4ABTA

Crystal structure of type iif restriction endonuclease ngomiv with cognate uncleaved dna
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
286
structure length
286
Chain Sequence
MQPLFTQERRIFHKKLLDGNILATNNRGVVSNADGSNTRSFNIAKGIADLLHSETVSERLPGQTSGNAFEAICSEFVQSAFEKLQHIRPGDWNVKQVGSRNRLEIARYQQYAHLTALAKAAEENPELAAALGSDYTITPDIIVTRNLIADAEINRNEFLVDENIATYASLRAGNGNMPLLHASISCKWTIRSDRAQNARSEGLNLVRNRKGRLPHIVVVTAEPTPSRISSIALGTGEIDCVYHFALYELEQILQSLNYEDALDLFYIMVNGKRLKDISDLPLDLAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYPE-2 RESTRICTION ENZYME NGOMIV
publication title Structure of Type Iif Restriction Endonuclease Ngomiv with Cognate Uncleaved DNA
rcsb
source organism Neisseria gonorrhoeae
molecule tags Hydrolase/dna
total genus 97
structure length 286
sequence length 286
chains with identical sequence B
ec nomenclature ec 3.1.21.4: Type II site-specific deoxyribonuclease.
pdb deposition date 2011-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09015 NgoMIV_restric NgoMIV restriction enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Type-2 restriction enzyme NgoMIV 4abtA00
4ABTA 1FIUA
chains in the Genus database with same CATH superfamily
1OGJA 1GRVA 2ID9A 2VRWA 3D54D 1OQAA 2CGEA 3FTPA 3I6MA 3N2ZB 3QU5A 2SBTA 4QU8A 3T99A 4EF6A 4FQ7A 2FFBA 1POXA 4OQLA 5AMXA 3UHPA 1X9HA 5KU7A 4RFSB 1GOTA 2IXFA 1P0IA 2GBLC 3RQSA 4UTZA 1P5ZB 1HEYA 4KEAA 4J91A 4MWBA 4AQ7A 2C03A 2ODBA 1COZA 4O33A 5KX5A 1QOQB 1FUKA 2EGHA 3NLLA 4MSUA 4PLFA 1SBCA 1P5RA 2ZJ2A 5DBHX 4BO6A 1E9BA 1DBVO 4UDYX 4HQFA 3CKMA 1T36A 3GLFE 1GDDA 2QL6A 3HWRA 2JGMA 1SVSA 3P5SA 1JJAA 5KJ6A 1MQ8B 1VJTA 2WPNA 3WRVA 5JEDA 4ICIA 3BJIC 2IK8A 4R1UA 4PLYA 4TKUB 4CMCA 4C4YA 3SX4A 5BVHB 4UHFA 2LDBA 1L7QA 5JWOA 4XD2A 1QGDA 2G83A 3ENKA 3IDOA 4PM4A 1F8YA 4XKJA 5CM9C 3ZIAA 4D0SA 3CH5A 1VCNA 3W6UA 3WWOA 1SKYE 1CE8B 3H3XA 1L7OA 3AVQA 5EJ8A 1WJGA 1V8ZA 4YMIA 1YB6A 3T5GA 3CS3A 3VR5D 1FXWA 1LJUA 2XGOA 3SI7A 3ZWAA 4EIWA 4KTTE 2G1AA 4IIJF 1ZVMA 1ZICA 2PZMA 3DE7X 4YMWA 3M49A 5AW3A 1WG8A 1A5ZA 4LX8A 3KD3A 3ND5A 5E0KB 4E3WA 3E2PA 1EFVA 2H1IA 5C3MA 2GK4A 1P8JA 1Z18A 3Q6IA 3RAEC 1QUFA 2ZIWB 1ZIXA 1D8AA 3N58A 1TYZA 4HGQA 1UXHA 3SMQA 1IY0A 4RETA 3LX8A 1XPOA 2HU7A 3GAMA 2UUAB 4ROSA 3TVYA 1P2DA 2BKAA 1UPAA 1ST3A 4YFVA 4Z8YA 2D0IA 4H3SA 4GR5A 2Q46A 4JBLA 4AW9A 1D6SA 4QSHA 2FP3A 3C5WP 4FNMA 5EKDA 5JYCA 1ILEA 4PRZA 4CIVA 1RTKA 2PXHA 3RAGA 3G2NA 1Y6FA 2GHQA 1ZCBA 3LHFA 4IUDS 3R44A 2QL9A 2XBLA 1DIHA 3JCZA 4LYDA 5F5LA 4HK4A 3KJEA 1CUEA 2ERXA 2OZVA 3CSSA 2CNWD 1FTGA 1KTVA 3EGCA 4HDNA 4PR3A 3R5KA 2O7RA 5HK8A 2ORED 3SXUA 4A27A 1Z5UA 1C9JA 3VC1A 5E7IA 1UQRA 1IHYA 2JRLA 5A5FA 2EX1A 2C94A 3MINA 2XZOA 2GARA 1OI2A 1YRBA 4FTWA 4GUDA 3T4XA 4X65B 2VS1A 3W5AA 1JQJC 2BFNA 3N0RA 3L4JA 1QH0A 2XNCA 3TFWA 3UG6A 3DWEX 1QMGA 4Q93A 1NUTA 1LVGA 4UW9A 3C3BA 3BWVA 3WGGA 3AF1A 4HTFB 3JQ9A 3OEYA 2CJFA 5L40A 2CYAA 3E7WA 2OC9A 1YRLA 1B8OA 4HEJA 1ZD9A 3LZCA 2P5SA 1ZCJA 3FLEA 5JDIA 5F1KA 1XXHA 2AEJA 2ETVA 3LZ6A 9LDBA 4YMLA 5AW2A 4HZIA 2Q8NA 5D8DA 1JU3A 3ZGVA 1I4TD 2Y1EA 3FMVA 2HYDA 3B3QA 1ZD5A 5HUJA 4AS1A 2B8WA 3C1AA 2QX8A 4RK5A 5I7AA 4MRSA 3S2ZA 4E1VA 1B73A 2V4UA 4QBKA 5B4VA 2CLEB 4TRNA 2CBZA 1PNVA 2DBRA 2HSZA 4A2WA 3PXBA 2AV6A 3FDJA 5K01A 4QO7A 3FOFC 4Z4FA 4FLEA 3IKTA 4JVNA 3KHKA 3CEPB 3KCNA 5CM2Z 3ADBA 2GVZC 1IEQA 4UJ3A 4PG4A 4Z3DA 3C87A 1ULZA 4HI0E 4R5MA 3S7ZA 1FTWA 1W36C 1VG8A 3NW9A 4JL6A 3G13A 4Y9RA 1SQ0A 5AM5A 3X1ZA 4MWSA 4PHTA 1UBTS 4D4MA 4G5QA 3CA8A 2WDZA 1XVAA 3H8SA 5AK4A 421PA 3H2HA 4TTSA 2UXDB 4DFDA 4DNFA 3T4PA 1U9YA 4LDRA 2ZSDA 1IAQA 3HJFA 2BF7A 2NAFA 4XTRA 3IVGA 3MAJA 2WAXA 1T8WA 2GRUA 3HB9A 4RM2A 3F9CA 1V5EA 1JAZA 2C5EA 4GPTA 2WUWE 1V3VA 3QLVC 4NFHA 4BLWA 4C0XA 4D8TA 4IJQA 4ES6A 5LKAA 1G18A 1UJ4A 4KN8A 1LQTA 1E2PA 1KIFA 1S3GA 2BEKA 3BEDA 1NL3A 1P73A 2AK3A 4KDRA 5JDCC 5T4HA 3ELBA 5I3CA 4ZI3A 2CXSA 3EZ9A 3UY4A 3G85A 2XQJA 5BYAA 1FF9A 4IKPA 1N5MA 4WA7A 3V8EA 3VKVA 2RC6A 3EODA 3TIVA 4R9NA 1ENOA 3O3OB 1GZUA 5DHFA 3NKVA 1BS1A 1GAXA 2XMQA 3N05A 4COOA 4KQHA 2YRWA 2OBMA 4REQA 2TYSB 1JWBB 3PQ5A 2PYIA 5DYNA 4WK0B 1LDEA 1ORHA 2BZGA 2I6FA 5F21A 2VOJA 2G6BA 5ALEA 1GUFA 3PGKA 2R97A 3PR1A 4M83A 3KSMA 4TQGA 2FPOA 4G0UA 1WU8A 3VKHA 5IHXA 1A4XA 2OV6A 5TSDA 4HNVA 5DT9A 3JV7A 2I62A 4QULA 2IEIA 1FFXA 4YJGB 1PR1A 1XP5A 3CO0S 1XT6A 1S2LA 2BN4A 3IOEA 3PFNA 4IJWA 3OP1A 4Q9AA 2L0XA 4MEJA 1XZEA 1LI5A 3DDUA 5CNMA 2GJKA 2RGNA 2V03A 5JMWA 1TFRA 2JVJA 1OXXK 3H9CA 3C4QA 4RF5A 3PRHA 4RZHA 4DMRA 1CUFA 1WLYA 5CBPA 1EQUA 3HR8A 4KLRA 3FPKA 3GLQA 3RD5A 5LNK1 3F6YA 3WLTA 4HR7A 1U0BB 2C8LA 5JS8A 2C4MA 5AVRA 1BQ4A 3ND7A 3B3FA 2PFSA 3PQ8A 4YWJA 2YWEA 5HF5A 5KSPA 3GOQA 1PR4A 3HACA 4RVCA 4EKNB 4XZ3A 1S3SA 2AB0A 4X9XA 4PLGA 4RGQA 1YZ3A 1CJKC 2NT4A 3I45A 2R6DA 2NUPB 4N3NA 4NNOA 4PNPA 4Q3EA 4JZKA 5TJHA 2F8TA 3L4KA 2GXAA 5COQA 5FFFA 4UE6A 3LRTA 4AUMA 1OHHA 2A0UA 1L6IA 3HO6A 5EN4A 4ZDWA 3UM9A 5AKIA 1QNFA 2H59A 1RE1A 4G24A 1A9YA 2QF7A 5I4IA 2BGIA 2E87A 3F7MA 4G9GA 3WXMA 1ZOSA 2GFIA 4UMVA 1BGXT 4TLEA 4JNKA 4DM4A 4EY6A 3RTCA 1N8TA 2FZ4A 1H4VB 3PPXA 2NIPA 1EA7A 3IXMA 3CZ9A 3P0HA 1ZNZA 4U9HS 3DA8A 4O8CA 1T0PA 1Z0IA 2JDID 4EGSA 1RMYA 1P3DA 3EHEA 1HDCA 2ZBGA 2IP1A 3B82A 3HKBA 3IERA 1IQ0A 1E3TA 1A9XB 1QJ4A 1M7GA 1Y8CA 1ELOA 1F5SA 2J5RA 4LRUA 2I87A 4OSOA 3VDRA 3DLAA 4ZAXA 1HTTA 3HM2A 1A4UA 3LF2A 4LHSA 2PUVA 4NYIR 5K4AA 5DM70 2Q49A 3EDCA 1KEKA 1WEHA 5KIAA 4JI7B 3CIFA 4HDMB 2VFAA 4C0QC 2ENWA 3BC1A 3RJZA 2ZIFA 2RHOA 1S9DA 4PQGA 3F78A 4UNPA 1Z5ZA 5IZCC 1D0VA 5GAJA 3LT4A 4D26A 3ZEAA 3VYSB 1BDHA 3NHSA 3IIEA 3R7NA 2O5CA 5BSVA 4JYPA 1HT1E 4FE7A 1PRYA 5D5HA 1BW9B 2WF6A 4O3MA 4GQIA 3F9IA 1RS0A 2GETA 3VV3A 2P9EA 3E5MA 3EW9A 4FDAA 2G8LA 4CUJA 1C41A 1EK0A 4F4DA 2FK7A 1HLFA 5BO5A 1JU9A 4FDMA 2WP0A 2M1ZA 5A06A 1T4BA 4N4AA 1KYQA 1R0YA 1W0JA 4V24A 1T9BA 4PO8A 2IKQA 5CA1F 6LDHA 4WJKB 4DV4B 1O8BA 1HPLA 1BFKA 3QEOA 4YDHB 4EZIA 1N78A 1DOAA 3LLCA 3H84A 4RV5A 4V3CA 3NUGA 2IWHA 1G6HA 3JW8A 4JWTA 1E8MA 2LGJA 2X0NA 4LOIA 1QVVA 4GRIA 3W5UA 4FIZA 4XEUA 1SXJC 2F4NA 2ZULA 4AMZA 3Q88A 1RP1A 2C1XA 4L57A 4M2LA 4YFYA 1WE2A 3WX0A 2EDAA 3EEOA 1T1SA 4ZODA 4F2PA 4UVIA 3FI0A 3L0PA 1T4GA 3DFZA 4JC0A 3WWPA 2QGNA 3FH0A 5F7OA 2R65A 3K05A 3DEJA 2HX1A 3K0EA 1XFAA 2C4HA 4TMYA 1IXKA 2LVBA 5E1OA 4ANFA 5A3JA 1NBWB 1U63A 3DL2A 1XJCA 4FR0A 4U9UA 2P5YA 3L5KA 4MV0A 2NPIA 2QOEA 2QTAA 4RH1A 1KU6A 1VSVA 2X3YA 1XMJA 5NLLA 4XGKA 4C6RA 1IULA 3EEFA 3H9JA 1XO1A 4ZEWA 1RFGE 2DFDA 2ZI6A 4BGIA 4KG7A 1BN7A 1YZNA 3G6KA 4XQEA 3B7GA 1KWKA 2O2ZA 1GQYA 1XYGA 2P78A 3HGMA 2WVJA 3R7WA 5HPYB 3SJUA 3DEKA 3R6DA 3V3TA 4WKNA 1VL1A 2NO5A 2VF4X 2XOKA 4WCDA 5JXJA 4XFJA 5T4BA 2WG0A 2H8GA 1JAIA 2IXEA 3LXXA 1OR8A 2QK4A 5TS2A 3OQ1A 2CMGA 5CB8A 3KQLA 2NZYA 4LF9B 4ZAWA 5A7HA 4XPZA 1Q95A 6AT1A 1NULA 2YH2A 4LWPA 4RKRA 4PG5A 1QQ5A 4G0YA 3WNQA 5KQGA 4K9RA 1RZ3A 5C18A 1YI8A 1KZGB 3L41A 3PQCA 1JWLA 3UT6A 1AGRA 4QTXA 3JQ6A 3C24A 4B09A 3SZOA 4DMKA 1U0TA 3AEZA 1KDVA 3CKKA 3DAPA 2PXAA 4L3WA 4DR5B 1PN3A 2F17A 4YIKA 1YJ8A 1RWMA 1DAKA 3MWGA 1ZVQA 2ID8A 3O3MB 4HDSB 3R8FA 2PV0A 5BSRA 5LA6F 3CLUC 2C29D 1PT7A 2LW7A 4FYKA 4H4EA 4XVCA 3DW1X 4KMOA 2VHUA 3G7NA 1T3LA 4GOOD 4E03A 3K9FC 3GI1A 5TMDA 1YQQA 1EWQA 4HB3A 4P83A 3ELUA 1UQTA 5DP1A 3NWPA 2VQ3A 1VYUA 4G9BA 4V38A 5C46F 1P18A 2WIBA 1E9CA 3A4TA 2Q3BA 1GWNA 1YZQA 1W49A 2AXNA 3PBKA 2WYOA 2QBYA 5HJEA 1GTVA 3B6ZA 2DY1A 2F1OA 3UKDA 1R50A 2WWFA 5JCOC 4F46A 3HWSA 3STHA 3VR6D 2GO1A 4KLCA 3BF7A 4AJ1A 4D3XA 1NXQA 2OXFA 2C7VA 2P5TB 3SOZA 1BOFA 1MRSA 2ZAIA 1XLTA 1TC1A 3GL9A 4JVOA 1G55A 4YC7A 2YKGA 1AKYA 2AKAB 4URFA 2VK4A 3EYAA 4RZ3A 3I8XA 3PEFA 1P6XA 3SK0A 1ZUNB 2GAJA 2W83A 4KRXA 1GSIA 2DH5A 3QVTA 3ZNOA 4OBXA 1IE3A 5ALIA 1HRDA 2HZ7A 2NVUA 3WBFA 5JRZA 2Y76A 1YZLA 1N2CE 4A0GA 1L5SA 1S2DA 3PPYA 1EDEA 1Z5WA 4Z7OB 1GQRA 1BCRB 4IJ6A 2C77A 2NVWA 3O21A 4M49A 1FFEA 3E3NA 3U0VA 3B5IA 4YMVA 1RI5A 1C1XA 2BM9A 3QOYA 5EJGA 1KIAA 1J5XA 4R6XA 3QFFA 4J1SA 5G0VA 3PDJA 3DQQA 3KE9A 4EHKA 3FNEA 4Y2YA 3TTWA 5H82A 3ZLTA 3DUWA 4ZYWA 4HQ0A 2R751 2Q9CA 2R4TA 1BFUA 2B4AA 1E9DA 2HMVA 2X0JA 3UT0A 1BEUB 2FVYA 5EP4A 1GGKA 1G20B 3IPLA 5I5GA 2NMVA 3EXHC 1TJPB 3HYTA 3PFIA 1NQOA 2AOWA 2EU8A 3KEMA 1DKUA 5A6VA 4EEZA 1ZGJA 4AY6A 1DFHA 2CYCA 2Z5FA 3ZLBA 3RVQA 4CLDA 4YRGA 5INTA 3CPJB 4JXKA 3J80A 2ODEA 3G89A 1YKSA 2P4SA 4C7OA 4Q7MB 3HEMA 4IIDA 2AFRA 2QR2A 5GTDA 2O8EB 3REGA 1KU0A 4DZTA 4MWOA 1X70A 2HWWA 2JIOA 4HGZA 4QGFA 3WKAA 2RAPA 2O8DB 3ZQ6A 2GHTA 2WHQA 2Q4OA 3HJGA 3HCOA 2FGJA 3QVXA 3QX8A 3DMTC 4DABA 2MOKA 2DG2A 1SKQA 2RJOA 1L4HA 1U0NA 1JJ7A 5H4GA 1IPFA 3A3OA 3A7EA 3NHBA 3SR0A 1PL0A 1KFCB 4EGQA 2CKMA 3VPAA 3U09A 1A2BA 4OLBA 3RRZA 4K26A 4CIXA 2VJQA 5I5EA 4G23A 4ZREA 3A1VA 3AESB 1OF1A 1G9XA 4LI3X 1I1HA 3EUAA 1V5IA 4Z9YA 3UNXA 3DCJA 1VYHA 3F5FA 1ZCFA 2J4DA 3HJAA 3HUEA 1F8GA 4WN3A 1WAMA 1KK0A 4C7VA 3WGLA 2B2NA 2HV9A 2P9FA 2X8BA 1LS6A 4J6EA 4HYTA 1MX5A 2FCAA 4O4JF 1CULC 3TQQA 4IY1A 2TMDA 3MAGA 2X5KO 1B1AA 1XLWA 3IHTA 1HSZA 4TS9A 3TTXA 3GLKA 3MELA 3PFHA 3KKEA 3B6IA 4TSFD 5SY4A 2XE6A 4MMYB 4F1JA 5AOAA 4H16A 3QXCA 4ZQIA 1QO0A 2IDMA 2R1ZA 3B6KA 4BFUA 2OO3A 1NE2A 1PWYE 3OTIA 3M6WA 3ZHZA 1RSZA 1O77A 3CX7A 3Q85A 4O2AF 1E3SA 1M34E 1JHPA 3NALA 2ZRFA 2C2BA 4G5XA 1JIVA 4BZQA 4DCTA 4C3UA 1E60A 4KBFA 1WB6A 1MVLA 1GR0A 1ZOOA 3JVEA 3K9BA 1IOWA 5K03A 3BMOA 1AJEA 1JSXA 2J33A 2UZAA 3NEPX 2WHRA 1EXWA 3KTAB 4M98A 5EUQB 2D2EA 3I12A 2JJ1D 1NONA 5ENZA 1EUCB 1JHUA 1C4KA 3QIAA 5BSKA 5LP1A 8OHMA 5ALSA 1BS9A 1XFDA 2V54A 2PUHA 3TLMA 1II9A 1SCNE 2RHMA 4DQLA 1ZR4A 2LZ0A 1ITZA 1GA1A 3G82C 3IMEA 4PXSA 4C6SA 3LOUA 5FKJA 3KKMA 4ZTZB 4R1SA 4ZQCB 1DNPA 1TL7C 1EU1A 3JWGA 3ZJ5A 3FPFA 3O38A 2X1LA 3ZCXA 4Q4JA 1JEQB 3F1LA 3RK1A 4E33A 5BURA 1GPAA 1FW6A 5DNVA 1JVSA 1ZY2A 1MB0A 3DDOA 3QW4B 4IEFB 4WFQA 2OWEA 4B73A 2CVFA 4I5DA 1Z8NA 2ZJYA 1WCIB 2IFTA 3CEHA 3KX2A 4GP9A 1TA0A 4P7FA 4P35A 1RXWA 4QBFA 3V7WA 2ZIXA 5EIEA 2YS6A 4MKIA 1NBHA 3ERCA 3PTLA 1UMDA 1K5HA 1VIVA 2QAJA 5HBGA 4ND2A 2G0NA 5K8VA 3L1IA 4HX2A 2JRCA 3FKSA 3B6MA 5D7BA 3ZU4A 1T9KA 2JAUA 3WOHA 2G70A 5AW9A 5DM0A 1CEQA 4B33A 2H4HA 5F33A 4LJ4A 5BMOA 3I2JA 4MULA 3KOMA 5DHAA 2QENA 4MLCA 5JSUA 2M32A 3K16A 2Z5VA 5FPPA 1LZKA 4F6LA 1RZRD 2QRQA 2FFHA 4L9AA 2FB9A 1GQ2A 1SPXA 1NJFA 1JILA 5F9MA 1DQYA 5CA0B 4Q3BA 4IIVA 2I65A 5EGNA 4NXMB 4TMFA 2GEJA 1T1GA 1U2PA 3ZLJA 2C07A 2V7QA 3OKCA 1G21B 3RT7A 2AUTA 3L6CA 3TF5A 4U02A 1BAPA 1TVMA 2OAGA 4G0ZA 2O7QA 4NAHA 3A4MA 1Z17A 1MTZA 2YJ3A 4RELA 2OGUA 2NXNA 4BNMA 1GNPA 2QZ4A 3DO6A 2CZCA 3A32A 2NV6A 2A57A 3N2NA 4AJ4A 4BVFA 3A4IA 1UBHS 3KQWA 3DM5A 2QQFA 3KTFA 4Z53A 2OKCA 3DWIA 3UJ6A 2ZUBA 5EPUA 4AQDA 4D4LA 1JR3D 2VP2A 3PGA1 5JAOA 3ZE9A 5C4GB 1B0ZA 4U7DA 3ZK7A 5C37A 2CYBA 3K8QA 1KEEA 1X7GA 1XDWA 2CV2A 2H08A 1MG5A 3A9UA 3DPIA 3W78A 4I99A 3SICE 3U60B 3AONB 1Z2OX 1URPA 3H19A 1O89A 1ORRA 1RZVA 2HU5A 3HN7A 3DKKA 1PKEA 2CEAA 3K3PA 3MJDA 4TWAA 2BPOA 2P4QA 3TW8B 5E6UA 3CWCA 4K6FA 1JHVA 1JECA 1JKJB 1NUAA 1A9SA 2Q7XA 1SUIA 2X0IA 1CLUA 2YWJA 1S8FA 3PUXA 4LMBA 4Q37A 4RD1A 1JV2B 2XQFA 1IOZA 1CG6A 4FGZA 4NNJA 5AI0A 4YMGA 1TF2A 2HGZA 1KQFA 2BEUB 3RBVA 2FW6A 4DIDA 3SVZA 2F1HA 2IEBA 2Q2OA 1V71A 3JASB 1DC4A 3FLAA 3LUAA 3W2GA 4ZIRB 1O0SA 5C5IA 1RHKA 3OF5A 4F2WA 2BZSA 2ZI4A 3NIFB 4JODA 4AZ3A 4F8YA 4AUEA 5FUBA 4UARA 4BP8A 1TKRA 1EFDN 1Q3TA 4MAMA 4UM8B 4UUAA 2W6CX 4B0OA 2XWPA 1H1TA 4MV5A 3MOSA 4PBTA 4DEXA 3OSZA 5KS2A 4V0OA 3KS9A 5ENDA 2MSNA 3IJEB 2PO5A 1ZMXA 2V7TA 2XDQA 1R4ZA 1NXXA 3HG7A 1QS0A 4D3ZA 2J46A 1WV1A 2BGKA 1M6VA 2VDOB 1W9HA 3IURA 3VVBA 2FSHA 4P0QB 3ICOA 2ABWA 2NYRA 3I9OA 5G53C 1HOXA 3AHHA 5CVVA 5SZJA 4ETIA 5HR5A 5B58C 2AVNA 5KNCA 4E13A 3K9HA 2ZWMA 3NEYA 1YZFA 3GLIE 1LPAB 1KQGA 2JLRA 4HAVA 3BG5A 3ROFA 2BR5A 3MT8A 2NZWA 1SY7A 3AFNA 3CX6A 4I55F 1U8TA 4L1KA 4MQEA 2C0CA 3AZPA 4CHTA 2IHYA 2R8BA 3RVJA 3SKXA 4E1AA 1RQPA 3JQGB 3GLGB 1NSFA 4XR9A 3U7QA 1YONA 5DPMA 4N5HX 1V6CA 3RFVA 3ZZUA 1V16B 1FLDA 2D1TA 2ZZNA 1JQDA 3ISTA 3ZKWB 3DVSX 5JBNA 4EAQA 3KBBA 2PSJA 3UHOA 3H2YA 3CNBA 4ZAGA 1W0KA 3QF4A 3WMGA 4YP0A 4RVDA 3GAAA 1PYGA 4FYPA 1IB0A 2MHCA 4JP1A 4ZV7A 4CKCB 1P19A 2EL7A 4BLTA 1AD2A 1RKQA 2X8JA 4TWRA 3TJMA 3HEBA 3LYAA 4RA6A 4LV5B 3A2KA 1JR2A 2QRVB 4PRYA 5HFNA 1KSGA 4TUYB 4WOBA 4W1PA 3UV3A 4F3NA 3QPDA 3K1ZA 1CZLA 2QU7A 3N59A 2HKIA 1XI2A 5AP9A 2BHLA 4JI3B 5GJBA 2JJQA 2OYSA 3DL7A 3QU2A 4UAVA 4AIIA 5BN3A 4Q3NA 2E4AA 3VAZA 1I80A 1PS9A 2O4CA 4O08A 4D99A 3EK2A 4E7PA 5G3ZA 2J87A 2W43A 2WWVD 4NBKA 3C6ZA 2IHUA 3QUBA 1QQAA 1TTHA 3K1AB 2KBFA 3R4CA 4EVIA 1E2EA 1QYDA 2YIVX 4G1EB 5AI8A 1N6OA 4OFBA 2EQBA 2Z4SA 1MIOB 2XUDA 5F64A 3ZV3A 3CC8A 3VNAA 2WBLC 3GQBA 1NJ1A 2VF5X 3K5PA 1O6CA 4P3XA 5DXFA 1VJDA 2X4IA 1N1GA 2O3TA 2Q9AA 2XKJE 4LJ6A 1Q77A 4URHA 3TEMA 4GOMD 2Z95A 1OSNA 2PNJA 3NXSA 1AXGA 5L3SA 3H8VA 1MPTA 4X20B 3TS1A 2WIAA 1LDNA 1PD1A 1ENZA 4QL3A 3UT5A 5L7TA 1N34B 3T52A 1WPXA 3WGUA 5MHTA 4ZHQB 1QZ3A 2HSEA 1MX9A 5HG0A 1YVUA 1SC4A 2GNPA 3JD3A 3PKIA 2XCTB 1O94D 3K15A 5ELLA 5BR1A 5K3OA 4W5TA 5K0EA 4A91A 1YA4A 3IPXA 3PWTA 2FQXA 2DFNA 3SJAA 1A3CA 1E2LA 2WZBA 5HHTA 4OY3A 4GGOA 1KE2A 3Q8LA 4UM9B 1XQ1A 5C8YF 5IASA 2PUGA 3GT7A 3QXGA 4LEIA 2OGTA 3UUGA 5LOVB 5I7OA 3N76A 5JALA 2WOJA 5HM6A 5DCWA 3DKRA 2AYXA 4MUJA 4INZA 4ARBA 2Y71A 2JGKA 1SO8A 3QTTA 3OQ6A 4L9WA 2I3AA 1W48A 2WYWA 4PC2A 4WDQA 2JJ2A 1GG5A 3OFKA 4UEJA 3O73A 5B3AA 4B80A 4BZWA 2QRNA 1FFSA 4QPJC 4R1LA 3U40A 4AZ0B 1M6EX 1Q7GA 5AKYA 3EYWA 1YMVA 5FOQA 2ID7A 1WB9A 1QB7A 2I3DA 2GUWA 3EZ7A 1E8DA 3W5CA 3AHGA 3VBEA 2WJZB 5KVAA 4HQ6A 1ULSA 2PGJA 3FCSB 4FX5A 3OZBA 4KE6A 5ALZA 4D82A 4Z4QA 2CL0X 5LD2B 4YAOA 1Z39A 2ZKLA 4P3PA 1WXDA 2YY6A 3UV6A 1OLXA 4B84A 4AKSA 5BV2P 1X7WA 3N2KA 3WQBA 1Z4MA 5AW4A 1ACJA 3CV3A 5EESA 1KJNA 4JITA 3RBXA 2NTEA 4CDGA 4OU5A 5JFTA 3WGMA 5F3RA 5FEUA 3SPXA 4A8JA 4UAJA 4V0NA 1Y3BE 2YV2A 2UVDA 3BA1A 4UUBA 3K0AA 1DADA 4K9NA 4MARA 4RVOA 3H3JA 2YC2C 1AGXA 3BL6A 2R11A 2P8JA 3TAUA 4DC0A 1GG8A 1CR0A 3D4NA 1DJNA 1FNMA 4OHKA 1E69A 1P2UA 2P9JA 4OQ4A 3TQIA 4GG1A 2BJWA 2ZJFA 3K6SB 1XPJA 1NP7A 2RFLA 1ZNWA 3U4DA 1VLQA 3FE2A 1JDNA 1YUNA 1GQFA 2WKQA 2W37A 3I0NA 4HZGA 4Y2GA 2A3RA 1LSOA 4WT7A 4EGCB 3ZWXA 1C0IA 3IO5A 5JRDS 4LYGA 4DCVA 1KC3A 1PK7A 3UAVA 2QD4A 3OIVA 3B2NA 2PV7A 5A4JA 3AM1A 1KMCA 5JECA 2W7TA 1VHDA 4UCFA 1MENA 2R7KA 3CU5A 5K0BA 4KYVA 4KIFA 2IUYA 5JUWA 2H48A 2V97A 2PX4A 3DP7A 2VJDA 1TO2E 1EVQA 4JJGA 3TCKA 3CRMA 4ZVSA 4BECA 4A6EA 2WMNB 1CUXA 2NZ8A 4RXUA 2FN3A 1TVEA 3H1BA 1ZYUA 2JZOA 4CKWB 3RU2A 1E1YA 2NN3C 3BAZA 3D0OA 5F2NA 2CDRA 3HCDA 4JP8A 2XB9A 1N1EA 4RHCA 4BQNA 4DMCA 1N75A 2AK2A 4F96A 3FOEC 2A9OA 1L3BA 4NJEB 1SXGA 2HK6A 1KIMA 4MUMA 4B4VA 5I7RA 1YQWA 2JIMA 4CQNA 3FRJA 1XJ0A 1UWCA 1ONPA 5HS6A 1C2TA 1UPCA 2BKVA 2BZ1A 2VRBA 4OHBA 3RUEA 3ADKA 1IPEA 4G5OA 4LYEA 3AUTA 5GMOA 1E2DA 5L3QA 1EDDA 4D5GA 3DBOB 1KVQA 1M33A 5SYAA 1I13A 3M5DA 2P4HX 4R2LA 1D1QA 4E2ZA 3RS2A 3CLRD 4PLVA 5IC4A 1MJHA 3IEMA 4DLNA 5DU2A 3ZW9A 2PJZA 2BT4A 1NXOA 3MC1A 1XNGA 3WNDA 1O95D 2O1XA 2XF2A 1M5RA 1NN5A 3NHMA 1ZOLA 3JQAA 1FJ2A 1H8ED 5HZMA 3LV8A 4ER3A 3RABA 1JXAA 3UHFA 3WJ7A 3INNA 3BGSA 2IV2X 2Z1NA 4MUIA 2OO7A 4K1XA 1W5BA 2P65A 4BGVA 1EFLA 1ESEA 4NYJQ 3D6TB 2X3FA 4BMXA 1PVVA 3PJGA 1H8HA 2O2IA 3B7PA 1L9KA 3BL8A 4FFMA 4KJXA 4CG3A 3IE1A 1N4DA 3TSOA 3RANA 1UJMA 2V65A 3MWFA 3DZJA 1RWXA 1TM1E 3EMKA 3KR9A 3UWSA 3WISA 5BUQA 4M1MA 5JLJA 4HWRA 5F2EA 1QJCA 5IWAB 3THWA 1QWOA 3AM5A 5H9VA 1TD1A 1EMDA 1KR5A 2GPWA 4P4GA 1AKNA 4ECEA 3CF2A 3DE1X 1Q19A 4RY8A 4LRSB 1R37A 2I5PO 4XPIB 3U3OA 3LCJA 4NVRA 5JC1A 5LQUA 3KV3O 4IOJA 3MRTA 4YK7A 4CCYA 1RXVA 5LQAA 3GPBA 3HYRA 1JR3E 2Z9CA 1MRNA 3K8OE 4QODA 2QLTA 4KLNA 3UMVA 5KNBA 3F97A 4RORA 2ONCA 4G8JA 5CNKA 3WLFA 1MFPA 4Q9LA 2Z6VA 3TSCA 3LE8A 2I2XB 2GCIA 2INGX 3AFIA 2G7ZA 4UPVA 2VWPA 2W6IA 2AF3C 2GA8A 3GJYA 3OESA 4YR9A 3I9JA 2JK1A 3BS4A 1YOBA 3O8OA 2W42A 1PR2A 1HZJA 4GR4A 1K27A 1TQDA 4MHOA 4TTIA 4UC0A 4QFBA 1AY0A 2H2DA 3DQZA 3G0IA 2YFQA 2JGDB 1H2BA 2WG1A 3E22B 3I72A 4IEEA 4TV9B 5DI3B 3V7UA 3ZWVA 1M2VB 1B8PA 2VATA 4Y2JA 4NV1A 4BB9A 3PT9A 4WY5A 3P9IA 1W4BA 4YASA 3ZHVA 2JBHA 2MYPA 1OBVA 3A1DA 4WXRA 3TDKA 3RUDA 2XUIA 2ZUSA 2CXOA 3V4PB 4NNPA 3ZC3A 4UCXA 3CHYA 4F5EA 5BRAA 2EKZA 1VQ1A 1OZGA 3AOGA 1QV7A 4MQ4A 1QIGA 5A3RA 1EDBA 3TLGA 5TF4A 3U4CA 1X2BA 3EUEA 2ORIA 2CDBA 2HXYA 3ZWNA 3Q3CA 4EB8A 4EMBA 1F60A 2QHXA 4OQMA 2LUOA 3TJZA 3H13A 2D0DA 4WN9A 1NFRA 2DR3A 2PSEA 3P32A 5KHAA 3OE4A 3LX4A 5ILOA 2HTFA 3QWHA 3ZXXA 1KO1A 2XXAB 4H18A 5D5QA 4ZT5A 4C2TA 2R62A 5LDDC 3NHAA 3QHQA 4CNBA 4E6EA 1SVKA 1NI5A 1Z83A 3PUZA 1FY2A 1U8UA 4TQ9A 2H4FA 2KS6A 4FYJA 2F7SA 1UKVY 4FW9A 3GGJA 2GHRA 4HWPA 2AOVA 3M6VA 1T0JB 1V4BA 3TNDA 3WJ2A 3TNJA 5B36A 3NANA 2B8JA 4OF4A 3O74A 4NK5A 1S7GA 3OQHA 1ECPA 2E55A 2QRPA 3UMRA 3VDQA 3D6VA 4M9ZA 4RKYA 2A7XA 4K86A 4P2BA 2ZT5A 1XA0A 2B36A 2YVUA 1RM5A 1HNWB 1QDEA 3CN9A 3AJ9A 3I28A 3O95A 4QLOA 3B9QA 4ZMRA 1IHXA 2ZT6A 3U3DA 4OA8A 2E5LB 2DJ5A 4GPD1 5TPWB 3V1MA 3CMMA 5AW0A 1ML4A 4KC0A 2FFAA 4HH4A 2BGUA 5EE9A 1WKVA 1EWKA 1Y1SA 3UCEA 2C58A 1PDWA 5KJCA 2H2FA 3MYYA 1CRWG 5IVPA 1PZGA 4AXXA 5BMVB 2Z30A 3KJGA 2CNKA 4M86A 3U4AA 2XZPA 3AT1A 3VKUA 5F9FA 1QNLA 4GL4A 2R6CA 5AKHA 4F5WA 1GRQA 3O90A 5TPZA 3Q5EA 4PO9A 3L7KA 4D9JA 1TLFA 4JP3A 1A96A 1PJ2A 2EKBA 2GPSA 4KX3A 4ZCPA 4LZWA 4NU5A 1QP0A 4G5SA 2I6QA 1A1VA 5KTKA 5E6SB 5JXGA 1F2UA 5DULA 1FRZA 3D3QA 2EFYA 2YOHA 3H9EO 5JVDB 3OKPA 5H59A 2ATCA 1PG2A 2PGXA 4UM7A 3VNQA 4ASUA 4RTMA 4D4IA 2VT2A 4QOEA 4U0KA 2X1MA 3N0WA 3KEGA 4AG3A 4FWTA 4M88A 1FEZA 4YI3A 3ROZA 1HEUA 1UR5A 3ZWBA 1N6LA 1SGWA 3N6RA 4DV2B 3D43A 1DUIA 4BV9A 1FMTA 4LJLA 5HNKA 2OB2A 5A0FA 2J3EA 4GF5A 2ZUUA 3KZOA 4CL0A 3P4YA 4V03A 1Q74A 1R0WA 1SVUA 1CT9A 2HRZA 1U6IA 2X4LA 3E9NA 3A9RA 1FSSA 3IPCA 5DTEA 4B4DA 4B0PA 4EBBA 2N75A 5BWMA 2RHDA 3T35A 3LL4A 1U2ZA 4L74A 1RWBA 2AWNA 2RI6A 2VJLA 4PZYA 3SZRA 3VNBA 4DDUA 3KQPA 2JCXA 3R77A 5U1PA 3A2NA 4JYMA 3ZHUA 3E53A 4DLZA 3AIOA 3EY9A 4U2FA 5H02A 3ZIAD 1FP6A 3RIHA 1TEXA 5ED0A 3UFBA 4B34A 2RGEA 2EIHA 4RLSA 2ADMA 3EBLA 4MGIR 3U4HA 2YWFA 4MQLA 4MLDA 2EZUA 4XIYA 3C6MA 3F3MA 4ZI7B 4IUCS 2XCRB 3E03A 1I8TA 1I1OA 1PGQA 4BO5A 3RTAA 1D2NA 3ZZNA 3SXPA 2FVXA 1J24A 4X3OA 2FRDC 1YDEA 2MINB 4DKXA 3ANTA 3OJ0A 2ASEA 3P9PA 2VT7A 1HYQA 3GA0A 5KYUA 4NOMA 1LNQA 2ZG6A 3VUFA 5IAJA 3AY0A 3UWPA 5FTLA 5AM1A 2ACWA 4DG5A 2AWOA 2DWUA 5P8WA 1CD5A 2VT6A 1OYOA 3H8JA 4TL7A 3WFZA 3A26A 1GPWB 1T2UA 1YZVA 4LQLA 4U9IS 1NAHA 1E7MA 5B1YA 2BZ0A 5GINE 1OX4B 1FX0A 4HL6A 1KAGA 2DJIA 4N9QA 4FZRA 4BP3A 1U2GC 3JQ8B 4CMEC 3EJ6A 1NSYA 4F3KA 2EXXA 5L45A 4YQZA 4RGYA 5EXDA 2BTOA 1FP1D 1J70A 5GZ6A 3GJZA 4U2KA 1Z4NA 3KUUA 4YUWA 4J43A 2ET6A 1R0KA 2RBEA 5FUXA 3B51X 3GLSA 1U8CB 3M34A 1RD4A 5BQPA 3ZVKA 1DINA 4LXUA 4B7UA 3U6BA 2IP4A 1GIAA 3ASVA 3NTXA 4B17A 1RDFA 3FFAA 1PLKA 1P1KA 2ZUEA 3IUQA 4IDPA 1LI7A 2W6OA 3GEPA 1VL2A 1TM7E 1G9TA 3MSCA 4G4SP 1KYVA 3HO8A 4NSNA 4Q9IA 4YA6A 1S8NA 4YV1A 2RD2A 2WUFA 1G0NA 1G4HA 1TUIA 4A73A 2RKBA 1MIHA 3STTA 1OV4A 4ENRA 3O7MA 2GZ3A 4IGEA 4AN0A 1N6PA 1XDZA 1MX3A 4MRVA 2G4VA 3OF2A 4CCWA 5CLJA 3EPHA 2GKOA 4KVZA 2O5EA 1TTPB 4J1QA 5J2TA 2OZLB 1F06A 5FR2A 3C3DA 1HE1C 1WHTA 3WJAA 3X43A 2GJ9A 1A4RA 2VWGA 2WR8A 4JT2A 4B43A 3WQQA 4AIRA 4PSCA 3W77A 2AL7A 4UMEA 1YZHA 1HURA 4PNZA 1O9HA 4G5RA 5B3JC 2ACVA 4ALKA 2ZJ8A 3DVAB 3GFBA 3B85A 3NVMB 2X0EA 3IA7A 3QZUA 2RGYA 3NAGA 1L4MA 3IBSA 3D8BA 1ECLA 5JPDA 2MMGA 5F23A 2IF2A 4OOEA 2V6JA 3K1TA 2PSDA 1GUBA 3SEQA 1AMNA 1IZZA 2IHNA 1RYDA 3M4YA 3TVDA 1YJ5A 3SDSA 1FNSA 5DLDA 4W5JA 2BGMA 3IHKA 3L0ZA 5E4TA 1N2BA 2HO5A 4WW0A 4LF6B 1YHNA 5KOHB 3VVMA 2NZ2A 3WAKA 5IYZB 3CZAA 4I66A 1CZOA 3TZEA 4X62B 2PUEA 4MP8A 4BNDA 221PA 5CTAA 4UTPA 3SS8A 2GPJA 1P1HA 2ENUA 5TRTA 1A7KA 2OBNA 3DBRB 3E3LA 1J2RA 2IY8A 3QBJA 4M8KA 4I4TF 4RCVA 3T1OA 1ANKA 5LYJF 1NBMD 4LWZA 4B32A 4CVNA 2E3JA 3VU0A 2VDQB 2NACA 2H07A 4XQGA 2BEJA 4XRGA 3BHNA 1K6JA 3CLTD 3U4GA 1XV5A 4R1TA 1V7ZA 4LNUB 4FXPA 1DUVG 3CM0A 3HC7A 2VPIA 3UH0A 3EVFA 3TPCA 1XVTA 4QDKA 3OAAA 4II3A 1XRSB 1WWKA 4BY9E 1DC7A 1D7AA 2F9LA 2HTEA 4G1UC 3TRDA 3ZU2A 1KS9A 2FUKA 2B98A 2Z43A 1LTHR 4ZZ2A 2OEPA 1H2EA 2HCTA 1K7EB 2AJBA 4ZVMA 4C4RA 2JB9A 4KWCA 3EEBA 5U4XA 2J41A 4RJIA 1FDSA 3GRVA 4PRLA 3Q3IA 2BDTA 3UAXA 3DFIA 5CIQA 2XB8A 3P9SA 1H3EA 1RKUA 4EQ6B 1C5KA 3LDFA 4YJ2B 1BN6A 2OR3A 4HNUA 4MTCA 4MWDA 2WW8A 1ZDMA 3H4IA 4R83A 3M2PA 1ZH2A 4PGHA 3HCCA 1QKJA 1BHJA 1KQOA 4RD3A 4WCFA 1KOFA 1QYRA 1CZNA 4S1OA 1WKBA 1KDRA 3WK8A 5DXJA 2OGWA 1DKLA 3Q3JB 2V5AA 3K5WA 4EP1A 1G6KA 2CL7X 3HDQA 2WICA 1EJ0A 2YASA 3OM9A 3DOIA 4DXDA 4RGVA 1KDOA 4MR9B 2W2TA 4J2TA 4GECA 2HBRA 1ZMBA 1QH1A 3BZBA 1QIMA 5TF0A 4BNWA 3OU2A 5B4UA 1BU8A 2CUZA 5FA5A 1UJ5A 3IAAA 1P2BA 3UAZA 1QV6A 3ER8A 3IFSA 1EX6A 3L04A 2C3PA 4L3VA 4RXMA 4TVSA 1A5TA 3ZHYA 3HXKA 1OHHD 2NU7B 4JC8A 3T7KA 4EJSB 3U3MA 4URXR 1WZ2A 1CVLA 3AG5A 2VF7A 4O4LF 4QUBA 3GF4A 3GR6A 2Q7DA 4WZAA 4F9EA 2ZANA 2AF4C 3C3EA 4YRFA 2G8NA 2MWMA 3E3OA 4BO0A 3TLEA 3ZV6A 1J00A 2AZDA 3AJEA 3VJRA 4CF7A 2WSIA 5C5CA 3UICA 1X1DA 4QJ3A 5C8XA 4M55A 5KNCH 5B2EA 4NPAA 2VHZA 3VAYA 1RPTA 3NIWA 3PYMA 1QE5A 4FZ3A 3MBOA 4NY1A 2UAGA 3T9FA 3LHDA 1WHSB 3C3XA 5ARBA 5JD6A 2F2TA 2AFHA 2EZ4A 2OD7A 3I30X 3IP3A 4BQOA 3DDSA 2A5DA 4GYKA 1XALA 3O2QB 5B3LA 1LNZA 3LUJA 2C2HA 5PNTA 5EIHA 5KBYA 4XM2A 5IDXA 4RGBA 5J1SB 3H0KA 4QBIA 2DBYA 3BSFA 1IOLA 5T4EA 1QGOA 1XTTA 5IAKA 2QE6A 2NXCA 3VDNB 4D9HA 2JIRA 3GA5A 3Q4GA 4P5DA 1AU9A 4M54A 4MQFB 5AVVA 1Z4OA 3KLPX 4BTVA 1SH7A 1KNQA 1TQ2A 1OU4A 5KAPA 3DHNA 3DSRA 4J49A 4COKA 4XH9B 1N5JA 1CR4A 2C31A 3X1WA 2I3ZA 3WFIA 4ETMA 5JYBA 1U11A 3H42B 3LHSA 4QUGA 4IWXA 1LW7A 4Z99A 1TKBA 4M7WA 2JBWA 4JLAA 4AJHA 3FXAA 5B1EA 1N7IA 3M82A 2B9VA 3IMFA 4FGJA 1UK7A 4D81A 1PJ3A 1R0LA 2QN9A 4JLNA 4RTLA 3ABQB 3H18A 3I0ZA 1ZA1A 4LAFA 2WVHA 4IDBA 2W8ZA 2X9LA 2Z2XA 5B12A 1HYHA 4Q7LA 3VAAA 1TD9A 3OZCA 1XDGA 3KPVA 4WNYA 3U48A 1E0SA 5DOZA 2PMFA 4BFCA 5CYOA 5HUHA 1QX3A 1G60A 4DDWA 2C00A 2YV1A 2KI5A 3O8LA 2RBKA 3WIUA 4JGIA 5FQOA 3FPLA 3ZXUB 2HLDA 4RQBA 2ZT8A 3B38A 3LDUA 1IU9A 1T9DA 4M37A 2ZKIA 2FXVA 1M1XB 1W9MA 2GF2A 1XZPA 2ONYA 2C5BA 2YDXA 3IP5A 4FGWA 1KI2A 5TVGA 4IH9A 3ROEA 1VJGA 4ZYYA 3LS2A 3LVQE 1A7JA 4QUJA 4Z9XA 4P7JA 3VX3A 2RB4A 4KFRA 3R74A 3GRPA 4DT1A 2JLXA 3TR0A 4QGAA 2SKDA 3GJTA 3ZGOA 2DB3A 1PWXA 4M7RA 2XIJA 1W5SA 2FR8C 4UHDA 3W04A 1NC1A 2NSYA 2L19A 3SSAA 5LU9A 1DTWB 2JZNA 3ZDCA 4CM4A 3HDVA 1SHZA 1TA9A 3E15A 4TXJA 3OT5A 4RF4A 2YHAA 5IMBA 3EIEA 1W36B 4N3AA 2XOKD 1SHJA 3RW9A 1CS0B 1M2KA 3MGAA 4OLJA 4YQYA 2QTTA 4ZKEA 3WC4A 1NWCA 2C2YA 4V1CA 1RJEA 3G5AA 4ISCA 5H70A 2X1VA 2NP6A 4Z4EA 5E9QA 3JRNA 2YIDA 3LQQA 4LY3A 4NCKA 5ALWA 5FULA 5L3RA 2QD2A 4KVFA 5F1YA 1QSGA 2AMJA 3KYCA 4JLPA 5LMZA 3CVWA 4J07A 2X2FA 4RY2A 2FHSA 3O4VA 3OIFA 1I7PA 5ALUA 2VNSA 1GCOA 2IWRA 2ZXUA 3GEMA 4LTDA 4L73A 4PLTA 3HLYA 2R00A 9ABPA 2EJUA 1Z0KA 1TEZA 1A9PA 3IQHX 4H9GA 1FJHA 1L1RA 3BIXA 4HSEA 4L3OA 3VO9A 2FYTA 3HUFA 5IVHA 1LPSA 3MMPA 1D9XA 1O9GA 1KY3A 4R8SA 3QKIA 5CNJA 5FWXB 2PJDA 4DBVO 1C0PA 4BFTA 1X1BA 4Z3OA 3P19A 3AP3A 2RGXA 2XPCA 5EJ6A 3P5BA 5JG7A 1SC6A 3DAFA 1WMDA 3H6GA 2AUMA 1N7JA 5C8VA 4XB1A 3DC7A 1B0UA 1RI1A 3ENQA 3F5MA 4HKTA 3MB5A 4IEIA 4RCZA 3SHFA 1MA0A 4K46A 1TZJA 2JGNA 4KN6A 1P3Y1 4G5HA 3EARA 3TRHA 5SICE 2CD9A 3HB0A 1VBNA 5DYTA 3KB2A 4C7JA 4BNIA 2UVQA 4LS3A 4S1WA 5LQCA 1EP9A 1R18A 5BRJA 1KMHB 3VA7A 4O3FA 4W8HA 3SS9X 5C7LO 2Q41A 4UHBA 2ACKA 2GF0A 2A7QA 2Z6QA 3P8ZA 4OLHA 1RWWA 3A05A 3KKOA 5CLQA 5FV7A 2ZBPA 3T9AA 3QVWA 1AF4A 1NW6A 2ZRHA 1NDHA 3RTEA 4CIBA 3P0IA 2HMWA 2QN2A 4TS1A 1LRKA 2QRHA 4DQKA 4PTYA 2IA5A 1BX0A 3V4ZA 2QNIA 5IJ0A 4G8BA 2BHTA 1HH4A 3IJPA 5CJ2A 4CRWB 1YAJA 4KQWA 4XWKA 3FOAA 3HU3A 3LU1A 3UENA 1C4OA 3PENA 4UZEA 2A5YB 3L1KA 4FEYA 5HZKA 1ZJ4A 3TQHA 1EWVA 1EQ2A 3RARA 3JALA 4C0LA 3EWIA 3H05A 4PBRA 4RS4A 1DQZA 4ZT2A 4B6RA 3BXGA 4CLRB 1VE6A 3K1JA 5G0SA 4LJ7A 4LDZA 3Q8MA 2VYCA 1C3OA 1EUDA 1FLNA 2O0KA 3KVYA 4HFRA 2CK3A 4MICA 5FP0A 3WK4A 3K8YA 2NLOA 4KYTA 1UWLA 3HB1A 3BHIA 1OGYA 4MS4B 4B6PA 1G5QA 2Q0SA 3N70A 4V1CI 2XI4A 1PEAA 2JG3A 1R4NA 2C0PA 4QLBA 3K2BA 5FAKA 2DYKA 3SDBA 4M1ZA 2WWXA 3PTAA 5GV7A 3ZTWA 3U1BA 1RPAA 3EXEB 4NH0A 4CV2A 3A6JA 3QWIA 4R16A 1JXMA 3ZCUA 4ZGBA 3SBOA 2VCYA 3T3MB 5CDTA 1BKYA 2J48A 3DMNA 1N9KA 4QHYA 1GFSA 4PF1A 2AC7A 3DPUA 1JT2A 3VPXA 4C2BA 3WB9A 2JI6A 3WDLA 4D5EA 3HPRA 2Y1KA 4H7EA 4PLHA 5E6RB 2Y1CA 1FJXA 3CISA 3ER6A 2IS2A 1G64A 2H17A 4AWAA 4DY4A 5B3KA 3RVDA 5U4QA 4LVOA 3DFKA 1R0SA 2F3TA 1I24A 5ERGB 3FSEA 2YWHA 4TMXA 1UCFA 4P3KA 3ZVNA 4S2EA 1E5LA 1NXWA 3OTQA 3QVLA 4YTEA 1PJQA 5JIBA 1QLWA 4BQIA 1KERA 1R6AA 3RVMA 2PY6A 3GYGA 3DV0B 2O2GA 4JJ4A 2XA2A 5JCJD 1VG1A 3UB4A 5CR9A 2V6IA 1NBME 1PT6A 2F1JA 4LF4B 2GXSA 2E7ZA 4IIBA 1Q17A 1XWFA 1PJSA 1USKA 2YFKA 5IKPA 2MIIA 2VQEB 1VCHA 5KAMA 4DBZA 1K89A 3B36A 4ZOAA 2GTHA 5JARA 1O7JA 1WSWA 1SXJB 4RVFA 1CIPA 1P7ZA 3LC0A 4UMFA 2FV8A 4IIFA 1HZZA 1QO0D 5HILA 5BSUA 2BLNA 4MYSA 2W6JA 2ZJAA 3F5QA 5KYVA 4CF3A 1KWGA 2Y1DA 2ZYWX 3VI3B 1ZW1A 2GF9A 4G0QA 2XUAA 2PLAA 3OQOA 1ODJA 2RHTA 4FFSA 3TDMA 4E7OA 1Z33A 2FPGA 4YJHB 1PWEA 3K9NA 1GKUB 5LYYA 4BMCA 2O2DA 1JDSA 2QJOA 1UK8A 2WSSA 1XQWA 5KNBH 4JFAA 1OH8A 5L7WA 1Z0FA 2PRYA 2VNAA 4E94A 4PHCA 1E1RA 3EPJA 2YJ6A 1VJCA 3QE2A 2V6FA 2D5LA 2RGBA 3URMA 5K8CA 3EY4A 5LQNA 3BSWA 3P9QA 4HYQA 3VQTA 3EOAI 1YB4A 3N39C 1NN3A 3P4XA 3PQDA 5EZ6B 4GMDA 4J90A 1Y7LA 4BLUA 5EFZA 5JS6A 1R64A 1YL7A 3FOZA 2C7GA 2OL4A 4PXYA 3GXBA 1ETHA 1O2DA 1O58A 3NM4A 4LECA 4PSVA 1EX1A 5HJ5A 1E6CA 1U1DA 1PWZA 1EX7A 5BW6B 1FX1A 4DLLA 2HBQA 3P2YA 4LOJA 2BRUA 1YR2A 4DTIA 5FJIA 2Y0EA 2HNBA 4KGDA 3TXAA 2LIPA 4NFSA 1WNFA 2HCFA 5HRAA 3NATA 3KFVA 1SXIA 3FKSD 1IZ0A 4QJ5A 3HFJA 4WK6A 1CY0A 3U17A 3ZLVA 3V4RA 4BE9A 1QYIA 5IUJC 3AVYA 3TLXA 5HQ3B 2F4VB 2O07A 4NXNB 1BIFA 2E85A 1A2QA 1FXWF 1EM8A 2WFLA 4IBOA 3SGLA 3W8DA 1AMOA 1KPGA 3TCNA 1IUKA 3D3EA 2EP8A 3L8GA 4M8LA 1SK8A 5EZ5A 3ILXA 2QKYA 4FYWA 1DX6A 2Z56A 3EH1A 3NYQA 4XWYA 4NYIQ 5AW5A 4HXFB 1MC5A 5A5DA 3IQZA 1K7FB 3PD1A 3CLVA 2JFGA 4TKVA 4U6QA 4B6OA 4CM6A 4U7JA 4BEBA 3S8EA 3OT4A 4QOHA 1CEYA 3BE6A 3LP5A 2V7QD 1Q1QA 4GZMA 3TGPA 2I6SA 2XYPA 3SG0A 2WUDA 3RASA 3VSDA 1K2WA 5CX4A 4HC4A 5KEIA 1I0IA 3RC1A 1U4OA 4P33A 1M0SA 2RHGB 2H7XA 3LVBA 4F4JA 2GCOA 1GFWA 3AKDA 4LXHA 2GBGA 3B9RA 4B75A 1PFUA 4YY3B 3GBVA 4I2VA 3NFRA 2D2IA 2FMUA 4K7JA 4YCBA 5TARA 4AP6A 1KI9A 3IP8A 2P11A 4LDJA 4XJSA 4A7PA 2HK8A 4XLZA 5DRYA 2B92A 4ENUA 4YJFA 5D1HA 4U7FA 4UUMA 4L5JA 3C3YA 4GZ3A 2FG6C 3CTPA 2EDCA 3LUGA 3RO7A 2K7ZA 3LX5A 3R23A 1X1TA 3S68A 4K2AA 3HVUA 1NVDA 3BFXA 4GNKA 2PBRA 4HDAA 2OPHA 2DSTA 4HLNA 5C4MA 3CVUA 1S89A 3HR4A 3HUUA 2ZWOA 4W7HA 1GG9A 3AEKA 1QFYA 2YIMA 4BL5A 1E3WA 1V45E 5BV8A 5AT1A 3HADA 3IEPA 3JQ7A 2VJAA 4PYNA 5FNVA 5GWXA 1N4AA 4E14A 5LP6B 5DGHA 4MGEA 1HTBA 5JNRA 1ETUA 2FG7C 2H7VA 3JZFA 1Z56C 3QVMA 3R09A 1TZ2A 4OUDA 4NE7A 3UJ8A 3H6HA 3BIFA 2FN7A 4IL5A 4J0QA 2UZ1B 2YYZA 4KH0A 1U9JA 3EXHB 3HE3A 2OD9A 4JX9A 3TRFA 2Y6VA 2VF8A 2NO4A 4IJ5A 3ZHOA 1SUBA 4HNHA 4ZT7A 1KI6B 1F2DA 2PMKA 1B2LA 3MJRA 4WESA 3RAJA 3UK6A 2VIIA 1Z7WA 4BVEA 5KTYA 4PG7A 4YRDA 1RTTA 4X45A 4R4JA 1JL3A 3AFMA 1II8B 4NCXA 1J5PA 5DNWA 5EE0A 4NESA 4R31A 1XZDA 5IF9A 1YR7A 2J9RA 3M3DA 4P98A 3FYUA 1RYBA 2I33A 1VKZA 4V02A 4PYLA 2HJRA 4HLQB 1T2DA 4I9FA 2Q45A 3VSEA 1Q50A 2WZCA 4QT4A 3FZQA 2IT1A 2HU2A 4BMYA 3LSTA 4PLCA 3WV5A 2HIGA 2HRCA 1O6ZA 3BJZA 3TK1A 5JC8A 1E9RA 1P9OA 5KNCD 4DRZA 1IC6A 2O0LA 3JQRA 4ND8A 2WU8A 3GRUA 4OHPA 3L4BA 1Z8FA 1XTRA 3DMFA 2XA1A 3LFTA 4U3JA 2ZJ1A 2CN1A 1IDN1 4QO8A 1YJXA 2PJUA 1NVFA 4MUHA 2P0EA 4N7BA 3VTFA 2BFFA 3N8GA 3QUAA 3R6GA 1H42A 4RF2A 2NYUA 2ODAA 4BZXA 2VF2A 4DIEA 1ONSA 1V35A 1KJJA 1N9GA 1NNLA 1ZH8A 3HHPA 5E7QA 5AXCA 4BMPB 1YHZA 2QT0A 5DTIA 3S2YA 3ID6C 2DFKB 4AO8A 1VYTA 4IAOA 2BFEA 2D7JA 1RU3A 2XAUA 3KAJA 1W0KD 4YREA 4F4HA 4DA0A 1PG0A 4JLMA 4NICA 3U7HB 1UJCA 4A0HA 2FUG1 2ORWA 5ERYA 6PFKA 5JFGA 1U28C 2Z9BA 3E9YA 2P6UA 1D3AA 1ORWA 2G9UA 3EN0A 3IB6A 3KVNA 3OA0A 3WB0A 4K9KA 2Q3CA 1KDTA 3DB2A 2C95A 7MHTA 3IP6A 2R1TB 3SS7X 4L8WB 2UUOA 1F6WA 4M0LA 4B8ZA 4Q9JA 4QA9A 4MKZA 4JUAA 4DG8A 1TUBA 3T7RA 5IEJA 1U2DC 2J67A 1ZC4A 4XD7A 2GBIA 2BJHA 1WXXA 2WNIA 3A28A 4K05A 1QE3A 2AG6A 3D4OA 2QZPA 3FYDA 2P6NA 3GMDA 2WINI 4MV4A 5B53A 1V96A 3ZDFA 4DR4B 1D7OA 3A4NA 4C2UA 1KEPA 4GM1A 5HS4A 1TMYA 4DSNA 2FSGA 1YRQA 3E3MA 2B5WA 3AR2A 3F3YA 3WLAA 5IKXA 3SE7A 4XYEA 3N8NA 3LYHA 4L6AA 2G9ZA 2I71A 1FU4A 3MVEA 3V3KA 4PZDA 2HJHA 4PHGA 2DLDA 1DWOA 3FIJA 4UBJA 4CN9A 5JAMA 4GR9A 2BP7B 3UYKA 3ESCA 1QH9A 4DW8A 1F17A 4MVJG 3S1SA 1V37A 3MXOA 4JP5A 2OXTA 5CFNA 2Q6VA 4KV7A 4DMFA 1W30A 4AAYA 3QA9A 1K75A 4Q18A 2D06A 3BGVA 2PTGA 1N36B 4R0VA 3V7YA 4HQOA 1U80A 2QW8A 3BREA 4L4SA 4RTKA 3L46A 2N9UA 3QF7A 3THRA 1KQPA 5A9SA 5FAXA 1LF5A 1N2SA 5FA6A 1RQNA 2ZJZA 4Q16A 4TLBA 4YCAA 3IT3A 2VHEA 1ODCA 2OLEA 4WPGA 3WGYA 1H22A 2J9FB 4DQ0A 1VZ3A 2Q3JA 1W1UA 3S29A 4BFWA 3KOUA 3WS7A 3OLXA 3Q11A 4CR8A 3NDRA 3SZUA 3LK6A 5JATA 3GXOA 1JJIA 2WI8A 1GA4A 2AS0A 2R2AA 2QRGA 1AXRA 1DV2A 1CERA 1U65A 4UEQA 1HLDA 4TM8A 4V0RA 3UUWA 2O8FA 1A77A 1J90A 4IDCA 2AJDA 4HWGA 4IHQA 4N12A 2I6UA 2WE8A 2DY0A 3E0QA 4OH1A 2AYZA 1JLSA 4P1ZA 2JJ2D 2L17A 3CT6A 3WMEA 5JPCA 2BTEA 4WVFA 4YLGA 1BVRA 4KYUA 1WKCA 2NUAB 2FA9A 1ZUD1 2BM8A 3FTEA 4BO7A 3F1KA 3AESA 4OQFA 2BGJA 2M9MA 4GNRA 5SYMA 3TXYA 3OH8A 4KVGA 4BLOA 1VE1A 1X1QA 4CDRA 2MSWA 4B40A 5EE1A 4GXNA 2CY0A 1TU4A 1X77A 1TPZA 4HUQB 3G17A 4ESOA 1IQPA 4KXNA 3PR3A 3V4SA 4I1PA 2DBVO 3IVXA 3W5JA 5ADUS 3CZ4A 2PUWA 3HVIA 3H2ZA 1OD6A 1VMAA 3NBZC 4WLFA 3ZGLA 1Y8AA 2Q4BA 2F3RA 4Z7NB 1G3QA 2ZYUX 1MMFB 1MG0A 4JJ6A 3AFOA 1XX6A 2IPAB 4DLUA 1Q83A 3UVEA 4AJIA 1NUPA 1O94C 5I4CA 2IYUA 4KYIB 5AD1A 4MDHA 5CDYA 5HKOA 1DAPA 1IN4A 1N5LA 2OFWA 2VG8A 3BULA 1OC4A 1SZPA 4NENA 1LDGA 3TLBA 1QU3A 2R5FA 1CQJA 2F9FA 3KIPA 5IAAA 3KAKA 2IBMA 4JCOA 4U2BA 1KMMA 4GOJA 5DCUA 5AVSA 3BQ9A 3JAWB 3NT4A 3CUYA 1FYWA 3GEEA 2JI7A 4WHMA 5FWNA 5KDLA 2YHSA 4R6WA 1QHIA 2DT8A 3GLVA 1Y6ZA 2AHRA 1IWPB 2JCGA 1MC1A 1YULA 4Q3LA 1GPDG 4UATA 3HCFA 5B2FA 1ZRHA 3HXLA 3FYTA 3ZWOA 4WH0A 2Y05A 1ECCA 4IIJB 3UMJA 2ST1A 2F8LA 4J0HA 2YWXA 4O4IB 5HMLA 5K6AA 4D8UA 1VGVA 4PZ0A 1SBTA 4LHVA 2JW5A 4Q4HA 3UQYS 2CLSA 4N0MA 1DOHA 1DAGA 3HVKA 1NJ8A 1PI3A 3JYHA 4QDXA 1EG7A 4GOND 4TZKA 3FHOA 3K0FB 3DL4A 1S2GA 1KMIY 3UWMA 2G80A 4QGHA 5I47A 2C97A 3P45A 4I1RA 1XVIA 4EJ6A 2BMAA 3E8SA 2BJVA 5J2UA 1EQAA 4YT5A 2G5CA 3BD9A 1SVMA 3HJBA 3K0CC 1GGVA 3K9QO 5BYJA 3DBHA 4A8HA 4EY4A 3GOHA 3K2QA 3Q7TA 4IR7A 5K0TA 3CSUA 1YCDA 2PPLA 4TZ0A 1EHYA 3OOSA 4H6PA 1VIAA 4TTTS 3L8YA 4QU0A 3BD7A 1AXEA 2AUNA 2PN1A 3R5FA 3K70C 3E5NA 3PXUA 4QPCA 1UEXC 4CTNA 5C4IA 4G0VA 1NN0A 5IM5A 4BVAA 3E70C 2I55A 2I4RA 3IPRA 4AG5A 4G36A 4EUSA 3R3XA 4KXQA 4Q3DA 5T4FA 1JGTA 2H1LA 3OI7A 3CH7A 4GLLA 2FMTA 3KKNA 1UOOA 1SQ6A 3SY8A 5CCEA 5C32A 1J23A 3TW6A 3DUFB 5IMSA 1CVIA 3C5EA 3RLIA 1QOZA 2O0HA 1NLUA 1DBQA 2ZYGA 1X1EA 5FOUA 3HKEB 3AVTA 5ESWA 1SXHA 4DPLA 4GAEA 1ZISA 4J7CA 2APJA 4EHJA 4D8XA 3JQAD 4IIGA 4ZO4A 1MXHA 4R8VA 2D2VA 4G25A 1CF9A 4XLLA 5T57A 4ODIA 2IE8A 4RENA 1EP3B 3CX8A 3W2IA 2IYRA 1SXQA 3VV2A 3V00A 4YUZA 4ZD6A 4ZU6X 4NMWA 4OBBA 4AWXA 5BQ3A 2LWIA 4UTVA 2CXRA 1NBIA 2FDRA 4FONA 1BEZA 3RS7A 3KQSA 4DJDC 4OQZA 2YNMA 3VHLB 2VR1A 2D59A 4PTLA 1EFCA 4ZWNA 2QL5A 4YCNA 1D0SA 1NSTA 1H8HD 1J33A 2XGGA 1O96B 3FYSA 1PGOA 4IYJA 4OREX 2XGJA 4HPJB 1M8JA 3PIIA 1QPGA 4UHJA 3G0GA 1QH8A 1CUZA 1IONA 4R1PA 4CHGA 1NG9A 3NORA 2VDUE 4X3PA 4FOPA 4RK0A 4N5MA 1QK3A 4KR2A 4O1HA 5G3YA 2ZM5A 3SSOA 4RKQA 1KORA 1Y5RA 1VA4A 1T0IA 2CWDA 2XUQA 4AK9A 4N5LA 1XD2A 2A0YA 5KNBD 4GM0A 2Y1LA 5BY2A 1VFPA 1GNSA 5B5SA 1KE1A 3PVCA 2OMEA 2O3UA 3DF9A 2ORVA 2ZWVA 4LMAA 3WL4A 2B78A 3T94A 1JAXA 4XQCA 4YRLA 3WRXA 2ZRDA 3CLRC 4CL3A 2A58A 2W6ID 5ADWA 1V9CA 1XF9A 2PQMA 3L0SA 3P7MA 3LXUX 2GD2A 1L7XA 4C4ZA 3WB2A 2HDWA 3BILA 4A0SA 3HCNA 2J59A 4ZTUB 2FWJA 1DBPA 3UJ3X 2WU3A 1LNSA 2E4UA 4ZTBA 1L5ZA 1VKRA 2QT9A 1DIOB 4OQXA 2G40A 3GCWA 3QWBA 5CK5A 1NA5A 3V9PA 3WBKA 3ZGNA 3ESBA 2NU6A 4Y1RA 3O3NB 1FSGA 1FS4A 1ZCAA 3HKCB 4PSDA 4Q7JB 4OBEA 5CG1A 5LZ8A 4CKEA 4GFDA 4N0QA 3ZY2A 5PGMA 3RF7A 4K1LA 3ZWCA 3PQ4A 2PVSA 3EHDA 3Q3EA 4W9NA 1GUDA 5KHOC 1CKEA 4L02A 3OOYA 2ZZKA 2H1WA 3ONFA 3QLUC 1KRHA 4GPAA 3MTEA 3UHJA 1ZR2A 1X8LA 3DAGA 3L1VA 3NFYA 1NV9A 3TR5A 1X94A 3TNLA 4HBGA 3UAGA 2QTRA 3GGDA 4RYDA 2VAWA 4AYXA 1Z63A 2BBTA 4BFLA 1NVUQ 4OEHA 3JS5A 3LFHA 5EE3A 1M54A 4CTMA 3AI3A 2WFZA 4OQYA 3WRYC 1N6NA 1RYFA 1INLA 3SWWA 3ROTA 3GJ8A 3JVUA 4DVJA 3L7CA 3R3UA 5K8JB 3GLFB 1NY5A 2J5XA 5JE8A 2JF0A 2D1QA 2D5AA 2ZS8A 4NJMB 4RYLA 1JFFA 2ZI9A 1PGNA 1TK9A 2OV2A 3S2EA 1YVRA 4Z4HA 5FUYA 3RJTA 1Z0ZA 1U3FA 5EJ7A 1HLGA 2WMYA 4BMNA 4TUYA 1OZAA 1Z15A 1YRYE 2X13A 3DMHA 1GVNB 3DT8A 4CKBB 1YDGA 2DKOA 2JFBA 2PT9A 2I6GA 3ZZMA 2H52A 3BWEA 4IIXA 1F6DA 1E1CB 3KL2A 4BQQA 1IBKB 1P77A 4JLSA 4XIIA 1D2AA 3WIDA 5AKJA 4IFEA 3CX3A 4ZYLA 2Y3IA 2GM9A 2JAPA 3VX4A 1GPBA 5D87A 2ADFA 1XF1A 4XX0A 3ACBA 3BWCA 3U19A 2J9XB 1EYZA 1H2XA 2WIGA 3PC8C 4IINA 4N9WA 3EXAA 4PCAA 3TI7A 4RM3A 2ZUFA 4RSMA 5GIOE 4XYLA 1Z73A 1VP9A 4PO1A 2CCJA 4AKTA 5TPZD 4AKEA 2XNSA 2GAOA 5K99A 2YQZA 3LP8A 2GN2A 1H65A 4E46A 1GD1O 4OXRA 3ZOKA 5FPTA 2FDCA 2NZXA 5JADA 1OBHA 2P69A 3D81A 5H7XA 1Z6XA 4E4TA 4HVLA 2XZDA 3BGOS 4ASUD 3R3HA 4A2CA 2B2CA 1RLIA 3IPAA 2A9JA 4UBOA 4AF6A 1M8KA 2QDXA 4GYYA 1QYWA 1ZJWA 2A1TS 1F4PA 5AICA 4YAIA 3DKPA 1BXRB 3OMWA 3G1UA 3I9V1 4P3NA 3ABZA 2Z1DA 2Q27A 3T5DA 1JHQA 3LT0A 2WDPA 1E6WA 1LC3A 4LISA 4LFCB 1W46A 5KSZA 4BATA 5K3EA 1HT3A 2VDLB 1V1MB 4BMVA 1Z5OA 3QXSA 2W22A 4Q4CA 3WMXA 3QMPA 3C45A 1GU1A 3GRAA 4NC9A 1QFMA 4G37A 4GL2A 3FTCA 3T3NA 4E15A 2B99A 2JASA 1ES9A 1B26A 2FSSA 1NXVA 3BH6A 4E32A 5ISMA 3LFUA 3LUCA 2DFPA 3VYWA 4B83A 5T67A 1E1KA 3NAZA 1FRQA 1DEXA 1ZH0A 2OENG 4JOBA 3ANLA 3H5NA 3O84A 4ENQA 1E9EA 5AWFC 1I5OA 3Q2IA 1YQDA 4NAVA 4JNCA 3E23A 1VLVA 1E9VA 4HV4A 1CF4A 4RH0A 1DQSA 3SYLA 1FC0A 2C5LA 2HUNA 2WWGA 1GVHA 2QTMA 4LOAA 3UGKA 2R47A 5GPBA 4D9MA 3A4YA 1QONA 1J1UA 3BWMA 1EX9A 5C52B 5ITZA 5F4ZA 2QY9A 3EA5A 4O4HA 3BTSA 4RZIA 3JRWA 3SC2A 5G1PA 3RVOA 5B7GA 1X8XA 3JQFC 3P96A 3R6TA 4GI3A 4EI9A 2FU5C 3L2OB 2IPXA 3MCZA 3JPWA 1PQPA 4KE7A 2CZQA 2N1BA 4MEAA 5ETJA 1G63A 3ND8A 4RK7A 4XSHA 4E88A 3AC0A 3NHLA 5CXUA 1K6IA 1JG2A 1H23A 3LCCA 2VYQA 1ZNYA 5BNZA 5CA0F 5K9ZA 3LDHA 4MVJA 3GT4A 3KUDA 1PQYA 1YMUA 2C61A 2XNHA 4DOMA 3G2PA 2EQ5A 3F49S 3UMCA 1L7RA 1ILWA 4AT1A 4F3YA 6YASA 1IJKA 3BRSA 3EIHA 1D4FA 3IS3A 5EJEA 3STYA 4KNYA 1O1YA 4PEVA 4F6CA 2CJWB 3RAFC 2E2WA 3L43A 3UUEA 2R96A 2P67A 5T64A 3C8HA 4JLBA 4INJA 4U00A 2XVMA 3C2QA 3U6KA 1ATZA 3PEVA 1U3GA 4FJ0A 1ULUA 2WOOA 4P34A 3UFXB 3NWEA 1MC8A 4QGBA 4V2IA 1E89A 1KO4A 1QHHA 1ZWLA 2I3GA 2OHIA 3OQIB 2WPDA 4ATNA 5JROA 1YZUA 5CAEB 1LV7A 4ZO9A 4YP9A 3S5UA 3TO5A 4B5KA 4CV3A 1Q22A 4AKGA 2V0CA 3GJ6A 1T8RA 4HRXA 4ZVOA 1NBAA 2R6HA 1GL6A 2DR2A 4FFBB 3P2JA 4UBLA 1KI7A 2JLCA 1UANA 2DULA 4UUPA 3ZY4A 1F0NA 1R4MB 4HRYA 4I8XA 3BDIA 4L8LA 4MIYA 4WEOA 2KMLA 1JMKC 1T3HA 1O6GA 4KJZA 1K8ZB 1BS2A 3AKEA 3I9MA 1GTMA 1HE8B 1CY2A 1Z7EA 3K09A 3W5DA 3BWDD 2HWKA 1Q14A 1W8DA 3QPAA 1UJ6A 5FT9A 4BZPA 3OLCX 5B30A 5JANA 3T3HA 3ANSA 3WQSB 4EYKA 1A8QA 1FRVA 4OO3A 1G8YA 4WERA 1NR5A 3QU4A 2VK8A 4YGYA 2ZGVA 1EE1A 4LJAA 3ZE8A 2CV0A 4ZO6A 2G1UA 4G1BA 5C0OE 4HT3B 1K5GA 1GO2A 4AP5A 1EEXB 3TTSA 1VPVA 2MSDB 1TM3E 1TADA 4Q21A 1T35A 3VR4A 3ZDZB 3GG9A 1WDKA 1UBSB 1V39A 1N25A 3FNBA 4Z9FA 2D1FA 4CMIA 3OZFA 3NCHA 1U5BA 1TDJA 1YS4A 1F0KA 2LE0A 1E9AA 4CZ2A 3IJRA 5I9MA 3DD5A 2HY7A 2XQGA 1BGWA 1E6UA 2Z9DA 3KQTA 1X13A 1EAMA 2BKXA 2BHSA 3D2AA 3GDHA 5DW3A 3M83A 4FIDA 5FFNA 3THXA 5JO9A 1OH6A 2I2AA 4B9AA 4KQKA 3BK1A 4KK3A 5HKAA 3LBAA 3JR3A 4OIFA 4RW0A 2GO7A 1TEVA 4S1TA 3HP7A 5H3LA 3TBFA 5JQGA 1PL6A 5ERXA 1I14A 2QUBA 4WXMA 4AX8A 4EEXA 1JDZA 1FDOA 3GPIA 3ONEA 3G1WA 1P45A 3EB9A 3EZ6A 3OECA 3LQFA 2V45A 2R1UA 4M36A 1I6WA 2Q62A 4RAOA 2QXUA 4J1NA 5FBZA 3UWOA 4B7ZA 1OAOC 2VNIA 1W94A 2YYYA 1U99A 1SQGA 2X2PA 2ZK7A 4JUFA 4KNVA 4TZTA 4ZARA 4HWKA 4CCSA 1DJQA 2DHQA 4XW2A 3L7BA 5HF9A 5ITSA 2I4LA 2OP0A 3ZNNA 1UM9B 3LOQA 5EXPA 3I4LA 3SU8A 1THMA 5SV2A 3DJYA 2JFOA 1NF3A 2FOXA 2F3UA 3KOYA 2ZAYA 1L3IA 4RJ2A 5EA2A 4Z1MA 1IPHA 1TT5A 5EP3A 5JMOA 2W2KB 3L1JA 2VZ9A 2X22A 3HMKA 1W88B 2OXRA 2YWCA 3MWLA 4HPWA 4N49A 3RJMA 3AMVA 1K3FA 5BOSB 2I2WA 4RHEA 3GEIA 1CQWA 3H0EA 1KFKB 4ALMA 3N2EA 4ZMBA 1J9GA 1SCKA 1A9OA 3TOZA 2R1VB 1SIWA 2V7WA 1DWQA 3ORQA 4EUEA 1JFSA 2FNAA 3JZMA 3IQXA 1E0DA 1AKUA 1KEZA 1P4HA 2HBYA 1KRXA 2GSWA 4N54A 1W2HA 2WTMA 3BYZA 3LKBA 4L2IA 4KO8A 3HYSA 4LW8A 4REMA 5FR1A 1KO7A 5EHIA 4AY5A 4CU2A 5F9HA 3WO1A 3D8RA 5C31A 2Q5CA 1IHOA 3ANNA 3C3JA 1N3BA 2QLNA 3DBIA 4IO0A 3CLTC 2A0KA 2ZATA 3CVOA 3R7DA 3MFQA 1NBEA 4UFOA 4GSLA 1S7CA 4JQCA 4PLWA 5JMPA 2ZI3A 5BR4A 1L4FA 4C08A 3MJHA 4NBUA 1Z38A 3I9V6 4ND4A 1VPDA 3TKLA 3SIWA 4YMHA 4ZHQF 4IP0A 1V3QE 4DXAA 2AD5A 1RLJA 1E96A 4DYDA 4PANA 5FTJA 3HVHA 1C50A 5A05A 3T3PB 5LM3A 2RAUA 3E61A 5KQRA 1GADO 3ZWPA 1KKUA 4BO3A 1GPNA 4O2AB 5CB6A 1NTOA 3IVCA 5JZMA 3PSAA 1CQIB 2MCFA 1DIAA 2QDKA 4AJOA 2ZW9A 1DLIA 1TAHA 1TCBA 1BJTA 3BRCA 3PEWA 5LOVF 4KFUA 4IIHA 3G2HA 4EAAA 2WHYA 3A9CA 2W2XA 4X1YB 4TM7A 1RMTA 3TD6A 7ADHA 3MD0A 5IC6A 1JNYA 3W90A 1BXGA 2Q4DA 4R05A 4F72A 1C0LA 1EFAA 2WM3A 2WIDA 3EGDA 5H8WA 3PJEA 5C53B 3LHIA 1VCOA 1S8OA 3N8HA 4KXLA 3STWA 1ULAA 2BAGA 1UZNA 1YTUA 3PLRA 1BMDA 1RHQA 3GH3A 3ZGZA 3ZBUA 2BTQB 1Z6AA 2Y1XA 2RONA 3DCYA 4I8IA 1F1BA 1U0EA 4I50A 3IPYA 4KX5A 4XM1A 2FEMA 3ZZTA 4FFPA 1PFYA 3NBAA 4FW8A 2CLIB 2NP7A 1M1ZA 1V3TA 1E6EA 1KBQA 1AUOA 3WNVA 4MLZA 4I1IA 3GVXA 2WB4A 4JBYA 3LDAA 3PL5A 1T1JA 3AB8A 4HEHA 4A4DA 5CX1A 1R00A 3T3OA 4EGJA 3PL1A 4CF6A 5GOZA 5BN5A 4FHEA 5EKUA 4IVRA 3ZR4B 3Q6MA 4NMHA 2OYCA 3ELWA 5FUQA 2FETA 3IT2A 5HZHA 2RHRA 3LQ2A 1IXZA 2JGLA 4DYVA 3ZZ1A 2VSNA 3JQDA 4KBYA 3LHKA 1R6BX 2C4NA 1E63A 4FYMA 3ZUPA 5IXSA 1H0HA 3O4JA 1RAIA 2O52A 5DX8A 2VDWA 4TT8A 1ZZEA 1LTQA 1BH2A 3GUYA 1B42A 4R71A 1V5FA 4ALLA 1C0KA 4FT2A 5K05A 1E32A 4FS3A 1QZTA 4R7GA 3UKOA 3SEZA 1XP8A 5IDQA 3I5XA 1LLDA 1QC5A 2B1IA 2HLDD 2PLNA 1TTQB 2V1XA 3AY6A 2A88A 3HL4A 3OURA 5THXA 2DWOA 3CB4A 2REOA 4AJNA 3AQ4A 2WLSA 1J0DA 3QEMA 1YBVA 1CUSA 1WXQA 2ZR0A 4DZRA 1OXBB 4JK3A 4ZOQI 8ABPA 1SN7A 2EAUA 1TZBA 3B89A 1XLUA 3H4TA 1C7JA 2EC5A 2GYYA 3I01A 4M0MA 2RCYA 1HMPA 1OOEA 2COKA 3KXLA 5HFJA 4JUDX 3ZWWA 4WVLA 1E1LA 2Y68A 4E11A 4UREA 4DCCA 1TW3A 3PJRA 2IL1A 3L7NA 1F12A 3UB3A 3C85A 3ZWYA 5EPEA 3SJ7A 1ZK0A 1WV0A 3ETGA 4OI4A 3G9QA 1UJ2A 4MV7A 3V8VA 5D3QA 1SHUX 1DKPA 1PX0A 5J40A 5J59A 1UJNA 1RLMA 1UXOA 3V4VB 1N2CB 1NYQA 3VHRA 4HRVA 3WGNA 3WYGA 4CFYA 4DJJA 5L4SA 2XVYA 2O54A 3NEAA 4C0BA 3IAEA 4HN2A 4BQFA 2B61A 5CCDA 3NWOA 2QLLA 5AJHA 3MTGA 5DWDA 3TR6A 2E4XA 4U7WA 1JFRA 1I2AA 4HGYA 1XZBA 3EF3A 4YALA 4DQDA 3ICEA 2CHGA 2FLVA 1Y5NA 4GEKA 4XIFA 1VHJA 1L5FA 3DEFA 2BEVA 4RPKA 3LTNC 4JC4A 1FUIA 4MQMA 4X1KA 4F8JA 1JYSA 4ZYXA 1SIUA 1YOVA 3ESQA 4LXYA 4MS3A 1T25A 1ZK3A 3MCVA 3SFVA 1OJ7A 4ZI2A 1MDFA 3NI2A 2HMUA 3OPYA 4LE1A 5T41A 3WTBA 4QOGA 4CI9A 3WZ2A 3DYBA 4HVCA 2P77A 2QVCA 2C2XA 4OP1A 5IJWA 2AR9A 2DMRA 2Z4TA 4RLHA 2IHZA 2DWCA 3LWNA 1X7ZA 5B1IA 1V1RB 2NU8B 3NDPA 3RBZA 3FKQA 2ZSIA 4GS5A 4C14A 1DCMA 2FG5A 1W59A 2H54A 2PGIA 3ETJA 3QUCA 1KAMA 4H3KB 3EEQA 1DZIA 2QUAA 3FM9A 2HJVA 3H99A 4LHZA 1KZ7B 4HTAA 5JSKA 3I4CA 5FOVA 1E9SA 3BH0A 2O1SA 1DEHA 4L4UA 4P2GA 1OREA 4WJZA 4HX5A 3U62A 4DIFA 1XA3A 3WRWA 4B81A 1XHLA 3KQOA 3A1CA 3BN3A 3LO8A 3TVTA 2QN6A 4D97A 2HGSA 4DEVA 3WSTA 1MEEA 3U56A 2P3OA 2DE0X 2UYYA 1RYZA 3D2BA 4RKWA 2XE4A 3NWBA 3D2CA 2AEFA 1LH0A 3LBFA 1ODKA 5JZOA 1S4QA 3W5VA 2I9PA 5I4BA 1G8GA 4Q1BA 1R8QA 1UOEA 3RB8A 3BPSA 4K6CA 1I10A 3T1HB 2Z04A 4KTVE 1DVRA 4L8GA 3WBJA 3FKJA 5L8VA 3LA8A 1RRFA 1B8UA 1T0HB 1T4CA 4J16A 4C4AA 3OD5A 4HVAA 4ZEVA 1E5TA 1Q5PA 2QROA 1GG2A 4P53A 4CDNA 1HR0B 5EJIA 5HWSA 3PU6A 3OTWA 3AUYA 1WF6A 2ETXA 4PVCA 1NY6A 3IDZA 3GN1A 2HQOA 3PF8A 2CNBA 4A10A 1NMSA 3DFMA 2FUEA 2JLBA 1M34B 3OZGA 2P79A 2IU4A 2XTNA 1GRRA 2CK3D 1UMBA 2RC5A 4LHYA 4M8SA 4TTAA 2ZRNA 5WRFA 2ESRA 3QU7A 4N41A 2CJXA 2WU1A 1EBUA 3OJFA 4RQTA 4TV9F 2CLOB 2HL6A 4PLZA 3I73A 2QN7A 4HFNA 2VWHA 2JD1A 4Y7DA 2QA5A 5M3BA 3HSSA 1P1FA 2GSDA 2QIOA 3OT1B 3PDIA 2VH1A 1N6RA 1DQPA 5DLQC 1L4YA 3B53X 3OWOA 4IF4A 2OBXA 4F11A 4F3TA 1EAYA 1EVKA 4C03A 4X71A 3ILYA 2PWPA 2PR7A 3NUQA 3BMQB 4PZUA 5HFAA 2VP6A 5JAQA 5KOHA 2Q2NA 1GAEO 3OZTA 3WIEA 1YHYA 4WQMA 4P86A 1GGEA 2BKEA 2GEBA 4I6JA 1DRWA 4P58A 3FPJA 3A2LA 3FF1A 3EE6A 4A36A 3HGTA 2Q3DA 1GZ5A 2QMQA 1E1DA 2PX5A 3UPUA 4X7BA 3R7SA 3SP1A 4RABA 5A6SB 1UPBA 3O4HA 3AR6A 4F45A 1WD5A 1E1NA 4NULA 2K6GA 2WSBA 2GH1A 4OV6B 4DANA 2JHAA 2XLCA 1R16A 5CW2A 2C9OA 1QYXA 1ZH4A 1Q44A 3GPCA 2VDNB 1DKMA 3S5JA 1NASA 1YK0A 4GMHA 1T2FA 3U3ZA 1M2WA 3N53A 1M6WA 3IAUA 5J63A 2MSEB 1Y9JA 1VJ5A 1FNBA 2HEGA 1QG2A 3KQMA 3VTKA 1UPUA 2BFDB 4BNFA 5L51A 3I61A 3VKWA 1HM5A 1ISJA 4H7FA 5SY9A 1ADJA 4K9PA 5FBHA 2OG2A 4IWYA 5E7JA 2B7LA 2CDNA 4JL8A 2N3ZA 5ECDA 4BJ6A 4JI4B 3PJFA 4CW7A 2BWJA 4MX8A 1OI7A 4XUEA 1Q3HA 3I2GA 2REQB 4PC7A 4ARSA 2FEKA 2XYGA 5C8YB 4N48A 4AZTA 2G9QA 3PJDA 1EBFA 4ZOLA 1B23P 1OLSB 1UBFA 3IB3A 1UZAA 1WULS 3MS4A 5KO2A 2W6JD 1V1JA 3QLJA 1ZM3A 1AS3A 3P2MA 4R2XA 1W7AA 4FVTA 4LHXA 1GGNA 1QUEA 4YAGA 5BMVF 3LPDA 1MA3A 1AQNA 3OUTA 1WZIA 2CB0A 1M9NA 4C30A 4O5OA 3PNVA 5JU6A 1QRRA 3MRXA 2B4KA 4JGGA 4X7RA 5DDIP 2GBLA 1Y3HA 4M6WB 3CO5A 3OM8A 4QG7A 2YUTA 2WSSD 5FRDA 4Z6KA 1JR6A 1FRFS 3SBXA 1L7NA 2Z6UA 4DPKA 1E3IA 4MDYA 3UMBA 2UZIR 1HFJA 3OY2A 4OK3A 1H05A 4RHXA 1E1RD 5JVDF 4X93A 3ZYCA 1TJ5A 1Y8RB 2IGTA 4ZCIA 1EJ2A 2P6RA 2ZAGA 4EZBA 3WICA 5KI6A 2X6RA 1H6AA 3FTQA 3KD2A 2FP4A 3JWIA 3FHJA 3HY4A 4MV8A 1JI3A 3TOXA 4P4SA 2YYAA 3G1TA 2QTWB 4J2HA 3RU3A 1M2OB 3O1IC 1DG1G 4RX1A 4YV7A 5KYKA 5EJ4A 3SZLA 2VTBA 1H5QA 3GFGA 5EMLA 4GZ5A 3GNSA 4NPCA 1FYFA 4F0JA 1B8NA 2O5RA 2XDAA 2PKXA 2TECE 1KQNA 4NJOA 3LAWA 1PCXA 4TLDA 3UA4A 5LQDA 2PUAA 3DLIA 1D2GA 1MABA 4A6XA 1NRJB 2FMHA