMA 5TMDA 2P9QA 2NO6A 4X8HA 1E9VA 2FDRA 3ZCSA 4BJ5A 1X7ZA 4ALMA 2OG2A 2ZIVB 1NOIA 1IQUA 1NBWB 4GVPA 4AUEA 1KIAA 5A5VA 1I3CA 3ZWDA 4Y1GA 3NHYA 1YU6A 1KGDA 2FRXA 2XAUA 5HMLA 3TSAA 3UKOA 4BBZA 2VP5A 821PA 2DH5A 1Q3TA 2OLKA 1FDIA 3QOXA 5A0FA 1XVAA 1SHJA 2C59A 1Z2CA 2GF0A 3HKCB 2RKBA 4DSZA 4UMFA 1GUFA 3VISA 5EMHA 3PDIA 2ONKA 2BUAA 4J3NA 1R0LA 5GQSA 1DELA 2ZRQA 3STVA 4BEVA 2YOGA 1VC2A 4J16C 1PUXA 2R7LA 4AZWA 4C7XA 5CDFA 4B79A 1PEAA 5CB4A 4ZTZB 1QHGA 1NN1A 3DV0A 4RMIA 3IDOA 4WKGA 4G1VA 3I9NA 1NMZA 4K1LA 5T6BA 3TI9A 1QRUA 2OZVA 4DNXA 5IKPA 3D7MA 3RC9A 4BYGA 5EXDA 5HPYB 3DOEA 1PS0A 2QZ9A 4QPJC 1NUQA 4NZOA 4RTQA 1RI4A 5FBWB 4H60A 2V3CC 1UOEA 4GMDA 3S0JA 3ME5A 4YFYA 4YJDA 2C2XA 1D2GA 3SR4A 4DDWA 4C6RA 3GYBA 2A9QA 1IVNA 1ZI8A 2KJQA 4YS6A 1XEAA 1BH2A 3V7WA 4OXYA 2XVMA 5BQOA 1JA0A 2C8JA 2YV1A 4PCAA 2DFVA 5EQDA 1IHPA 2G82A 2XMSA 4NDAA 4D8VA 2QU8A 1MB4A 3I04M 4JV5B 1TLTA 3HSKA 3CNHA 1A69A 3KE9A 1BXRB 5C5IA 4DBLE 5KWJA 3HLTA 3O47A 4F3CA 5LQJA 4I4TB 4LAFA 3PLRA 4BFWA 2IYFA 1PT5A 2ZRDA 4PYRA 2OBMA 4MJXA 4Q7MB 1JFLA 4IDNA 4GQIA 4ZVLA 4Q7QA 4ZKDA 5C32A 5HUQA 3R9WA 2GBGA 4B4UA 3WGGA 3MSCA 3RLIA 3RBVA 4AO6A 4R81A 3OSZA 2PHZA 5FA6A 3UPTA 4CEIA 1P91A 4M4SA 2GN4A 2FG5A 2VWQA 3N74A 2JIBA 4OX9Y 3SVZA 3U5TA 4YXWA 3LHDA 1PZHA 2RK4A 4JQZA 3WLOA 1JQKA 1J56A 1E3JA 4KVGA 2G9QA 3NP9A 4YRCA 2JLXA 4Y2XA 4X24A 1GNRA 2Z08A 5LCXA 3ONFA 4YJ2A 2YIVX 4N5LA 1YJ8A 2OY0A 2WY2D 3OZSA 3VKUA 4AZ3A 4Q1CA 4F2HA 3UJPA 3OOWA 3WLRA 4DLNA 3H2BA 4QBTA 3L3BA 4AJ4A 4Y2GA 2XV1A 2HJWA 3AZPA 1B0UA 2XUKA 3KBOA 1V45E 1Y1KE 1E0DA 4JI1B 3R7FA 1DJLA 2WIDA 3M4ZA 4HFNA 2GBCA 3S4YA 3V46A 1BKYA 2ZJ3A 1FPQA 1R12A 3KEMA 3FFTA 3OM0A 5CW1A 5F73A 5IN4A 2V6BA 2B61A 4NSNA 4US2R 4W7IA 3ABZA 2PUTA 2OUKA 4BGDA 1T8YA 1G55A 1OV6A 1YVRA 2ZYIA 4UARA 2HSDA 3QIAA 5TQVA 5HOQA 1XTQA 4N03A 3ZNNA 3UGJA 5CXUA 5JEDA 5IDVA 1ZN7A 5DI3A 1NKVA 1JA1A 1CV2A 4KQJA 3SD7A 1AB5A 1X9GA 3OWXA 3ZPXA 2A14A 3NBKA 2ZE7A 1NW4A 2WP8J 2FWPA 3BHMA 1R8YA 3L8EA 4K6GA 4LNUB 1EVKA 1QYDA 1ZOIA 2IUUA 2O8EA 5GONB 3MCWA 2WSIA 3NJ8A 1AKUA 1EA7A 1U5CA 1NLMA 3PFCA 4KRXA 1DC8A 5C7IO 3A9RA 3SLRA 4L3WA 4BMVA 1UDWA 4FKBA 4MR7A 4HDRB 3T7CA 1YAJA 4XR9A 2HZ7A 3DWFA 3FPFA 4R1PA 4IIFA 1ACLA 1YQDA 2GZAA 2P6MA 3PGKA 4AXBA 3ASZA 3NT4A 4Y67A 1LRKA 3PXBA 1NLUA 2XZDA 3R9XA 3RS9A 4D0LB 1ZSVA 1PGQA 2P1RA 1GRCA 3DD5A 4AMVA 4IIJB 5FBVB 2QAJA 3ZE8A 2GZDA 1Y8RB 4CI0B 4X8MA 2WTXA 2PPLA 4MWDA 2XWQA 3GNLA 4OM7A 5K4AA 1PZNA 4NK5A 2V0CA 1J1ZA 2HNAA 5D8DA 2Y4OA 1SXJE 2BD0A 1CQPA 4C0QC 5CDYA 3C5WP 3UOWA 4BLPA 3ILYA 3SZLA 4G07A 4BDSA 4C89A 2TYSB 2QMQA 3WS7A 1IYZA 1NMXA 1WXWA 1PP4A 2XMGA 1IXSB 2A9JA 1EFPA 4BRSA 1WU8A 3C16C 3NHMA 4U9HS 4X3OA 4XQEA 5JYEA 1DZ3A 2Q5IA 3GV0A 4PLFA 5CA1F 4YDQA 1YBMA 4UTZA 1EJ6A 1GFIA 3O8NA 3H6HA 2O3RA 3ZD8A 3A0UA 3HA3A 3TVYA 1K5GA 2V7BA 3EMDA 4JOCA 2DBQA 3GRKA 4HDAA 3RC1A 1OREA 1DXHA 2CNBA 1QP8A 1DG3A 2ZWIA 4EVSA 2JAHA 4Q18A 2W6MA 1DO2A 2WU1A 1N5KA 3MCTA 2Z4SA 5CDGA 5K0FA 2X4DA 1KVRA 5F21A 1K6MA 2ZWPA 5C53B 3K53A 1EA5A 4XTRA 2QM8A 5HQ3A 5EE0A 3UT6A 2IT1A 5FL7D 4DQVA 2HA6A 2V7QD 2VKQA 3RUEA 1QU3A 2OCKA 1D6MA 2NN3C 3CEAA 1FU7A 5BSTA 1NXOA 4LISA 1SUEA 2F1RA 3EDOA 2OD2A 3EIOA 4K3UA 4L5YA 4M46A 3UAWA 3VZBA 4KG7A 4BGIA 1I94B 1J7KA 2HIGA 4MJ7A 1R8XA 1TK9A 4JP2A 4EG4A 1G8PA 4G5FA 1TA9A 5FXMA 2YMQA 1A4RA 4MAMA 4U2EA 1U3GA 1O58A 2PUEA 4AAYA 2FN4A 1AKQA 3WNBA 4GI1A 5FYDA 3VHQA 3V42A 5IYZB 4UASA 2P2ZA 3MYRA 1DAEA 3DM9B 1GQYA 2WD7A 3RYCA 1A50B 3EIQA 1BVRA 3ZCXA 2VP4A 4WY8A 1Z82A 2Q0HA 4MQFA 1Y7LA 2YXPX 4WT7A 5I7AA 3L7AA 3DVQX 1JV2B 3NHAA 4TT3A 3LBNA 1K66A 1UMDB 2UZ0A 3P0FA 4MSUA 2VTKA 5KJCA 1ATIA 1JKIA 3P9QA 1UXJA 1CLUA 2V6IA 4JLSA 1M2KA 3FZQA 4OI2A 3EEQA 1BWPA 4GGPA 4YC7A 5BT9A 3OF2A 4IBOA 4BKUA 2RI6A 3I62A 1K75A 1RYNA 1T2AA 2P2YA 4PONA 3UHJA 1ABEA 1E2QA 3B82A 4QZVA 4D9FA 3S8EA 2FR0A 2FSGA 4L02A 3CX6A 3PIIA 1OMOA 3G2KA 2C1EA 4D0NA 2O5CA 2V54A 2RI1A 3VV3A 2C7BA 1Q21A 1MU0A 3TQQA 4P22A 3X1YA 3T4PA 5AKIA 1B6TA 1P44A 2W93A 3R6WA 4CHTA 5JAOA 4B7CA 2VUUA 4UMEA 3ZJYA 1Q83A 4HPXB 2JCBA 2QJFA 2PFKA 4WNYA 2ZDHA 5FADA 1PW7A 2PZLA 1BEEA 1N2HA 1OBVA 2RGYA 3D7KA 4X7MA 4KWHA 4AY6A 1XZDA 2WUFA 4K8OA 1LPOA 3BVPA 3UZUA 3T61A 2OZLB 4RF2A 3FDXA 5IZCA 4RTMA 3N1UA 1UPAA 3KVVA 4MWOA 4NK4A 1EBBA 1Z2DA 4UUAA 3U13A 1ORHA 4C43A 4OYYA 1IN4A 1W4LA 2WWTA 1WMAA 2QG6A 1FA9A 5JHHB 2JI9A 5LKAA 2FA9A 3G0GA 2FMXA 2PS0A 3D3QA 1XP5A 5EGSA 1R10A 2QAGC 2VBIA 1R0XA 3GLFA 1R37A 3H2HA 1A7AA 1M54A 3I2HA 3K9BA 4JT9A 3T5DA 1YZHA 4MMXB 2AK2A 4BMZA 4XVCA 3GWZA 5C51B 4BVHA 3MQFA 3RVNA 3ABSB 3EASA 3KQQA 2QBYB 3GJTA 5AI8A 4QJ3A 1JIKA 2DPHA 3CF4A 3HMKA 1HNNA 3IP8A 3N05A 4WUTA 4DIUA 1FDSA 4DFDA 3LFTA 3HVHA 4MDHA 4X95A 3L82B 1NBOA 2V96A 5EWLB 1P0PA 3V7FA 2GVNA 2EGGA 5I7UA 1WA5A 4JYZA 4G26A 1KEVA 3GD7A 5LZ8A 4YA6A 4HT3B 1SOWA 3FDIA 3IUYA 3PS9A 3PEUA 4EGJA 2ZBFA 4X6YA 4FDVA 5ED0A 4BXOB 3RK0A 1XK6A 2OO5A 3JS5A 1VJTA 1NDQA 3TZHA 3PG5A 2DR2A 2OGWA 1OAKA 2ANBA 1QLWA 1JP7A 4MGYR 3UTCA 4CLHA 5DNCA 1QQAA 4RKQA 4IQ8A 1QH0A 3KAJA 3QF7A 2ONCA 1KVUA 2NAFA 4ZVUA 1W1IA 1NW7A 1ZVJA 1FU4A 3TLJA 5IC6A 3L84A 5G41A 1NVVQ 3IIJA 4O4JB 3MRVA 3LOQA 5A0VA 4DGQA 3H0EA 1VPVA 3H2YA 3LYHA 5B6IA 1YF3A 4GM4A 1X94A 3RFFA 1JU4A 1EGQA 3V4ZA 1A76A 1W19A 2EV9A 1X0VA 1GADO 1ULBA 5LZ4A 3B1FA 1QOPB 3T7SA 1Z25A 4ITUA 3E9QA 4F2GA 4MYDA 1Q74A 2A9KA 1W8IA 2ORED 3U3KA 1U3UA 2A9FA 3JQPA 3NKLA 5CT6A 3IAM6 5JW6A 4UHKA 2YN0A 1Q7BA 3UH1A 1SC6A 2LZ0A 2CGEA 5KTOA 1PT7A 2X2FA 4HR7A 4TV8A 5BQPA 5G0VA 4G0XA 4ENWA 5CT9A 1QUEA 4FEYA 1SHTX 3HCNA 3I83A 1E3QA 4G56A 2V8BA 3RFTA 2DPLA 3EGOA 5ENVA 5L6MB 1SUBA 1C4OA 4GWGA 4MOWA 5DISB 2TS1A 2IYWA 2XZPA 3CH6A 5CM8B 5EWLA 4MLDA 5ALYA 1RYBA 3ZU2A 3GZNB 6REQB 2CNDA 3FPSA 3U2QA 4PU0A 3A05A 4TQGA 4OHZA 1JHOA 2SKEA 1Y4ZA 2G1KA 2QL9A 5CGZA 3FJYA 4Y2HA 1QB7A 3KQSA 4RA9B 3ZV6A 4ZGWA 2PLNA 2NYUA 1T26A 1TVEA 2RHLA 2YXNA 3FDZA 4MW5A 5EJAA 1E63A 1A8PA 1Z4MA 3HEMA 2PX8A 2GX6A 1M5TA 3N6RA 2ZSKA 3ONNA 2YZ7A 5TVKA 3FNEA 1GHTA 2M1XA 3AQ4A 2R62A 3HSYA 4Q47A 1XQ6A 3M7IA 1QCCA 1RWNA 4JL6A 4R2WA 5I4BA 5FBRB 4DDKA 1YGYA 4LY0A 2PX0A 1KOLA 4LJ5A 3KYCA 1SCNE 1VDZA 4IJVA 4PCLA 4RJJA 5FPTA 5KB3A 5KTYA 1KKLA 1EBUA 4EO7A 4P86A 4UFNA 4BEBA 5DHAA 5B6JA 2PIDA 1YZGA 3MMSA 2H1IA 4MA4A 3F49S 5HYVA 1J8FA 2QLLA 3PGLA 4UJ3A 1ESEA 3HP4A 4LHYA 1OXUA 1HLGA 3DLTA 3NM6B 2FLKA 2P30A 2HSGA 1E7RA 1MA3A 4PG5A 2CFIA 2AA3A 2CK3D 3BGWA 1VMIA 3A6GA 2EG9A 2YWEA 2V8OA 1Z73A 3ORQA 3D8SA 4A1OA 1EGAA 2JZNA 4ZCMA 1TEVA 4JBLA 4QU9A 2CDBA 5I9BA 1VLQA 2YJNA 1DMRA 1UJNA 2JAOA 4GP6A 2BEWB 1E96A 5COAA 1L5SA 3LW7A 2HM7A 2RB5A 2FWIA 2NU6A 1U9JA 4TKZA 1ZIXA 1KJZA 3JZAA 3AL0C 4FDLA 5AJHA 4OXKA 4D42A 1OAAA 1ZXXA 5FB3A 2NO1A 1BW9A 3LDAA 1QG6A 2OE2A 3H86A 4LRUA 3NBUA 3AEXA 3NVAA 3Q0EA 4M9RA 3BIWA 2G5GX 2ASEA 2JI8A 1A9ZA 4OSPA 3ZDYB 3QQPA 5NLLA 3O03A 1GARA 2I66A 2WWRA 3PPXA 2ZZNA 4RZIA 1V96A 3CNLA 1Z45A 4GD3Q 4X97A 5FO0A 3DFFA 3ZVKA 3H2ZA 3UK6A 2XIQA 1BC5A 1N2CE 1P39A 2AG6A 2CYBA 2NAPA 3R9KA 2JRLA 5EZQA 4CF3A 3ZZTA 3B8EA 3P0EA 4A1FA 4RIFA 1AO3A 3AHDA 1Y6GA 4ZTUB 3E9CA 1T2FA 3LOUA 2I55A 2H0RA 4PZYA 2R68A 1VZ2A 1SK9A 1A9QA 3BGSA 1LLUA 3DL4A 2IYRA 1TW2A 4MULA 4CLRA 5ALZA 3B9RA 3SC2A 1YRBA 1A97A 1FVOA 3F9IA 1JJFA 2IPOA 2WJAA 2ZP1A 3EMBA 4WNAA 1E3LA 5H4HA 3Q8KA 2VYQA 2JGLA 5TC4A 1O9GA 1YRHA 3IQDB 4MVWA 4QAQA 1Z4JA 4IZHA 5HW0A 2WTEA 3UNXA 4ZN6A 3I37X 5BVGA 2G76A 1O9HA 3AHIA 3R75A 2PBFA 1TUBB 1QYIA 2J6BA 1Q7GA 1L8QA 2IYNA 4TPKA 3REQA 4V1CB 5IT4A 4CEIB 4MVYA 3ZWQA 1XZPA 2HGSA 3D3NA 2GYYA 1CP3A 5SZJA 1LK7A 2E6KA 4K9LA 2P8SA 3O9VA 3G2NA 3D4NA 3WBJA 2DKNA 4ZC8A 1E2HA 1EAYA 3ZDBA 3EQ6A 4FCVA 4EIWA 3NP7A 3HBAA 3CSDA 3L9WA 3KXLA 2QX9A 4RQAA 4DDVA 4A6EA 4RD0A 5KKNB 4MPTA 2EBFX 2IY7A 1HUQA 3HYCA 3PRKE 1RLUA 3NEPX 4OHRA 3JAMA 1EFKA 1J25A 1K8QA 4FBGA 1G3QA 3LT2A 4FYYA 4QXPA 2LNDA 5HVNA 2NW6A 3C6YA 2D0OB 3P4YA 5JSZA 5I5GA 1LH0A 1XI2A 3K70B 4EJMA 4IEFB 4GNRA 3UQYS 4BNNA 2FG7C 3KL4A 4UVGA 5L3VA 2CD9A 2I7TA 2OC4A 1ZOLA 2WYVA 2J0EA 3DDCA 3F5QA 1YA6A 2MYUA 2DZDA 1GY8A 4GKBA 3CLTD 1PZGA 2BH2A 2QSUA 2GKSA 2EP7A 3BJRA 3FOBA 1SB9A 2QOEA 3MT8A 2BEUA 3VTFA 2C96A 3ZS8A 5CDUA 4ZV9A 2P3LA 4JR0A 4O1MA 4QJ5A 3VZPA 4MW1A 1QLJA 4Q4DA 5EWMB 1D09A 1OTHA 3DHVA 2NOAA 2PXCA 2IYTA 3N6VA 3ZYZA 3DKVA 3NTQA 3JX9A 3TGPA 1USIA 4S04A 1O7JA 5D87A 1B8UA 4MVJI 4BWVA 1U28A 5EWJB 4IOJA 3WWPA 3PZBA 5JS8A 2VNAA 3C8DA 1F6WA 2EYQA 2NZVG 2F67A 3I2YX 4P4GA 4U7JA 3U0VA 4C2TA 3E1SA 4XPIA 3RIXA 3UWKA 2O8EB 4I36A 5DPMA 1Z2EA 1ISSA 2A5JA 3FN4A 3K09A 1ZGBA 4QO8A 3SZUA 3ZGYA 3H9BA 1QIFA 1X8XA 2OCXA 2OV1A 3ET5A 2VZ9A 2X7JA 1QR6A 1V6SA 3MF4A 3O82A 3DS8A 1N6HA 4MR9A 4F2WA 5IHXA 4DDUA 3G8YA 4BLSA 2Z1MA 3N8GA 3ULKA 5C81A 1LWOA 4K86A 4CKWA 3ROQA 4KLZA 1OYVA 1C4WA 1V3VA 4PQEA 2I2AA 5ICMA 4E46A 3GVXA 2AIRA 4PR3A 3SQWA 4I5GA 5AK5A 3CV3A 2JJ2D 4XQGA 1X8LA 2IXGA 2OQRA 1P1BA 3G5MA 3OE5A 2VBGA 1S1MA 4B34A 2B2XA 2ZAYA 2EBHX 3NHBA 3PGVA 2ZRNA 4IP0A 1ZAYA 1Y8QB 1RWXA 2WG2A 4ZANA 5FWXA 2YNMD 1W76A 3PGJA 4TV8F 4F71A 4PX2A 1G6KA 2BW0A 2VK8A 4HAYA 5BV0A 1UZNA 3WGHA 1UPFA 1BEZA 1RJEA 3AERA 3LZCA 3WLJA 5KTNA 2K87A 3LQ4A 2M32A 5D6OA 3FLMA 4BV8A 3AVVA 3VR6A 5CXXA 2F9LA 2HTFA 1ZYUA 2CV0A 5DW3A 4R51A 1KI3A 2IGBA 1THTA 2Q5EA 2Z0MA 2XXJA 3K0EA 3PHLA 1L5HA 4OG2A 2XLBA 3QLUA 2R6HA 5KDOA 3ETEA 4D25A 4DV7B 4TLDA 2TECE 4FOLA 4WRRA 4MO9A 1VA4A 5LA6A 1WQ4A 4LXTA 5AOBA 3B2EA 5F33A 1FIUA 3GUCA 4LNHA 4GZMA 3KVNA 2CNKA 2BEVB 5A4FS 3WLLA 1V16A 4RDXA 2VPIA 1D2EA 4WXYB 3OO0A 3LWDA 1I10A 1FBNA 4HX9A 4JIMA 3PHIA 4JLAA 5DIZA 2VAPA 1W0KD 4UMVA 2JAPA 4WE3A 5JD5A 1DC6A 2GKOA 2RAVA 1U6IA 3KWFA 4FEGA 3TDKA 2OZPA 3RSQA 2VXYA 2Q4OA 4YASA 1YSCA 3GX1A 3IP6A 1P3JA 4FK8A 1MHPA 1IWOA 3IP5A 4M22A 3T6KA 3ZNOA 3ENZA 1XYYA 1SXJA 2VHXA 3WAKA 1U28C 5J5CA 1OLXB 3DDHA 5KPJA 3UICA 3A6FA 4PYQA 3QBEA 4W5OA 3LYLA 3L6BA 4MEBA 1AKWA 1NBEA 3ICQB 2GZHA 1VRWA 4P3PA 3SXUB 4EJ0A 4I55A 3UJ6A 2FN7A 2W0SA 4QJBA 3K32A 3PJDA 4A0GA 1RYFA 1Y63A 2I03A 1QMGA 1QC5A 5B2FA 5FOTA 3OD5A 1GTJ1 2CFTA 4FD3A 3OD1A 2QTGA 2J9FB 1E69A 4R9UC 3RJTA 1RWBA 3H5NA 1AURA 2EFYA 3BE4A 4HUJA 3AR9A 2UYOA 5I7EA 3O2QB 4YH1A 3WGKA 5I8PA 2BTOA 5D7BA 4QBHA 5ADUS 1D8AA 4Y6OA 4R84A 4N41A 2W2OA 1TUBA 1GGNA 3PKIA 2AOWA 4GXRA 4UAUA 3UJCA 1V2GA 2GHIA 3G23A 4OQFA 1JAHA 1VYHA 4D0GA 1YI1A 1PG5A 4IJ6A 4YQZA 1A2BA 2FHPA 2FPWA 2Q5OA 2V5UA 1JEJA 3KKQA 3WNCA 3THWB 2X8AA 5B7PA 2Q62A 3GPDG 1MD9A 4LDNA 2OVFA 3FLAA 4WN9A 2AX4A 3J80A 1LZLA 2EQBA 3A6LA 1MEOA 2PUCA 1LEHA 4NYMR 3T54A 2GK4A 4FOOA 1NN3A 1EGMB 1MKYA 2QDXA 1I33A 3BCSA 3ETNA 3K9HA 3B48A 4CUZA 5KDDA 5ALVA 4BVEA 1QYXA 2I76A 2Y27A 2JIQA 2ZSUA 5C7LO 4DZZA 2IITA 2VC2B 4M7OA 1EFTA 4CPDA 4A36A 5A4JA 3SOZA 5DBGA 3Q87B 5IJ9B 1XKTA 3MWYW 4KWIA 3RFUA 1WXQA 2ZI3A 3DWGA 3VAZA 1EP3B 3KYIB 5L45A 3UV6A 2PWAA 1U8ZA 4WBNA 3A9WA 1UKEA 3CCCA 3ITKA 4Q3NA 3H4MA 5BUQA 1M34E 1SQ0A 3P0JA 3PNSA 1IZYA 5CCXA 1I51A 2QA5A 3GRUA 3LY9A 3ML1A 3Q3CA 1S6YA 4DMKA 3WYDA 1C1DA 3GJYA 4B0PA 4FDUA 4CRWB 3NLLA 2O48X 1DSSG 3PIRA 3L8ZA 1GKKA 1F3LA 3EXEB 3QF4B 4PGMA 4QRDA 2LDXA 3TOXA 2EIXA 2CXTA 4JYBA 4AG5A 1MZVA 4B3BA