4ABTA

Crystal structure of type iif restriction endonuclease ngomiv with cognate uncleaved dna
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
286
structure length
286
Chain Sequence
MQPLFTQERRIFHKKLLDGNILATNNRGVVSNADGSNTRSFNIAKGIADLLHSETVSERLPGQTSGNAFEAICSEFVQSAFEKLQHIRPGDWNVKQVGSRNRLEIARYQQYAHLTALAKAAEENPELAAALGSDYTITPDIIVTRNLIADAEINRNEFLVDENIATYASLRAGNGNMPLLHASISCKWTIRSDRAQNARSEGLNLVRNRKGRLPHIVVVTAEPTPSRISSIALGTGEIDCVYHFALYELEQILQSLNYEDALDLFYIMVNGKRLKDISDLPLDLAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYPE-2 RESTRICTION ENZYME NGOMIV
publication title Structure of Type Iif Restriction Endonuclease Ngomiv with Cognate Uncleaved DNA
rcsb
source organism Neisseria gonorrhoeae
molecule tags Hydrolase/dna
total genus 97
structure length 286
sequence length 286
chains with identical sequence B
ec nomenclature ec 3.1.21.4: Type II site-specific deoxyribonuclease.
pdb deposition date 2011-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09015 NgoMIV_restric NgoMIV restriction enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Type-2 restriction enzyme NgoMIV 4abtA00
4ABTA 1FIUA
chains in the Genus database with same CATH superfamily
3V2UA 3ML1A 1E2LA 4RAQA 1ECLA 4UXHA 1QUFA 3K6JA 1KEEA 3NT4A 1HBJA 2QMEA 3UW3A 3VA7A 3WA7A 4E6PA 3KB2A 3F6CA 1HMYA 3H1FA 4B3FX 1GPBA 1VLZA 2WKRA 1OH5A 4HAXA 3R7AA 3MG9A 1DEAA 1I5EA 2VPYA 1RYEA 3FLAA 3I6IA 4MVJE 2I6FA 1C0PA 2FZEA 2QTTA 2W2KB 4QGBA 4Q1VA 3LOUA 5AUOB 3BRWD 3PTZA 2E87A 4IJUA 5LU9A 1JNXX 3QF7A 1N78A 4ZCLA 2P8SA 1UOOA 5MFPA 3UMBA 3EZNA 2WFLB 1CRPA 3O38A 3LJKA 3HJGA 4Y98A 1S2MA 2Q3DA 3I32A 2LP4Y 4WCFA 1H2EA 2AWNA 5ESWA 2G4VA 3U39A 3T35A 2GJ8A 1OHHD 2FN9A 2HK7A 5KUTA 4ETWA 2W9XA 3PXAA 4TM8A 1DKMA 4RZSA 3JY6A 4YCMA 5FX2A 2PMBA 1Q0UA 2VI5A 3BTSA 1CB0A 2E4UA 2VJBA 2ZFUA 2X3YA 5EPUA 3HE3A 4CDRA 1UBSB 1E5LA 4KAXA 1M0WA 1MENA 1GZSA 4C30A 2X0EA 4BO4A 1Z0KA 5ALQA 5BO5A 4HQOA 4MMXB 1EPUA 4JLNA 4QZVA 3VDXA 4D4IA 1N6NA 5A5VA 4DIOA 1GYPA 1EFRA 1PJBA 4QDXA 4F71A 4LXHA 4W1QA 5AOBA 2OZKA 1XD2B 4C5AA 2XNJA 3L0CA 1NVGA 1GKLA 2PKYX 4X85A 4EHJA 2CJPA 3WGZA 3VKFA 1NMEA 3F1LA 3LBIA 1KO7A 1FC0A 3N8DA 4POAA 1R6DA 3R7WA 1BFDA 5FI3A 4H35A 3EAQA 2OWDA 4YN3A 3UH0A 4XW2A 2WUFA 2JKYA 3B9RA 4NCHA 5B58C 2JIPA 4ZV7A 5IKOA 5EIBD 3C45A 1OB5A 2HJRA 1E4EA 3HSSA 5T8KA 4BXOB 4KK3A 2XBUA 2IXTA 3LA8A 1OB2A 4HO1X 1CDEA 2FQQA 2RAFA 1FUUA 4LMRA 2JPDA 3ES9A 3PX3A 2CKDA 3KEGA 1TFUA 3EMBA 5EOVA 1P1FA 1XEAA 2CXQA 3FTPA 3D3QA 3UYLA 3A2KA 3FPGA 3RLFA 2OZEA 1B42A 2PS0A 1KOLA 2BT4A 3EIEA 1KKMA 1GSHA 1U8UA 3QJ5A 4GSLA 2JLXA 2IPXA 1UFVA 1CEEA 2YIMA 3EGVA 4BO5A 3NYWA 1U0JA 4J0CA 4AJPA 1JKMA 2IZZA 1XPJA 3H5VA 4NMXB 2Q3HA 4ZD6A 1GTSA 4NEGA 1VIDA 1YS9A 2YJGA 1DTWB 1YUBA 4FDLA 5HIIA 5T41A 4AXBA 3D7LA 3KR1A 3ZK9A 1FYFA 4DJJA 4ZARA 1H4SA 2E5WA 3NHKA 1NN1A 5AESA 3JASA 3A1VA 4GBJA 4ZA2A 5GM1A 3W8FA 5HZMA 4YAIA 3KHSA 2ZUSA 2HAEA 3F8TA 3I83A 1K1EA 2O7RA 2C9OA 1XXLA 3P9XA 4PZYA 1R6XA 1GFZA 2HDHA 3E3OA 3MJDA 2EFYA 3ZBUA 2FMHA 3A9WA 1GRVA 4HJRA 2AK3A 1ISIA 4JA0A 1VG1A 3BZWA 1N6PA 1IXKA 1G5IA 1ESEA 1BWPA 2P9QA 2PPLA 3Q41A 3EUWA 4G4IA 4JENA 1L8LA 1MQ9A 4LOIA 5CT8A 3IBYA 3ZK7A 2YFHA 1TADA 4DDVA 2OQRA 4XIGS 3UGQA 4ZU3A 1NOKA 2NV6A 1SA0B 3F0TA 4TKZA 2BF7A 3O9ZA 3HB9A 1ZI8A 2B8NA 4OHUA 4HK4A 2BGNA 1O94C 3G2JA 4RORA 3IQDB 5KU7A 1XO1A 4LOKA 2FNAA 3C6YA 3OE1A 4JC8A 3SLRA 3F6PA 3IDSA 5FL7D 5K51A 1G3IA 4HX5A 4MP6A 3AU9A 4I8DA 3M6IA 5CDSA 4PSVA 1UCFA 1VJDA 3B7PA 3EVGA 4BFXA 5AW1A 1CLUA 1QH9A 3JQFA 4MPTA 4BEVA 4X7MA 1JQEA 4V39A 4X62B 3B3AA 3OG9A 4HI0E 4M0FA 1EA7A 2IK8A 2HI0A 4JEHA 2GASA 3FKSD 5FWAA 3A31A 4ZI2A 1MVNA 2QM3A 1ETUA 4X6UA 3W7BA 5FOWA 1RACA 3O1LA 1P31A 4LBYA 3L6RA 1HMPA 2XBMA 1EK2A 2GERA 2RIRA 3D8SA 1IVSA 1NBME 4HWRA 2RSLA 2WWYA 1TT5A 4YO8A 1ZAKA 3Q5DA 1GT91 5BURA 4US2R 4BQQA 4ZGBA 3MSCA 1VA4A 2F3RA 1L8XA 1FPQA 4NBUA 4M98A 5B7NA 5JMTA 3HM2A 4RL6A 4L9SA 1OSNA 2CN1A 4AG6A 2YVLA 3CX8A 1UR5A 3OTWA 2BFBA 1V25A 2HY7A 1LPOA 3B8EA 2P8JA 1FCJA 3RWOA 3WIUA 3BX1A 3MM4A 3M6XA 3C3BA 4OHWA 1YRAA 4N0MA 4I6GA 2H1FA 2AK2A 4OJQA 2YWFA 3QPDA 2RG1A 1A2BA 5HF8A 1V3QE 2ZR7A 3GVHA 4B71A 4A9AA 3I6MA 3OE7D 1YS4A 3TFQA 3AJEA 1UKVY 2F1IA 1YDHA 3JQGA 4TZKA 1M6WA 1WY7A 5P21A 3ZGZA 3A06A 1HYEA 5DM70 4RA9A 5JEDA 1KPHA 3MQ2A 1THZA 3EXHA 4QT0A 4RHTA 1MNQA 4D9MA 4W6ZA 2EFDB 1T6XA 3CRNA 1Z83A 3UG7A 4Z4FA 4GMDA 5IN4A 4AJ4A 2P77A 1Y5IA 3BJRA 3HCNA 4KWIA 4WZBB 1WPGA 2CDNA 4YRMA 4NSNA 3KQLA 1B76A 1KYTA 1NI3A 1P9NA 2JBAA 3LHSA 4BGVA 5LJLA 1Y1PA 3G5TA 5K5EA 4KAFA 4BDTA 2YRFA 3M5CA 1B93A 2FR1A 2QD2A 3Q3IA 3WL6A 4EP1A 1NW8A 4MR7B 2UXBB 1XA3A 1XEXA 1QIJA 3WSWA 5CDHA 3IUNA 1B00A 3EN0A 2QM0A 4ZP1A 1JKFA 1WUTA 4J7CA 3BWEA 5EUMA 4EUHA 4AJOA 5B3KA 1A71A 4OVKA 5AVRA 1BDIA 1TX4B 1E99A 2WHPA 3ZU5A 2FRXA 2ZE6A 3JSAA 2QQGA 5CB4F 2CFTA 4XYLA 1P4JA 1R6VA 4ITVA 1L8OA 2FGKA 2XUAA 1PR6A 1XAHA 3GGCA 2AC4A 4L16A 2IE8A 4ZVQA 1G63A 1PJSA 2H2DA 1QGED 3AI3A 3KEMA 2QLBA 4O4LB 5FJJA 4QU0A 1FLNA 3HPQA 5TQVA 3VR6H 2ZVPX 3O4FA 4FT4A 2I4IA 3PNLA 5COBA 5H7XA 4BNJA 1PJCA 4IF4A 4IHJA 4M7RA 3ZLJA 2OFXA 2Q0SA 2NVWA 3CF4G 3HEBA 4M1YA 5U4QA 2H5IA 5DNEA 3ZR4B 1MUUA 4I4TF 5B6PA 1F0NA 4OKSA 1M2WA 3TAXA 3VR3A 1Y8ZA 3LP8A 4Q00A 3ZCXA 3ND9A 1CY7A 5JCOC 2GUGA 1KL7A 2B1RA 1V35A 3ZH2A 4LDPA 2WAAA 4L0MA 4WLNA 3RKUA 3A2MA 2CMFA 2WMOB 3ETLA 5ETJA 1LX7A 1ZD2P 4FK8A 4FOSA 4I4LA 2GN2A 2CNLA 4HGQA 4G36A 1QP7A 2QE7A 3L7OA 4R2MA 5K09A 1UFKA 3A1FA 3AFGA 3BKWA 3D5QA 3OOYA 3Q9SA 4GHWA 2O6LA 3HG7A 4TXJA 3ZDZB 3FYSA 4RK4A 5THKA 3EPLA 4HUQA 4C0QC 1D7OA 4GR4A 4HLNA 4E2FA 1QBKC 3K0CA 4XX0A 4DANA 3KOWA 2CVPA 3VJLA 4FYKA 5JU6A 2EZ4A 3HR8A 4U2KA 3TTXA 4LRQA 2ES4A 4NU6A 3H8WA 3SX0A 4C7VA 1TC2A 4RFVA 4MA4A 5BMVB 1KDYA 2PZJA 1CY0A 1JDBC 2JH3A 2QTLA 2Z58A 3FHCB 3OLQA 4RF3A 3V34A 1YCDA 3IP5A 4AG3A 1CV2A 1OC4A 1XZQA 2HA0A 1JDPA 4XARA 3MTBA 5K6AA 10MHA 1ADGA 1IN5A 1IAVA 1JVSA 1YI8A 3GNTA 1JFFA 2RHWA 1XKLA 4BC0A 1JPUA 4OXNA 2VWQA 2VDJA 2ZYRA 1CD5A 3E82A 3VZCA 1N2JA 5TQ2A 4ZVLA 3PFKA 3BJMA 4MW5A 4QXMA 1W4CA 2AYZA 3RK4A 1P7CA 4DLNA 3PT5A 2MCFA 3WB1A 5D86A 1M2VB 3IIEA 5DLQC 5DU2A 2PR2A 3TR0A 3CA8A 3PFWO 2PD3A 3P0RA 1K9VF 1XZBA 2YJTD 3PR2B 5LOVF 2XTZA 3ZV5A 3L4BA 1XDSA 3CLHA 3GHHA 5LZ9A 1J22A 3GG9A 4X8HA 1IG0A 1IHYA 3DLPX 3WV4A 3KALA 2JHCA 1B7GO 1YRLA 3CLTC 3D7SA 3ETDA 1EDBA 1ES9A 1IZ7A 3MMZA 1GTG1 4IJ6A 4R01A 2O06A 4D6YA 3RAEC 4M36A 5B7PA 1YA6A 2IHTA 4NI5A 2XB6A 3D0RA 3TPCA 3LP5A 4EBFA 4Z1OA 5TPWA 1N8NA 1QGDA 1NE2A 1SPBS 2GAIA 5SZIA 5IS2A 1WXIA 4TMXA 1HQCA 3LTEA 1C3LA 3AV3A 4RENA 4PY2A 5F76A 2KE5A 1UQRA 3DGFC 1WMEA 5TVKA 1TUBB 4LC0A 3PE6A 3CVUA 1JG4A 3NTQA 2OXRA 4BNHA 3FKQA 1LKZA 3FPCA 2V8OA 1DX4A 1UZAA 2OB1A 4YONB 5DN6D 1VZ2A 1QCCA 2I4RA 2WQZA 2XQJA 1XZDA 3W2TA 5LUBA 3TIFA 2ZEJA 1FXWA 1W48A 3JSXA 2PZFA 1D04A 3OZFA 3SYMA 4CE6A 2R4QA 3DL4A 2BGGA 3M7IA 4BNZA 5AICA 2DFLA 3UHAA 4QWMA 4Z1MD 1WDMA 4GQBA 3IQGX 5HILA 1M0TA 3KJZA 4EDFA 3LE8A 4D43A 4GLJA 2HEIA 1OGJA 1J00A 1H9BA 2BZGA 4YAGA 2WNSA 3IC5A 1A8UA 4GX2A 4HMPA 5EIAA 4H7FA 4FIZA 1QB7A 2B1JA 3L43A 1QHIA 2QVZX 3B2QA 2HJVA 4WDRA 3U80A 4B82A 3DDHA 5LP6A 1P3DA 3TLYA 1A76A 1T43A 3Q8KA 1A1VA 3M1YA 4LJYA 4B2LA 1EEXB 1L0BA 5DM60 2A0YA 4MDEA 1P91A 3M2TA 3EHEA 4XCXA 4BEJA 4ZPXA 2VHYA 1TRKA 4RLQA 1UBFA 4XTCS 1J5PA 1GCOA 3ROKA 1G5HA 1LW7A 2BM0A 2CLDX 1WAMA 3FCAA 3W5HA 3CUWA 2HLHA 1JBQA 4G4SP 4LJLA 1DX6A 1ORIA 2C03A 5IK2D 5DSXA 1XZJA 4RTQA 5CUQA 1MZVA 1XMXA 5B58T 5BR1A 1QVAA 4CUKA 1K7EB 2W2KA 3CISA 3LQFA 1MJFA 5F5XA 3WVNA 1YTUA 2NX2A 3RVDA 4UTNA 5ALOA 3OOSA 1FMFA 1U0OC 1QM5A 4KV7A 3ZWAA 2B30A 3WB0A 1UOEA 3C6XA 5CM9C 1YMQA 5DWQA 3C3XA 5A03A 1MDFA 2FSUA 2ZSIA 3C7CB 3EEQA 1ZMBA 3EWIA 4GVLA 4RMJA 3RU2A 4F46A 4MDYA 3PEWA 5CIYA 1GPWB 3HSYA 4Q24A 4C4OA 2WUDA 5IAKA 1LV7A 2F17A 2WJHA 2Z2JA 3NVMB 4LOAA 4A6EA 3E1KA 1QR6A 1KYQA 3LD9A 5F1PA 3WQQA 5AVSA 4K6OA 4GL2A 3CTPA 3EIQA 1F5SA 1NY6A 3GZTB 2XOXA 5IF3A 3RC8A 1T2AA 2NO4A 3FUWA 4FSHA 3DMYA 4J0FA 5KNCA 1E4VA 1VI5A 5K0NA 1AN9A 3CURA 1R1DA 1K5HA 3ORYA 1SCBA 2WYIA 1J49A 2DM6A 1RW4A 3R3UA 4JR2A 5JYCA 5J2UF 1X70A 1LLFA 1V5GA 4OGFA 3X2SA 4DXHA 3IT2A 1MJHA 5IJWA 2G1JA 4BVGA 4ZK6A 2RHDA 2FFQA 2ZDGA 1TKRA 2OXIA 1OAOC 1N0WA 3IV7A 4WXPA 3TIXB 5JDCA 1JEQA 3LOPA 1MVLA 2SKCA 4U1RA 2QLLA 4LRWA 5JW6A 2DX7A 2HDNB 1UBOS 2O2CA 3TXAA 2A9OA 1X1QA 3MSXA 1Z4NA 2ORYA 3CLUC 3VPDA 4L4XA 4X71A 4DQ0A 4BXOA 2FX3A 4H3VA 3UT5B 2ZM6B 3N3BC 1GNPA 1PQWA 1YFJA 3G6WA 3RSLA 2IH4A 1EHYA 2F6RA 2G3YA 5LMCA 2IS2A 1JA1A 4MPRA 4NJEB 1OKKA 3WWEA 1TVKB 1ZK2A 3RUEA 1M6NA 1U28C 1VPEA 1OV4A 4JP8A 4PPYA 3HP4A 2HK8A 4ZDIA 2VQEB 3P32A 2DVMA 4MP8A 2BLNA 4RW0A 2IZ7A 3T99A 3WKCA 4MWTA 3IUBA 1KP3A 5IVIA 5AVQA 3T7TA 4IWYA 4RS3A 4S0ZA 1UBMS 1H8HA 3D8UA 3IJPA 3ZDYB 4G2NA 2SECE 1TOAA 1U8ZA 3IPRA 1BRTA 3LI2A 2J9RA 2QP9X 3NWPA 3OQPA 5K6AC 5AVKA 1G1MA 3EXIB 2PRSA 5EQDA 1N2EA 2J4DA 4FKMA 2ORWA 1UBCA 3R4CA 4C20A 4ZICA 3ZD7A 2BD0A 5KCZA 1QVVA 2QLMA 4EYOA 4WBNF 4KWCA 3VH3A 1FRNA 3EGCA 4JBNA 2NU6B 4D80A 1OXUA 4FUTA 2AX3A 4IINA 4OXQA 3K1JA 5K8LA 4FDTA 5JQWA 1MABB 3DEHA 4GMKA 5TF0A 4FPXA 1RRGA 1MV8A 1DV2A 5ALTA 3S44A 5ES3A 1QIKA 4DRZA 1HFWA 4DDHA 4QG3A 1UBRS 5IXJA 3LY9A 4W5QA 1SRQA 3AR3A 4CPDA 2XUIA 2Z6QA 2OGWA 5G1OA 4P3KA 3WL3A 4C06A 1OH6A 4ZEWA 1KJZA 2OFWA 1AH2A 3NDRA 3PK0A 4HLUA 3IUPA 2PL9A 3K15A 1AUPA 3G7SA 5LLSA 2W4MA 4AMYA 4EQ6B 1FFSA 1FVHA 2MDTA 2VRCD 4XM2A 4GWKA 1LK0A 1G18A 3O74A 4JFRA 4MKFA 1J39A 4DS3A 1RCUA 1LU9A 3MLBA 1VPTA 2DKOA 3MWDB 4UUMA 4UVEA 1IZ8A 2WU4A 3AI1A 2ZGVA 3TUJC 2O14A 5AW6A 2EWMA 3NTLA 4HXGA 1LPAB 1XKQA 3PQ7A 2A0KA 3GNLA 4M60A 3OPYI 3EW9A 1ISPA 1Y7PA 2C94A 2FMIA 2JIBA 4Y2UA 3R24A 3MS4A 1U80A 1QHSA 2ZVJA 3AILA 5T4BA 1QK5A 5ESXA 4BNKA 5BNIA 3DPUA 1FNSA 5B3JA 1E6WA 3AR6A 3B48A 4H3KB 3U17A 2PPVA 1XVIA 5A2QA 2UZ3A 5FLKA 3AYZB 4KRXA 4LF6B 4ZVNA 1AD2A 2JGFA 3QVWA 2JGDB 4L8FA 3ZHVA 3ROEA 4FM9A 5EIEA 1V45E 2BBWA 3HVKA 4OHCA 4HNRA 4ECEA 3L7CA 4TSRA 1JEJA 1Z08A 3G8AA 3ONEA 3U9TA 4DNFA 2CK3D 1GARA 5JNLA 5MN5A 4CV2A 1GTL1 2A58A 1USGA 3AF5A 2BM8A 3HA2A 4RTKA 1WVMA 3KB1A 4OLBA 4MVJF 3K1YA 3D6UA 3DMTC 4ZYWA 4U7HA 4CEIA 2EFJA 4WZ6A 4DR7B 2GPAA 3BGSA 3HHPA 3C5VA 3PCTA 4OHYA 3DZ8A 2WU0A 1J2TA 4HTFB 1NUSA 2BEWB 3N3AC 4CMEA 4R68A 4Z0TA 1G8MA 4WV3A 3IJEB 5J4VA 1DPFA 1KK1A 2ZKIA 3EFOB 3RDPA 4P5PA 4BGIA 4QXAA 5CD9A 2Z8YA 3S2FA 4YT2A 1TVCA 4P8RA 3W1WA 2PS9A 1U0LA 3L07A 4D41A 3UJCA 1YBAA 3HDVA 4O29A 4ZT7A 1E8DA 2RJ3A 4RLHA 3KTAB 1ZC3A 1QX4A 4J29A 1GZ4A 3B6ZA 2A94A 2Z83A 5C7IO 4I6JA 1JNYA 3P19A 1ADFA 5BNFA 3S5JA 4LDAA 2DQZA 4IIYA 4M8KA 2PRZA 1UXHA 4YAOA 3RRZA 2G6BA 3B12A 3SKVA 3UANA 3OJCA 1BHO1 3OLWA 1LBIA 1N5JA 3PC8A 3ZJVA 3PQ8A 2JH9A 4CV1A 2E2WA 3GXOA 3OE5A 4OUDB 4YRTA 1WB9A 4F4IA 5I6DA 3G7UA 1BJTA 4R16A 2G4CA 4RZIA 2NO6A 4P98A 1L5KA 1CUCA 1E5QA 1MRZA 3I2FA 3CW8X 3BK2A 4YMWA 2CXRA 1N9KA 2RK4A 5THXA 4QWWA 2FKAA 4UAJA 3FA2A 4NZYA 5AVUA 1SKAA 4OJMX 4A0FA 1GT6A 2NQ2C 3LHKA 1S0UA 4LWZA 2BUBA 3DFKA 2IYXA 2GJ4A 1Y5MA 2C29D 3BZUA 4R7TA 1NI5A 4BJ1A 1N5DA 3GJRA 3JD3A 2AF4C 1MOSA 4MUKA 5CNMA 1CQJB 4FZVA 5ANRB 3WI7A 1BROA 4YEDA 4QUHA 3ASYA 5BNZA 5AH0A 5F23A 4MKRA 2F2TA 4Q3AA 3OKFA 1ISSA 3RIGA 1H0HA 3K8YA 3KVOA 2EBHX 1K6MA 2IHJA 1YIDA 3Q9NA 4PVDA 4XVQA 1ZDMA 4HDMB 4Q9AA 3FR8A 4FSXA 5AI0A 4AZ0A 3FDXA 2GRJA 3HCOA 3R7SA 1MB9A 1MB0A 2VXOA 1U7DA 1YE8A 4Q1EA 4YQEA 4DMFA 4UAUA 4J3NA 2NZ2A 1UP7A 1AHNA 5I7VA 1TGVA 3TPFA 4RFSB 1NZDA 1MXFA 2EZTA 1HLDA 1XVAA 4JOSA 2ZWIA 4NNJA 4ATNA 1FNNA 2YR0A 4MW6A 4DV1B 3CC8A 4NEHB 4FYHA 1FTYA 2JFNA 1APBA 3AM5A 4RTPA 1CUWA 1RRVA 1X80B 3F8WA 3SBOA 1PTJC 3T4XA 5E0KB 3DHEA 3IQXA 1GNLA 3KG2A 2ZWOA 4KPUA 5F3WB 2FW9A 2I87A 1TEZA 5KQRA 1JECA 1JDTA 1VB3A 1V6AA 2WI8A 3ETJA 3LY8A 4LK3A 4ILEA 3ROTA 4Q01A 4AIIA 1I1QB 2FW6A 3A6HA 3QVVA 4DPMA 4U2EA 3A6PC 1QFJA 1J2EA 1Q1AA 1U7XA 3BMCB 1UC5B 2RAVA 3O8DA 1X15A 3D4LA 1TM5E 2AMFA 2DQSA 3B8HA 3N7UA 1M2VA 1YZVA 4REQB 1TQ4A 1ZCAA 2HF7A 2QUJA 4BN4A 3VO9A 4EK9A 3ANYB 1ZGGA 4KYUA 1S8AA 4TSKA 2FV8A 1DQRA 3B1KA 3FOAA 3BTOA 3KSUA 4GX1A 4QOFA 3QBTA 5IEBA 2R48A 4Z3KA 5A9SB 4Z4IA 3B5EA 2E6KA 2R1TA 4HNSA 1T6YA 2OO5C 2Y4OA 4PYNA 1U8YA 5A3VA 5HS6A 3GRRA 3T4UA 3OF2A 1C8BA 1JFRA 5KNCH 4TV9B 1ZESA 4OHXA 1JKXA 5FA5A 1DO2A 1RI1A 1XU9A 1VJRA 3QVMA 5DJ5A 3LUPA 2EJVA 3SZUA 1TAUA 3U3JA 1DFGA 1JEAA 2HJSA 3EDRA 4FGUA 4E33A 3HGQA 5JBNA 1DC7A 2VHQA 1NRIA 1P9RA 4EI2A 5JNTA 4BV2A 3JX9A 5SZKB 2XD4A 3VPGA 1PJ8A 3I5AA 3IA2A 2TMGA 2R5NA 1HYQA 2AF3C 4IV5A 1TUBA 4R2XA 3C4VA 5C80A 3H0KA 5HTKA 4F96A 4YV2A 5FJIA 3M6VA 5IX8A 4P4GA 4KN9S 2IW1A 1GUYA 2YOGA 3BFKA 3WS7A 1LNZA 1XDGA 2Z3ZA 4OHMA 1WZ2A 2HLDA 2BI7A 3NORA 1Q0QA 2PBZA 5AKKA 1BJKA 4C21A 4EX7A 1YK1A 2BHTA 2OD7A 1ONBA 4RVHA 3DEKA 2B9EA 4DJTA 1ZU4A 2GZAA 3EUFA 4G4JA 4EAAA 1E5VA 4HDNB 1JDJA 4TX1A 4Q9KA 5U4XA 1TQ8A 2J41A 3GZJA 4BBZA 1AKQA 2VUSA 4C87A 4JXZA 4HEQA 1X42A 4RPHA 2Q8QA 1U3UA 3STXA 1I33A 1U04A 3AUTA 1YVDA 3MWKA 5C31A 3HKDB 4B5LA 1Y89A 3DG9A 1W5EA 4PTYA 5LNK1 5LXTB 4IOKA 1RKUA 3HABA 4EKIA 3KJQA 1L5OA 4GSKA 4O5OA 4CL2A 5A7GA 4B33A 3KKPA 2O2IA 4ZDWA 2PN1A 1LEHA 2ZAIA 3I3SR 4RZ3A 2GK3A 1JLRA 3BHNA 3DYIA 4OU4A 5K6TA 4GGPA 2FQXA 1XZLA 3L0OA 3LVBA 5JPCA 3SVZA 5ELMA 3AVVA 1Q20A 3P26A 3K30A 3MBOA 3TNLA 721PA 2RH8A 4CEJB 3WGNA 3DAGA 1RKVA 5CM8B 1Q0PA 1KOFA 2YTZA 3I9NA 3OZXA 4D98A 3FBWA 2FZGA 1F7VA 3FNQA 3SZMA 4E5DA 4EA9A 4TUYF 1H3EA 1O6FA 5EUQB 1KTIA 1ZL2A 2GZ1A 3L8MA 1VZ3A 2B92A 2R6FA 1Q7EA 4HN9A 1ZJ5A 2VP6A 3TE6A 4FGKA 1Q7GA 1D1QA 1PL6A 1XNJA 3DVSX 4UXJA 4D2IA 1DXQA 5E95A 3KXIA 2VUIB 2E0IA 4MPDA 5EYPB 3S2IA 4LF9B 5DGCA 1CSEE 1C9EA 1N9GB 1OT3A 1P9WA 2YINC 3DAHA 4XR4A 4XIFA 3DOIA 1LQTA 4MPPA 1KXJA 3PYMA 1KZHA 1AO3A 3K5HA 5MN4A 1XZCA 2FXIA 4MIKA 1R0BA 5DWDA 3TQCA 1FP7A 2QOEA 4CKCB 1DJLA 1TLFA 1U1DA 2B8EA 4NCIA 4XGNA 4BQPA 1TYZA 4EG1A 4PHFA 2WJ4A 4IZHA 3TEMA 1J0AA 4KNVA 2JAXA 2QX6A 3EXFB 1DDIA 4Y1RA 4EMBA 3O3MB 2FWIA 3EEOA 1QYDA 1A9RA 1NVTA 2PAFA 4Q16A 1LSJA 3QXJA 5AQEA 1DDGA 4ZANA 4XWAA 1C7RA 1ZH6A 1Y9EA 1TJYA 5HCNA 3PU6A 2IYAA 1I80A 2WJ3A 3AVQA 2XA9A 4RZXA 3FWYA 3TTUA 4ZGGA 4N76A 4UVHA 3EIFA 1NSYA 1Q84A 3FPLA 4HH0A 1BSVA 2QQFA 3CEMA 3RSHA 3FGNA 2BFCB 2HPHA 4CUZA 3TEFA 1XZGA 1G60A 1F60A 4KZKA 1PGQA 3UT5A 1XNRB 3WJ1A 2I7CA 3EFEA 1FTNA 5D7NA 4D3ZA 4DEYA 1BXZA 1SVSA 2A0XA 2D2FA 2YHBA 1QFSA 2V4ZA 2G1AA 3GBSA 2FSGA 3LWBA 4CEHB 3WLHA 3GGSA 2ZRIA 2QZ9A 3CYFA 1IBLB 1CP3A 2W0MA 3V6LA 4NE9A 1PWXA 4Y0NA 4PFJA 13PKA 4YMUA 1CZNA 3AUKA 1SZJG 1ULAA 2QTWB 1BXKA 1U1GA 3FZEA 4HN4B 1UFRA 2G82A 4MHOA 4HRVA 3Q0TA 4LV8B 4JUCA 2VAPA 3MWLA 1KPIA 2W43A 5DULA 3O95A 3MUOA 5C4MA 3EXIA 1G19A 2H2AA 2Z30A 5LIPA 5H4HA 3SEZA 1JSXA 5KB3A 8MHTA 1W2WB 2AEEA 4N5HX 5BV1A 1XSEA 3T41A 3O0TA 4NBTA 4JBGA 4H7PA 5JZMA 3PIRA 4D4HA 1J0DA 1X14A 2NU6A 4KEAA 5KKCA 2XTMA 2ZSFA 4GPIB 1B4DA 2I55A 4UUQA 2FHSA 2RHOA 3A04A 4NH0A 5KSPA 4BWYA 4YACA 3U44A 1QQAA 1MABA 3OQIB 1HOXA 3RQSA 1ULTA 4ZCPA 3IMGA 4G5SA 3CJQA 2NUBA 3WYNA 4AKTA 4FC6A 1L4GA 1T0BA 2HTEA 3DB1A 5FR1A 2IDZA 4ZDKA 3O47A 5AVXA 3GVIA 4OI1A 1W35A 4RCYA 4MUEA 3PYLA 3A6DA 5DDIP 3R75A 5IWAB 4MQBA 3LDGA 4IX9A 4C01A 1M9NA 1SUCA 1KQFA 4EQ6A 1UJ2A 2CMHA 2C9DA 3G6KA 1U0SY 4I4CA 3JAKB 3TM5A 1G5FA 2YJ5A 3DQZA 1O1YA 1XKTA 2A9VA 1Y42X 3LXXA 1IEXA 4GPAA 1NQOA 2AVDA 3MWDA 5HQTA 1YS6A 2O9JA 3TOZA 5KNBA 3CZQA 1KY2A 1XGKA 2ECKA 1Q17A 3NWOA 3QXCA 4EKGA 1TJ4A 3LDAA 1T8WA 4R05A 3KJNA 4NX2A 3A26A 5DHUA 1Y3AA 1ZD8A 1YDEA 4BNYA 5EFOA 1FE8A 3E70C 2I3AA 2CLKB 3D1JA 3W1VA 2I1VB 1ZGCA 5BVHB 1P6UA 3CQ9A 1LFAA 1RHUA 3R5KA 1PJQA 3SZGA 3INYA 3KT0A 3MTQA 4LJ6A 2Q9AA 5AT1A 4DLYA 4G0PA 4HH3C 1DOAA 2ZJYA 4G5GA 3E18A 1BDHA 2R5FA 3NX4A 1FJGB 1NC1A 2LDXA 1KFCB 4IZ6A 4KXQA 2WQ7A 3EMKA 2JGDA 3OUUA 3CKMA 1VJ1A 2XH8A 1RQ7A 2AW3A 3QEOA 2IP1A 3EEBA 2YMQA 4FBGA 2N9UA 5IBRA 3VKWA 2B8JA 3UFBA 2XCUA 3G1UA 4PC1A 2V7PA 4JT9A 2I4OA 3TIIA 4Z7JA 1E6MA 3K6RA 1WOYA 4CV0A 1ADJA 1PX2A 4KC0A 1N5OX 2GTIA 2WKQA 1SC3A 4KVFA 4N3NA 4OSEA 5EJEA 1HLGA 2HMAA 2IHKA 2VF4X 4L8GA 2OAEA 1ZH2A 2JFYA 1MO6A 3PDIB 4MVYA 4ODIA 2BCEA 5LQAA 3MWGA 1WB4A 2VK1A 3EZXA 4DHEA 4FYIA 4WUVA 3CZPA 4MP3A 3M33A 2OBXA 4NDNE 4FIDA 1FMTA 1U6JA 3FFTA 4EYGA 3U31A 1WDKA 5TJ9A 5EJ4A 2WWVD 2VP5A 1PL0A 5HXAA 3R7NA 1NUHA 4QBTA 4CLDA 4F11A 5HHTA 3DAPA 4MDFA 7ADHA 2XTJA 3A9TA 3FMIA 3T3EA 4BWGA 3KTAA 1P3JA 1EA5A 1Z4JA 2VPZA 4Q7KA 4CMCA 4D92A 2H3EA 1EFVB 2OBLA 4LQCA 5BN5B 2LCQA 5CXXA 2Q49A 4K7JA 4HAZA 1L2TA 3RUAA 2C04A 1BWRA 2WSMA 2X4DA 1JA9A 4OHOA 5TS2A 5A05A 1D6MA 3A4LA 4JDUA 2JLAA 2ISQA 3COWA 4XIJA 1C4WA 4OUDA 1JWAB 5ECWA 3V2GA 4DPLA 4LCBA 2PQ0A 5FV4A 4QDKA 4RANA 1IIBA 3ZY5A 2XNHA 4K81B 4LVOA 4PZUA 1PHRA 3ZZ1A 2IY7A 4Q9IA 1J2UA 1LI5A 3JQ9A 4HCJA 5I5EA 5FQNA 5AUQA 3JZFA 2BGJA 3QX9A 4WOPA 4XSGA 2CCGA 4O2AB 4B6JA 4ECAA 3RADC 4QPPA 1I6WA 3WDSA 4TLCA 1E8MA 2P2NA 1Z5UA 3GGPA 3R44A 4KFTA 4UZEA 3IDQA 1QFYA 4YT5A 3WRXC 1VSVA 3RR2A 1M8GA 1EVKA 1T5BA 3KO8A 4HFNA 4PXSA 1CQJA 2BDEA 2WV9A 1VOTA 4ND6A 4U2GA 2AB0A 2ON6A 4MINA 4F86A 1OXXK 4Y18A 1YQTA 4L7VA 4O1HA 2PLFA 1QVZA 1K06A 2A4MA 3W3ZB 4HDMA 4MUGA 5FFFA 5HBGA 3GJ3A 2G88A 3ICQB 5BUSA 1KU6A 3AZQA 3M6MD 2I99A 1M8PA 5JC1A 4Q4CA 1RZVA 2ACKA 3DOFA 3AESB 1GAJA 4X90A 2Y93A 4ZVPA 5CT5A 4HNVA 4B3BA 1XYVA 3O8QB 3NWBA 4M88A 1E1DA 3PNQA 4Y7CA 1G3MA 2JJ8A 5JH7B 4YRRA 2HOQA 2C5FA 2RGNC 1KI4A 3A1CA 3PJFA 4PLTA 3GPIA 2P2CA 4QPZA 1SKQA 4ZVRA 3M3DA 4WKOA 4PN7A 3T3OA 4LJ7A 1FP2A 1GL7A 3ZWQA 1CNMA 2FR8C 4BLVA 4CLHA 2WHXA 1Q0RA 1DC5A 3LY7A 2AVNA 5H82A 1SCUB 3GFGA 2BEVB 1NVVR 4M1KA 5AI6A 3NC1C 1HE1C 2ESRA 4AK9A 4DE5A 1NZJA 5B2EA 3NOQA 1HDRA 2BP7B 2I6SA 4C76A 5AW4A 3A4VA 4Z7QB 4WKBA 4F4HA 3O8OB 3Q8MA 3A2NA 3BMCA 4REQA 5FOXA 2P6NA 3H6HA 1RCFA 4D8UA 3W8RA 3ILHA 2AI1A 5B37A 3RJMA 1IEVA 2OQIA 3CG0A 4OQQA 1GZHB 3TVYA 5TY0A 1J97A 1Q57A 4J03A 2ODAA 3RGWS 5DTMA 3ZN2A 2BYTA 4UOZA 3QKWA 4TV9A 1HDOA 1R0RE 4UBKA 4I9FA 4XD7A 1CUFA 1TF5A 2XR1A 3F4BA 2PT9A 2GI4A 2ZVQX 3MRTA 3C8DA 3TSYA 4IIFA 5K45A 3D4IA 3IKMB 1LPNA 4ZMBA 2BMAA 2ZI6A 5AIBA 1RIFA 1TAQA 2CHGA 4LSWA 1UWCA 2AI3A 3OQHA 5HBRA 4B79A 1XPOA 2J0VA 1B8UA 3IXLA 3IPLA 5C8YB 2WIDA 1QKKA 2J8ZA 2OB2A 3EEIA 5DV9A 3ZHUA 1FLAA 1YS1X 1CEQA 5H5JA 4UE6A 3V4VB 3ZEAA 1QQBA 3IHWA 2FPGB 2ATCA 1G42A 1DINA 3DTYA 4HPXB 3TS1A 2ADMA 4J2HA 1GRRA 1F0YA 5A6SB 4KVZA 2P1ZA 1OWNA 2CGEA 1IN7A 3E7FA 3QVJA 3EVNA 4PZ9A 3WNCA 3WYDA 4TOIA 4CZ2A 1QTNA 3D7KA 3L0IB 1K6XA 1OAOA 1JT2A 4CETA 1L7EA 4RZHA 3S99A 2ZBGA 1NN3A 4N40A 3T7IA 1G20A 2AOTA 4HDNA 4AXXA 2B0CA 1XTVA 3IKJA 3NOXA 4PXAA 4C7OB 4B81A 1GCGA 2AQHA 3FROA 3PEYA 1PLKA 1YIOA 2QRGA 3LKVA 5JLAA 5AUNB 3CVVA 3WWZA 3N7AA 2XNSA 1BC5A 4FNGA 2Q9UA 5HP4A 4L9WA 1E9AA 4BAZA 4DLWA 4C07A 3T61A 4A26A 4QODA 2XMBA 2K2QB 3I8SA 1L5NA 1X77A 3IPYA 5LXTA 4PXYA 1EXMA 4TKUA 1IPEA 4Q34A 1M54A 4BL5A 2A9JA 4JOCA 1OH7A 3H2IA 2KS6A 1V5WA 2EKZA 2JD2A 2NYVA 3QJGA 3QYFA 4GAEA 4L5CA 5DXAA 1B0ZA 5DTRA 1J24A 4IDBA 1M1NB 4BJ6A 3O3NB 1Y7IA 4V2UA 5K2MA 4TLMB 3QUSA 2QYHA 3LKZA 5JRZA 5K8VA 1EIWA 3VU0A 5LA6A 5EKXA 5TF4A 4CEJA 3N9IA 4BO8A 3TSWA 1T2VA 1FDWA 2ZJ3A 3L1VA 1VDMA 3P4XA 2QK4A 4FVTA 3RC3A 4XDYA 3VDMA 3BGWA 2AR7A 3ER9A 3FJOA 3NXSA 4HMOA 5CH5A 1FB5A 3AHEA 3F3SA 3AF0A 1A97A 3PNYA 4NU5A 4Y2HA 3X1JA 4GBED 2K4MA 3C3KA 4M86A 3BGIA 3NXKA 3PC6A 4PYRA 3VI4B 3ZE7A 5F9HA 2Q6VA 3UMYA 4KOAA 3CEPB 1O03A 2H1WA 1FXWF 2D1YA 4P22A 5ALRA 2F3PA 3FB4A 1BN6A 3DA8A 1RBYA 1MC4A 2GTPA 4LXUA 5EYPA 3SHWA 1E3LA 4BTEA 2C7OA 4U2FA 3KKEA 2X4IA 1N6LA 2VFAA 2M6SA 4G8BA 4RVFA 4YB8A 4JR1A 3LT2A 5JQGF 1YCFA 5ILQA 3UKJA 2W2NA 4FMDB 3N8IA 3UA4A 2BHLA 2GEUA 3WFJA 1G2PA 2B78A 1AUOA 2VHTA 3CINA 4JLDA 3KYCB 4YR7A 5MHTA 3LLMA 1UBJS 3TLXA 3JR7A 5DHAA 2F67A 4C2BA 1UKYA 4X6LA 5IPFA 1X1BA 2H0RA 3VYUB 5BR8B 4RK6A 3T94A 2C2GA 1GA6A 1PNRA 1US8B 2QG9A 5AVYA 4Q3NA 5KNBH 4ZJUA 2O2JA 2ZS7A 3Q85A 3NBAA 5DHTA 1Y5LA 1G6Q1 1PYDA 2C95A 3DO8A 3E2MA 3FNRA 2RHCA 3ROXA 3BTVA 1C9JA 4S1TA 5FQOA 4MYDA 1B2LA 4F4UA 2IELA 2VR1A 4AG5A 4KWTA 1Z0JA 4GM1A 3DBIA 1T34A 3DLCA 2J9GA 3UAGA 4G1FA 3FI9A 2QA5A 4QPDA 4CQJA 3MT9A 1ZCZA 1Q11A 1AIPA 1G1AA 1O94D 2BFCA 3B3GA 1YBFA 5H59A 4CM4B 4YUWA 4Z9XA 5G0VA 4D9BA 1J1UA 1PP4A 4RDCA 3T5TA 4W7HA 3VYTB 4G3XA 1ACJA 3AMVA 2X1MA 2G07A 1JVBA 1ODCA 1JLSA 2ASVA 5AK4A 4C2UA 1Q77A 3ASVA 3MWEB 2BGWA 4ZRDA 1RWXA 2VUHB 3D8HA 4CEHA 4BZQA 1DMRA 2ET6A 2O3JA 2VRBA 2JLRA 3HN2A 3ZKWB 4BKPA 5LD2B 1ZLXA 3ELYA 1KAHA 4ZQIA 2OKGA 5FUVA 3SR3A 2FW1A 1GPJA 3IB3A 4J1TC 4RHFA 1SVLA 5I5GA 2V96A 2ZIGA 4UDYX 4ND7A 4ZQBA 1VLMA 1KIFA 2VZLA 3WAKA 4LTDA 5F33A 2V7QD 4BAGA 2MSNA 4G85A 3DMTA 4D4GA 2QVYX 1YQ9A 3MK31 4ZXFA 3UT0A 5KTRA 1FUYB 3WYBA 4PG6A 5DPMA 1H93A 4YRNA 4X1IB 2VPXA 4B17A 3T4EA 1ZMRA 5D7BA 2PGNA 1EX9A 4MLDA 3EK2A 2OQVA 1SCIA 4O8CA 4YRKA 3IBGA 3ZCUA 3TMYA 2MU1A 1JGTA 2BE7A 3I42A 3OIVA 2JDID 1S3IA 4PRYA 1B73A 1W5SA 4DYDA 1E9FA 5JSKA 1B26A 1HL3A 3DVAA 4QXPA 4GIBA 3WZ2A 1FZTA 1IJFA 3KD3A 4XE5A 5IVHA 4TT3A 3LWNA 1RM0A 2PMFA 2XQIA 1ADBA 4RJLA 2O8BA 3G3EA 5AO9A 5IJ9A 3QPUA 3ADBA 1JHVA 1KI9A 2BISA 3NKLA 2FVYA 3PD7A 4KMRA 4NIMA 4UJ3A 3V1LA 3HU3A 1ZJZA 1XNGA 5HE9A 2QTBA 4DLPA 1ZYUA 1VXRA 3LA6A 1S2GA 3AR4A 3FB1A 5K1ZA 4IWNA 3QTTA 3ZNNA 5DB4A 1X87A 3LOQA 1BH6A 1DX9A 4U7TB 1PEAA 1WSWA 4N47A 2Q5FA 4PANA 3DB2A 3QXXA 4HRAA 3SIRA 1JZSA 1RZUA 2M6KA 4DEVA 3NH9A 3KVRA 4YCBA 3RO7A 3SQDA 3FW1A 4D3SA 1I30A 5I4CA 1P4AA 3S40A 2XSZA 1Z18A 1I4LD 3EXG2 3JAKA 2BFFB 3CUSA 2JH8A 3ZQUA 1Q95A 4GECA 4K0RA 4JEIA 4O1MA 4WY8A 3RAJA 1N77A 1J2JA 1XTZA 1IUOA 1W96A 3BIXA 3PDJA 4RACA 3STWA 3R8FA 1SBCA 1X7XB 1RPTA 3C3JA 3KZNA 2QZPA 1F4PA 2EVWX 2P1RA 4G67A 2HRQA 1PJ4A 3E9MA 4IMJB 3AF2A 4OD0A 4AX4A 2AQ8A 4L5JA 1L5GB 1RXIA 1D2NA 4ID9A 4A0GA 5BVHA 1ISHA 3ANXA 4G8CA 2PWAA 4EB3A 1COWD 3CN9A 1LTKA 1CWUA 2ZJAA 2K2WA 2NZJA 4LVNA 4EX6A 2PWPA 4BPBA 1C80A 1LW6E 1YE5A 1Z5PA 3GCZA 3M6LA 3OZBA 2V5VA 1IXRC 1EVIA 3E84A 2BUCA 2CEAA 1QHEA 4F38A 1IJBA 4GL4A 3H1PA 4GDFA 2B4KA 4L3VA 4EQZA 2GN0A 4JU8A 1NF3A 2DYKA 4PLWA 4WN9A 5ELLA 2J6HA 1JIIA 1P73A 2ZRDA 1E1RD 3OT4A 5BR4A 2ZIUB 3PIIA 3CO0S 2IKSA 4QYWA 1GUFA 4M49A 3L1UA 3I6QA 1R9GA 3ZWBA 4IY1A 4O63O 1FDRA 4MGHA 1P19A 2IV3A 1A50B 3A0RB 2VVTA 4KXWA 3UAXA 5BW8A 1SKBA 1M0EA 4RVCA 3QU5A 4JJEA 4KBFA 4Q3BA 3PDIA 5EKTA 4LXQA 3TL3A 4PAGA 4G0OA 4BTVA 4HV4A 1ZS9A 2WAXA 1XTPA 1TC1A 2P65A 3D02A 2JFGA 1G3RA 2QENA 4FFLA 1YBMA 1Z37A 3M9LA 2OCGA 4B6OA 1ZD4A 3N75A 1K8YB 3JU3A 1VI6A 3QTLA 4PYIA 5C1IA 2IWHA 4U8GA 2OHFA 3IFSA 1VKHA 3NJ4A 1NU8A 1RZ3A 2E37A 2FPSA 5JAQA 1LVHA 4DT1B 4EJSC 2BF4A 5JCXA 5C52B 2DZDA 1H22A 4P3PA 5CJ2A 5AW8A 1YL5A 5L3QA 5AHXA 4YREA 3FHOA 1JIKA 1O6BA 4R2LA 4KG7A 4A8JB 1ADCA 4HLCA 4P08A 5BN5A 3FZQA 3THWB 3KAJA 4PO9A 1I51A 1NW3A 4EPWA 4R8MA 3T3MB 4YXFA 1FW8A 3GLHB 1E6EA 3CX3A 5K0JA 3DAYA 2OO5A 1II0A 2GSDA 3FPKA 1ZRSA 1NOJA 1SUPA 2HU2A 2WM2A 1K68A 3AJRA 4FD2A 4LZNA 3DHWC 1U7TA 4M8LA 4LOHA 3MN1A 4AJEA 2CV0A 4WLFA 2WM9B 4MWBA 4DHWA 1KSHA 2V8BA 4PYQA 3D7MA 1DKUA 4NZNA 4L7QA 1B0PA 4O2AA 4RHCA 1DKRA 4ZGWA 4D9IA 5KNDA 2FEWB 3MJVA 3L18A 3BSFA 4JOQA 1Y8QB 2CL7X 1DAKA 2B6NA 2JANA 1Z6AA 3H4IA 1F9AA 3GEBA 4A91A 3OMXA 1PWZA 4EELA 1JYEA 1YCGA 2G09A 3M5PA 5AKLA 5EHXA 3F5SA 4QDOA 1E1CB 1YJ8A 4PYKA 4YR9A 3SP1A 4A1OA 1XMVA 2Q3CA 2FEKA 4RD4A 3TF5A 4M9UA 2ZTUA 2C3PA 4KX3A 4BX8A 4UUPA 4I1IA 1GTJ1 3NP9A 4XUCA 3VR5D 4Z51A 5CAEB 3DL0A 2H51A 3KWMA 4IVNA 3WBBA 4EHBA 4C22A 2AYXA 1GPMA 5KO2A 4RMHA 1YA4A 2BM1A 2TS1A 4A0RA 2YFQA 2VZ8A 2ZPUA 2HWWA 2AZMA 2E49A 2ZUUA 4NR0A 4PHTA 221PA 3O8QA 2RH4A 2OYRA 4Z8YA 5JH7A 4FFWA 4CWAA 1PN3A 1YAJA 1E0KA 1KK3A 1NYRA 3M0EA 1UOPA 1ZOLA 1UWKA 2J6CA 4MVJD 4CMJA 3QPWA 2QSUA 2GZDA 2Z0MA 2ZUFA 3U7JA 1TKAA 1O0SA 2X6QA 3U0BA 1SCUA 1U2TA 4LJ4A 2BEVA 1ODKA 2GN6A 2MR6A 3OA0A 4O4LF 4TL6A 5JCZA 3ESAA 5F3RA 4PNEA 2HV8A 3E4DA 2QXTA 5BQXA 3FTQA 3IO3A 2BP7A 4ENPA 3NCHA 1DHRA 2BMDA 2JCXA 4LHXA 1Q50A 2YWRA 2AXQA 4FFBB 3RIMA 3O8OA 5ABPA 2IUTA 3NHZA 4QSHA 4L4YA 2HYDA 4RGBA 2J7PD 4RDXA 3PWZA 3WB2A 1KC1A 1WCIB 4MVJM 3SR0A 2BDUA 2QW8A 4B09A 1IBMB 2VP4A 3KT8A 4WDQA 3CF0A 1U2DC 2FR0A 2WIJA 2QTNA 4LDQA 4DJ5X 3EPPA 3O8CA 3H9CA 4OEHA 2GCGA 4LPSA 3ZWOA 2WSIA 4R0NA 5GOZA 3I64A 5K4GA 1QF6A 3H0EA 4B44A 2ILVA 5EMKA 3NV9A 1V6CA 3SC3A 3J81k 2NPIA 5DASA 3GVXA 2GZ2A 3VGPA 2ICAA 3BL8A 1MB3A 3TG8A 1PVVA 2O3SA 4CKZA 3FFAA 2W2QA 3RYHB 2WM8A 3WO1A 5M29A 1U9IC 4WGGA 3E9YA 3LZDA 4MW7A 3HMQA 3ZY6A 1YL6A 1JQ3A 4UBMA 1L3CA 5D85A 3ZJYA 3LYLA 4M9CA 4NS4A 2NN3C 3BB4A 3NUQA 5CX4A 2VNJA 4ZRNA 1AZSC 4M22A 4K9PA 4MRPA 4EENA 5C8YA 4B48A 5BMVF 2ID8A 2VK2A 3SZLA 4BU1A 2FPGA 2IHVA 4AZVA 3MXTA 4V0SA 4L95C 2Z9BA 3KEQA 4YA6A 3NHPA 2I71A 1SMKA 2J5QA 1T1IA 2FB9A 3G1WA 3IIIA 3LTNC 2PT5A 1RVDA 3CZAA 3L93A 1RC1A 2M98A 3AP3A 2AKEA 4QVIA 2AEMA 5D5HA 4PCAA 4HWOA 1R6BX 1XEWY 1NVKA 3UG6A 5BNTA 1OZHA 4YRSA 2YXBA 4W4TA 3VHRA 1TM2A 3V1KA 5A5EA 1GFIA 4C7OA 1PRYA 1CR6A 1T9ZA 3HB5X 1JXAA 1CR1A 1K89A 3A4MA 3D3KA 1JLMA 3IUQA 4AFNA 1Q3KA 2H07A 2BGUA 2Q46A 2C9CA 3MF4A 5I01A 2C7BA 1P1BA 3LGSA 2EQBA 3NGXA 4HKTA 3UF0A 5H3CA 1NLFA 1V48A 4QL3A 1Q92A 1DRWA 4WKGA 2UYOA 3EGEA 5TRTA 1Y9AA 1BHJA 3QFSA 3S68A 3AYXB 2HSZA 2MSKA 4DQDA 3OLVA 3OP4A 2XXJA 2F64A 3PPIA 2QY9A 5BV8A 2DB3A 3AHGA 3DYBA 3N0VA 5HOQA 3V2IA 2OD2A 3SZOA 4PHCA 1CHDA 1Q83A 3JQCA 4ZVVA 3TJRA 3F3KA 1AK2A 2ZTMA 1SXJB 1J70A 1NF8A 3F98A 4BX2A 3HY4A 3FUUA 2VQDA 4DDUA 3BWDD 8GPBA 2PZEA 1XWIA 3WLIA 2D5BA 5IKXA 1VG8A 1VMEA 3H5LA 3PUJA 3G2HA 1KIMA 4CKBB 1KGDA 3H9QA 4BOYA 4CIDA 3P2YA 4IYRA 4Q7JB 3TXYA 3IRUA 4GBMA 2SICE 3R40A 2VYNA 3LG2A 4JX9A 4LJSA 5DBGA 1FFXB 3FCCA 3AO0B 1FVOA 4CIWA 1JLKA 2J3DA 1N5IA 3R0XA 5LLDA 3S27A 2ERYA 4FLMA 4TYNA 4U0KA 1VKOA 1XZAA 4YJ2B 5D84A 3L5KA 2CJYA 5IARA 1XL0A 2Y1WA 3TRKA 2SNIE 1EH5A 2VP0A 2GDJA 4DUYB 3LW7A 1FQJA 1MORA 2J67A 3KYCA 3U3ZA 4KJXA 2PV7A 2C4NA 4URVR 1ZK3A 5MDHA 2XNDA 4OP2A 2AW5A 4E2XA 4RK5A 1US8A 2R7AA 3PC3A 4V1CB 3ZXUB 3N7TA 5EXTA 4IKPA 5CYOA 1A5ZA 2V03A 1W0KD 4RY2A 2DTEA 5BQPA 2W6ZA 4EB0A 4LC1A 4RKFA 4ENQA 5IU6A 1D1TA 2CDAA 1NBMD 2FSSA 3SK0A 4URXR 3H2GA 4R1QA 1W2GA 2YBDA 3A4TA 2O8DB 3TI7A 4Z9BA 3U7FB 4PTZA 3EQ6A 2GJSA 1TEVA 2DTXA 3VKVA 4OFBA 4DRYA 3GEIA 3L1JA 2HM7A 5JZOA 2ZR9A 1E2NA 2WQ6A 2QY6A 3GRCA 4CM4A 3S1SA 1N3LA 3U5TA 2AR9A 1A4RA 4KQ9A 2B7CA 1BGXT 3O83A 3E48A 4LJ9A 4KR0A 1DCFA 3V5NA 5IH3A 3VO1A 5C35A 4JZKA 2RBEA 4U0JA 2X3FA 1BU8A 1ATIA 1IWBB 4G8JA 2ISSD 1SVWA 2O8EB 2DY1A 1FBTA 1JIVA 3EY4A 1V43A 4IF6A 4E5PA 1WLSA 3MWEA 3QPBA 5BWLA 4I8IA 1WB5A 3S2EA 2GT1A 1JYFA 5F73A 3TSCA 3D4BA 3ZKWA 4YY3B 2ID7A 1PFUA 2D3WA 2UU9B 5E38A 4LRXA 2ZRNA 2Z1DA 4V0OA 5IFLA 4N65A 2GFIA 3J7AC 4CHTA 4F1JA 1AMOA 3PJRA 16PKA 3VR0A 2R00C 4XFJA 5B6IA 1IYZA 3UYKA 1WHSB 5CNKA 1DG9A 5F1KA 1PFKA 2FHPA 1PL7A 2NIPA 4CF4A 5L3SB 2FMTA 4MR8B 2CLIB 3A7EA 3RS4A 1FLVA 4HQRA 1KIAA 1SBQA 4IM7A 4X1IA 3S0JA 1KEVA 1P4HA 2I3BA 3CPJB 4CG0A 1D4OA 5BSUA 2QX7A 3H5OA 5EWLB 1ZNZA 3AHDA 5BSMA 2RHJA 4YJFB 1RLMA 3OWXA 4N03A 5GINE 3P2KA 3TZQA 2CF5A 3VU1A 1HUQA 1YBVA 2EP8A 2IEDA 3GMIA 4G23A 3QU7A 3L06A 3KLNA 2P3LA 2YYZA 5ED0A 1N3IA 4IP0A 3ROPA 4KCGA 1TE2A 3C8MA 5DEOA 5K0BA 3LL4A 3RW9A 2NSHA 1M72A 2Y1KA 1HYGA 3NHAA 3O84A 3OD5A 1U0NA 1TO1E 3MQ4A 4GC9A 3WGYA 2BZSA 3ZJ4A 1XXHB 3CNLA 5G0UA 4BB6A 2P27A 2MYNA 3K09C 3PFGA 4JGBA 4K2AA 4NFLA 4ER5A 1G5PA 3QW2A 3SHFA 4GEKA 3RUDA 2XJ9A 4UU0A 2IQIA 2O5RA 1DO8A 4PEVA 3QWHA 1JR3D 4XQ9A 4B43A 4B7XA 4Y67A 5IVKA 3ZE1B 1G41A 2WIFA 4L8VA 3BZBA 4DG9A 3ESCA 3K6KA 5LMNB 4UBJA 2ZIXB 5L3RA 1C3OA 3ZV6A 3ZGOA 3OAAD 1JJVA 3D1VA 3O03A 1L7PA 3PQ5A 3UH1A 4XQCA 5KNDH 4KW7A 4UDXX 1HT3A 1UDBA 3OIFA 3PEEA 1E2QA 1QLWA 2WSLA 3IEKA 1T26A 4BQSA 2XUHA 1H05A 1XLWA 4FYVA 2G5TA 4OBWA 3WLFA 5HJEA 4L07A 3KKOA 5IUKC 4J0GA 4DC9A 4EG6A 5K0EA 4QQFA 3A8TA 2GXQA 1L5YA 3F5MA 5DF1A 4ZFNA 1PT8A 5AJZA 2V6IA 1X7XA 5L40A 1L4BA 4B34A 1Z07A 4HGZA 2QPLA 3WRXA 1I7DA 1XFDA 3IQZA 4D5GA 521PA 4NH4A 4RPCA 4CMIB 3BGVA 3E58A 3I6YA 1HTBA 4KXMA 2XKKA 1ZOPA 1OMOA 4KHZA 4DSOA 2OXFA 4MHSA 3GDFA 4BCDA 2O1SA 2H7CA 4JUDX 2O59A 1TB4A 5EJFA 4LJKA 3QPCA 4NONA 2BLLA 2GCOB 5DYWA 2Q45A 3G8YA 3VAAA 5M7EA 4HUJA 3TOSA 3ICVA 1DRJA 2YQ5A 3MFYA 3WA6A 2HTFA 2UUOA 5H1YA 4ZCIA 4WJZA 3KLBA 2Z2YA 3BREA 2Q3MA 3CEJA 4YXWD 1UEXC 4JVMA 3ORSA 2ZT6A 1T3ZA 1LFDB 2AJ8A 1YZ3A 5BQFA 2RGNA 1WQ1R 5IDWA 1QOPB 4BVHA 1OU4A 1PTKA 1UJBA 1UWLA 2Y1DA 5SY4A 2R65A 2FPUA 4DSUA 3D64A 1WMSA 3DW1X 1P2TA 5JJ5A 4K5QA 2FR8A 2FSIA 4WPGA 3DF9A 3GEDA 4X91A 1RLOA 3E0QA 3LUJA 4NLLA 4EA8A 5CYPA 1W1IA 1U0HC 1VCMA 3QHAA 3FCOA 1W2HA 3W6UA 4MV0A 1JP7A 2GA9A 4DT1A 4K03A 4ZIRB 3VNVA 4ZO8A 4JU9A 4BFVA 2PUDA 5H3LA 3A58B 3IOCA 3RYIA 1PI3A 2XVAA 5JNRA 1CZUA 1G291 1NMQA 2IZ6A 2D74A 4Y2PA 4D4JA 3BDAA 2PBLA 3THWA 4G0VA 2FEOA 1BE6A 3EC2A 3LM8A 3RARA 3WGUA 4TS1A 4CDGA 4MYCA 3GFPA 1JMKC 2DH6A 3HACA 3W78A 2IDMA 3IKTA 1GNRA 2IZ5A 5J4YA 5JSZA 2DGDA 3LC1O 3PQ4A 1X7WB 4LE2A 4S2UA 1XU7A 2C2ZA 3C14C 1BG6A 3AM3A 3ONNA 2A2ZA 2CDBA 4UM9D 1I2ZA 3AEKB 2PANA 1NQWA 3V1NA 2ZUWA 4HX2A 1NT2A 3EXG1 4OGGA 1DIHA 4L3OA 3NKFA 4RPKA 3GAZA 4S1VA 1NMXA 5BQOA 4AAYA 1NRJB 4Z6KA 1DXHA 2EKDA 4NPHA 4R0VA 3AIMA 1NJ1A 3SCZA 1HX7A 1U7ZA 4ZTBA 1PEYA 4WGFA 1SUWA 1I4WA 2W2PA 4D3YA 1XT6A 4DWVA 1C1XA 2OG2A 3H5AA 4NAVA 4DMHA 3FAZA 3ZCTA 5BRAA 4KPYA 1KDZA 1NIPA 1RQ2A 4Q1FA 5FBZA 3E9QA 3T1OA 1T9GS 3B5IA 2DFKB 3HHEA 4UATA 1QKIA 4MS4B 1HEUA 1SY7A 2H4HA 5A7HA 4YMVA 2H5JA 4NOKA 3L6CA 3FCEA 3KR2A 1ESZA 4MUHA 1LH0A 3I2JA 1L5SA 2OBBA 2YXDA 1WM1A 3TZHA 4B4UA 1EE2A 1YR9A 2XY4A 2K87A 3ECAA 1G7SA 3ZWYA 4H7DA 3WYGA 4NV1A 1N36B 1M7GA 2FK8A 4WK0B 4M0EA 4XDZA 3UJPA 5JMPA 3V1YA 4Q7QA 5F3DA 1II9A 4AKIA 1HYHA 5TGZA 3MTAA 4WMLA 1XRMA 3N2ZB 3Q5EA 5CEEA 1M73E 5J5CA 1ODIA 2B35A 3HA7A 2PKCA 5CFOA 1NY5A 4LJ8A 3ZZTA 1U7PA 2A67A 4ARCA 3Q7IA 5J1SB 2PUBA 3SQXA 1Z0SA 4C7JA 3DYVA 5EJGA 5CW1A 2G9NA 3O6VA 2NO9A 4FFBA 1BOOA 2W6PA 2EDAA 2FQYA 2IZ1A 3EW7A 3OTQA 3HCPA 4UZSA 4IILA 4LDJA 2VTDA 3C1AA 3I05A 4V38A 2H8KA 3C8HA 3DV2A 3U81A 2DXIA 2HYIC 5IN5A 1NJGA 2F9LA 2X77A 1Y7LA 4MIYA 1NJ8A 4OX9B 4LG1A 3SG0A 3DAOA 1MAAA 4Q4LA 4R2WA 3NBXX 1IN1A 2IOYA 2HH9A 1F48A 1HQKA 4NBSA 4WOCA 2F59A 4Z54A 1FS6A 4MQ5A 1MBZA 1MB4A 4RV9A 2GOYA 3BB3A 3TO5A 1Z8FA 2ZRGA 3LAWA 3PXDA 5D51S 2QBYB 5G0TA 1T29A 1SOMA 1AKYA 2PD6A 1EXDA 2JL1A 4MS1A 4HG2A 1KDVA 5L51A 5KYYA 2AC2A 4W7SA 2XA2A 3QLJA 2KYRA 1EQAA 1XK6A 3H9EO 3ESDA 3JD2A 2OPBA 3JD4A 5ESDA 3SXPA 5EA2A 1YCHA 1RZRA 2BRUA 1QYVA 5JDIC 2R2GA 3UMJA 2JGRA 1ZSYA 4NOLA 3ER8A 3A9SA 3Q9LA 1Z6GA 5FTKA 3AY0A 5D6OA 3WICA 2D7CA 1RJ9A 2D1RA 3R3VA 1I2MA 5BPFA 1MNAA 4UHEA 3SSAA 1KQPA 5CYFA 4Q9DA 2PE5A 1GSOA 1IN8A 1ZOOA 1WXEA 2JLCA 4QICA 1LBTA 3HU2A 1TU0A 4PLZA 1ZCBA 3R0ZA 2AFRA 1TFRA 1E62A 3BM5A 4PWYA 1BH2A 1EFTA 3SC2B 4PFQA 1P1JA 4I3GA 4D9EA 4J6EA 1RWVA 1NP6A 2Y1XA 2R85A 4DQLA 3OEHD 1W93A 1SCAA 3FWNA 1O97C 4OA5A 1Q3TA 1PVDA 3W2IA 2VTVA 2YNMA 4TV9F 1Z29A 3CJRA 4GI5A 1KMHB 3LW8A 4UBLA 5LPNA 4J1TA 4R71A 4MIEA 1TQHA 6GPBA 2C2BA 1OZ0A 2IIPA 2HC9A 4KSYA 1QHFA 2R751 3R20A 3E2IA 3QVKA 5AW5A 4F85A 1RKQA 4DC1A 3D31A 3QLUC 1LBQA 1PGJA 1EXWA 1O58A 3GH3A 2MMCA 3HUTA 4W1SA 2ZUEA 1X9IA 4M0LA 4L4ZA 2G4LA 2QQ0A 3GW8A 1QF7A 1OYYA 5AM4A 1BQ3A 1CJCA 1W4BA 4OP1A 4W1RA 1RWOA 1BX1A 2Q3BA 4FZ3A 1ZC4A 3U3OA 5I4IA 1R6AA 2AZ4A 3QNWA 2XTNA 4CKBA 3BWBA 3PLAE 1TZJA 3Q10A 5KC9A 2OM6A 3KDAA 1WNTA 5I7UA 1KVSA 1FFXA 1NWHA 3BMQA 4ZVMA 3RHFA 3UNXA 4B47A 3IPCA 3E61A 4HWKA 1W7AA 4MH0R 3BXEA 4J0EA 2PBFA 1H94A 2AE2A 3HXKA 4AKHA 1BYIA 1N2ZA 1FNCA 1O95D 1ZZGA 3A3KA 3ZC3A 2I80A 4NZPA 3G0BA 2Y2VA 3B1ZA 3OCCA 4IMRA 4WK4B 3U1VA 5JR3A 3K9QO 2QMHA 4HZGA 1WDLA 4I81A 3NNNA 1SNYA 4CQMB 4YUVA 1DTEA 2ONYA 5LXTF 3VSEA 3ZU2A 1E2HA 2WWTA 4UEWA 2UYYA 2AN3A 4JITA 4JI4B 2EGUA 1ZVMA 1JILA 1CR4A 2VJKA 1K98A 3B13B 3BC1A 4IKEA 4O4IA 1HDEA 1X1EA 1Y3FE 4S04A 1RBMA 1XA0A 2JAHA 3A1WA 4KK4A 2FF5A 4EPVA 4PN3A 4YASA 2CLHB 3EG9B 3KKZA 4DCTA 2HBZA 3G8BA 3THOA 3K20A 1YASA 2QUBA 1F8XA 1PUJA 4KGXA 3IPAA 5IVPA 3ISVA 4JMLA 2XMGA 3HA5A 1A4UA 3KT6A 4JI1B 2DPXA 3I3OA 3AHFA 3SOZA 4B6RA 3QUTA 1W4RA 1ZG3A 2CYCA 1V5EA 5G2OA 3SQOA 2A5LA 2WJVA 4UC0A 1OGIA 1SVIA 1TCVA 2VHJA 1YR1A 3I2YX 1KKLA 2XUZA 3EX7C 1U7WA 1OT5A 4HYYA 1MCZA 5DCUA 3SBEA 1QK3A 2XRZA 2ETVA 4RHUA 5A0VA 5DIFA 1NYQA 4ZREA 4AX8A 2LDBA 1EVZA 2O8EA 5KYUB 3I52A 1H8ED 3PF9A 4N0PA 4RFLA 1G4HA 1ZD1A 2JAWA 1P7VA 1ND6A 1T5HX 3HYTA 3LK7A 2AMVA 4NS1A 2QRQA 1Q44A 1KA9H 1J8QA 1R8JA 4G5XA 3ZDAA 1PFYA 1M2HA 4L6AA 1R8YA 4TPKA 1FY2A 2HNKA 4OHBA 2OVFA 3ROMA 4A92A 1EK5A 4AYWA 5FT9A 4DWWA 3IP6A 4WINA 1NF2A 5F21A 4HY3A 4KLAA 1S2DA 3BAZA 1U2SA 3L0PA 3TAUA 1UQUA 2GVDC 1GPH1 4HC4A 5KC8A 4JI7B 1E2FA 3LHDA 2F00A 3H6KA 1SOAA 1WHSA 4HQNA 1DVRA 3C7AA 3RI3A 4Y2TA 1M33A 1DDOA 3R76A 4MR8A 3EQ8A 1QIIA 5JCJD 1G5RA 1DCKA 4CODB 3GLHE 4AUMA 4AUEA 4R1NA 3ICOA 1QB8A 2W0SA 1E64A 1CYEA 1ZGBA 3OU2A 1NL3A 5EWLA 5ICGA 3WLPA 4CIAA 4YJFA 4RKRA 4BMNA 5FXMA 5KVSA 4RSMA 3T1HB 4K05A 2ERXA 1MR3F 2N0SA 1LPBB 2EZ9A 5GADl 2BHRA 3WMRA 1T8RA 2XCTB 2HBYA 4ZVTA 3LPLA 3CRRA 1JG6A 4DL9A 3JQDA 1CDDA 2HJGA 4ZV9A 3KYBA 2G1UA 1SHUX 2WRZA 1L1EA 1XXHA 2ZANA 4JMPA 4BNGA 1YB4A 1C9NA 1T0UA 3L9XA 2XYPA 3NRBA 3QYPA 2X4LA 4MCHA 3RBZA 5HWSA 3OD1A 5M04A 3T7RA 4JV5B 3QNUA 4CM8A 1W581 4DLLA 3EYAA 4KYIB 3T52A 3FUTA 2A5DA 2XDWA 4Q3OA 2CW5A 4R8KA 1YWGO 3C6QA 1OY1A 2EEPA 3CMCO 1HO3A 5DNWA 5I4KA 3EMDA 4YQZA 6NULA 1MG0A 2Y2UA 3DHNA 3RWBA 5EIFA 5HF5A 3KOXA 4R1TA 2PH5A 5DH9A 1K0FA 4M87A 4PGFA 1U0EA 4B7UA 4F3YA 5CAEA 1DC4A 3G9ZA 1LBHA 1SUBA 3AIKA 2RI0A 3QU9A 3HS3A 3PFIA 5LQMA 2WSBA 1PR3A 2Z8XA 4OREX 2ZSAA 4R2JA 3LP6A 5CLGA 3RS8A 1ILEA 2ZZMA 3QVLA 1XYYA 4URFA 3IDZA 4HWPA 1IOVA 4ZAZA 1UJNA 3OIGA 3NB0A 1GR0A 4IDNA 4LSZA 2G8NA 1CYDA 1GPLA 2DJ5A 4RJJA 4G1BA 1CY6A 1Q15A 3GWZA 1XEFA 4C4XA 2QG6A 1MAVA 5H68A 4EF5A 2QVCA 4EGFA 1UBKS 3KOUA 4I5FA 4GKVA 1Y3IA 2FQWA 2WWRA 3AHJA 2BTEA 4I2NA 4H2DA 2QSYA 2Y6VA 2X58A 3NFYA 3LCVB 5GONB 1GDHA 4CGYA 2ZBVA 3OLXA 1F51E 4C4SA 2Q4OA 1AS0A 2Q1XA 3CNHA 1E6CA 3BE5A 3ICPA 2NYUA 3R5XA 4ZT5A 1HZZC 4Q3EA 2CJWB 5JNUA 5JIBA 1AUXA 2HWXA 2I54A 4ZEXA 3WRWA 1VGVA 1T0PA 5KAPA 1WEHA 3BWYA 5K0SA 2AXEA 3AUAA 4IDPA 3WHKA 1NR7A 4JROA 1PBTA 4BFYA 2CVOA 1JN0A 1Q22A 1MAWA 1C8VB 1QIFA 2P67A 4FQ8A 3TZKA 2DWQA 1P45A 3AWIA 1RHMA 1J7JA 3MERA 4Q6BA 5HE8A 4ZVOA 1VFPA 2LBPA 2X4GA 4AKSA 2FEXA 2WAOA 1XRQA 4NXNB 3FLMA 1PG0A 1TXGA 3BWCA 2WTAA 2DKFA 3G2OA 4XOUA 3SJZA 4YIHA 1PU2A 3ZDBA 1S96A 4Y9SA 1Z6YA 2GXSA 1CKEA 4BTLA 1DLJA 1TLLA 4URWR 3MW8A 2WZCA 2XMDA 4CU2A 3H97A 3WYFA 1MQSA 4IFTA 2GM9A 2C97A 2OCIA 3MOGA 5DX1A 2IUUA 2GKGA 3ZOKA 1JSRA 5PNTA 5EZQA 4HR7A 4IX1A 2Q4TA 2GZSA 1EBFA 4FGLA 4QNMA 1Q7CA 2VJCA 1EXVA 1U8EA 3F3MA 5J4HA 3EFHA 4ZI7F 4I5DA 3AU8A 1VSBA 1X94A 2VYFA 3BEOA 1Z4PX 3CLRC 4KXLA 4EHAA 1U2DA 3I58A 3OWHA 3WL5A 1L1RA 3CO5A 2ZK7A 1K7CA 4RD1A 2WVGA 5CIQA 4IWXA 5JWHA 4MB6A 1XMOB 4OM8A 3Q1LA 2FCAA 3OP1A 5GVRA 5EZSA 2DFNA 2H2FA 1QO0D 2EFEB 3OQ6A 5L3ZA 3QXSA 4YFYA 3N2KB 5FPPA 2QMYA 1ZGAA 1P60A 1PK7A 1TT7A 4MOWA 5G53C 1FVFA 2JGLA 1CZLA 1U9IA 3AEKA 1HH4A 3OQ1A 3MCZA 1T1SA 4B87A 3BL6A 1YQXA 2AIRA 1EGAA 1SU6A 1O77A 3VOBA 4M1TA 4ZZ2A 2CFCA 1P72A 3LCJA 1LRLA 4D25A 3OLZA 5LB2A 3D3NA 4QQKA 4CCYB 1J33A 4B9EA 4GRDA 4MS3B 1G8SA 1VJGA 1NX6A 2RIPA 3LVQE 1LS1A 3N8KA 4P7KA 5F77A 4RXUA 3HKEA 1JJAA 4ROTA 1K8QA 3H3JA 5DM1A 3GCXA 3IOMA 2VOEA 2AXNA 3HO6A 4M1ZA 1ETHA 5F7ZA 3B51X 5DNCA 1VLJA 3CRVA 2H3HA 1S2OA 2XB4A 3TQQA 1GADO 2XIJA 3GIDA 3EGOA 1GPUA 4MS4A 3ZW8A 1NJSA 3RCBA 1F2TB 1SXJE 2P9YA 1MT3A 2WIBA 4UOEA 1H5UA 1XTRA 3UOWA 4BQNA 1E3MA 3WNZA 1N0UA 5TR9A 1V9SA 1G8JA 4DNOA 1DRVA 2XQFA 4BKRA 3EIXA 2QRNA 2CLOB 2JJ2D 4ME6A 1TKBA 4QUAA 2C4VA 3M70A 1BVYF 3FDZA 1NBHA 3HLYA 3NJ8A 4KR7A 1HRKA 2XF8A 1TU4A 4JOBA 1TMKA 4PYLA 1PJAA 5H16A 2NUTA 2QORA 4PG5A 3W5AA 1T4BA 4B85A 3OEED 4O2AF 4MV8A 1G8AA 1GZUA 4JSTA 4Q0MA 1GSAA 2UVPA 3KOZA 4YMGA 3WZMA 2W6JD 3E35A 1KVTA 1ZRHA 4Y0AA 3AFMA 1NI4B 2NVUB 3X1YA 3QYAA 1RWNA 2VQ6A 3D6AA 3W3AA 1ZJ4A 2ZRJA 4P2BA 5IC6A 3ZX5A 2I3GA 2ZJZA 5EIBC 5IKPA 4I4IA 1ISRA 2IYSA 1H0SA 1MTZA 3HNPA 1CE8B 3CUUA 2I4MA 2OESA 2ODPA 2WVAA 3NDPA 3AJ8A 3MAGA 3NRJA 1NBOA 3VZSA 2RD2A 1O96A 2FMUA 2PJRA 4EKEA 1P8JA 5DXFA 1M2GA 1DQNA 1DO0A 1NXPA 1SHKA 1YA8A 2EYQA 4OTZA 5DMXA 2DHDA 2WZDA 4TSFD 2QJRA 2XA1A 3NATA 5AP9A 1DAMA 3PP8A 5C0OE 4LW8A 2YXEA 2ID9A 2B2NA 4E0BA 5JUWA 1WDTA 1BMTA 1Z88A 2Y67A 1VKJA 3C6MA 2JIZD 4WCDA 4QSMA 3I0ZA 4GPEA 1A9QA 4WJKB 3SR4A 2QBYA 4UEKA 1JSZA 4C0WA 1JQ5A 4EFNA 1GN9A 1KYVA 4GPZA 5JH7F 3EZLA 3J80A 3MTJA 3RFVA 5K4AA 4F3KA 4F4DA 2H1LA 2FU5C 3LIPA 4GH5A 3GLSA 4TTPA 1U63A 2PG3A 3I9V6 3A1EA 5C8DA 1OAAA 4QRDA 3FF4A 1HDYA 1ZZEA 3K0AB 3MRSA 3ZQ4A 4ARAA 4P3YA 4KRFA 1GUAA 3VDNB 4LJAA 3FFXA 1ZKMA 1DXYA 3DHVA 5ICFA 1ZWLA 5IDQA 2YS7A 4IJWA 4X3OA 4XVRA 4K1XA 2YHSA 1XBTA 4ZO6A 4H7KA 3RNOA 1BYUA 1RXSA 1CLEA 1DKOA 1OFUX 3G0IA 2JGMA 1LLDA 1XRLA 4LQ4A 4B6QA 4B3TB 1D2CA 3OPQA 2E18A 2WG0A 3AKEA 4J90A 1UDWA 3KQWA 3ODGA 4Z0HO 3VPCA 4ZOLB 1UMDB 1QU3A 1FMJA 3L41A 3AY7A 2NTJA 2OCLA 2GF0A 2XKBA 2WMYA 3SC2A 5JTUA 5F7JA 2ZIFA 3K7EA 3MJFA 1BO6A 3WK9A 5K7SA 4P82A 4GBGA 5DGDA 3MWJA 1UBGA 1Z6XA 3PCXA 3QKSB 5BRJA 1U0TA 1YUNA 1EP1B 2QZ4A 2Y92A 2H1CA 3GEMA 3TTSA 1E96A 2FZCA 4IMPA 4Q4HB 5FTMA 1WPXA 4AJLA 5D3QA 1GPYA 4CM9D 4OJKA 1RHKA 5K3FB 1NXQA 4NV3A 4HNUA 1L1QA 1UEIA 3H3FA 4F2HA 1CZHA 4BQRA 2ZRMA 2CL6X 2R00A 2HRRA 1XXHE 1YOVB 4FP9A 3C1TA 4M55A 1HOTA 4OSOA 4TTQA 5C8YF 2I34A 3ACCA 4AF8A 3SJCA 3Q72A 3PWSA 5EGSA 3AEUB 3I2KA 4ML3A 4PAQA 4EYQA 3CF6R 3NAGA 2L82A 4YJKA 1Q7RA 3PUVA 4WLVA 4FB5A 3EDOA 3GLTA 1AZWA 3HR7A 2V3VA 1C7ZA 3R0QA 4X41A 2BMFA 2QROA 2QR2A 1UJCA 5JAMA 1WV1A 3O9MA 3HBAA 3OY2A 1E3JA 2LKDA 4LXYA 4BLSA 1F3LA 3BMOA 2QAGB 3UMGA 1WABA 3PF8A 3Q4GA 4LOLA 1P1CA 2HLNA 2LNDA 4EUSA 3LUFA 2D7DA 4BNTA 3T1TA 4DLSA 1THTA 2OFPA 2DUJA 4MWEA 3HRKA 2JLZA 1X86B 4XB6B 4A8TA 3DS8A 1E2IA 5EGNA 3LBAA 5KSYA 2ONKA 2FEMA 2Z9CA 3L04A 4B46A 5HDQA 3QLVC 4I9NA 4CQMA 5KEIA 2D59A 1OA1A 2PSEA 2YVAA 1N8KA 4DREA 3AOEC 1T2CA 3IOEA 4PWZA 3TSZA 4TS3A 2DERA 2ODTX 4AZ3B 4RXTA 4Z49A 5C53B 1XVVA 1FYVA 3TH5A 4M9ZA 2ZJ6A 4MQLA 3H2HA 3VTFA 4KR3A 3B2EA 1VJTA 1PV2A 1Y3DE 2J9ZB 2NTVA 2IUFA 2NYRA 4LVUA 4N5NA 3SYKA 1YZLA 1JWBB 3COZA 3CR8A 1GOTA 3Q9UA 3W6NA 1SG6A 3R9XA 1NRWA 1OLUB 1VMAA 4UTZA 3HJTA 4FUQA 3X43A 4MKHA 1RFLA 3NVKI 1EUZA 2Q4BA 1LD3A 4OIFA 1E9BA 2MHCA 1RQGA 1N7IA 3NRCA 3G5UA 1SWWA 5A71A 3UAVA 3VHXB 4DR4B 1R6TA 1GR1A 4LVCA 2IYEA 5JAOA 1P2DA 3GXBA 3SYTA 1X1RA 2AD5A 2EKBA 3QUAA 5B1EA 4P3XA 3UVEA 5B1IA 2UZ1A 1EKXA 2F8LA 4BLUA 5FI0B 4Z8XA 4ES6A 4BGUA 4JJ7A 1DQZA 3I9LA 3I1IA 1DGQA 1W0JD 5HVNA 4YJGA 1JSLA 4Y2GA 2FOLA 4FMDF 5IW8A 1G2OA 5K3CA 1BKSB 2VPWA 3KJFA 1P8AA 4XWTA 1W36B 3C8UA 1KRHA 1XP5A 3MD9A 3FFBA 4PG8A 1SIWA 4NCKA 4QGHA 5IM5A 2ISCA 1VHLA 3D6VA 3QIVA 2WABA 3MAJA 4H08A 3O8LA 4UEOA 4EA6A 1QG0A 3DCIA 2AZXA 2Y0EA 5CK4A 1PJTA 2RJNA 4D7AA 1BCRB 4KITB 4N48A 4H9GA 3DUFB 3K1AB 3S3TA 3S8YA 2CFRA 5EIWA 3G2LA 2BTOA 2V7BA 5CT4A 1JDVA 2JFUA 2ZSBA 4RWEA 5GP1A 1IC6A 2HV9A 3UCXA 1NSTA 2Q4DA 2IYYA 2FZVA 3OKCA 4IZOA 4OBXA 2NVOA 2XWQA 3OECA 1FDVA 3A1TA 3DBLB 3NM4A 4C43A 2DUUA 2ZSKA 1OFVA 2JLWA 4YYZA 3VYSB 3DCYA 1LRKA 2M6LA 5A3JA 2XVXA 3BD8A 3E5NA 3TCNA 3GP8A 4JI6B 4R5MA 2ZBUA 3KWJA 4HQ6A 3B85A 4IO1A 3Q0EA 3ADDA 1UBNA 5SYNA 3VTZA 1K75A 1OTYA 1SOUA 1QQ5A 1OGYA 2GHIA 2H59A 1H2WA 1K2VN 2A8YA 3ANMA 4J1NA 2VXBA 4YWJA 3OU6A 1SHTX 5JS1A 3C39A 3OKPA 4R41A 5EZYB 2AJTA 2Y0DA 3IESA 4QYIB 5HSGA 2IHNA 3D5EA 5JBIA 3PRKE 3PI7A 1S2NA 4BMCA 2Q3JA 1EM8B 4G1VA 3THRA 2D5IA 2GDZA 4I3FA 1P7YA 3NBMA 9GPBA 1AHPA 4FR5A 1PSWA 5AQ1A 4M89A 1GM5A 3O8BA 1CQZA 3VZPA 3L6OO 5H02A 4J49A 3HCRA 2ZZKA 3VH4A 2H8GA 1E2GA 2J9YB 3FPSA 4EUNA 3HUDA 1N7HA 2WAYA 4XDGA 5I7AA 3MMPA 1KAMA 4N82A 2PX3A 4BWVA 3OQMA 3KBOA 5MGBA 1ZHFA 1CTQA 4E03A 3U40A 2L69A 1KQNA 1M8JA 2JA2A 3R7BA 2RHRA 1P18A 1JAIA 1JAHA 1IHXA 3INRA 5KIAA 4BP3A 4WEOA 1WW8A 3JWGA 3GFFA 2B2CA 1NJFA 2BGRA 3VR4A 3HZRA 1NX9A 4B73A 4DQXA 4XTRA 3JQBC 1RPJA 4QFBA 1ABEA 4RAOA 4RV4A 5GONA 1YU9A 3X1MA 5EAIA 4AS2A 3DV9A 4NCBA 4P0QB 1REQA 3T3GA 8LDHA 4XUGB 4ZKEA 1XD8A 4E3ZA 2CJWA 2XB8A 4R1MA 1VHDA 3BERA 5DSTA 3DM5A 2FP3A 3ICWA 3VR2A 1E2EA 4D9FA 3EQ2A 1FDUA 3DTVD 4R3NA 5T6MA 3WLLA 1Y63A 1XAGA 2XF2A 2PLRA 1QZXA 3MRVA 3KX2A 5LQDA 4QOHA 3J7TA 2X9NA 1UAAA 1DIBA 3ABOB 3L40A 3UA3A 2PSDA 1ESCA 3BN3A 3K0BA 5ALZA 1RJGA 1STOA 2EHJA 1JLLA 3VC7A 3CH5A 1GFSA 4A7PA 4R31A 1NT4A 4BX3A 2HRZA 1RD4A 3KE8A 4BVLA 3WP1B 5IAAA 3FOFC 3W3AH 2Q41A 4Q7LA 4TTAA 2YJ4A 2AG1A 2DP4E 1J23A 4JLAA 2DT5A 3O3OB 3LZ6A 2I2WA 5AK3A 4YP7A 4E15A 4HADA 5NULA 3D4OA 3NT5A 3AJDA 2L17A 3VU8A 4IDDA 4GLLA 1C14A 4MI1A 3TTWA 3PNPA 4ARBA 4B3GA 2Z6UA 1KE2A 1O54A 4BB0A 4KDEA 5G4KB 2J9FB 3IBSA 4DN6A 3IIJA 2HCTA 4LSGA 1PD1A 2OVBA 1E9SA 1KZ6A 3H05A 1QZUA 4Q9JA 4EY4A 2WICA 3SEQA 1TJ3A 2NZVG 3I01A 2VS1A 4KE7A 1R9NA 2QN8A 1CY4A 1EFPB 4DMUB 5FPYA 3V33A 1DOHA 2FUEA 4J4TA 1MT0A 1LWNA 4IHAA 4XASA 4GE0A 5EZ5A 5YASA 3WIDA 2BI4A 5KTPA 4X9XA 4DMLA 4CL8A 2HHHB 1Z0IA 3N2KA 4C6TB 1ODJA 5LCXA 2V7UA 4RVSA 4WNAB 5J5AA 3HL0A 4DIBA 4RKWA 1JPNA 5EPEA 5KHLB 1L7VC 1FUIA 3TJMA 3NALA 1B2RA 4RBNA 5CVUA 4PQEA 5JV5A 4JI8B 4ETNA 4FFSA 4LHSA 4WNIA 2Q5EA 2XWBF 4K1LA 1KY5A 1YMVA 3RM3A 4FTWA 5E1BA 4EHKA 1KDRA 4PZEA 2IYLD 1Z4QA 2ZRFA 5B64A 1Y8AA 4QOEA 2M9MA 3N0XA 4MS3A 5JDIA 4YQFA 5ITWA 2XHZA 1QZ3A 2YJ3A 3PDUA 3HZHA 3ZDFA 1XQ1A 4CLRB 4XB2A 5K03A 4L9RA 2L0XA 4JSRA 2A9RA 4II3A 3DE1X 3FKJA 1D2HA 1WUIS 1Z68A 2HA6A 2W2LD 2ZE7A 1NQUA 3FOBA 2YOFA 3NNSA 3PL1A 4I14A 4IDAA 3W1EA 4OXRA 3GVPA 1ZXLA 1B6RA 2Q3FA 4RLSA 4F3NA 5E6UA 1P2VA 4Z9YA 1NIJA 2HQ1A 1Z4MA 1JR6A 4A2WA 4CN8A 4RGVA 2J3QA 4HDKA 5EI5A 3KB8A 3ZCVA 2BL4A 4EG0A 4N0QA 4UAGA 1A2OA 4PBTA 3O8NA 5EP2A 3HM9A 3F3YA 1VECA 1QIDA 3KYIB 2Z95A 4U02A 3LNCA 4B75A 1G5QA 1GTVA 2O2YA 3AKCA 5EESA 1JZQA 4HUTA 1VCIA 4IDCA 4ED9A 3RC2A 1ECBA 4R6WA 1PR1A 1I7QB 1ECCA 5CGQB 3G0HA 2GWRA 4KO8A 2EU8A 2J87A 2V0NA 4OX9Y 4AS1A 5ITZB 3HB0A 1O8CA 3E15A 1F8UA 4MQEA 4BUZA 5A9TA 3K1ZA 4ENRA 4OXXA 1I4EB 1U3VA