4ABTA

Crystal structure of type iif restriction endonuclease ngomiv with cognate uncleaved dna
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
286
structure length
286
Chain Sequence
b'MQPLFTQERRIFHKKLLDGNILATNNRGVVSNADGSNTRSFNIAKGIADLLHSETVSERLPGQTSGNAFEAICSEFVQSAFEKLQHIRPGDWNVKQVGSRNRLEIARYQQYAHLTALAKAAEENPELAAALGSDYTITPDIIVTRNLIADAEINRNEFLVDENIATYASLRAGNGNMPLLHASISCKWTIRSDRAQNARSEGLNLVRNRKGRLPHIVVVTAEPTPSRISSIALGTGEIDCVYHFALYELEQILQSLNYEDALDLFYIMVNGKRLKDISDLPLDLAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYPE-2 RESTRICTION ENZYME NGOMIV
publication title Structure of Type Iif Restriction Endonuclease Ngomiv with Cognate Uncleaved DNA
rcsb
source organism Neisseria gonorrhoeae
molecule tags Hydrolase/dna
total genus 97
structure length 286
sequence length 286
chains with identical sequence B
ec nomenclature ec 3.1.21.4: Type II site-specific deoxyribonuclease.
pdb deposition date 2011-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09015 NgoMIV_restric NgoMIV restriction enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Type-2 restriction enzyme NgoMIV 4abtA00
1FIUA 4ABTA
chains in the Genus database with same CATH superfamily
1TA9A 3HZZA 1RU3A 3EMKA 1RHJA 1CETA 2AVDA 1NOJA 1TYEB 5B5SA 2WOJA 4Z7OB 1CY1A 1B0PA 3EJWA 2XQGA 4OHKA 4FFDA 1JTFA 5GQSA 5JO0A 4U7PB 1CDDA 2BUAA 4BFWA 4KH0A 4X71A 1YFLA 2QN1A 3RANA 3TKLA 3T7CA 1U0OC 2AX4A 3HRHA 2OV1A 4LDQA 3UAYA 2IVZA 1REQA 2QZ9A 3BGOS 2AWOA 4GP6A 6AT1A 1H9AA 4JXXA 4ZOCA 5EJMA 3KVNA 3BHMA 4Q1FA 1QIFA 1SQGA 1WB6A 3JQFA 2OUKA 5BN1A 1WB4A 3T5AA 2GNOA 3P8ZA 2WWIA 3FUTA 4FP9A 1UXKA 1Z2OX 4F9EA 1XL0A 2CL5A 1MB9A 2HTEA 4QGAA 1T9ZA 2C9CA 4P7KA 4ZANA 3TW8A 3UMSA 3UMRA 1XZPA 3UXEA 1NF8A 4PHTA 1HT1E 2NUBA 2B3DA 4JGGA 4Q9AA 2H4XA 1XRMA 3ME5A 4I7EA 3FVTA 3JSAA 4F4HA 4LQ4A 4MHSA 3FYUC 3K8OE 3LC0A 3N1UA 3QLTA 4RHCA 1TZBA 4MVWA 4D9FA 4HWGA 3U6BA 4Y2HA 4Y9RA 2WNIA 4U9UA 4MR8A 1SK9A 1JA1A 1F4LA 3LKBA 3OLWA 2AG1A 1NMYA 2QR2A 3GZNA 1XTUA 1XA3A 3AEZA 3VR3A 4KR3A 1SJ9A 3QVGB 5BYBA 3BXEA 5J4LA 2AUNA 3QELA 4IIGA 3M1YA 4Y6SA 2AIRA 4DBVO 3S0JA 3WMXA 4F92B 2G82A 5DT9A 4G0WA 4AECA 1LDGA 3ZE0B 3H86A 1E2LA 3EGWA 3NLLA 3O4GA 2ZYAA 4OHVA 1PGQA 4DV0B 1KAGA 2RE8A 2Q29A 1IJBA 1B7GO 1H22A 1ONNA 3PVSA 4LJ7A 1DJOA 3F2IA 3W2HA 4CKZA 3QWIA 1B0ZA 5J43A 3U7QB 5E3JA 5JIBA 3QWAA 1CEYA 4G0QA 3G3EA 2WM8A 1VXRA 2H1OA 1NVMB 1CUXA 4CIBA 4V0MA 1H2HA 1FNSA 3K6KA 5AI9A 5KAMA 5EIEA 3DWGA 3W4JA 2QHXA 7AT1A 3K0CA 3AYXB 2YN4A 2X2EA 4BQQA 4MRNA 1N7GA 4JYBA 4QQ8A 4W1PA 1UMCA 3ZLTA 4E51A 1TF5A 3NWEA 1QGZA 2XUZA 3LZDA 2ZUWA 4ZQBA 1J5XA 3Q1KA 4DMUB 1Y9ZA 1J6UA 1TZMA 4QGGA 5K8CA 2ZE7A 1FYEA 2G83A 3NYRA 1D2RA 4AX8A 5IJZA 2XMPA 3IPRA 4DIBA 4GBMA 1Z4LA 1YF3A 3BAFA 5F76A 1QZXA 4JLWA 1L4GA 1WDWB 2VNSA 2YXLA 1LBSA 1TQ8A 1CS0B 2HT6A 3ELDA 4EHLA 3IUQA 2H29A 3KU1A 2GKSA 3KJHA 1FBTA 2GO7A 2SECE 2GN0A 4UJ5A 5CBPB 5JI3E 1OT3A 1T9DA 2JLRA 3O5AA 1SOWA 4IEFB 4I6EA 3WDKA 1OVMA 1JE1A 2LE0A 3NBYC 4PZZA 4A4DA 1T2CA 5TQ2A 2PV7A 2HMAA 4N5NA 3LMKA 2UZ1A 4FEYA 2EQ5A 3X1XA 4JI4B 2XEXA 3TIXB 4FNMA 2E4XA 2YRXA 1ZSYA 1N6RA 2Q41A 2VG8A 3A1FA 5EKTA 4XWAA 3JVIA 3MVEA 2I87A 3GRUA 4DMRA 1B41A 3A2LA 2XE4A 4GE3A 2V59A 3LDHA 3NW9A 5FUMA 1AQUA 4UU8A 4LXTA 4X1KA 3B1FA 1KSJA 1IVNA 1N2XA 1QO7A 3QPAA 2X76A 4G1FA 4GAEA 4LNHA 2ZROA 4JWKA 1Y6JA 1SC6A 1XTIA 4J07A 3O7MA 1KZ1A 3PT9A 3E7PA 1Y6GA 2IEDA 1BYUA 3GPIA 4M9SA 3RRYA 5AOAA 4C5AA 1AKMA 5BSHA 4HPJB 5K20A 4ON9A 3JTMA 2H9IA 5DGCA 5KU1A 1YIDA 1PCXA 1U7UA 1XCLA 1NXOA 2NUAA 4MV5A 2HREA 5THKA 3TSZA 1F4PA 1TC2A 1BD3A 1XXHA 4G5OA 1ULSA 2X5KO 3SG0A 3WGKA 3L41A 4KU4A 1RYYA 4IGEA 1QIIA 2RK4A 1G2PA 4M0DA 3A9CA 1JPNA 2B1JA 3DBRB 1CDOA 3FPKA 3W5BA 3PFHA 4AY5A 4RXMA 4YACA 1P5FA 4EHAA 1QP4A 1K88A 1JRLA 4CM9D 1WB5A 1VB3A 2V5UA 3A6KA 2D1TA 4CT0A 1SEVA 1U2TA 1G3MA 3EXG2 3RFUA 4HMOA 1C3VA 1E9SA 1G63A 2WI8A 3PNOA 2TMKA 3LO8A 4LBWA 4M0CA 4MWCA 5C5EA 4L5IA 4B3DA 5T8KC 1T24A 1Z33A 4MNTA 4ACAA 4FGUA 5ICGA 3JD1A 4LFAB 3M1AA 4LPKA 4H6VA 3UUGA 3OQPA 4KVFA 3V7FA 5JXJA 3CR7A 1YGPA 4GMXA 5CH8A 4AJOA 5IULC 3G2PA 1AXEA 4QE3A 5ERGB 2WJPA 5G41A 1ADBA 4ZV7A 3KR1A 3DYIA 1SBQA 1YD7A 3EZGA 2CXSA 4ZEOA 4BZXA 1O3YA 2ZYWX 5AI5A 1FSPA 3TJRA 5HK9A 3AESA 1YDHA 4TRRA 1BC5A 3OLZA 5HSGA 3F7TA 3KJIA 2Q3FA 4XWGA 3DYBA 1UBEA 2JANA 4C1NA 3JARB 4AZ3B 2WTUA 5K3FB 3Q8XB 1XAJA 3TNJA 3B1YA 5BR7A 2FPKA 5KCZA 2VHTA 3R3JA 1K7FB 4H31A 2QW1A 2WMNB 1EBBA 1HPLA 3KFXA 4JXKA 4XB6B 1PTKA 4RDCA 1Z18A 1PQPA 3TZKA 5AK3A 3KB1A 2JHPA 4R31A 3ZU5A 5AKXA 2EFHB 4KXXA 5DNDA 2CLLB 5ECDA 3CZ4A 2BTEA 3WRYC 3N8HA 4H18A 1NAHA 4LRWA 3CJTA 5CXXA 1YCFA 5H82A 3ZXYA 3RRJA 1UPAA 1XU9A 2D00A 3EIUA 4WCDA 3L04A 2PMKA 2RHRA 4DMKA 1R6VA 2QVBA 4EW6A 1FMLA 1R4NB 1QDLB 1IMJA 2UZIR 2YOHA 4INAA 5JR3A 4TZTA 4ATNA 4EW1A 3C7TA 3G2OA 1BCRA 1JEQA 1X38A 2XWBF 2H1FA 4RFSA 4MDYA 1CLEA 3EBLA 3B89A 1IBKB 2YW2A 3HUUA 3SR4A 4HVLA 2ETVA 4EB0A 4EEKA 5DI3A 1C3LA 1NBEA 3DFIA 1WVIA 3G7NA 3HDJA 3PWZA 3AY3A 4EELA 3IKVA 1G3UA 3DB1A 2RMKA 1Z4MA 3MLAA 2ZJ1A 4J4BA 1GGEA 1KDZA 3HCOA 3KXKA 1EWYA 3BL6A 4WXRA 1OBVA 4QULA 5L6LB 1S9DA 3TOVA 3WRWA 1X87A 3PFWO 3UTCA 4D8WA 5LOVF 4B34A 5ESRA 4F04A 4CL8A 1U3TA 1SUPA 2FP3A 3I2IA 1KAHA 1CUDA 1T1RA 1U7PA 2DVMA 2V97A 2C59A 3KAPA 3NRJA 4UNPA 3P97A 1GZ7A 3T7TA 1FYDA 2PPLA 3C70A 2FB9A 4FFNA 3D43A 1GNTA 3SXUA 3WJ1A 2JFVA 4R8LA 2Z83A 4QYMA 2IY7A 1G7SA 3VV2A 5IBCA 2FLVA 1VKOA 1J24A 1L3CA 1QIEA 2QJTA 1XR3A 5BR1A 3FJOA 4QQNA 5HDQA 1NUTA 3UMBA 3KSBC 2JIPA 3PC4A 4XUCA 4YP6A 1FFEA 2I6XA 3K9QO 4PX9A 4KLAA 1AIPA 2RHWA 1ZYUA 2RG7A 3GJ0A 4B47A 2ET6A 2IEYA 3OX2A 5E7MA 4EG6A 4BO0A 2ZITA 3IOEA 2FSSA 4I6GA 3O8BA 2YTZA 1W4ZA 4CIXA 3AFHA 1JQJC 4J1TA 1LBEA 1GARA 3E7FA 2CY0A 3OIYA 4Y6OA 3UHJA 4PYRA 2EQAA 4MW6A 4G07A 4R0VA 1SXHA 5AKLA 3CF6R 1R6BX 2ORIA 2DPXA 1G55A 2UVDA 3HEAA 3Q3IA 4RQTA 3VX4A 5ALVA 4QPJC 3BZUA 3O3MB 1MO2A 2IP2A 1TZ2A 3GWGA 3BICA 1VC2A 1O7JA 3AQ4A 2OGWA 4NBLA 2BAGA 1HYGA 5CD9A 1J5EB 5GM2A 3PUHA 2F43B 4ALIA 3LE8A 3MGAA 4KKVA 4GOKA 5ALHA 5DWQA 1N3IA 4NOMA 2DB3A 5FLXA 4ZXFA 3MD9A 1EVQA 4H3VA 1J0CA 3LKVA 4QG7A 6LDHA 2ZSIA 1FZTA 4HWKA 4WLNA 1M2VB 5LZ5A 4I14A 1DKOA 5JNWA 3PA8A 3ELYA 4G97A 1DIRA 2P9FA 4M21A 1FFXB 1ORDA 2VJBA 4ROSA 4LF4B 5D5QA 4PW0A 1WY5A 3JATB 3AKZA 5DJ5A 5AVWA 2OAEA 1DAHA 1C0IA 1T5OA 1G60A 1KMCA 2XVZA 1J0XO 4MRMA 4CCYB 4YCNA 4MHOA 1EB9A 5EHQA 4FN4A 5JANA 2AW3A 1XNJA 3ZWOA 1QP8A 3TWOA 3GLGE 1UBKS 1FC0A 4E2WA 5DHFA 3VSDA 5EMHA 1JUDA 1OI3A 1TQDA 4UUAA 2H16A 1TD9A 2NW6A 3IT0A 3ONWA 5AR1A 3SZUA 3ZS9A 4FFSA 2VT7A 1HFJA 3W7BA 5C8VA 5AIBA 3IAS6 1I2MA 3SF8B 3R7DA 4CGYA 3MGBA 2PUCA 4RD1A 1J0DA 1W6RA 1Y80A 3NJ4A 4LYHA 4EA9A 2C4NA 5B3JA 2FG5A 3USZA 4YXFA 1K06A 2OCDA 5LDHA 3CGWA 1GKLA 1DC8A 4D25A 1J2JA 1P4JA 3BL8A 3KJQA 5BMVB 1U7TA 3VYWA 4BKMA 1MIHA 4EFLA 1DDGA 3IPXA 4ZPJA 3I39X 3OH8A 3MWKA 3D6TB 4MARA 4QL3A 3HZHA 2P27A 1VE3A 4JBYA 4ZGWA 2BJWA 2FWAA 4HQNA 5JJIA 4TQUS 1YR1A 2G0TA 5KHLB 2Q4OA 2VFAA 3QKSB 2XBMA 1RWKA 2W2LA 2PGXA 4HS4A 4QXAA 4U6QA 3LWBA 3LHDA 3K0KA 2QI9F 4C4TA 1IMOA 3ACDA 4N03A 3E22A 3FZNA 3E0XA 5JD6A 3Q98A 4A0FA 4JUAA 2OOKA 5IKMA 1QANA 2IODA 5JMOA 5F5XA 2A84A 2G4CA 2Q0XA 1NP6A 3AW9A 3FPEA 3CUEF 3H18A 5TXGA 4DA9A 4JDPA 4DWJA 1X2EA 5IXYA 3PUJA 4KV9A 4ZHSA 4IJQA 1CUBA 4HTFB 3ZY6A 1TVKB 3P0FA 3ETLA 4ZVKA 4CV2A 4O3MA 1RP7A 3O75A 2BFEB 3B7WA 4CNQA 1AKEA 3WQHA 1I01A 3OZWA 1W87A 3REFA 4MCAA 4FFMA 4FN5A 3VPHA 4L2IB 2WF6A 4NYMQ 3RV3A 4IICA 2OB2A 3F6CA 1MDBA 1P0QA 2IP4A 2JZOA 3GMSA 2AZDA 1U2GA 2F9LA 1CU1A 1JG1A 1QJ4A 1G2IA 1W9MA 2PL5A 2V7PA 3GJ6A 2YJNA 5B4UA 3C3KA 3QHQA 1D8TA 1VDZA 1T9CA 2QN2A 5EPUA 4CLHA 3CE6A 4KZKA 5A4MS 5CP8A 2WIFA 5KMGB 1CPYA 1QV7A 4E5KA 1DV2A 5K0NA 5HJ7A 1HDZA 2I66A 2YQ5A 3G17A 4ZYXA 2QMQA 2WTXA 3GBVA 4TZ6A 5L95A 3G0HA 3ZQ6A 4JLSA 4IJ6A 5EOVA 4S12A 3X1DA 2CFRA 2C31A 1LV7A 1CIPA 1YMUA 1YOVA 4UD2A 3EMVA 1HFWA 2KQUA 3QWHA 1DVRA 3FRIA 3L0ZA 3OLQA 4GSYA 1YB4A 4LY6A 1VJTA 5DH9A 5HF9A 5IBPA 4EUEA 2HPHA 2Z2KA 1GJRA 3IKJA 1QHXA 3A58B 5CVTA 4V02A 2GM9A 5DLYA 3VPGA 1OF1A 4QOJA 1YRQA 1LPAB 1AGNA 4H3SA 4DLXA 1Q17A 2FTKE 1O9HA 5KS2A 4M3NA 5KQMA 4K9KA 5T7BA 2OKCA 5EKUA 2I91A 5AK6A 2R62A 2C1ZA 1U7XA 2AC2A 2YV4A 3U9SA 1UDRA 3WC4A 1PFVA 1GNLA 2M6RA 2I99A 3HUEA 4ESVA 2XNJA 2QUBA 3GJ5A 3TZBA 4RA6A 2QTFA 1VLHA 1EVYA 1Z2DA 3JCZA 3WRVA 2PYIA 2GBCA 3GBPA 3QZUA 3WWPA 4EHHA 4EX6A 3V4LA 3JAMA 5IH7A 2JLSA 5IU6A 3RIXA 5KDDA 2WYIA 1OXXK 4G86A 1N5LA 1IQRA 3PVZA 4IM7A 4RJIA 1C8VB 4YBZA 4H7IA 5F21A 1FOEB 3VKVA 4YI5A 1R4AA 4UDOA 3SQLA 2BR5A 1DOHA 3GCWA 4RTNA 1GPLA 1K8RA 3EFHA 3EFOB 2NYRA 1RIIA 1JLRA 2VQDA 3NFYA 3QLJA 4BE9A 5CPFA 2GX6A 4PYKA 3T0IA 3WYFA 3I6YA 2OHOA 4GL4A 3RK1A 5FBHA 2GKOA 1T6YA 2OZEA 5FV7A 3CH7A 1NY5A 2RGGA 2GI4A 3MCVA 3SJAA 3AHHA 1DBRA 1TJPB 1U0GA 3CZCA 4E22A 4HNQA 4MZXA 2ORWA 2I3DA 3TKYA 1MLDA 3K8YA 3LGAA 1IU9A 4K7JA 3S7TA 4C6RA 4BVLA 2X7HA 3A3PA 4MJ3A 4PANA 3NRCA 5GOTA 2A9KA 3ROTA 2WBLC 1J8FA 2VTBA 5IJ0A 3ES9A 4GZMA 2CLEB 5I47A 2J5KA 3NVMB 1LVHA 4ADSG 3P4UA 3EIXA 3W2EA 1T9AA 3OPYA 1Q3KA 4IUDS 2AEEA 1PT5A 4CHTA 1EHIA 4LOIA 5GGXA 4CI0B 4EKYA 1NNUA 2P1DA 3K5PA 4HOYA 3UH1A 4A3SA 4D3ZA 4DT1A 3FSGD 1A8SA 3NASA 3MRXA 2OFWA 4LI3X 4XUDA 3KOYA 5D3ZA 5ESDA 3W4IA 4D82A 2BISA 4H59A 4PAMA 3WGNA 1XPUA 4KUHA 5CAEB 2VDJA 5FNZA 4AAYA 3ER9A 5KX5A 1VE7A 1SG6A 2FWRA 3TR0A 2CXTA 1CZNA 3E9EA 2A0UA 3L1KA 1EEXB 1QDEA 2JEZA 4OSOA 1U0BB 2I6TA 1Z6YA 3TRDA 2XXAB 2J9YB 1V7PC 1ZU4A 3NHLA 4Q7LA 5AQ1A 4BB9A 2V0GA 3SJCA 1Q7CA 2YW9A 4G1VA 3DCNA 3RUHA 4DQKA 4D8VA 2ENUA 1IN5A 2ZSHA 3ZHUA 4BTEA 1EFLA 2O0KA 3LTNC 2GFQA 5F7OA 4MRAA 3CR8A 3O1JC 4DLSA 5FADA 4ZCRA 3CKKA 1JR2A 3RYCA 5AW0A 2J3MA 2YUIA 5FT9A 2X3YA 2BE9A 2JI6A 1ZVMA 4B75A 2FZLA 3VHQA 2P4EA 3QMVA 3CUWA 1E0AA 3OJXA 2IV2X 2B5OA 5HIKA 1DC3A 3QQ5A 4QNMA 3TD9A 2HU7A 1OXKB 3Q7TA 4ZI2A 4S0XA 1E2MA 4NXNB 3U7GA 2H6EA 3QKIA 2YZGA 3NJ8A 3Q0IA 4MWZA 5K6TA 4G0OA 3WB1A 3U2QA 3IALA 4D9EA 1Z9BA 3LK6A 1X13A 2GCOA 5IEBA 2IPOA 3V1MA 1JV2B 3TBKA 3QMMA 4UNIA 1LZLA 5E38A 2COEA 1P74A 4C7JA 1ZD3A 2EHDA 3Q7EA 2ZRCA 2OORC 2FV8A 1QZ3A 1WZNA 1Y4UA 3P27A 4RJKA 3V1LA 3ETCA 2GSWA 1ZEMA 4MWBA 1CG6A 1VLJA 2A1UA 2ZYVX 1ZN7A 3PWTA 4NC9A 4X44A 3SXJA 4EY5A 2X2OA 4EHBA 3OETA 1P17A 4GMKA 4NG4A 3U62A 3VNAA 3WLOA 2YWDA 3N2KB 1AVTA 2VK8A 2WWWA 3OM1A 5KWSA 2AC4A 4TV8A 3MOGA 3AF6A 1JR6A 3COWA 4XYEA 4XW2A 2F59A 3SR3A 2XEDA 2GUWA 3FMPB 4NAHA 1DAIA 2ZQYA 5LQDA 1QF9A 2VHZA 2VWQA 2Z8YM 3GOQA 3D81A 3IQGX 3RYFA 1ENPA 1KDTA 4HI0E 2IKQA 2BZ0A 1S3GA 2XCTB 5JXGA 2NPFA 1FQWA 2PUFA 1RJ9A 1M2WA 1K68A 1PD0A 2G63A 4K46A 4ARCA 1KMQA 1VRVA 1RBMA 1Z4JA 3IT3A 2BZSA 4MV8A 1QM5A 1B93A 4DDUA 1PK9A 2HNKA 1RPTA 4AJHA 4IDEA 3AETA 3NEYA 1BS2A 3HWX1 3JQAD 2FZKA 3OE4A 3PL1A 3HLYA 1E0DA 4I55B 1GU0A 4JVMA 4MJ7A 4QSMA 4X61A 3RPEA 4F45A 1SXJB 4JKOA 4XIYA 4K1LA 2W0SA 3TZEA 1IXSB 1UINA 3KBOA 3ZVRA 3FXAA 4EGSA 2UVQA 1JTVA 4CLRB 3MUOA 3K71B 1Z2CA 2ZTSA 1LBTA 1ZGCA 1PV1A 1S2LA 3MJSA 1XALA 3CEHA 5KTKA 3VU9A 1BSVA 3N5KA 3IOMA 1Q15A 2PKRA 4PZDA 1WCYA 2OM6A 3H97A 4CKBB 3L5KA 3Q2OA 1HKUA 1B3BA 4P1ZA 2R1UA 5F78A 1DRUA 3VHXA 1J22A 1IQUA 1DRJA 1VBKA 2FFJA 3AXTA 2PUAA 4RMNA 4I1YA 3U7IA 2ZXFA 4WKCA 4NE7A 1BHSA 4C6SA 1A50B 2CNDA 1Q1ZA 1NJ8A 2B2CA 5C1PA 5BP7A 3INYA 2JBAB 5KTPA 1OH5A 5ESXA 2VHUA 1PNTA 3MT9A 3FF4A 3GGPA 3I0NA 3L46A 2WK1A 2P9EA 3GX1A 4P38A 5CPBA 4TMXA 1JXOA 3K15A 1MJGA 4N1AA 3VC2A 1BDIA 3VGJA 4KIFA 3ICOA 2B78A 2M6LA 4G1BA 4FB5A 5GVRA 4AQ7A 1T9GR 4RVUA 4ME6A 1FE8A 4C0WA 5AUNB 3MCWA 2I6QA 4BFSA 2ZEJA 1ULTA 4H7FA 1ISSA 2R7NA 5F3DA 4DZZA 2QOEA 2WFLA 4XJXA 4BFCA 2RDMA 4G24A 5KTNA 2XRMA 2WUVA 5E2AA 5BUCA 1DIBA 1EP9A 1COWA 3EC1A 1QTQA 4R2WA 4NZMA 5KX5F 2C8KA 3I9KA 4DARA 4BX9A 1WP9A 2IDJA 2VJNA 1V16B 1OLXB 3F3KA 5F7JA 4DR7B 2HWUA 1CVIA 1XEWY 2QT9A 4Q1AA 4ZPXA 4KV7A 5KINB 1P1BA 2VDNB 3E9RA 1ZW6A 1H6AA 4P5EA 3VBEA 1DIOB 2IUSA 2H2GA 2G70A 3L8DA 4DLRA 3DL7A 3ETEA 5IABA 3A70A 3QI7A 4FMPA 2B36A 1SQ5A 3WGQA 5ANRB 3H5VA 4MV0A 5CTJA 4IILA 1KK2A 4YAWA 3E9ZA 2NPOA 1YMVA 4AI6A 3FLEA 3ENNA 1N2OA 3LPCA 1M9NA 3ENVA 5CNKA 3FNEA 5FWYB 2W2QA 4OXIA 2P7IA 1KMMA 5JS1A 3GFPA 2EBHX 4EL5A 4XASA 3V48A 5A5FA 1DG1G 3BWXA 1TT5B 2WR8A 5EZYB 4MR7B 1YA8A 1R8XA 2EYQA 4FUQA 4K6HA 4QJBA 2H52A 3F2VA 1K6MA 2QVGA 3ULKA 4CV0A 1J8YF 5AM0A 4EYEA 4K0KB 1GVNB 5H68A 2VR1A 3EWIA 3F47A 3LVQE 2D7JA 2QZZA 2ZAOA 3S99A 2EG5A 1G98A 3EARA 5LLSA 1NF9A 1Y1LA 2VBIA 5IF3A 4UJ3A 1BE0A 1K8YB 2WYUA 2ZBQA 3K8ZA 4K40A 4MUAA 2PD3A 1XMOB 1LTQA 4QBGB 2N3ZA 1U3WA 3I04M 2QLLA 3S3TA 4QICA 4V0KA 3A37A 3DZBA 3U3RA 1G5RA 3A1DA 3DG9A 1TKAA 2BR3A 3OE5A 4MPTA 4XB1A 3VTKA 4B4WA 1XPOA 2WC1A 4M60A 2CJPA 4NDNE 5K6RA 1Q92A 2CVQA 1XQ1A 3AVTA 1QWSA 2PUJA 4PSVA 4QFCA 3ZZTA 4F86A 4XPIB 2Y2VA 1NN5A 1NN0A 4JELA 2XDYA 3K92A 2YQZA 4IQ8A 5AXDA 1ICEA 4Q02A 4GBED 4JHXA 10MHA 1KH2A 3BERA 4DMMA 5LUAA 3INRA 3EX7C 4UVEA 3AF0A 3OSZA 1DT3A 2XTAA 2DE0X 4Z6KA 5AW6A 2J4FA 2HV8A 2ZSAA 3VH3A 3WI7A 3UJ6A 5AK4A 2J5QA 4XWOA 1UOQA 4FW8A 3SKVA 3A6PC 3HDGA 1I0IA 5JT1A 2C2KA 3WK9A 2R8YA 4RKRA 3IQEA 4LVCA 1OFIA 4Q0MA 4D9HA 2GNAA 4P32A 4C07A 3LY5A 5CD1A 3MF4A 2BKUA 5CJ2A 4ARBA 1WIWA 5LP6A 4UHBA 2OEPA 3CINA 2VYQA 2GF0A 4EHFA 1H0SA 1SQ0A 3SC3A 1XCMA 3BDAA 1H2WA 4WE3A 3UUFA 3RRZA 4RZXA 1R8SA 4EVRA 1UKYA 3PHIA 3PD7A 5GPBA 4PRKA 5GOZA 4MS4A 4OFWA 4D97A 4TTRA 1BFDA 1NVWQ 3HP4A 3M6AA 2O2DA 4BAUA 5DASA 1ND6A 2O0JA 2CJFA 3L7YA 2WUEA 4WBNF 1QQBA 4EPYA 1XWFA 5H59A 3SC2A 3X1ZA 1HE4A 4NCAA 1XZ8A 2QPTA 1PWXA 3HCNA 3VPBA 2QJOA 1RAHA 3C87A 3HXMA 1XZAA 2G76A 4FKZA 2VRNA 1HG0A 1CUVA 4QGFA 4BGVA 3HYCA 4P4GA 3RVOA 2CBXA 3VOTA 5C4IA 2G9NA 2CHEA 5DHUA 2JCGA 5LQUA 4P4SA 2AQHA 3I53A 3RVNA 3MWYW 4EHKA 1LW7A 2IGTA 4BVKA 4Z7JA 3CWZA 2Q50A 4ENTA 3RHSA 3W6PA 3U3JA 1EHYA 4N54A 4YT5A 2PRJA 4EY4A 1DQNA 3PX2A 2XITA 5BPHA 3IUJA 4FR0A 3UKDA 4YRKA 2NSHA 4RHEA 2MYTA 2JDID 2IUTA 1KIAA 4WA8A 2FUG6 1I7PA 3E03A 5A7HA 3DDNA 1IRIA 1DLIA 4BV3A 4MHTA 1PLLA 3ZD8A 4OHZA 3EQ2A 1NF2A 5KJ1A 3NUQA 1L5SA 2ZXEA 2Q5OA 3DT6A 1R00A 4JIGA 2DQYA 4M1ZA 4NONA 4Z9FA 3N7UA 4YPOA 3IEKA 1U6JA 4NBTA 3A1EA 3NWBA 5DNUA 4ALJA 1RZ3A 2WMOB 3GNQA 1CC1S 1Y5RA 1THTA 2FPGB 1WBJB 3LK7A 1RTTA 4IDHA 1XQXA 2QMHA 4HB2A 4J0CA 4LOHA 4NJMA 1J33A 4RX1A 3L06A 1A5AB 4KQ2A 4WKPA 2CDAA 3OLCX 5KHAA 3U17A 5DPMA 3MB5A 1CX9B 1TXGA 3H1EA 4RORA 2GR9A 1KZ9A 4YJDA 2DR0A 3OKCA 1TK3A 1X7DA 2XPCA 3HP1A 1Z07A 2JI8A 3W5JA 4XD7D 4TTTS 4TTQA 4LDNA 1FXUA 3CF2A 1Y7HA 3ODGA 3AHGA 3HA3A 3PWKA 4I1PA 1C8LA 1H8HA 2NVUB 5EP4A 5INTA 2RGNA 5IT9A 1XHFA 3PG5A 2G72A 4OMDA 3WLLA 2FN4A 1U9ZA 2CEAA 5BW8A 2WKPA 2XA1A 1UODA 2X40A 2JATA 1U0EA 3IOCA 4RKEA 4RGBA 2ANCA 4AUMA 2RHOA 3D4OA 4PGGA 5FFFA 4LC1A 4OL0A 2ZJ2A 5K05A 3K0BA 1QQ6A 1E89A 4U2DA 2HIMA 1WV0A 4YONB 1W5BA 2ETXA 4OQDA 5CB8A 1PT8A 1VQ1A 1BRMA 4MUBA 2WABA 7REQB 5GINE 3OVMA 4R8KA 2WJ6A 4G1MB 3RVDA 4BHTA 1SU6A 4G63A 2JPDA 1RABA 1E3DA 4H1UA 4X7BA 3P9XA 4C30A 2RB5A 1QFXA 1S3SA 3A9WA 3AIMA 3EEYA 4GPZA 2I7TA 2R65A 4HYTA 5DSZA 3TZLA 4IFEA 3TOXA 2G9UA 5EIXA 1MC1A 1U8YA 3KAJA 1BGWA 3H1TA 1F2VA 1EI9A 3EW7A 1JIIA 2G9VA 1QE0A 3NP7A 3QYFA 4GIBA 3IV7A 4IEEA 4Z9YA 2I80A 2JLUA 4CTOA 2PKCA 4G5XA 4Q00A 3AU9A 4D6XA 1WG8A 1W75A 4WZBA 4R54A 4W1QA 4QECA 5AUOB 3ZZ1A 5DT2A 1XU4A 2EFYA 1HNZB 5FRDA 1UPFA 1UBFA 3THYB 3B85A 4G0VA 4LFBB 3B8EA 3IEVA 1C7IA 4RAQA 1XKTA 2Q6OA 4MKXA 1NQ5A 5AICA 4PE5B 5JPDA 5KYTA 5LQMA 3IR6A 3TECE 2PGDA 1N36B 3UEOA 2CWDA 4HJXA 2FSVA 4OU5A 5DO9A 1GL9B 3RM3A 4QUHA 1R5NA 3FGOA 4YUZA 4PYMA 2I8CA 3WWCA 1UK9A 2GM3A 3CYFA 4XJSA 4JKYA 4X95A 4CM1A 1ILEA 3HVUA 4GLBA 5F23A 1CW2B 2M9MA 2VP9A 4OFXA 1MC4A 4CKWB 5IG2A 3PIRA 2QBYA 4WASA 1ZK2A 3PTLA 4EF5A 4L57A 4D8UA 2YVQA 4OJYA 2PZKA 2X0DA 2R1VB 2WFAA 5HKOA 3IVMA 2FPIA 4J0FA 1EXDA 3BFKA 7MHTA 4OHXA 5HF5A 5J2UF 1KI6B 3AM5A 4ZOQI 1SUFA 2AJDA 2GVNA 4RUKA 3MA0A 5A6SB 5I7VA 1Z4QA 4L51A 1XZIA 4NSNA 1JXAA 5CYOA 4A16A 2WVJA 4YXWD 1NVBA 1PWZA 2H4YA 1WPRA 3MD0A 4JBLA 1L5HA 2QSJA 4F2GA 4NP6A 3ZZNA 1QO0D 4A9AA 4HB4A 3VM6A 2XWJI 2ZU0C 3REGA 5IYZA 1ORIA 5A4DA 2C5GA 5EGNA 2PCLA 4C5BA 2OFOA 2O7NA 1NUAA 2H4JA 4BB5A 2FWBA 3CEJA 4N40A 4OBWA 5G02A 3UCEA 4AW9A 3QLVC 3IS3A 4F85A 2REQA 1XYYA 4NEHB 5ALXA 1QHEA 3I5XA 2B9VA 3GDGA 1P8AA 1U9CA 3I2YX 1YBAA 4O4LA 5FPQA 5AT1A 2Q4EA 1MOPA 2CXRA 3LA8A 1AS0A 3FCXA 5D00A 4XFKA 5LXTA 5IJWA 1NHWA 2VHQA 4O59O 1UXOA 1KI8A 4ZDIA 2QT1A 5D3QA 4B9EA 2ZRNA 2IXTA 4LJ5A 4M8NE 5AVJA 3MMZA 4PG5A 3GPLA 2CNLA 4Y2XA 4O02B 5E2BA 2NO1A 4WAUA 3IQFA 4C5CA 3MHTA 2GERA 4FXPA 4H2DA 4EA8A 3R74A 4D74A 5C8XA 1PSWA 4OCZA 3DLHA 3GZ4A 1P19A 6ADHA 3DLAA 1MA0A 4HNHA 4WXHA 1UXIA 3PXAA 4E2XA 5C5IA 1YS7A 1XIVA 2YMQA 2Z98A 2DX7A 4WZAB 2A9OA 2W7TA 1IY9A 2IEAA 3HYRA 3I12A 4ML3A 1XNRB 4KR2A 4FBGA 1GCAA 4OLFA 2XB9A 5H1YA 2E89A 4URZR 4F2DA 4HHEA 1PR5A 4BLOA 1JDTA 3OPMA 1BTOA 4P8RA 2AYZA 3VPAA 5AW4A 5MN6A 2VUIB 4PC3A 1M2JA 1ZD2P 5H9WA 2ZE6A 3W6ZA 2YZ2A 3QE2A 1XTRA 3N86A 1EHCA 4TUYA 1QB8A 1NUUA 1UPCA 1XD2B 4ZZIA 1P73A 2IE8A 3FWPA 2IXEA 4JNCA 3CV3A 4QPDA 2PUBA 2ZVDA 4GC9A 4PPYA 2H1RA 4O29A 3W9UA 3BEOA 4IIFA 2PGAA 5M04A 5H80A 1USWA 2VJLA 3SSNA 1Q2XA 5BYAA 2BRUA 2P9CA 2HDHA 4M1KA 2R4UA 5IAEA 3RVSA 4NBRA 5KKCA 4OU4A 3G2IA 5TPWB 5BR8B 1SHTX 2PWAA 2C4KA 2XDQB 4MCHA 4YO7A 1M1XB 3R75A 2ZRHA 3G2HA 4MA0A 3U49A 3WR5A 2Q7OE 3TZHA 1H4SA 4YCDA 5BWOA 1TYBE 2NO9A 4MKFA 1QLJA 3OPVA 1E79D 4U8HA 3BPSA 2OYRA 1E1MA 1YB2A 1VI6A 1ZNXA 1TVEA 2VHYA 1M54A 2MMCA 1CIJA 3KHTA 3AW8A 4HLUC 3HK2A 1BJTA 3ODPA 3D5EA 1F0NA 1J8VA 4P08A 3P9ZA 1XMPA 3C4QA 5J5CA 3RYHB 4KX5A 4RLFA 3D8NA 4EG8A 3DOUA 2VUSA 5KPDA 3H3XA 4PICA 3KC2A 1AGRA 4R2LA 2B69A 3MTAA 1NFFA 4TKUB 1Q19A 2QAGA 4UFOA 4CDNA 2XJ9A 4BWFB 1EXVA 3G02A 3CF4G 1QKKA 4BXOA 2VAPA 3I8SA 5BPFA 3CRZA 3DUFB 1E2IA 3HCRA 2IYLD 3KR0A 4CU5A 3GJQA 1ZLXA 1LPSA 5REQB 3U31A 2B82A 3T7EA 3GN1A 1T2NA 5K8UA 3AM1A 4J9UE 2HHLA 2OILA 3NPAA 3CUYA 1E4EA 1W4BA 2FPSA 4QDTA 4MVJM 3R7WA 2H8GA 2O1EA 2PGNA 3FVRA 4GS5A 4DV4B 2VJOA 3IFSA 3GCZA 4HUQB 2AFRA 1VTKA 4JU8A 4RDIA 3U4GA 1CNMA 2GPBA 3QW2A 3VHLB 1IM5A 1XTTA 2X22A 4K1XA 2XHZA 3PCTA 3ZWWA 1I3LA 2Z1MA 1HLDA 3K2QA 2QDXA 4Q4JB 4Z9AA 2IFTA 3TZCA 3ZVNA 1MAHA 3KVRA 3ADPA 5F3RA 3DR3A 5CK4A 3WNQA 4FZ3A 4G4JA 5C32A 1UK6A 4TWBA 1YACA 2LVBA 2Z09A 3ZJYA 1WU7A 4PTLA 4L75A 2NVWA 2QPOA 1A4XA 3ETNA 3QY9A 4RM3A 2DYKA 4N8SA 3IUSA 4BVBA 4BYGA 5KOJB 3DUWA 4QBFA 4DSNA 1QFJA 2BGNA 3FFXA 1QS0B 3SS8A 2A4MA 1YNOA 4BQIA 2MWMA 3GJSA 3LDGA 4Y2SA 1THGA 3IVCA 4YCJA 1C3XA 3PRHA 3U1TA 1A9PA 2Q49A 1AN0A 1KO1A 3R3HA 4JB0A 4N7RA 3ON5A 5F7XA 3CPJB 4GNRA 2GLUA 1PJ8A 3F1LA 4KLCA 3BEDA 4MA4A 1EFAA 1Z08A 1ST3A 6NULA 4E6EA 1VCOA 1FNBA 3I4FA 2EP7A 3SZGA 1P5RA 2ECPA 5KTRA 1KBZA 3W8RA 3UAWA 3BVPA 2D0IA 1UK7A 5EESA 4NYIQ 2BKEA 2AKAB 2QL7A 1MVNA 2OBYA 2IXGA 4PXAA 4OUDA 3IAEA 3E4DA 1BVHA 3K5HA 1FP1D 3ER6A 4MDHA 2NWQA 3LZ6A 3THXB 2CBGA 1L4MA 1PG0A 4XAQA 4YFVA 2FR1A 4O4LF 5AUQA 3AL2A 5EY5B 3AIOA 1JHPA 1DELA 5J4HA 1XEFA 1A2OA 4NDAA 4NHEA 5T6BA 3G5UA 4O3FA 3O4JA 5HZKA 3OLYA 5BY2A 4ZC1A 3PJEA 2QM3A 3H2BA 1J1ZA 3KZKA 4Q05A 2KLBA 1UOOA 2R5WA 5KB3A 4F97A 3X2EA 1L7QA 2IP1A 3HXPA 1ZKMA 3VOAA 4EY8A 5JS2A 1FX1A 2X3UA 3WGMA 1NUPA 3KZ1E 3GARA 5I9TA 3ZNNA 4BBAA 3FTQA 3RVLA 1E99A 3KUKA 1GQFA 5JYEA 1C9EA 5BN4A 1JE0A 2C5BA 2WB4A 4NABA 2JFWA 4RGVA 1VIYA 1FRNA 1X1QA 1P7WA 2J4DA 3BCUA 3H5NA 3L7DA 4G01B 2OCBA 2NU7B 4RH1A 1O5IA 3BTSA 4HZGA 2QZJA 2ZBEA 1JF8A 3OT5A 4TL9A 1QOZA 5EE0A 2BBSA 3UK0A 1D3AA 1ZGJA 3LBAA 4EK9A 3HCPA 1ZISA 1Y48E 3G8CA 1PJ4A 2IYZA 1DC4A 1FVXA 2WHEA 3DDUA 4S0ZA 2ZUCA 1WEKA 3L7NA 3BGSA 4E7OA 2WD7B 3JQFC 4YJFB 2RJOA 2X8WA 3DDCA 4RD2A 3TIVA 3YASA 3U3XA 4L3WA 4AJKA 4IV8A 4WKOA 5HQTA 2QN3A 3KKEA 1Q7GA 4EUSA 3R6LA 2XLBA 5ALFA 5AP9A 4YN3A 4C4XA 3PNVA 5KIAA 1N1DA 3OESA 2WVAA 1CY7A 1ZITA 3DW3X 3R3ZA 3TOZA 3ADDA 2X8BA 3AVUA 4YYZA 1NU6A 4GO1A 2XNSA 4WDQA 2HSJA 3QGMA 2QE7D 3WYBA 4DQUA 2CNOA 2PUTA 4PNPA 4B09A 4C0BA 1YI8A 4OIMA 3AF3A 1GPKA 1UOEA 2I22A 5IDYA 4KOEC 1E1LA 9GPBA 1IAVA 3E35A 3W06A 2WG2A 1O77A 3FUCA 2ZQ5A 4JQZA 1KGDA 2F1JA 2Y1XA 4N82A 5KI6A 2W5UA 4EI7A 4C78A 2DHCA 3DYVA 5JFOA 4J0GA 4LYYA 3DS8A 5DK6A 2XDAA 4EJMA 4RVHA 4EBFA 1IAQA 1SHJA 4YAFA 2AGVA 2ZPTX 3OFJA 1WPXA 5F77A 1TX4B 4GICA 3C15C 4BNKA 4XSGA 1TJ5A 4ENQA 5ICEA 2IIPA 1BXRB 4XR4A 5EFOA 3ABZA 3T9BA 4DDHA 1GSHA 3KWMA 4WPGA 5M7EA 3ZLBA 2WJGA 1Z0FA 2Z5FA 3NDJA 4YJ2F 5AKIA 1BHQ1 4AZTA 3F0TA 4Y6LA 4ASUD 3OQMA 1M1YE 2W2MA 3R77A 4XGNA 1W93A 5HS6A 5IP5A 3TBHA 3K6SA 3T94A 1NQXA 2EL7A 2O9JA 2XE8A 1GKIA 1ZPDA 2A57A 3FSJX 4DDMA 5CX1B 2DHQA 4R98A 2AG0A 1NW3A 5K5EA 5KYKA 4PHHA 4IJ5A 3W4KA 4BJ5A 5JAHA 1ZW1A 5AKKA 1X7YB 5EP3A 2NZXA 4EF6A 2CT8A 4JR1A 2PFGA 1DOAA 2X14A 3GDHA 4JA2A 2PAFA 2VQEB 3D8HA 4KR7A 2IPLA 3L0DA 4J7AA 4JFAA 2EJTA 1B6GA 4EUKA 1C7QA 2FUG1 2J08A 1VPTA 4IX1A 5TB5A 1ZNQO 1EAMA 1K8QA 2XUFA 3A3KA 2OQVA 4GMGA 4QOEA 1GNVA 1O94A 1LPBB 3NNDA 4AX4A 2ZPUA 1NNEA 4MMZB 1Z8FA 4KK3A 4AKSA 1TTTA 3K9BA 2IOFK 1IXKA 2OSBA 3PXXA 5CMLA 3B8HA 1M8PA 3DVLA 4JCOA 4WFKA 1EFPA 2F3RA 1GZ5A 1E3WB 2O8VA 3M70A 2P6NA 4F4CA 4WOKA 1RXVA 3BF8A 3ZWPA 2AN5A 4YA6A 5T6MA 2OBNA 1T0PA 3OQJA 4OB8A 4DEVA 3VNRA 1IB0A 3UQZA 3C6ZA 2VKTA 1QR6A 3A4MA 3SZLA 3CY6A 3ZH2A 4B4UA 1KJIA 1R4NA 2YHIB 3K94A 4CTMA 4AS2A 3FLBA 1M7HA 3DTVD 3KV1A 1L5WA 3CS3A 4N49A 2OLEA 1VLLA 3BK1A 4NBUA 3PCXA 5CVUA 3SC6A 2L82A 2QX8A 4CM4B 1M6VA 2X0IA 3FOCA 1Q50A 2NAPA 3PJDA 2QRVB 3QOYA 3NNSA 4DJFC 3A6EA 1DZ3A 1SUIA 5JMTA 2DPGA 3D1JA 3EWAA 2MSCB 1P6UA 1KRWA 1ANKA 3VVMA 2H8KA 3ESAA 4H17A 1W4LA 4MRPA 3FKSA 4G8CA 3WKBA 5K3AA 3U39A 2QX9A 3S5UA 2OWEA 3WL8A 1AKVA 2WJZB 4DCOA 1TGVA 1EFHA 4M9XA 2HA2A 1F8FA 4R9VA 2F55A 1XRJA 1SQ6A 3BULA 4KQEA 4K8RB 4CJXA 2ARKA 5E1MA 2I2CA 1ULUA 1QYDA 1JALA 4MP3A 2ZT8A 1B14A 1E4OA 3KQVA 5FI5A 3PKZA 1DBPA 1G21B 3LA6A 4X24A 3HKBB 2Q4TA 5ALUA 3B52X 3SLGA 3LX6A 4B35A 1CZRA 4OLAA 1W76A 1JI0A 3QX3A 1A2QA 1YQWA 4YV0A 4TLCA 1C8BA 3IXQA 5A02A 1O9GA 1RYBA 2IDZA 3ZOKA 2HO5A 5KYUA 3F6RA 3KBBA 3IUBA 3TNFA 1G4UR 3IJEB 4DHEA 4DMCA 3QU5A 2XYGA 3O4FA 5BXYA 1ARZA 1J39A 1RE0A 2L19A 2QI9C 4M53A 2AK2A 3PQ8A 5E1DA 1NKSA 5F9HA 5BNIA 1TMYA 2QLTA 4DIKA 2B5WA 3RROA 2O3RA 1UAGA 1BOOA 2B8EA 3COVA 4AO8A 4KRGA 5IW8A 2ZB4A 2V4UA 1ZOIA 2JA1A 3V46A 4HATA 5THQA 3HJBA 1Y1PA 1CB7A 4BFUA 4GOXA 2VZLA 2PSFA 1T36A 3DE7X 4CQMD 4PYLA 5JC8A 3TUIC 1I8TA 3AFMA 3TVDA 4LFCB 1DKPA 5F4ZA 2KS6A 5EHZA 5KO2A 1KO8A 2VJQA 4FYHA 3MBKA 4WY8A 4Z49A 1RWOA 3NEPX 2IYOA 1ZC3A 3B3FA 4AZ0B 1NOIA 3MRSA 4MR9A 1D5WA 4YLGA 5H3LA 3QU4A 4UHJA 5DGHA 4YAGA 1ZK3A 3QX7A 4BZZA 1KDOA 4RTKA 4ZOBA 2B4KA 3ZD6A 1QORA 5AI6A 1IWPB 1J2RA 2HRRA 3VR1A 3PQ6A 1V9CA 1TA0A 3RC7A 3TLXA 1BXGA 3O82A 1T5HX 2PKEA 4HAUA 3G0OA 3ZHVA 4CL0A 2RK3A 3KEMA 3R7AA 1K4KA 1V1RA 5AI8A 4UTRA 3GDWA 1DHRA 3OIUA 3ELUA 3C5EA 1KOGA 2A78A 2EHJA 2R00A 4MV9A 3MJVA 1H23A 5ALGA 2XTZA 2Z2JA 5DYTA 5K3EA 4LZNA 2EKQA 2SNIE 2O7SA 1EFCA 3OT1B 5BXQC 3OPQA 5ALZA 3OU7A 2PRYA 2OBBA 1YK1A 5EKXA 4Q3LA 2ZJ3A 3A3OA 1L5OA 1A8QA 1V5GA 3CSUA 5CW1A 1BQ3A 3DHYA 1HNWB 2NOAA 4CKXA 4ARAA 2R47A 1UBSB 1WVGA 5KOHB 5KSWB 4NEGA 4RK7A 4E2YA 1P3Y1 2Q1YA 1UKVY 2EZ8A 5BSMA 1BX3A 4I3HA 3WGLA 1Y3CE 2OLJA 4OLJA 4PFKA 1PWEA 1W2WB 3Q3EA 4MVYA 4PAOA 2JLYA 2ZT7A 3I42A 1XTKA 2DPYA 4DQLA 2GH1A 1WW8A 1Z0SA 1ZUD1 2ISSD 3UATA 3KQHA 1YL6A 4AFNA 4EB6B 1H9CA 4M6WA 3GG9A 4LV8B 5KNCH 4TV9A 5AJYA 3ITDA 3EYWA 3P9NA 3IAXA 1RS0A 4I0WB 2YASA 1QYRA 2Y1DA 3JQ6A 4M1EA 2Q6IA 3QG5A 2W2VA 2Z3WA 1QJCA 2NV6A 1M2HA 4OQMA 4DCJA 1CUGA 5D7NA 1XUOA 3UMGA 4HTFA 3T9DA 1Q6ZA 5DWDA 2RHTA 4FQ8A 3O8RA 2DT5A 3SZMA 2BFEA 1QDUA 4AXXA 3HXOA 3TM5A 4UC0A 1NG9A 3IHLA 3FPHA 1I36A 1GZUA 1WVMA 2AR0A 3IEUA 2LD4A 4HLDA 4L2IA 5J3JA 1VP9A 4CFYA 1UCFA 3QFFA 2OP1A 4UUBA 3O9MA 1MH9A 1E5TA 4HG2A 1UKAA 4M55A 4IWYA 3DEJA 2DUMA 4YP7A 3K2IA 1L4BA 4FYXA 3FPSA 1GG9A 1E5QA 1PP4A 3L6EA 1PQYA 2FPLA 2VLIA 2ZIZA 3B9BA 2ONZA 4MYRA 4O4JA 4P81A 1ODFA 1Z5OA 4LV6A 4YAJA 3OJ0A 3CNEA 1J0BA 3PXEA 3JASA 3HVHA 2W6ID 3GROA 3A4TA 4FD2A 3ZQUA 1DARA 2MIIA 3A10A 3C6KA 5LBIA 5EAIA 1MXHA 2ZW9A 3IIMA 3KZVA 1BD4A 2SBTA 1E32A 3NT2A 4GX5A 4PY2A 3ZNPA 4DG8A 4GL2A 1TOAA 3W5HA 2R5NA 5CDFA 2EXXA 3ZBUA 2LV8A 4FSHA 2B1GA 4UU1A 3STXA 2LCQA 5H7XA 1NLUA 2YX1A 1P9LA 3ZUGA 2ZBRA 4AP5A 3RYTC 5DBIA 4NPAA 2WKWA 2IXBA 1IWOA 3THRA 2R1ZA 1RKBA 2IX3A 1X1CA 1SEPA 2RGUA 3MTQA 4NOKA 4RL6A 4MZDA 1W0KD 2IELA 1Y1KE 1FRZA 3X1KA 4EENA 5A62A 1ZJWA 1H94A 3BJIC 1AQLA 1HDCA 5CCBA 1S96A 2XX3A 2C4TA 3ZGOA 4CU2A 1E1RD 1G17A 1H2YA 1RPJA 3BQNB 1MC8A 4TGLA 2ZRMA 3QUCA 4CMKA 1FQOA 3ENZA 3WLTA 3NP9A 4KGVA 4BMZA 4DLZA 4W8GA 2FOXA 1PJBA 4HEQA 3BSYA 5A1JA 4Z0HO 2O3JA 1GRVA 5IC5A 4RD4A 4CG2A 2LTAA 1EX1A 2WF5A 2YWGA 4G37A 2PFKA 2VH5R 3G2LA 4I81A 3GP5A 1QGYA 1JEAA 3GFOA 3MBOA 3PUKA 4IHQA 5E0KB 4HDNB 5F35A 4EQ6B 4NCXA 5F98A 2Q5LA 1BJKA 3M5PA 2FE1A 4TVSA 3N2YA 1G5HA 3WP0A 4P4TA 1FDSA 4S2UA 2GYYA 4EGQA 4EJ2A 3L8HA 2PPVA 2Z58A 3EG9B 4K26A 3R09A 2XUIA 4HWPA 4IV5A 5I7RA 2OV3A 4JUBA 4ARZB 1JNXX 3OE1A 3DTYA 1ONSA 4B7UA 5CBKA 3J7TA 4OGWA 3TSWA 1NI5A 2O0HA 3A0UA 4XCVA 4YAKA 1DWOA 1NZJA 2RSLA 1MNAA 1K8ZB 4AXBA 1G8YA 3RF7A 1GYPA 2P77A 3WQRA 1BEUB 1Q7EA 2ECKA 4IVNA 4YV2A 1W5AA 2OM2A 1FP4A 1SR8A 3HFRA 4X93A 2OA0A 2WSSA 3B5JA 2NO6A 3H0KA 3ZVLA 2RK6A 1GAJA 1N2ZA 3DBHB 4QUDA 1IM8A 1YSCA 2NACA 4JJAA 4KUGA 2HBQA 2F17A 2O54A 2IEIA 5HWSA 2Q3DA 4NU5A 4JMLA 4TMFA 4H7HA 1P2DA 1YZTA 4Q48A 1EG7A 4DNFA 2XCLA 3GLGB 1C0PA 4LWPA 2WUDA 3ZWXA 4MLDA 2YVKA 3FFAA 1G18A 1XVIA 2IE0A 3EOBI 3T3DA 2XOKD 3WLKX 1TLFA 3BORA 3HL0A 3QXCA 1YCDA 3FNBA 3T3MB 3WWYA 2P6OA 4IIDA 1MT0A 2D5CA 1XA4A 2ZRGA 2A33A 4BS9A 2D54A 2PO5A 1RWBA 2GTHA 2UYQA 4EIWA 4FE3A 1GDHA 2F8TA 1LFAA 4D3SA 3RIYA 5BMVF 4DV3B 4HGOA 1NJ5A 2FRXA 3A6ZA 3DL0A 3WLAA 5B30A 1H8ED 3ANTA 1N6HA 5IT5A 3V32A 3E58A 2ZWPA 3IDOA 5FTKA 2C2MA 4ZJPA 1NL3A 1L8QA 2OBMA 4H77A 1BA3A 2VP6A 2Z6VA 3C2QA 3PGJA 3W6NA 3EC7A 4OM7A 1FX0B 1OA1A 2YYAA 3WB9A 3OQOA 1RRMA 3RC9A 4DBLE 3TGPA 1SXIA 3WYDA 3E61A 3N2IA 1RVV1 3BTOA 2Q4DA 3I45A 2CFIA 3PK0A 3C0KA 4L9RA 4YCSA 1W4AA 2VRBA 3FR8A 4UARA 5I8ZA 3T7KA 1YBVA 4H6WA 1L1RA 1C9KA 4KWIA 5CXSA 5H81A 4BBJA 4C1BA 1NYRA 3EEIA 2O8CB 4DSUA 2QU7A 2ZUTA 2JH9A 1WSDA 3LLSA 4RK0A 5BRAA 3SEQA 3DCYA 1CRZA 1MFZA 1PJTA 3CUKA 4O1IA 4RJLA 4Z4CA 4DR3B 4EMUA 1DAEA 4RPHA 2B6HA 1ND5A 1ZSVA 2B8TA 5FEMA 4ZIRB 3EFBA 5LD2B 1WQ1R 2IF2A 1USKA 2LBPA 5FIUA 3FNFA 1G9TA 2QR5A 3M83A 4EJ6A 1KJ8A 1H0KA 3GFBA 2HSZA 5AVYA 5AJWA 1DV1A 5B4TA 2IH5A 2I2DA 5A1TA 1VG9B 2FKAA 1DCKA 2XAUA 2QYOA 4PYQA 1ECBA 2O1WA 2R4TA 2G0AA 3F9IA 4B45A 2WKQA 5T57A 4S05A 5BSUA 2P9QA 2YHSA 1ESMA 4EQZA 2FMIA 1GPYA 4E5VA 1M0SA 4AULA 2XUQA 1C8KA 4NAUA 2WSIA 3N2KA 3O2SB 3BIWA 4Y1FA 5BOSB 1KDVA 3IJ5A 5CDTA 3U7RA 1Y82A 2C2OA 2MSLA 3RIGA 2AMJA 4HZUA 4UREA 4F6CA 2AI2A 2VZEA 4IGIA 4MULA 1TM5E 4I8IA 1JHVA 1XJQA 3COZA 3MBIA 1WCV1 2J0UB 1N2BA 3GJTA 4WK6A 5BWLA 4KR6A 3DWIA 3R40A 4JC0A 1B74A 1CE8B 4TMZA 1AO3A 3IBGA 5H02A 1ITZA 1DCTA 1MU0A 3IQZA 2NXCA 3PXBA 3BXOA 1JNYA 2GAJA 3CUVA 1L7RA 4EPXA 2Z3VA 5T4EA 1J42A 2ZIFA 3T5TA 4OHBA 3AWDA 5HIIA 2DSTA 1Y89A 3QV1A 1EVZA 3KOMA 4W5QA 1WBDA 3JWPA 6ABPA 5LN1A 2D8AA 3U44B 2IXFA 3LF1A 2RARA 1JQEA 3L8EA 4OHCA 2HSEA 4N5DA 1ORHA 2PL3A 2PNFA 2JGLA 5HKBA 4GLLA 5KYVA 3ETDA 2R7LA 1P91A 2Y0PA 3NIDB 2H9AA 1N1MA 4CT5A 5ARBA 4XOIA 5KJFA 4I46A 4F2HA 1E4YA 4YJGA 4BV8A 1Q1QA 4CLRA 4Z4IA 5M34A 4MS1B 4L95C 3OZTA 4J94A 5TMDA 1Y5IA 3KO8A 1B8NA 2BHNA 1HDRA 3PDCA 1LZKA 4GH5A 4PQGA 1PD1A 3QEJA 1YONA 1I3NA 5K7SA 1H0HA 1YVRA 2J3QA 4UNQA 3OZBA 2G8NA 1T5IA 1EFTA 2JLQA 3PUWA 5LFAA 5JDIC 5FLKA 3QTLA 3PGKA 1L9XA 4YRQA 4G0MA 4GMHA 3ZGZA 2F1OA 3TTTA 3TLAA 4IZHA 4ZCQA 1KEPA 1OBHA 1NC3A 4YROA 2SCUB 3BK2A 1N25A 4FUTA 3N9IA 4XQ0A 2V7QD 2GDJA 4Y3UA 4ZODA 3SCZA 3KFVA 3ESCA 4A82A 4Q1DA 3L6BA 4RENA 2EKZA 1WDTA 2JJ2A 3BMCB 3C6MA 1NBMD 3I2JA 2COUA 1SUWA 4X8MA 1V5FA 2HXYA 1WEHA 4NLLA 4CQJA 4ZYWA 4YASA 3O31A 2CNKA 1FRFS 2HDOA 4R1NA 1GYRA 3KVVA 4A10A 5EIAA 3MS2A 1RQ2A 2DFLA 4HNGA 4KLRA 4DDWA 1T5LA 3AG6A 4NHOA 3WFZA 2GWHA 3MTGA 3E9CA 1R0ZA 4V39A 3EQ8A 1O9BA 5ES4B 1Z6PA 3ZD9A 2YINC 3AUXA 3VO2A 4BC1A 4NS4A 1LKZA 1EP1B 1F8YA 1M1NB 3Q3HA 1GA4A 1OLXA 1B8OA 1I4EB 2DAPA 3C5WP 1MABA 3ZJTA 5EWJA 2ENWA 5DHTA 5D8DA 3G2MA 2UZ0A 2I34A 3IBSA 1C9JA 3H4IA 4HSGA 5E95A 3SS7X 1KKUA 3MAJA 3U48A 3UT5B 1V6AA 4IQ4A 2PM8A 2R8PA 2WJAA 2Y4OA 4M86A 4YUVA 3UVEA 1WMBA 3KT8A 4ZVOA 4G0NA 4V38A 1RJGA 1W96A 1JT9A 3HEBA 4QDUA 3ZWBA 1RZRD 2P78A 5FWYA 3CB4A 1F8XA 3LT0A 4EITA 2CVPA 1ZN2A 1LSJA 1UDAA 1LRJA 1V37A 2ZRIA 1DWQA 4JQYA 5JD4A 1TT5A 4MR7A 4TSKA 5KDLA 3W90A 3K6RA 3W2IA 2QMZA 5DVZA 4WJLA 4B8YA 2Y0DA 4TYYA 5AW1A 1N6KA 4TYPA 4AB1A 5AOCA 3EJ6A 3Q3VA 3S2UA 4JP8A 4YUAA 1BCSA 2DBZA 4XLLA 1Y8AA 4V1CI 3VOSA 4B3CA 4FINA 4P7FA 4WOJA 3LLCA 5KSOA 5DYIA 2QLJA 4S2EA 1Y7PA 1MW9X 2GPYA 2OZLA 3OCYA 5CGZA 5HP4A 2VQ6A 5KOIA 1VL5A 1FP7A 3OLVA 4OSEA 2DBYA 4N18A 2IYYA 3FCUB 1DBSA 1UDBA 1GGMA 1J2UA 2Y6UA 3KK0A 3IR7A 2CFOA 4TMYA 4DCNA 1R0BA 1GY8A 1WOMA 1YIOA 2A35A 2ACEA 2H0QA 5ICMA 5HTOA 3ZV7A 3WA7A 4RCVA 4E1BA 4F3CA 4RA9B 5K3CA 3EA4A 3CURA 2OB1A 3ZCVA 2QPLA 3RUIA 1TCUA 3JQAB 3SQNA 1QTIA 5EMJA 3GD5A 3DC7A 3BRWA 3DMNA 1HE3A 1RW4A 3GA7A 3VNVA 3NAGA 4TS3A 2ZYTX 4ZCMA 3P32A 2JIDA 2HB6A 4DUGA 4ENSA 3DQZA 1VL0A 5ALRA 3IDZA 1X15A 4JIMA 2XKJE 3IHWA 3RQSA 3TIIA 4BBPA 4C4RA 2O4UX 3TQFA 3GLFE 5KUTA 1NVTA 4QASA 3PD1A 4XX0B 1I3KA 2CXNA 3TXYA 1MEOA 1YB1A 5HKKD 3TAHA 1SKAA 4CQNA 3HCWA 4HXEB 2WJVA 1QG4A 1B26A 5CVJA 3TG8A 1FEZA 1OFGA 3IMKA 3AHEA 1KNXA 2A88A 1GQ2A 4CLXA 3KOOA 1F2TB 5GJWC 5JEEA 2I1QA 3D6JA 4MYDA 3U3ZA 1A96A 3GRPA 4JLJA 4B7ZA 5TEWA 3K0FB 4JLPA 4WLEA 2IBMA 1XN1A 2Q6TA 3GEHA 4P3YA 1KFKB 4I55F 5TT1A 4YIKA 4R2JA 4TT3D 1PX2A 5FOVA 5IASA 4P80A 1JZQA 2XUHA 3GJRA 1B2RA 3GJ7A 4H27A 1CQZA 4TKVA 1ADGA 1UEJA 5CFZA 2HJVA 1Y7TA 1TEVA 3H05A 3ML1A 2W22A 3W5CA 3NHKA 3M6LA 1VPEA 1H85A 1S5PA 3BB3A 4HN4B 5BVGB 5HRAA 1DFGA 1E63A 1NOKA 2GASA 4PFJA 2C0PA 1PJSA 5AI0A 1I24A 2HLDD 4G5SA 1ESEA 3NONA 3K1JA 1WXXA 1AHPA 5A4KA 3GYGA 1KRHA 4FCVA 4OQQA 3KETA 3S4YA 3O21A 1JEDA 1PZFA 4E33A 4RD0A 3QJGA 2FVXA 3PYXA 2I71A 4BMOB 2IU6A 1Y8ZA 2OOSA 1DAKA 4FC7A 3OOWA 2P6PA 3VR0A 1GZHB 1Y4DE 1AURA 1T4GA 3LY9A 1W88A 1UPUA 4D4MA 4DCPA 1Q1GA 3T9EA 4JKIA 1E9DA 3D4NA 2ZR8A 2DHEA 4J7XA 4XSVA 3V8MA 3JQGA 3KPWA 4NE2A 5MN5A 5DXJA 3RD5A 1PI3A 3WTCA 1FU8A 3R2JA 2ZB3A 4BO3A 1EINA 2PE5A 3CG4A 3OTGA 2DERA 3FBGA 1ZEJA 3ZIUA 4YMTA 5B58C 3SN6A 4KPUB 3D4IA 2B9EA 2W8BB 3IQHX 2RGXA 3AUYA 4P3OA 2ZUBA 4W4TA 5FA6A 2WWYA 4UBNA 3BYZA 4M8LA 4QRHA 1J90A 1QG6A 4V24A 1SUEA 3WZLA 5DHQA 1IQ0A 3D6MA 3CKLA 3LX4A 2E21A 4JDUA 4ZEXA 3WDLA 5TR9A 2GK4A 1NJGA 3GL9A 3BN3A 4QHSA 3ZN2A 2NVUA 1B2LA 4E0BA 1OWOA 1W8IA 1XRQA 2R6AA 2O2GA 4C76A 3B82A 4YRBA 3FCEA 4UE6A 1XZDA 3HBAA 4L16A 2Z04A 4L8VA 2CNBA 3SLKA 3VAZA 2HDNB 4BNIA 1U7HA 3NBMA 2GRUA 4II2A 4RHXA 3STHA 1R18A 3AOEC 5ITWA 1Z5ZA 2FLKA 3DQQA 3ORRA 2V7VA 1G6KA 4I1RA 4LZJA 3DD1A 2HL6A 1LCIA 1OTXA 2QUJA 5CLHA 5DDIP 5EZYF 4ND8A 2ZANA 4UKDA 1U1IA 1Z8NA 2VPTA 2JGRA 4WJKB 1FDWA 3GPDG 2AJCA 1X92A 2EX1A 2HLHA 3LX5A 3HO1A 2HRCA 4RS3A 4DLKA 7REQA 1E3EA 4U9HS 1V4NA 4RH3A 1SKUA 3T9CA 5A0VA 2LGJA 1JIVA 2IYFA 4O0MA 4OJQA 5FA8A 3A05A 1ODKA 1LSSA 4JLAA 5C1DA 1CQJB 4RV5A 2ZUFA 2ECOA 1HEIA 1WTCA 5EPEA 5L4LA 5FBWB 1TKCA 1R5JA 2P75A 1SB8A 2Q07A 2H0AA 1YQUA 2XA2A 3CJQA 3E05A 3LPMA 4HXYA 1CNFA 1RI5A 4CG1A 1ZJJA 2ZJOA 4R9UC 3Q12A 4Y6QA 5AD1A 1OFVA 4DREA 4KC0A 5HVNA 2D0DA 4I2NA 4MB0A 4DY6A 1U3FA 4R1SA 3RJTA 3JRWA 2JGDB 2PKQP 3FB1A 1KVRA 1GWNA 3AVXA 3IL2A 2Y0EA 3EQ6A 1YZ3A 3W2TA 2ZIEA 3GQVA 2MSDB 4R8SA 3HM2A 3OOHA 3ASZA 5B1HA 2PX0A 4IIEA 1WLSA 2BFBB 2P5YA 4DIUA 4OXNA 3TTYA 1TQ6A 1B0UA 3U3MA 2V8OA 3M6WA 2VHVA 4WEQA 2QW8A 3VU8A 4OXQA 3KVYA 3BWEA 2C7GA 2PXAA 4HF7A 4NENB 5IUKC 5KNBD 1SD1A 2JHAA 3MJDA 1UBLS 2HJHA 4REQA 2ODWA 3WL3A 1I1QB 1OYVA 2E4VA 2PDAA 2R6DA 3P0RA 3P2EA 3ED1A 3WOVA 4A8TA 1NT4A 4K3VA 4BP8A 3VUFA 1MORA 4BNJA 5AVQA 2H63A 5IFKA 2YFYA 2RJ3A 2AD1A 1H1LA 3UHFA 2X0EA 4ERNA 3CTPA 1F3OA 3HABA 1NVVR 5CFRA 4PZEA 4N0MA 1AB6A 5GZ6A 4I66A 3MAAC 2R1VA 2B4AA 3X1WA 1PS9A 3HDTA 1NA5A 2IZ0A 3FOAA 3CLRC 2FK8A 4GFDA 4LUCA 4D9MA 2I2AA 1U7WA 2C94A 5JCJD 3BWDD 4NU6A 2AFHB 1VKRA 1SVWA 1U3UA 2LWIA 2VP3A 5A6SA 2WPDD 1DEOA 5DF1A 1JR4A 2YWFA 2HA7A 3ICQB 1NUSA 4DR1B 4OHMA 1GRNA 3RG2A 2CYCA 3WAGA 2B4TO 4IDBA 1THMA 3HI4A 2P2ZA 2PLAA 3C3EA 2WU1A 2R11A 3PQDA 5LP1A 3FOWA 1FS5A 3V8RA 4G85A 2QTZA 2I7CA 4ZEMA 1GG8A 1S3IA 4CKCB 2B2NA 1D4FA 1EFRD 1X3LA 2YDXA 4LJLA 4OHUA 2C29D 1QVVA 2XECA 2BH9A 3OFVA 3RABA 3ANSA 1QH8B 1ZM9A 2CLCX 3RR2A 4GNKA 3HA2A 3PFGA 4EB3A 4JFRA 2Y93A 1UBTS 3HCDA 5LZ2A 4ABTA 2DWCA 3ZKWB 3ASUA 1QV6A 1IUKA 4O2BB 2O07A 3UKJA 4F1WA 2UZ4A 3F49S 2C5AA 3FAKA 4ZO9A 5SICE 3WGYA 1SZDA 1V95A 4EWLA 4QDXA 1T2EA 3NAQA 5FV4A 1CCWA 3EZXA 2ZTUA 1JFRA 3LBYA 4G56A 2E6UX 1L7PA 1U02A 2OQRA 3PQEA 2JF0A 4PO9A 3A31A 2UXBB 4RDHA 4WZAA 3B2QA 3NM4A 2H7YA 4GI2A 4JQOA 5DTEA 1SC1A 2QN9A 3D54D 2FSVC 3OX3A 4B31A 4EKGA 4RLSA 3I0MA 1RJEA 1JQ5A 3COYA 4UDXX 3VQTA 1QVWA 5AVKA 1QE3A 2YZ7A 3AGPA 3JWHA 5JFTA 2FY8A 4GYYA 1F5NA 4N5MA 2PKYX 1FW6A 3JVEA 3H7IA 3QX9A 1F2UA 2JFNA 2WZBA 4C04A 4KN5A 4L5CA 1WZUA 4FGWA 5JS8A 2FWIA 1FL9A 3KQOA 2MJLA 1BWPA 4JI3B 3M7IA 1Z4IA 1Q3HA 1UJ2A 5DBOA 3VDQA 4K9QA 5HMLA 2PSHA 1DJPA 1TCVA 4HFNA 3LPNA 4UQPA 1XA0A 2EP8A 4U7HA 3QM1A 3U0BA 1QC5B 1Z22A 4DTIA 2XT6A 4JENA 1LEHA 5KNCA 4U7DA 3HB4X 3GHHA 3EVTA 2B7BA 4JB2A 1A82A 4CW7A 4FOLA 4D8TA 3ESYA 4FFWA 4F5ZA 4FFPA 1ORRA 3RRNA 2EJUA 1GU7A 4KR9A 2N46A 2OVFA 2A1TR 4HJRA 3DOHA 3OAAD 1Z5WA 4R4JA 1NXTA 1JDJA 1QGUB 3GO4A 4MGEA 2VF8A 4PCUA 3RYHA 4E4YA 3D6NB 1W36D 4EKIA 5G0WA 3UPTA 5H4GA 4GDMA 8OHMA 2G04A 2XQIA 3R0ZA 5B1YA 3IQIX 4H7KA 1E3IA 1N9KA 3N6RA 4DYDA 3UMMA 1WOYA 2J7PA 4JYAB 2WAAA 2Z0MA 4J3JA 4DJTA 3L8CA 4EYGA 2XZDA 2AMYA 4QT4A 2E55A 3P2OA 4CODB 5BQFA 3RDPA 2VXYA 3RC2A 1U0JA 5REQA 3OTIA 1PV4A 2Q2WA 3OCJA 4LTMA 4MQFB 5J4VA 5IXJA 2VPZA 2PS0A 4FX5A 4EMBA 3OF5A 4GPIB 4JJ8A 3UJAA 5AKGA 5JS6A 2FDRA 3N70A 2P9BA 2KW5A 3I2FA 3H11B 2VCYA 5ALKA 2EW2A 3E2MA 3TW4A 3UIEA 5L3SB 2B6NA 1U5BA 3RSHA 4OXYA 5KTOA 4K6FA 4HQRA 1WCIB 3ZV5A 2VJDA 3ZNQA 4HGNA 3W9BA 3EDYA 2Y99A 2JIQA 3RASA 3LGSA 4K3UA 3ILHA 2CXOA 1KEKA 1XAIA 2QUZA 2R5FA 4KIUA 3O03A 3JTEA 2FFHA 3LXUX 1T5DX 2ONKA 1JKIA 3K1YA 3L0SA 3PSHA 2Y67A 1T6BY 1RLIA 2JASA 2X4LA 1HURA 2F1RA 2ZSEA 1H4VB 3UWPA 1EXWA 5KBYA 4CV3A 1R66A 2FR0A 3IIKA 1GGJA 2PA3A 1QS0A 3O9VA 3PB3A 4M7OA 1F8GA 2WJHA 1I80A 4JBIA 1E60A 1EUCA 1ISPA 2XF2A 3OJLA 5G0VA 1U3VA 4HDCA 4AF6A 4W5TA 2XGJA 1FW8A 3P0HA 3UF0A 4A0HA 2JJ1D 4Z2YA 5C80A 2CV1A 1CHNA 4YRLA 5I4BA 2WQ7A 5E6SB 1OD6A 1A5ZA 3RS9A 4BX2A 3TVTA 5LQCA 2BH2A 3NDPA 3N76A 4QEKA 1T43A 2UUPA 3G59A 3ZWMA 1VL1A 2V03A 4X60A 4OI1A 3M5DA 3UXMA 4P0PB 2ZTVA 1ETHA 2MYNA 1HRDA 3V1YA 3TG2A 1NLFA 1WV1A 1E2NA 2YN0A 3GN2A 3N0RA 2Y0BA 2Z5VA 1G2OA 1JIQA 4G81A 1CR1A 1XYGA 5G53C 3VSEA 2ROQA 1Z63A 1Z75A 3KL4A 2B1RA 1GXSA 2ZBFA 3ZCRA 1EJ6A 3BOSA 2ZUUA 5FCDA 4TT8A 1LW6E 4UBOA 5IC4A 1UJ5A 1QVRA 1GQOA 1VM6A 4W99A 2QAGC 1OT5A 3B9QA 4S1WA 1F12A 2EJCA 1KSGA 1R6TA 2WWFA 2AC7A 3NHRA 3I1JA 4K03A 3AJ9A 1LSUA 4NCKA 2IWRA 2FMFA 3SM3A 1ZHOA 1UEXC 2EYUA 2F90A 3L9XA 1JTEA 3TJZA 1A97A 3NHAA 3QNUA 3F96A 2XB6A 1TAQA 3FYHA 1FFHA 1C9NA 4HAOA 2Q6LA 2YL2A 5HQ3A 2P90A 4K9DA 1SHUX 4AZSA 5JZMA 1Q6YA 4IMIB 4PQEA 1Q57A 3T41A 1J06A 1UJ4A 4OIFA 4MGHA 1YFZA 2ZYRA 3HL4A 4MXDA 1E2FA 5HYVA 3EMDA 4QWWA 3F5QA 5A06A 2B0CA 1BA2A 3H8VA 1NG1A 1P0IA 4PLCA 4GVLA 4TTJA 2YS7A 5JC1A 3FYUA 4CEIA 3VYVA 1KF0A 3F78A 2C84A 3MCZA 4OH7A 3ZKAA 3CZPA 3PXDA 1K6XA 3O3OB 1OROA 1ZN9A 3E9YA 2OQIA 2BM1A 3FLAA 1YA6A 1DKNA 4LRSB 1RQGA 4UFPA 7GPBA 5HZHA 1O8BA 2E3JA 3CWQA 1UQRA 3EK2A 5TARA 4DMFA 4Q5IA 1ETUA 1JJIA 1PQUA 3IP9A 1C30B 4CLDA 1MV5A 1T1GA 1TIKA 2NXEA 1Y6QA 1T8RA 3DZGA 3L6DA 4JLBA 4LECA 4Y0NA 4YJFA 3PXGA 5CVCA 2HRDA 3HYLA 4BWYA 1H05A 3RWBA 4P2GA 3PC3A 5GADl 3B6KA 1DXYA 1LDEA 4NDZA 4A8JC 1KFBB 1Q0TA 2OYSA 1WXFA 3FUUA 1U4OA 3VAYA 4K5QA 4L5AA 1IJFA 1I10A 4H08A 2HA6A 1QQTA 1M10A 2HU2A 3KFLA 1LLDA 1WKCA 2W93A 3LQYA 2IDKA 4M8KA 1AZWA 2ZIUB 3PHLA 3PZRA 4B2PA 3QKTA 4RMGA 2I2FA 4FOOA 1KY5A 2E5WA 2H00A 2Z3ZA 1PUIA 1JQ3A 2FSPA 2XGMA 4O0LA 1OILA 3OCCA 4B3TB 4M1QA 5HM6A 3H65A 2Y3IA 4V2IA 1R12A 1TAGA 4BUZA 2OL4A 3WK7A 4RTSA 1AS3A 3UGTA 4AS3A 4UHFA 4F8YA 1DTEA 3WQBA 1ECJA 3ZJUA 5L7YA 1FCJA 4NCBA 3KWFA 2WP0A 5DIZA 3Q2IA 1PV2A 2WVGA 1E9EA 2DU8A 3DMTA 4WDRA 1Y8RA 2GEKA 1ZM7A 3MRVA 5BT8A 2Q45A 1MOZA 2DFVA 3H6HA 3R5JA 3NHPA 4FHZA 2FYTA 4KFCA 2O2HA 2PZEA 1UZNA 2BMAA 3QXSA 3KDSE 1F6WA 5TQ0A 2OCAA 1UMBA 4ZT4A 5FO1A 2WP8J 5GV7A 1V7QA 3ZY3A 1BWSA 3RRXA 4DAOA 3WK8A 1XVLA 3GFRA 4NVRA 4UAGA 5JROA 2NTYC 3HMQA 1AGYA 2XCQA 5EE3A 1RWWA 1VYUA 5TVGA 1GNPA 2E1PA 3G23A 2NLOA 2EJWA 5EEHA 3ZHQA 4RK1A 1C81A 4WXPA 4JEUA 2PSEA 1NE7A 1SKQA 1X7YA 3T0GA 4AJPA 1YJ8A 3NYWA 3WV5A 1K2VN 1GR1A 1H42A 1QTNA 4FMDB 4ZEWA 4ES6A 5JAOA 1NKTA 1UFOA 2ATXA 1OKKA 2OCPA 4XVQA 5IF9A 1YS4A 5JSZB 1UMDA 4EUFA 2D13A 4BJHB 1XZGA 2MR5A 2PUDA 3H8SA 3A1NA 5BSWA 5K0SA 1N5OX 3E9DA 1FSFA 4N9QA 3CVVA 2G25A 1U8ZA 3UWDA 1JI3A 4FHDA 4TN1A 3H2KA 3I1IA 1E7WA 3IOYA 3WQSB 4O8ZA 1P4GA 3RBAA 1YJ5A 4LF9B 3WSWA 2F4VB 2YIVX 3AKDA 1WX1A 2LUOA 3OM9A 4LI0A 4CF6A 3IKTA 4DM4A 3FSRA 3AU8A 3OO1A 4PXSA 4RZSA 3AFGA 3EHDA 4L72A 3I5YA 1I94B 4ZDJA 2E49A 4E3WA 2YXEA 2VBFA 1DAGA 4L8WB 1R64A 4Q4HA 1HX7A 3QXJA 1P7CA 2UZ3A 3BCRA 1QMPA 1WMDA 1EZ1A 4HRVA 4LZOA 3TLGB 3RO7A 1JJAA 5ILOA 3UJHA 4HNSA 4A36A 2XVMA 1P2TA 2BTQB 3R0XA 3NOOA 2XCSB 1ZMBA 2WD9A 3GLRA 4N5HX 2DC1A 5JH7A 5K6AC 1ULBA 4DSTA 3MNFA 1ZH8A 1RYHA 2J9FB 1QAQA 3AR4A 3PIIA 4HEA6 3ZEIA 5TF0A 2K2WA 3L7KA 3VR4A 3KQKA 2VYND 2J09A 4CM4A 4B85A 4B46A 2QQFA 5FOWA 2QRVA 2VZ0A 3I76A 4NMHA 3L6CA 2D6FA 2JFGA 2OUIA 1NJ2A 2AE2A 2GLTA 2P2CA 3DFFA 2QA5A 3GEMA 4KNVA 4AO6A 4ARIA 1CUEA 1L8OA 2UYGA 4N3AA 3M82A 4OUKX 3L7AA 4FZ5A 2V6GA 1D2MA 1AHHA 4QBIA 5BSKA 4LF7B 2IU3A 2R8BA 3JQ8B 1SIWA 3BIJA 3ICWA 4N6OA 1I7SB 1YMQA 3QXHA 1ENYA 3WIDA 3KUCA 4ZP1A 1XEAA 1D6MA 4BB0A 2JAQA 5EJ4A 2JLBA 5DB4A 3UJ8A 1CRWG 5JNTA 3WRYA 4C4OA 3FF1A 4DCSA 3E0QA 1GM5A 4KN6A 1LBHA 5E3IA 3HFJA 1U65A 2VHWA 1KQNA 3TE7A 2YC4C 5BUSA 4PV7A 1A9SA 4CWAA 2J85A 2PZGA 4BJ3A 3IX7A 5BNWA 2R6JA 3FFTA 1N3BA 2G7MC 2N1MA 3MT8A 1O03A 3PWSA 3UG7A 4KQMA 3WHPA 5C1OA 4IRXA 4E12A 4RL4A 3AOGA 1NI3A 4YWHA 1O94C 3OTWA 4BFXA 3UQYS 4L78A 4QODA 3WFIA 2C1XA 2C78A 5K1ZA 4F12A 1F0YA 5JV5A 4OQNA 4GWKA 2BMDA 1C14A 2WIBA 1E9RA 1JFVA 1VECA 1G8HA 5CEFA 4OD0A 1QIHA 4LK3A 5ALTA 3E3LA 1CERA 3LBIA 2OAGA 3KHUA 4Q03A 1K3TA 3VR3D 1XZMA 4GECA 5U1PA 1VSTA 3D7SA 3GR6A 3K9LA 4GF5A 1JR3A 4FW9A 2QLMA 4BJ1A 3NTUA 4R2HA 2I4MA 2Z1NA 3P2MA 4U2BA 3L4BC 4TSFA 1C1DA 1ZCAA 1KMHB 3S2ZA 1KS9A 3SYMA 4QFDA 3MJRA 4AZ0A 4CDMA 3CXRA 3U5ZB 3OQIB 4P31A 4I1IA 1EUYA 5CA0A 1SPXA 2RCNA 4IL5A 1UPBA 1MB4A 4NZ9A 4Q3OA 2VPWA 3C85A 3KUUA 1F60A 1Z28A 2I76A 1DMRA 3D31A 2OTCA 4C7XA 1M6EX 2Y76A 3LIIA 4HEHA 4R2KA 4B3XA 3SP1A 2RONA 2ATCA 4JL5A 2OFFA 3QFHA 4OK3A 1A9XB 4Q1VA 1WTAA 1ODJA 4ZU1X 3CIOA 4YRJA 2KJQA 5EGSA 3WMRA 3N8DA 1KVTA 4KGDA 1UDCA 2I7DA 3QFCA 5TQVA 4BRWA 4JP2A 4D4GA 2OCIA 1X9IA 3A9SA 2J6BA 2ZZNA 3NXKA 1FMTA 1OV4A 3BGIA 1XTVA 4MV4A 3IE0A 4DV2B 3P26A 2P9GA 3UMJA 1W47A 3OZCA 3H13A 4OQEA 2IPXA 3SM9A 2QV7A 4N0EA 1QRSA 2QY9A 1KJJA 2QTNA 4F3YA 2X7JA 3QLEA 1Z4OA 5G4KA 4EPRA 1EFUA 1L4KA 4GLFA 1BNCA 4M1OA 4LHZA 3USES 1DBIA 4L9SA 3SYLA 1U9YA 3PR1A 3LJKA 2Q3HA 1JLKA 2JFXA 3PUYA 4GGPA 3CX8A 4JQSA 5FL7A 4MAFA 4K2HA 5HFAA 1QHHB 2WM2A 1DS6A 3AZOA 3K1ZA 4HVAA 1CY4A 3DTVB 3ESXA 3EDCA 1X1EA 3LLMA 2DBRA 1J21A 3RBXA 2PYZA 5CT8A 4EB6A 4G25A 3RV4A 1NFQA 5C8YB 1PZMA 1XAHA 2IYNA 2YJTD 4RPLA 4RK4A 2GD2A 3BZWA 1FJ2A 5BW6B 2BGJA 4CNBA 1RXEA 5KEIA 3K4QA 1EDZA 1CEEA 4HNAA 3HV2A 3GNLA 2EDCA 2F1KA 5C34B 2QP4A 1HLGA 4KO2S 1T3TA 1YGYA 1DX9A 1I1HA 1JG6A 1RXSA 3OBIA 3ORSA 4IZOA 4ZREA 3UK7A 4BMYA 1OIVA 3UK2A 3NWPA 3QTTA 1D7AA 1NI4B 4R7ZA 3UB2A 5IVPA 3GMDA 5IJXA 3O8CA 1B1AA 4LXHA 2UVPA 1EGVB 3UHAA 3EZLA 4JJ4A 1TVMA 1FXSA 1XX6A 4D8XA 4BVEA 1VPDA 2C95A 2ZDHA 4PBRA 4RHFA 4A92A 1PDOA 5KNDH 4XDGA 1PNOA 3JPYA 1Z6GA 3LYAA 3OT4A 3U6KA 1PEKE 3K1AB 1V8FA 2V5AA 3GRCA 3GNSA 3L4EA 1NVGA 3PQ7A 2W6CX 1UMKA 1XGKA 4AZVA 3NYQA 1SOUA 5JJKA 4NNJA 1DKUA 1WDKA 1YR9A 3DP7A 4GRDA 3UANA 2GN9A 1K7EB 2XUPA 4XLZA 2Z6QA 3RTEA 1GT91 1P61B 5F1KA 3UK6A 2CJWB 2NAFA 1EWTA 1UBOS 3AL0C 1UDXA 2D2EA 4QJ4A 4MVJE 2KI5A 2JVJA 2YNMD 1OA0A 5B7GA 1WD7A 1TNDA 2Q5IA 1S2NA 3PFIA 5FOSA 1TE2A 4CQMB 2XYRA 4KAAA 1Y8QA 2JD1A 5F64A 1NBHA 2WHQA 3TR5A 3PUZA 3W3ZB 2G1PA 1R74A 3CW8X 2PKQO 2O57A 3DKVA 4I9GA 2PGOA 4DLVA 1ADJA 3LHIA 3MK31 3I8OA 2W4MA 3MWGA 4I5DA 4M0MA 2O6HA 2Y27A 3N05A 3N8NA 4TYMA 5HCIA 4MRVA 5FWXB 1U6KA 4MGZR 2I67A 1AV6A 5HR5A 2D4AA 3ONVA 4MWOA 4WINA 4BC0A 4ZTZB 1CF9A 2HCBA 4G84A 2GOYA 1NQTA 3H83A 2WZCA 4WUVA 3E1KA 2V0CA 1Z0UA 1L7VC 5F51A 1FNMA 2FETA 4HX9A 3PNMA 2AW5A 4HWRA 4PHFA 3T3GA 1HFEL 4DLAA 5C5DA 2RBKA 1C7JA 3THOA 4AIRA 5DU2A 4MSUA 3TEFA 1I3OA 1DJLA 4MVJD 2HF8A 4E5DA 4UW9A 3SZOA 2Y68A 2H2WA 3VTZA 5F9FA 4QXPA 1KZ6A 2O48X 3NETA 4ZQFA 4QXOA 5KJCA 3DE6X 1YBMA 4NV0A 1J8MF 3CQ9A 4JUFA 3L6OO 3OCZA 4EYOA 5DM2A 3L7MA 1KZHA 3TTWA 1A1VA 3DDZX 1P1IA 2X5JO 4PXYA 1WA5A 3AUKA 3FWKA 3HRKA 3Q4GA 5K9ZA 3WP1B 4XCXA 3DBHA 3FYTA 3GGGA 3U4QB 3NHFA 2I4IA 1ZDMA 3PRKE 4G4IA 2GEJA 5DCLA 5DX0A 1GT6A 1OFUX 1GL3A 1L5YA 2HIHA 1LDNA 2VHCA 4YECA 2QTHA 3PD0A 1O96A 4GG1A 4X91A 3W2GA 1O95C 1RE1A 4LPSA 1LTHR 1U81A 2BZGA 2I4NA 1VGQA 3S1AA 2ZIXB 5CB6A 1T2DA 1AQJA 1OPRA 4NF2A 2BMFA 3TQHA 4R1MA 1NQOA 3TAXA 1PZXA 2PD4A 2IPMA 4BVGA 2NXWA 2D3TA 3ZTTA 3D2CA 3PEUA 3L0BA 3L8YA 3GZJA 4EVSA 1KK0A 1V5EA 2OV2A 4WH0A 4KSYA 2YXBA 1M3SA 1PK8A 1U2PA 4BNZA 3ZXIA 5KYXB 2AHRA 1JYSA 5FTNA 4MPJA 3VNBA 2XKBA 4B6PA 4O08A 4OXXA 2V4ZA 5GJCA 1NLYA 2EDAA 1KEEB 4HAZA 2QGFA 1FMFA 3CNHA 4UCQA 5JVDB 4I6JA 4Q9JA 2C4HA 2PLNA 1FA9A 4I1SA 1JQBA 3QXXA 5LQNA 3GRZA 2X6RA 2GETA 4U8GA 4BNDA 3VOBA 4DPMA