4ACFA

Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with imidazopyridine inhibitor ((4-(6-bromo-3-(butylamino)imidazo(1,2-a)pyridin-2-yl)phenoxy) acetic acid) and l-methionine-s-sulfoximine phosphate.
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
475
structure length
475
Chain Sequence
KTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Synthesis, Biological Evaluation and X-Ray Crystallographic Studies of Imidazo(1,2-A)Pyridine-Based Mycobacterium Tuberculosis Glutamine Synthetase Inhibitors
doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords GLUTAMINE SYNTHETASE 1
total genus 155
structure length 475
sequence length 475
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 4acfA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 4acfA02
1P52A 1G0WA 1I0EA 1FPYA 4BG4B 2OJWA 3JU6A 1SD0A 5J9AA 4Q2RA 2UU7A 4LNOA 4S17A 3ZXVA 4S0RA 1P50A 1QH4A 1VRPA 1M15A 4AM1A 1HTQA 1LGRA 4XYCA 4GVZA 1F52A 2CRKA 4LNFA 4ACFA 4BHLA 2GLSA 3NG0A 4LNIA 3DREA 2WGSA 3FKYA 4BAXA 2WHIA 2LGSA 2D3AA 1CRKA 1F1HA 1HTOA 4BG4A 3JU5A 4GVYA 1RL9A 3JQ3A 1U6RA 4GW0A 4RF7A 4GW2A 3B6RA 2D3CA 3L2DA 3L2EA 4Z9MA 2QC8A 2D3BA 1QK1A 1BG0A 4HPPA 3L2EB 3M10A 4RF8A 3ZXRA 4RF9A 5J99A 4LNKA 3JPZA 2BVCA 2J1QA 4RF6A 4LNNA 3DRBA
chains in the Genus database with same CATH superfamily
3AV8A 1P3QU 1LO5D 3P4RB 1V81A 3ZXVA 1JWUD 3AULA 3VFKA 4WQOB 3DHIC 4ANUA 3VHTC 1WIAA 3U8ZA 4GVYA 1C4PA 4BOSC 4FA6A 3LYYA 2D11A 3L2EB 3B2FA 2FCSA 2BWES 2CHWA 4M01A 1NI3A 2I1KA 1KJTA 4IWPA 4XYCA 1E8WA 2G4SA 2SEBD 2WP9B 3SEBA 2L52A 1FNWA 2KX3A 3A4SC 2J42A 4OVUA 2KQ4X 1H8CA 1QF6A 4RF6A 4XE0A 2GWCA 2KJRA 4AQ7A 4BFRA 1WXMA 1ZP0B 1RRBA 2WX0A 1QLBB 2G3QB 1L5PA 1NYQA 3NVVA 1ZGUB 2LGXA 5D3DA 2NVUI 4TMAB 3JQ3A 1WX8A 4FHJA 3CMMB 5IOIA 1WMHA 2A4ZA 1XLQA 2BB5A 3AE1B 2LMCA 2BVCA 1L0YB 4AP4C 2ZW1A 1I0EA 2MBEA 4RGNA 4LK0M 2OJWA 2AYOB 5J18A 4MDKE 1SJED 3VDZA 4N58A 1MJDA 1E6EB 4GSWA 3DBRB 3EECA 2CU3A 2LWPA 2EKEC 2LGDA 4GW0A 4M00A 4KDLB 1V86A 2XEWA 4WJPA 1TT5B 3VVWB 4JE3B 5I4DA 1TZOA 2BYEA 2J7QB 5IP4D 3I3TB 3EC8A 3BYYB 2W55A 1NVID 3MC0B 1F9JA 4KSLC 1J7BA 3RCZA 5BYRA 3QJZA 1SJHD 3ZJVA 2QMTA 5BMGA 2UWQA 1FRRA 3W5VB 1TY2A 1D6EC 1R4NI 2FIDA 3EFCA 4LNOA 2JY6A 1L2NA 1E90A 2DX5B 2KMCA 3CSFA 1TBEA 3RNFC 4PS8A 4BAXA 4LDTD 3VUWA 2ZNVC 3U52E 1K50A 1WR1A 2ZJDA 3KLSX 3PZ7A 3MJ5A 4MM3B 3NZSA 4G0NB 1XEEA 4F8CB 2SAKA 1WM3A 2DZIA 4BKSA 1C4CA 4FN2A 2KWVB 2WWZA 3A1QA 3UIOB 4LJOB 3M3JA 3ONSA 2ZCBA 4H2AA 4MT5A 1RYJA 4KZ0A 1C77A 1VR9A 4HPLB 2MLBA 1SXTA 3NZ3A 4P16A 5TSSA 4B0MA 3VTVA 3RZFA 1KH0A 1QZEA 2JXTA 3AEBB 1V80A 4NY0A 1C9FA 3QIJA 3TEYA 2D3GA 4BKTA 4KKJA 2R2QA 4A9AA 1KLVA 2Y5PA 4HROA 2LGSA 4G50A 1CRKA 3RZWC 2PE9A 4KGTA 1UBQA 5IKCM 1FXAA 1LFDA 2DLBA 5E6OA 3HIZA 5C1ZA 2JWUA 2DYOA 3SFEB 2PJHA 1JRUA 3DREA 2L32A 2GWDA 4BKSD 2PLPA 2AQ2B 1DOYA 1P98A 2KLCA 4A3OA 3DDCB 2VRRB 1UF0A 4FLHA 4DWFA 2Z0EB 3DWMA 3RNAC 3DHHC 4WJOA 4NAWB 5DPWA 2M17A 1YQBA 3JYUA 4GLSC 1HXYD 3MTNB 3VRBB 2FCNA 3I5JC 2N9EB 3KH0A 4LDTB 1R8GA 3OWEB 4C00A 4ZDVA 4IKGA 3IG5A 3PLUA 4P1CC 5D7GA 3SFDB 3P63A 1FD6A 1R4MI 4AOFA 1ZDXA 4KGRA 2O6VD 4W9JA 2ZPNA 3W1YA 2WLBA 3WALA 1V49A 1YQ3B 3H7SA 2L0FA 5LNK1 3FILA 2L05A 3PS6A 1PFDA 4Z9MA 3HHMA 3Q3NC 2FUHB 5J99A 3AE8B 2K3UA 2WXJA 1TS3A 1WM2A 1YN3A 1A70A 1T0SC 1EO6A 4J3OD 3HM3A 2KDEB 2JZ3B 3N20C 3FILB 2C7HA 3RI7C 2LFIA 4DBGA 1TIFA 4P1BC 2ICIA 4W9CA 4DHJD 4KKIA 2O6VA 2DENB 1LXDA 3EA6A 3T3NA 2LRWA 1HTOA 2JUOA 2LEKA 3VRAB 2JPHA 3ML9A 4DDGD 2IJ0A 3GP7A 3UF8A 1WX9A 4BOZB 2KFJA 1AYFA 2QDFA 3M62B 1P0RA 3RNCC 3NHEB 1UWMA 1GB4A 2L8JA 4WJNA 1WR6E 1OEYJ 1ZDVA 2BYTA 3EFUA 2WXNA 3IBEA 3ZLZA 1E8XA 1CMXB 2N1VA 5CHWA 2J52A 5BYQA 1RM6C 4E3CA 2E6XA 2LASA 1YX5B 3AE4B 4RM9A 3OG5A 4ICVA 2V3SA 4A3PA 2IO0B 4KSKC 1H4RA 3PVLA 3DPDA 1Y8RC 3AEEB 2D5GA 2JVCA 1EF1A 1T0YA 3JVZX 2KOXA 1F0ZA 2BB6A 3LB8C 1FMAD 2K39A 2MA9B 4PS3A 1QOGA 1V5TA 3Q6BA 3AH7A 2KANA 1SD0A 1C1YB 4Q2RA 2PPHA 3Q8FA 1FIQA 2DZJA 2VH1A 3EGRA 4JL9A 2LGYA 4JPSA 5LXIB 2RDGA 2DNFA 1AWDA 5CHVC 3PO0A 1JW9D 4JWUC 3L2DA 3LN6A 4LLGM 5LXHA 1UZXB 4WWNA 4A20A 3O13A 5E6NA 1XT9B 2MBQA 3PTFC 1QOAA 4JQWC 2KWDA 3HRDD 3FAHA 1GC6A 1B1ZA 2BYVE 5DPRA 2KD0A 5BO4B 1STEA 4F7ZA 2KDIA 4C4VA 3TMPB 2K22A 1WE7A 2MHJA 5AZHA 2PEAA 1T0RC 2ZEQA 4G3XB 3ZIMA 1JQ4A 2JRIB 3KQ4A 2KFKB 2PTLA 4ZHPA 2GBJA 5JHAA 1I35A 4WH4A 2ZNVB 3MFGA 1I4HA 1OQRA 1IGDA 3LXFA 4KDIC 2ZW0A 2N9PC 3V60A 1A5RA 3H1UA 4TV3A 4XC2A 3BVGA 1CZPA 2TSSA 3I57A 4MSMB 1TYGB 2DHZA 3V6CB 1ENFA 4EOYA 2KT7A 3A4RA 1UGMA 1VZ6A 2FE8A 4C7ZA 3ABVB 2KX0A 3LN7A 3TEXA 4A55A 4ZRKA 1PUTA 1ET6A 5DPSA 1LM8B 2LHDA 2NTSA 4LCDE 4W9DA 3ZYYX 1N6ZA 2K8BA 2KHWB 1SB3C 1XQQA 1NBFC 1OQYA 5JXVA 3CIRB 2WXMA 1XLPA 2N0SB 3RUIB 3AMZA 1QILA 1ZUD2 2W54A 1ZW7A 1YN4A 1YX6B 2JYTA 1VD2A 2BS4B 1BT0A 2RPQA 4FHKA 4WJQA 2L7RA 3UQAA 1ZOYB 2W3SA 1TKYA 2HTME 2ONQA 2KVZA 1T0QC 4WQMA 1FXIA 1WJ4A 2CS4A 1TTNA 1PYWD 1WXQA 1XCTL 1WJNA 4AJWA 4OVZA 1JCKB 2LRUA 3VQIA 1UNSA 2ASQA 5KHOA 1P1AA 1QOFA 2BF8B 3EHVA 4PT5A 1D5ZC 4DXGA 4EFOA 4MGIE 2KN5A 2KACA 4GDKB 3R66C 2QSDA 3ZJTA 3L4PA 1V6EA 4MGZE 4FBJB 4L2YA 2OHFA 5DCNA 2JF5A 3P42A 1KM7A 4NJ7A 2KDFB 1SE3A 3AECB 2H89B 5GMVA 3ZTDA 4RF0A 2BWFA 2KMAA 1KRHA 5DPTA 5G5GA 2M56B 4NAMA 4LJPB 3E9SA 3IAS1 1IYFA 3APCA 4K3CA 4NJCA 1Q0WB 2REXA 4RF1A 1U4AA 4WURA 2Y5CA 2WXIA 2EMSA 1L0XB 2B76B 3DOWA 2OJRA 4KGSA 3V05A 5D6JB 2EKIA 5LLIA 2MX2A 2NPTA 2WDQB 1WJUA 2MBHA 4ICUA 2W3RA 3B1LX 3TEZA 1WZ0A 1I4GA 2Y5BB 3WCQA 4WAAA 2CR5A 1WH3A 1BMLC 2VH2A 3T3OA 2AL3A 2DYMA 2WGSA 1AARA 1PDXA 3HUIA 2WXQA 2D07B 1M94A 2V4IB 3ZKJC 4E71A 2ZVOA 2I2YA 3L2EA 3DBRI 5G55A 2Z59B 1WSPA 3RT3B 3KVFB 2KFKA 4HRSA 1WGHA 2AWTA 2V3NA 5IA7A 3PSEB 3AN1A 1EU3A 1JMLA 3T9LA 2W82A 3C19A 3NG0A 2HDEA 3N32A 1JWBD 1WGDA 3APDA 4XWTA 4W9LA 3APFA 4R3DA 4GW2A 3ZRFA 5HG2A 1OFFA 5D2MB 3Q3FA 3ENEA 3L08A 3CF6E 2BQQA 2MQJA 3DBLB 1K51A 3RYTA 4FXCA 2B3AA 2WDTB 3ETRA 3DRBA 1MHHE 4B9KA 4P6VF 2NS5A 3W5UB 3IXSA 1JRPA 3H7PA 2WDRB 3BIID 1YOVB 2AL6A 2WQYB 2MEKA 3AE6B 5CX3A 4OZCA 4ZYNA 2NBVB 4OZBA 3X0WA 1V4GA 2MBBB 3ML8A 3M10A 2JWZA 2LUEA 4RM8A 1C79A 1JALA 4Q2JA 1YJ1A 3ECIA 1VA6A 3TSSA 4UDUC 1D4BA 3DQVA 5AUKA 1E5WA 3Q3MC 1FCCC 2WHIA 2LUMA 3ZRCA 4EZJA 1QKZA 4I6PA 3AM9A 4HKQA 3R2TA 2JZZA 2IPKD 3K9PB 1UD7A 1GPXA 2UYZB 5C23A 2GBNA 4G11A 3SHQA 1X1MA 2INPE 2V0GA 1DYQA 4IDIA 5EDSA 3RFZB 3P2BA 1FFUA 2G1EA 3IT4B 4JIOU 1L0VB 2KJ6A 1T6BX 1YMHE 3I63C 1WX7A 1YQ4B 3KYCD 4FULA 1WY8A 3DBHB 2IBIB 2J1QA 4XZ4A 2JU6X 3FC4A 5C2TB 5FR6A 2K25A 2IGGA 3A1QB 1WGKA 3NJTA 4REZA 3V3XA 2MP2B 3PZDA 1YJJA 4GOCA 4CHKA 4HVBA 2JXXA 1R4MB 3DVGY 2K8CA 1JROA 3MP9A 2PMVA 1K53A 3NS1A 2A5UA 2XK5A 1I4QA 4MGKE 1FPYA 1OGWA 1WGRA 1DOXA 2V9HA 3TBLD 4JX1C 1EUVB 4IOIE 3BVZA 3MHZA 3HM6X 3E56A 3RULA 2KC2A 5AZGA 4IUMB 2PIAA 2ZVNA 1U6RA 3VXWA 2KVRA 1QQRA 2KJHB 1BUIC 1QK1A 2KTFA 1WXVA 3KWLA 4HWIB 3A33B 5CHFA 3L54A 2O2VA 2KWCA 4YSZB 4IW0A 4K81A 4AM1A 2INCC 2CRKA 1FCLA 1ZXHA 3QAQA 1YD8U 1WRDB 4FJVB 4IWQA 4USAA 4MSQB 1MFWA 2C7MB 2J0MA 3PPAA 3JPZA 1YIWA 1S1QB 4KVGB 1BXTA 2WU2B 3GZNI 1J8CA 2C7NB 1P50A 4DK5A 2KK8A 3W2DA 3L10B 2GI9A 1P9DU 5L83A 4ANXA 1GUAB 4C4VB 4TUUA 4MM3A 3WAMA 1L6VA 5IO9A 4ANWA 4HXDA 4DHJB 2L0TA 4GIVA 1F77A 3ALBA 2QILA 3P4QB 5MPOA 4ZRJA 1I4RA 1F1HA 1KF6B 2J53A 5H92C 2CU1A 1WZ3A 2CKHB 2KNBA 3AB5A 1BG0A 1I4XA 3SR6A 1TGZB 2I38A 2IO1B 2KO3A 4FJZA 4GVZA 3UGBB 3NOBA 1UH6A 3B08A 2NTTA 3Q8AA 4HK2A 1FFVA 4HKZE 2WYQA 3PZ8A 1OTRB 3PT2B 3QHTA 4RF9A 3ZJUA 5EE9A 2G45B 2LJ5A 3PRPB 3J9CA 1CK1A 2WXKA 4S0RA 4D2KA 4US8A 4EZKA 4RNAA 1N60A 2KDBA 1UBIA 4BG4A 1N5WA 3DVNV 2JQRB 1MVKA 2MH7A 3U7DA 3IT6B 1ZKHA 3L13A 4US9A 3PGEA 5C3JB 2BKRB 4NAWA 3X23A 4YWGG 1C76A 4MACA 1CQVA 1L4ZB 4N59A 2D3AA 1EM7A 3BZDB 3ZNID 2BT6A 1E9MA 5EE3A 4MH8A 3QC8B 2KN4A 3PHWB 2YEPB 1PGXA 2BGFA 2IO3B 1D5MC 1VCBA 4W9IA 5T8IA 2LJIA 3T8MA 4FADA 2C9WB 4DHZE 4GN1A 3P1MA 5J9AA 2NR2A 3H9DA 4XGAB 4MH0E 2N9LA 1HEZE 1FNUA 1LGRA 1OEYA 1TKEA 1IP9A 1WRIA 3JSVA 1RWSA 5GXGB 1MI0A 2HTHA 5IN7A 4RCOA 1FO4A 1E8ZA 4RGTA 2N7JA 2NBWB 1NENB 3W1SC 2K5PA 4IM3A 4B6WA 2XN9C 3A9KB 1EWYC 2M0AA 2CHZA 4W9FA 1V5OA 3VAWA 3BINA 3S2AA 3RNEC 4AWJA 4KIKB 4KZCA 1WI0A 4WWPA 1EWCA 2V3PA 1HA5A 4B0EA 3H7PB 1N62A 2CJOA 2LVQA 3VH3B 1N5XA 5BMHA 3TL5A 1EF5A 1Q10A 4HDQA 1FXTB 2WXFA 1ISNA 1UGJA 5FK9C 4I6LB 1TS5A 1Q1OA 4LNFA 3N1XC 2ZCCA 2FBWB 2MP2A 3P4SB 1HZ6A 3I9V1 3VUXA 4ZOHC 1MPEA 4NZLB 4ZRQA 3H6NA 1E10A 1WE6A 4LNNA 3N1YC 3W1SA 3OAWA 4XWWA 4IM2A 1UUPA 2MJ3A 2BKFA 5AZFA 1V1OA 2DZMA 1WMHB 3K9OB 2WNMA 3VR9B 3N3KB 2GOWA 2Z8LA 1E7VA 4K7WA 2C60A 1RL9A 1SSNA 3DHGC 2YEPF 4YT0B 1IBXA 1VDVA 4URKA 3BK1A 3PRZA 2KXJA 4DHZB 2INDC 4ZYSA 2FIFA 3RN9C 3SD5A 3U30A 4K7SA 4OHJA 3M95A 4NPNA 5H8YE 2KDMA 5AUIA 2RSUA 4M0WB 1FEHA 3VH4B 3LDZE 1SGHA 2WXPA 2OEDA 2WXLA 3AU5A 4HCNB 5JZEB 4A90A 1J0GA 3B6RA 2WS3B 2EMTA 3QX1A 1HZ5A 2Z0DB 3IG8A 4RF8A 4W9KA 1WGGA 2V4LA 4I6NB 2X38A 4BBNF 4BVUC 4AUQC 4NQLB 5BYSA 3Q3JA 3NVWA 4NNJB 1XXGA 1KOTA 2L00B 4YTPB 2O6VB 3KUZA 2BYFA 1VLBA 1Y56A 2QEJC 4W9EA 4N9F4 3R3MA 4DDID 4HDOA 1LQBA 1VJKA 4GDLB 3JU6A 3Q8EA 3ZTCA 4C7YA 2Y3AA 1V8CA 4YXDB 2L76A 2ZZPB 5J17A 5HKHA 2BBCA 1XCQL 5AEKB 2IYDB 2DWQA 3Q69A 3IHPC 2EELA 5G5HA 1D3ZA 2QCZA 2PKOA 1G0WA 1WYWB 2CJNA 4OW0A 2MJDA 1J7CA 1SBBB 2E3TA 3AE9B 4HEA1 2JYEA 2MSED 1GB1A 2C5LC 2D10A 4DXAB 3AXCA 1E7UA 3AEFB 3MC8A 4TKNA 2J4XA 2BTEA 1N63A 2KKCA 3B0AA 2FCQA 1QOBA 3N9YC 3B2GA 3H8HA 2GRIA 1KTKA 3PV1A 2L1AA 3AEDB 4MGYE 1WXAA 4DXFA 2J0KA 3GE8C 3L17A 2PW9A 3QARA 2AQ3B 3A9JA 4ARIA 1FM0D 3AU4A 4M02A 2FNJB 2PE6B 4OZAA 2RD0A 3QWZB 3VR8B 5JHBA 4EZLA 2GB1A 1L7YA 3KWVA 4GU2A 1KLUD 3ZNZB 3URYA 3JU5A 1AN8A 4TSSA 4RF7A 2D3CA 1V2YA 1EU4A 3DWGC 1L6UA 4EUTA 3ZXRA 3HVDA 1TS2A 3R7RA 1DOIA 5HHDG 1ACCA 3EUB2 2W9NA 4NQKE 2HJ8A 2PVOD 3Q8BA 3SDLC 2N7DA 1SE4A 4TQ0A 1SIFA 2NCNA 5E6JA 1E0ZA 3V61A 2MWSB 2QJLA 2LXAA 3AE3B 1S3SG 4K3BA 3C0RB 1SIJA 3WAPA 1Z5SB 3NZTA 2MCNB 4HJGE 2HJ1A 1IUEA 2K9XA 4K1RB 3L16A 2BW2A 1P7FA 1C78A 3ZNHB 3AE2B 4PS7A 3UQBA 5JH5C 2JT4B 2M19A 1DGJA 2KTRB 2N1WA 2XNAC 3N30A 2K1FA 2KAJA 2YVCA 4JLCA 3VTWA 4J6IA 4MEMA 4JWSC 1IGCA 4C80A 1XLNA 4X57B 2JRHA 2KQSA 4L23A 4OVVA 1C3TA 5J2RA 3O65B 4F1SA 1NI2A 3MJWA 4BBNC 3B9JA 3ZW3A 1OQQA 2RDHA 4KIKA 1ESFA 1XF5L 4II2B 2CHXA 2VZKD 4CO7A 3R2IA 4RGOS 4YSYB 1PGBA 3BK2A 4WAFA 3DBHI 1K8RB 4PYUA 1R7SA 2WXGA 4LNKA 2WU5B 1T5XD 2WDVB 4YL8A 5EE1A 2M4NA 2XBBC 4DQOC 1HTQA 1VZ8A 3LVVA 2LXCA 4IWOA 1F2RI 4HLEA 2M1MA 3C8YA 1XLOA 3KUDB 4TQ1A 1TJEA 1N61A 1V1PB 2KLGA 3QA8A 4EKUA 1R4NB 1XD3B 3A9JB 3GOEA 1SEBD 3KW5B 2MRPA 5FR3A 2KWUB 1UWXA 1F52A 3V6EB 2D33A 4RH6A 4MJSB 1GNUA 1UELA 3OJ3A 3BY4B 1QH4A 2OOBB 4RMAA 2IDYA 4GMVA 3NVZA 1GAQB 2HD5B 3PREA 3RPFC 3DBLI 2RDBC 2LI5A 1ZE3D 3UI3A 4AS1A 1JWAD 2ON8A 2QC8A 4HCPB 3RNBC 1P7EA 1Z2MA 1RLFA 3ZVVA 3GB1A 4XDDA 5EE0A 1GJZA 2MJEA 3TUOA 4M8NA 1JWSD 2KC1A 2H88B 5KHQA 1YNTE 2RPVA 1KFYB 3HK0A 1I42A 2BPSA 2FUG1 4BZAA 1WF9A 1IPGA 3NY5A 4B95A 2FAZA 3TCAA 2R61A 2KQ7A 1WWTA 1XO3A 3NUHB 1I4PA 3R7QA 3TEWA 3A9KA 2M0XA 4BHLA 4O1NA 5CTRC 1ET9A 3P4PB 4WWMA 4GGQA 1RAXA 1WJ6A 4KX6B 3OJ4B 1E8YA 2QHOA 2N9KA 4BG4B 2L3ZA 4CYEA 1QT9A 1SE2A 3NVYA 3OLMD 2IGHA 4HPMB 3U4EG 4YTNB 2IY0B 1TY0A 4KV2A 1WXSA 2V1YA 4P7IA 3IVFA 2FCMA 3RD2A 4RFBA 2I1JA 1TZ1A 1E7PB 4GXBA 2NBUA 3WAOA 1TT4A 4LNIA 4PK1A 4II3B 1FRDA 2LD9A 3NS8A 2K6DB 4HJKA 1B9RA 4ZHOA 1C4AA 2ACZB 3BYTB 4M0WA 3ZDMC 3ZNGC 1NYRA 3AI5A 3V62A 2LVOA 3Q8CA 2IY1B 3AE7B 1WGYA 2O2VB 1FNVA 2N4FA 2LZ6A 4IM0A 1RFKA 2RMMA 2Q5WD 3RMKC 3FKYA 4IC7B 3N1ZC 4IG7B 4M8MA 1SE9A 2GBMA 1M4VA 2R2OA 2L83A 4CQNA 3PLVA 2D2QA 3Q2AC 3QK0A 3Q14C 1D5XC 2VZKB 1PQSA 4ZRIA 3SU8X 3ZQ4A 2JX5A 2G4DB 2QIEB 2IGDA 2K6QA 2GLSA 1L4DB 1WFYA 2KYWA 1J7AA 1HE8A 2N9XA 3L0WB 2K0PA 3W9CB 1TS4A 2BS3B 2INNE 4HPPA 3CSTA 4EEWA 3NZUA 2AQ1B 2WXRA 2NMQA 2G9HD 4L1BA 1T3QA 2WXHA 2KMMA 5D94A 1J19A 3BWUD 3CWIA 2KTRA 2LHEA 4WIPA 4YSXB 2AEHA 3R8BA 3TJPA 3U2SC 2MW5A 3Q3OC 2M8SA 2KZRA 2RGFA 4WWOA 4N6EB 3WIMA 2IO2B 5L95C 1CJEA 1WYGA 1MG8A 4AJYB 3TIXA 4NJ6A 4PYZA 5IAAC 4ASWC 2X8XX 2ZPYA 2MBOA 5HI1A 4A6QA 4MELA 1G6JA 1GG3A 4ACFA 4ZRPA 1F2RC 1K52A 3LJ3A 4EE2A 3ZO5B 3ZDTA 3DVNU 3QQ8B 4GDKA 4A8XC 1AW7A 5FKAC 2AX5A 2NPTB 3JSVB 2GMIC 4GB9A 1MHXA 1P52A 1NDDA 4ITKA 2BS2B 2PVGC 3IG3A 2HE7A 1VZ7A 3LVWA 4RGMA 4YTMB 1NEKB 1VRAB 3DBSA 3MC9A 3GS2A 3U7ZA 1V1PA 1V97A 2YLMA 3ZGZA 3IFWB 1GC7A 3DVGX 3UIPB 1PGAA 2N7EA 4MJSA 2DAFA 3AEAB 2LVPA 2UU7A 1VRPA 3WA0A 2K8HA 1M15A 4W9HA 1GOZA 1RFAA 4QAYA 1TKGA 2GBKA 2JSVX 2XK5B 4JGHB 2J0JA 2GBRA 3MHSD 3VTUA 3VUYA 3KUCB 1SF0A 1IBXB 3HVZA 4W9GA 1HQRD 5E6PA 3PRMB 5BMIA 2JZPA 2D3BA 4XDCA 3WANA 3D32A 4LTUA 3ZUNA 4BKGA 3AEGB 2DBYA 3JW0X 4ARCA 5HFYA 3RNGC 1I7HA 1ROEA 4FJYA 3UINB 2DYBA 3DCGA 2DAJA 4C56C 3GZNB 3PHXB 3AE5B 1KLGD 5G2NA 1YJIA 5D3IB 1ZXIA 2RR9A 2WX1A 3M63B 2LGIA 3KYDD 2DZKA 1MG4A 3QCAA 4GDLA 4XX5A 3NRZA 4S17A 1Q5WB 1YN5A 4ANVA 4E74A 1V9JA 2D32A 3IAM1 1ZPSA 3GE3C 3BVMA 5TR5A 2WXOA 4K7UA 1JWMD 2IZVB
chains in the Genus database with same CATH topology
1P52A 1G0WA 1I0EA 1FPYA 4BG4B 2OJWA 3JU6A 1SD0A 5J9AA 4Q2RA 2UU7A 4LNOA 4S17A 3ZXVA 4S0RA 1P50A 1QH4A 1VRPA 1M15A 4AM1A 1HTQA 1LGRA 4XYCA 4GVZA 1F52A 2CRKA 4LNFA 4ACFA 4BHLA 2GLSA 3NG0A 4LNIA 3DREA 2WGSA 3FKYA 4BAXA 2WHIA 2LGSA 2D3AA 1CRKA 1F1HA 1HTOA 4BG4A 3JU5A 4GVYA 1RL9A 3JQ3A 1U6RA 4GW0A 4RF7A 4GW2A 3B6RA 2D3CA 3L2DA 3L2EA 4Z9MA 2QC8A 2D3BA 1QK1A 1BG0A 4HPPA 3L2EB 3M10A 4RF8A 3ZXRA 4RF9A 5J99A 4LNKA 3JPZA 2BVCA 2J1QA 4RF6A 4LNNA 3DRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P52 A;  1G0W A;  1I0E A;  1FPY A;  4BG4 B;  2OJW A;  3JU6 A;  1SD0 A;  5J9A A;  4Q2R A;  2UU7 A;  4LNO A;  4S17 A;  3ZXV A;  4S0R A;  1P50 A;  1QH4 A;  1VRP A;  1M15 A;  4AM1 A;  1HTQ A;  1LGR A;  4XYC A;  4GVZ A;  1F52 A;  2CRK A;  4LNF A;  4ACF A;  4BHL A;  2GLS A;  3NG0 A;  4LNI A;  3DRE A;  2WGS A;  3FKY A;  4BAX A;  2WHI A;  2LGS A;  2D3A A;  1CRK A;  1F1H A;  1HTO A;  4BG4 A;  3JU5 A;  4GVY A;  1RL9 A;  3JQ3 A;  1U6R A;  4GW0 A;  4RF7 A;  4GW2 A;  3B6R A;  2D3C A;  3L2D A;  3L2E A;  4Z9M A;  2QC8 A;  2D3B A;  1QK1 A;  1BG0 A;  4HPP A;  3L2E B;  3M10 A;  4RF8 A;  3ZXR A;  4RF9 A;  5J99 A;  4LNK A;  3JPZ A;  2BVC A;  2J1Q A;  4RF6 A;  4LNN A;  3DRB A; 
#chains in the Genus database with same CATH topology
 3AV8 A;  1P3Q U;  1LO5 D;  3P4R B;  1V81 A;  3ZXV A;  1JWU D;  3AUL A;  3VFK A;  4WQO B;  3DHI C;  4ANU A;  3VHT C;  1WIA A;  3U8Z A;  4GVY A;  1C4P A;  4BOS C;  4FA6 A;  3LYY A;  2D11 A;  3L2E B;  3B2F A;  2FCS A;  2BWE S;  2CHW A;  4M01 A;  1NI3 A;  2I1K A;  1KJT A;  4IWP A;  4XYC A;  1E8W A;  2G4S A;  2SEB D;  2WP9 B;  3SEB A;  2L52 A;  1FNW A;  2KX3 A;  3A4S C;  2J42 A;  4OVU A;  2KQ4 X;  1H8C A;  1QF6 A;  4RF6 A;  4XE0 A;  2GWC A;  2KJR A;  4AQ7 A;  4BFR A;  1WXM A;  1ZP0 B;  1RRB A;  2WX0 A;  1QLB B;  2G3Q B;  1L5P A;  1NYQ A;  3NVV A;  1ZGU B;  2LGX A;  5D3D A;  2NVU I;  4TMA B;  3JQ3 A;  1WX8 A;  4FHJ A;  3CMM B;  5IOI A;  1WMH A;  2A4Z A;  1XLQ A;  2BB5 A;  3AE1 B;  2LMC A;  2BVC A;  1L0Y B;  4AP4 C;  2ZW1 A;  1I0E A;  2MBE A;  4RGN A;  4LK0 M;  2OJW A;  2AYO B;  5J18 A;  4MDK E;  1SJE D;  3VDZ A;  4N58 A;  1MJD A;  1E6E B;  4GSW A;  3DBR B;  3EEC A;  2CU3 A;  2LWP A;  2EKE C;  2LGD A;  4GW0 A;  4M00 A;  4KDL B;  1V86 A;  2XEW A;  4WJP A;  1TT5 B;  3VVW B;  4JE3 B;  5I4D A;  1TZO A;  2BYE A;  2J7Q B;  5IP4 D;  3I3T B;  3EC8 A;  3BYY B;  2W55 A;  1NVI D;  3MC0 B;  1F9J A;  4KSL C;  1J7B A;  3RCZ A;  5BYR A;  3QJZ A;  1SJH D;  3ZJV A;  2QMT A;  5BMG A;  2UWQ A;  1FRR A;  3W5V B;  1TY2 A;  1D6E C;  1R4N I;  2FID A;  3EFC A;  4LNO A;  2JY6 A;  1L2N A;  1E90 A;  2DX5 B;  2KMC A;  3CSF A;  1TBE A;  3RNF C;  4PS8 A;  4BAX A;  4LDT D;  3VUW A;  2ZNV C;  3U52 E;  1K50 A;  1WR1 A;  2ZJD A;  3KLS X;  3PZ7 A;  3MJ5 A;  4MM3 B;  3NZS A;  4G0N B;  1XEE A;  4F8C B;  2SAK A;  1WM3 A;  2DZI A;  4BKS A;  1C4C A;  4FN2 A;  2KWV B;  2WWZ A;  3A1Q A;  3UIO B;  4LJO B;  3M3J A;  3ONS A;  2ZCB A;  4H2A A;  4MT5 A;  1RYJ A;  4KZ0 A;  1C77 A;  1VR9 A;  4HPL B;  2MLB A;  1SXT A;  3NZ3 A;  4P16 A;  5TSS A;  4B0M A;  3VTV A;  3RZF A;  1KH0 A;  1QZE A;  2JXT A;  3AEB B;  1V80 A;  4NY0 A;  1C9F A;  3QIJ A;  3TEY A;  2D3G A;  4BKT A;  4KKJ A;  2R2Q A;  4A9A A;  1KLV A;  2Y5P A;  4HRO A;  2LGS A;  4G50 A;  1CRK A;  3RZW C;  2PE9 A;  4KGT A;  1UBQ A;  5IKC M;  1FXA A;  1LFD A;  2DLB A;  5E6O A;  3HIZ A;  5C1Z A;  2JWU A;  2DYO A;  3SFE B;  2PJH A;  1JRU A;  3DRE A;  2L32 A;  2GWD A;  4BKS D;  2PLP A;  2AQ2 B;  1DOY A;  1P98 A;  2KLC A;  4A3O A;  3DDC B;  2VRR B;  1UF0 A;  4FLH A;  4DWF A;  2Z0E B;  3DWM A;  3RNA C;  3DHH C;  4WJO A;  4NAW B;  5DPW A;  2M17 A;  1YQB A;  3JYU A;  4GLS C;  1HXY D;  3MTN B;  3VRB B;  2FCN A;  3I5J C;  2N9E B;  3KH0 A;  4LDT B;  1R8G A;  3OWE B;  4C00 A;  4ZDV A;  4IKG A;  3IG5 A;  3PLU A;  4P1C C;  5D7G A;  3SFD B;  3P63 A;  1FD6 A;  1R4M I;  4AOF A;  1ZDX A;  4KGR A;  2O6V D;  4W9J A;  2ZPN A;  3W1Y A;  2WLB A;  3WAL A;  1V49 A;  1YQ3 B;  3H7S A;  2L0F A;  5LNK 1;  3FIL A;  2L05 A;  3PS6 A;  1PFD A;  4Z9M A;  3HHM A;  3Q3N C;  2FUH B;  5J99 A;  3AE8 B;  2K3U A;  2WXJ A;  1TS3 A;  1WM2 A;  1YN3 A;  1A70 A;  1T0S C;  1EO6 A;  4J3O D;  3HM3 A;  2KDE B;  2JZ3 B;  3N20 C;  3FIL B;  2C7H A;  3RI7 C;  2LFI A;  4DBG A;  1TIF A;  4P1B C;  2ICI A;  4W9C A;  4DHJ D;  4KKI A;  2O6V A;  2DEN B;  1LXD A;  3EA6 A;  3T3N A;  2LRW A;  1HTO A;  2JUO A;  2LEK A;  3VRA B;  2JPH A;  3ML9 A;  4DDG D;  2IJ0 A;  3GP7 A;  3UF8 A;  1WX9 A;  4BOZ B;  2KFJ A;  1AYF A;  2QDF A;  3M62 B;  1P0R A;  3RNC C;  3NHE B;  1UWM A;  1GB4 A;  2L8J A;  4WJN A;  1WR6 E;  1OEY J;  1ZDV A;  2BYT A;  3EFU A;  2WXN A;  3IBE A;  3ZLZ A;  1E8X A;  1CMX B;  2N1V A;  5CHW A;  2J52 A;  5BYQ A;  1RM6 C;  4E3C A;  2E6X A;  2LAS A;  1YX5 B;  3AE4 B;  4RM9 A;  3OG5 A;  4ICV A;  2V3S A;  4A3P A;  2IO0 B;  4KSK C;  1H4R A;  3PVL A;  3DPD A;  1Y8R C;  3AEE B;  2D5G A;  2JVC A;  1EF1 A;  1T0Y A;  3JVZ X;  2KOX A;  1F0Z A;  2BB6 A;  3LB8 C;  1FMA D;  2K39 A;  2MA9 B;  4PS3 A;  1QOG A;  1V5T A;  3Q6B A;  3AH7 A;  2KAN A;  1SD0 A;  1C1Y B;  4Q2R A;  2PPH A;  3Q8F A;  1FIQ A;  2DZJ A;  2VH1 A;  3EGR A;  4JL9 A;  2LGY A;  4JPS A;  5LXI B;  2RDG A;  2DNF A;  1AWD A;  5CHV C;  3PO0 A;  1JW9 D;  4JWU C;  3L2D A;  3LN6 A;  4LLG M;  5LXH A;  1UZX B;  4WWN A;  4A20 A;  3O13 A;  5E6N A;  1XT9 B;  2MBQ A;  3PTF C;  1QOA A;  4JQW C;  2KWD A;  3HRD D;  3FAH A;  1GC6 A;  1B1Z A;  2BYV E;  5DPR A;  2KD0 A;  5BO4 B;  1STE A;  4F7Z A;  2KDI A;  4C4V A;  3TMP B;  2K22 A;  1WE7 A;  2MHJ A;  5AZH A;  2PEA A;  1T0R C;  2ZEQ A;  4G3X B;  3ZIM A;  1JQ4 A;  2JRI B;  3KQ4 A;  2KFK B;  2PTL A;  4ZHP A;  2GBJ A;  5JHA A;  1I35 A;  4WH4 A;  2ZNV B;  3MFG A;  1I4H A;  1OQR A;  1IGD A;  3LXF A;  4KDI C;  2ZW0 A;  2N9P C;  3V60 A;  1A5R A;  3H1U A;  4TV3 A;  4XC2 A;  3BVG A;  1CZP A;  2TSS A;  3I57 A;  4MSM B;  1TYG B;  2DHZ A;  3V6C B;  1ENF A;  4EOY A;  2KT7 A;  3A4R A;  1UGM A;  1VZ6 A;  2FE8 A;  4C7Z A;  3ABV B;  2KX0 A;  3LN7 A;  3TEX A;  4A55 A;  4ZRK A;  1PUT A;  1ET6 A;  5DPS A;  1LM8 B;  2LHD A;  2NTS A;  4LCD E;  4W9D A;  3ZYY X;  1N6Z A;  2K8B A;  2KHW B;  1SB3 C;  1XQQ A;  1NBF C;  1OQY A;  5JXV A;  3CIR B;  2WXM A;  1XLP A;  2N0S B;  3RUI B;  3AMZ A;  1QIL A;  1ZUD 2;  2W54 A;  1ZW7 A;  1YN4 A;  1YX6 B;  2JYT A;  1VD2 A;  2BS4 B;  1BT0 A;  2RPQ A;  4FHK A;  4WJQ A;  2L7R A;  3UQA A;  1ZOY B;  2W3S A;  1TKY A;  2HTM E;  2ONQ A;  2KVZ A;  1T0Q C;  4WQM A;  1FXI A;  1WJ4 A;  2CS4 A;  1TTN A;  1PYW D;  1WXQ A;  1XCT L;  1WJN A;  4AJW A;  4OVZ A;  1JCK B;  2LRU A;  3VQI A;  1UNS A;  2ASQ A;  5KHO A;  1P1A A;  1QOF A;  2BF8 B;  3EHV A;  4PT5 A;  1D5Z C;  4DXG A;  4EFO A;  4MGI E;  2KN5 A;  2KAC A;  4GDK B;  3R66 C;  2QSD A;  3ZJT A;  3L4P A;  1V6E A;  4MGZ E;  4FBJ B;  4L2Y A;  2OHF A;  5DCN A;  2JF5 A;  3P42 A;  1KM7 A;  4NJ7 A;  2KDF B;  1SE3 A;  3AEC B;  2H89 B;  5GMV A;  3ZTD A;  4RF0 A;  2BWF A;  2KMA A;  1KRH A;  5DPT A;  5G5G A;  2M56 B;  4NAM A;  4LJP B;  3E9S A;  3IAS 1;  1IYF A;  3APC A;  4K3C A;  4NJC A;  1Q0W B;  2REX A;  4RF1 A;  1U4A A;  4WUR A;  2Y5C A;  2WXI A;  2EMS A;  1L0X B;  2B76 B;  3DOW A;  2OJR A;  4KGS A;  3V05 A;  5D6J B;  2EKI A;  5LLI A;  2MX2 A;  2NPT A;  2WDQ B;  1WJU A;  2MBH A;  4ICU A;  2W3R A;  3B1L X;  3TEZ A;  1WZ0 A;  1I4G A;  2Y5B B;  3WCQ A;  4WAA A;  2CR5 A;  1WH3 A;  1BML C;  2VH2 A;  3T3O A;  2AL3 A;  2DYM A;  2WGS A;  1AAR A;  1PDX A;  3HUI A;  2WXQ A;  2D07 B;  1M94 A;  2V4I B;  3ZKJ C;  4E71 A;  2ZVO A;  2I2Y A;  3L2E A;  3DBR I;  5G55 A;  2Z59 B;  1WSP A;  3RT3 B;  3KVF B;  2KFK A;  4HRS A;  1WGH A;  2AWT A;  2V3N A;  5IA7 A;  3PSE B;  3AN1 A;  1EU3 A;  1JML A;  3T9L A;  2W82 A;  3C19 A;  3NG0 A;  2HDE A;  3N32 A;  1JWB D;  1WGD A;  3APD A;  4XWT A;  4W9L A;  3APF A;  4R3D A;  4GW2 A;  3ZRF A;  5HG2 A;  1OFF A;  5D2M B;  3Q3F A;  3ENE A;  3L08 A;  3CF6 E;  2BQQ A;  2MQJ A;  3DBL B;  1K51 A;  3RYT A;  4FXC A;  2B3A A;  2WDT B;  3ETR A;  3DRB A;  1MHH E;  4B9K A;  4P6V F;  2NS5 A;  3W5U B;  3IXS A;  1JRP A;  3H7P A;  2WDR B;  3BII D;  1YOV B;  2AL6 A;  2WQY B;  2MEK A;  3AE6 B;  5CX3 A;  4OZC A;  4ZYN A;  2NBV B;  4OZB A;  3X0W A;  1V4G A;  2MBB B;  3ML8 A;  3M10 A;  2JWZ A;  2LUE A;  4RM8 A;  1C79 A;  1JAL A;  4Q2J A;  1YJ1 A;  3ECI A;  1VA6 A;  3TSS A;  4UDU C;  1D4B A;  3DQV A;  5AUK A;  1E5W A;  3Q3M C;  1FCC C;  2WHI A;  2LUM A;  3ZRC A;  4EZJ A;  1QKZ A;  4I6P A;  3AM9 A;  4HKQ A;  3R2T A;  2JZZ A;  2IPK D;  3K9P B;  1UD7 A;  1GPX A;  2UYZ B;  5C23 A;  2GBN A;  4G11 A;  3SHQ A;  1X1M A;  2INP E;  2V0G A;  1DYQ A;  4IDI A;  5EDS A;  3RFZ B;  3P2B A;  1FFU A;  2G1E A;  3IT4 B;  4JIO U;  1L0V B;  2KJ6 A;  1T6B X;  1YMH E;  3I63 C;  1WX7 A;  1YQ4 B;  3KYC D;  4FUL A;  1WY8 A;  3DBH B;  2IBI B;  2J1Q A;  4XZ4 A;  2JU6 X;  3FC4 A;  5C2T B;  5FR6 A;  2K25 A;  2IGG A;  3A1Q B;  1WGK A;  3NJT A;  4REZ A;  3V3X A;  2MP2 B;  3PZD A;  1YJJ A;  4GOC A;  4CHK A;  4HVB A;  2JXX A;  1R4M B;  3DVG Y;  2K8C A;  1JRO A;  3MP9 A;  2PMV A;  1K53 A;  3NS1 A;  2A5U A;  2XK5 A;  1I4Q A;  4MGK E;  1FPY A;  1OGW A;  1WGR A;  1DOX A;  2V9H A;  3TBL D;  4JX1 C;  1EUV B;  4IOI E;  3BVZ A;  3MHZ A;  3HM6 X;  3E56 A;  3RUL A;  2KC2 A;  5AZG A;  4IUM B;  2PIA A;  2ZVN A;  1U6R A;  3VXW A;  2KVR A;  1QQR A;  2KJH B;  1BUI C;  1QK1 A;  2KTF A;  1WXV A;  3KWL A;  4HWI B;  3A33 B;  5CHF A;  3L54 A;  2O2V A;  2KWC A;  4YSZ B;  4IW0 A;  4K81 A;  4AM1 A;  2INC C;  2CRK A;  1FCL A;  1ZXH A;  3QAQ A;  1YD8 U;  1WRD B;  4FJV B;  4IWQ A;  4USA A;  4MSQ B;  1MFW A;  2C7M B;  2J0M A;  3PPA A;  3JPZ A;  1YIW A;  1S1Q B;  4KVG B;  1BXT A;  2WU2 B;  3GZN I;  1J8C A;  2C7N B;  1P50 A;  4DK5 A;  2KK8 A;  3W2D A;  3L10 B;  2GI9 A;  1P9D U;  5L83 A;  4ANX A;  1GUA B;  4C4V B;  4TUU A;  4MM3 A;  3WAM A;  1L6V A;  5IO9 A;  4ANW A;  4HXD A;  4DHJ B;  2L0T A;  4GIV A;  1F77 A;  3ALB A;  2QIL A;  3P4Q B;  5MPO A;  4ZRJ A;  1I4R A;  1F1H A;  1KF6 B;  2J53 A;  5H92 C;  2CU1 A;  1WZ3 A;  2CKH B;  2KNB A;  3AB5 A;  1BG0 A;  1I4X A;  3SR6 A;  1TGZ B;  2I38 A;  2IO1 B;  2KO3 A;  4FJZ A;  4GVZ A;  3UGB B;  3NOB A;  1UH6 A;  3B08 A;  2NTT A;  3Q8A A;  4HK2 A;  1FFV A;  4HKZ E;  2WYQ A;  3PZ8 A;  1OTR B;  3PT2 B;  3QHT A;  4RF9 A;  3ZJU A;  5EE9 A;  2G45 B;  2LJ5 A;  3PRP B;  3J9C A;  1CK1 A;  2WXK A;  4S0R A;  4D2K A;  4US8 A;  4EZK A;  4RNA A;  1N60 A;  2KDB A;  1UBI A;  4BG4 A;  1N5W A;  3DVN V;  2JQR B;  1MVK A;  2MH7 A;  3U7D A;  3IT6 B;  1ZKH A;  3L13 A;  4US9 A;  3PGE A;  5C3J B;  2BKR B;  4NAW A;  3X23 A;  4YWG G;  1C76 A;  4MAC A;  1CQV A;  1L4Z B;  4N59 A;  2D3A A;  1EM7 A;  3BZD B;  3ZNI D;  2BT6 A;  1E9M A;  5EE3 A;  4MH8 A;  3QC8 B;  2KN4 A;  3PHW B;  2YEP B;  1PGX A;  2BGF A;  2IO3 B;  1D5M C;  1VCB A;  4W9I A;  5T8I A;  2LJI A;  3T8M A;  4FAD A;  2C9W B;  4DHZ E;  4GN1 A;  3P1M A;  5J9A A;  2NR2 A;  3H9D A;  4XGA B;  4MH0 E;  2N9L A;  1HEZ E;  1FNU A;  1LGR A;  1OEY A;  1TKE A;  1IP9 A;  1WRI A;  3JSV A;  1RWS A;  5GXG B;  1MI0 A;  2HTH A;  5IN7 A;  4RCO A;  1FO4 A;  1E8Z A;  4RGT A;  2N7J A;  2NBW B;  1NEN B;  3W1S C;  2K5P A;  4IM3 A;  4B6W A;  2XN9 C;  3A9K B;  1EWY C;  2M0A A;  2CHZ A;  4W9F A;  1V5O A;  3VAW A;  3BIN A;  3S2A A;  3RNE C;  4AWJ A;  4KIK B;  4KZC A;  1WI0 A;  4WWP A;  1EWC A;  2V3P A;  1HA5 A;  4B0E A;  3H7P B;  1N62 A;  2CJO A;  2LVQ A;  3VH3 B;  1N5X A;  5BMH A;  3TL5 A;  1EF5 A;  1Q10 A;  4HDQ A;  1FXT B;  2WXF A;  1ISN A;  1UGJ A;  5FK9 C;  4I6L B;  1TS5 A;  1Q1O A;  4LNF A;  3N1X C;  2ZCC A;  2FBW B;  2MP2 A;  3P4S B;  1HZ6 A;  3I9V 1;  3VUX A;  4ZOH C;  1MPE A;  4NZL B;  4ZRQ A;  3H6N A;  1E10 A;  1WE6 A;  4LNN A;  3N1Y C;  3W1S A;  3OAW A;  4XWW A;  4IM2 A;  1UUP A;  2MJ3 A;  2BKF A;  5AZF A;  1V1O A;  2DZM A;  1WMH B;  3K9O B;  2WNM A;  3VR9 B;  3N3K B;  2GOW A;  2Z8L A;  1E7V A;  4K7W A;  2C60 A;  1RL9 A;  1SSN A;  3DHG C;  2YEP F;  4YT0 B;  1IBX A;  1VDV A;  4URK A;  3BK1 A;  3PRZ A;  2KXJ A;  4DHZ B;  2IND C;  4ZYS A;  2FIF A;  3RN9 C;  3SD5 A;  3U30 A;  4K7S A;  4OHJ A;  3M95 A;  4NPN A;  5H8Y E;  2KDM A;  5AUI A;  2RSU A;  4M0W B;  1FEH A;  3VH4 B;  3LDZ E;  1SGH A;  2WXP A;  2OED A;  2WXL A;  3AU5 A;  4HCN B;  5JZE B;  4A90 A;  1J0G A;  3B6R A;  2WS3 B;  2EMT A;  3QX1 A;  1HZ5 A;  2Z0D B;  3IG8 A;  4RF8 A;  4W9K A;  1WGG A;  2V4L A;  4I6N B;  2X38 A;  4BBN F;  4BVU C;  4AUQ C;  4NQL B;  5BYS A;  3Q3J A;  3NVW A;  4NNJ B;  1XXG A;  1KOT A;  2L00 B;  4YTP B;  2O6V B;  3KUZ A;  2BYF A;  1VLB A;  1Y56 A;  2QEJ C;  4W9E A;  4N9F 4;  3R3M A;  4DDI D;  4HDO A;  1LQB A;  1VJK A;  4GDL B;  3JU6 A;  3Q8E A;  3ZTC A;  4C7Y A;  2Y3A A;  1V8C A;  4YXD B;  2L76 A;  2ZZP B;  5J17 A;  5HKH A;  2BBC A;  1XCQ L;  5AEK B;  2IYD B;  2DWQ A;  3Q69 A;  3IHP C;  2EEL A;  5G5H A;  1D3Z A;  2QCZ A;  2PKO A;  1G0W A;  1WYW B;  2CJN A;  4OW0 A;  2MJD A;  1J7C A;  1SBB B;  2E3T A;  3AE9 B;  4HEA 1;  2JYE A;  2MSE D;  1GB1 A;  2C5L C;  2D10 A;  4DXA B;  3AXC A;  1E7U A;  3AEF B;  3MC8 A;  4TKN A;  2J4X A;  2BTE A;  1N63 A;  2KKC A;  3B0A A;  2FCQ A;  1QOB A;  3N9Y C;  3B2G A;  3H8H A;  2GRI A;  1KTK A;  3PV1 A;  2L1A A;  3AED B;  4MGY E;  1WXA A;  4DXF A;  2J0K A;  3GE8 C;  3L17 A;  2PW9 A;  3QAR A;  2AQ3 B;  3A9J A;  4ARI A;  1FM0 D;  3AU4 A;  4M02 A;  2FNJ B;  2PE6 B;  4OZA A;  2RD0 A;  3QWZ B;  3VR8 B;  5JHB A;  4EZL A;  2GB1 A;  1L7Y A;  3KWV A;  4GU2 A;  1KLU D;  3ZNZ B;  3URY A;  3JU5 A;  1AN8 A;  4TSS A;  4RF7 A;  2D3C A;  1V2Y A;  1EU4 A;  3DWG C;  1L6U A;  4EUT A;  3ZXR A;  3HVD A;  1TS2 A;  3R7R A;  1DOI A;  5HHD G;  1ACC A;  3EUB 2;  2W9N A;  4NQK E;  2HJ8 A;  2PVO D;  3Q8B A;  3SDL C;  2N7D A;  1SE4 A;  4TQ0 A;  1SIF A;  2NCN A;  5E6J A;  1E0Z A;  3V61 A;  2MWS B;  2QJL A;  2LXA A;  3AE3 B;  1S3S G;  4K3B A;  3C0R B;  1SIJ A;  3WAP A;  1Z5S B;  3NZT A;  2MCN B;  4HJG E;  2HJ1 A;  1IUE A;  2K9X A;  4K1R B;  3L16 A;  2BW2 A;  1P7F A;  1C78 A;  3ZNH B;  3AE2 B;  4PS7 A;  3UQB A;  5JH5 C;  2JT4 B;  2M19 A;  1DGJ A;  2KTR B;  2N1W A;  2XNA C;  3N30 A;  2K1F A;  2KAJ A;  2YVC A;  4JLC A;  3VTW A;  4J6I A;  4MEM A;  4JWS C;  1IGC A;  4C80 A;  1XLN A;  4X57 B;  2JRH A;  2KQS A;  4L23 A;  4OVV A;  1C3T A;  5J2R A;  3O65 B;  4F1S A;  1NI2 A;  3MJW A;  4BBN C;  3B9J A;  3ZW3 A;  1OQQ A;  2RDH A;  4KIK A;  1ESF A;  1XF5 L;  4II2 B;  2CHX A;  2VZK D;  4CO7 A;  3R2I A;  4RGO S;  4YSY B;  1PGB A;  3BK2 A;  4WAF A;  3DBH I;  1K8R B;  4PYU A;  1R7S A;  2WXG A;  4LNK A;  2WU5 B;  1T5X D;  2WDV B;  4YL8 A;  5EE1 A;  2M4N A;  2XBB C;  4DQO C;  1HTQ A;  1VZ8 A;  3LVV A;  2LXC A;  4IWO A;  1F2R I;  4HLE A;  2M1M A;  3C8Y A;  1XLO A;  3KUD B;  4TQ1 A;  1TJE A;  1N61 A;  1V1P B;  2KLG A;  3QA8 A;  4EKU A;  1R4N B;  1XD3 B;  3A9J B;  3GOE A;  1SEB D;  3KW5 B;  2MRP A;  5FR3 A;  2KWU B;  1UWX A;  1F52 A;  3V6E B;  2D33 A;  4RH6 A;  4MJS B;  1GNU A;  1UEL A;  3OJ3 A;  3BY4 B;  1QH4 A;  2OOB B;  4RMA A;  2IDY A;  4GMV A;  3NVZ A;  1GAQ B;  2HD5 B;  3PRE A;  3RPF C;  3DBL I;  2RDB C;  2LI5 A;  1ZE3 D;  3UI3 A;  4AS1 A;  1JWA D;  2ON8 A;  2QC8 A;  4HCP B;  3RNB C;  1P7E A;  1Z2M A;  1RLF A;  3ZVV A;  3GB1 A;  4XDD A;  5EE0 A;  1GJZ A;  2MJE A;  3TUO A;  4M8N A;  1JWS D;  2KC1 A;  2H88 B;  5KHQ A;  1YNT E;  2RPV A;  1KFY B;  3HK0 A;  1I42 A;  2BPS A;  2FUG 1;  4BZA A;  1WF9 A;  1IPG A;  3NY5 A;  4B95 A;  2FAZ A;  3TCA A;  2R61 A;  2KQ7 A;  1WWT A;  1XO3 A;  3NUH B;  1I4P A;  3R7Q A;  3TEW A;  3A9K A;  2M0X A;  4BHL A;  4O1N A;  5CTR C;  1ET9 A;  3P4P B;  4WWM A;  4GGQ A;  1RAX A;  1WJ6 A;  4KX6 B;  3OJ4 B;  1E8Y A;  2QHO A;  2N9K A;  4BG4 B;  2L3Z A;  4CYE A;  1QT9 A;  1SE2 A;  3NVY A;  3OLM D;  2IGH A;  4HPM B;  3U4E G;  4YTN B;  2IY0 B;  1TY0 A;  4KV2 A;  1WXS A;  2V1Y A;  4P7I A;  3IVF A;  2FCM A;  3RD2 A;  4RFB A;  2I1J A;  1TZ1 A;  1E7P B;  4GXB A;  2NBU A;  3WAO A;  1TT4 A;  4LNI A;  4PK1 A;  4II3 B;  1FRD A;  2LD9 A;  3NS8 A;  2K6D B;  4HJK A;  1B9R A;  4ZHO A;  1C4A A;  2ACZ B;  3BYT B;  4M0W A;  3ZDM C;  3ZNG C;  1NYR A;  3AI5 A;  3V62 A;  2LVO A;  3Q8C A;  2IY1 B;  3AE7 B;  1WGY A;  2O2V B;  1FNV A;  2N4F A;  2LZ6 A;  4IM0 A;  1RFK A;  2RMM A;  2Q5W D;  3RMK C;  3FKY A;  4IC7 B;  3N1Z C;  4IG7 B;  4M8M A;  1SE9 A;  2GBM A;  1M4V A;  2R2O A;  2L83 A;  4CQN A;  3PLV A;  2D2Q A;  3Q2A C;  3QK0 A;  3Q14 C;  1D5X C;  2VZK B;  1PQS A;  4ZRI A;  3SU8 X;  3ZQ4 A;  2JX5 A;  2G4D B;  2QIE B;  2IGD A;  2K6Q A;  2GLS A;  1L4D B;  1WFY A;  2KYW A;  1J7A A;  1HE8 A;  2N9X A;  3L0W B;  2K0P A;  3W9C B;  1TS4 A;  2BS3 B;  2INN E;  4HPP A;  3CST A;  4EEW A;  3NZU A;  2AQ1 B;  2WXR A;  2NMQ A;  2G9H D;  4L1B A;  1T3Q A;  2WXH A;  2KMM A;  5D94 A;  1J19 A;  3BWU D;  3CWI A;  2KTR A;  2LHE A;  4WIP A;  4YSX B;  2AEH A;  3R8B A;  3TJP A;  3U2S C;  2MW5 A;  3Q3O C;  2M8S A;  2KZR A;  2RGF A;  4WWO A;  4N6E B;  3WIM A;  2IO2 B;  5L95 C;  1CJE A;  1WYG A;  1MG8 A;  4AJY B;  3TIX A;  4NJ6 A;  4PYZ A;  5IAA C;  4ASW C;  2X8X X;  2ZPY A;  2MBO A;  5HI1 A;  4A6Q A;  4MEL A;  1G6J A;  1GG3 A;  4ACF A;  4ZRP A;  1F2R C;  1K52 A;  3LJ3 A;  4EE2 A;  3ZO5 B;  3ZDT A;  3DVN U;  3QQ8 B;  4GDK A;  4A8X C;  1AW7 A;  5FKA C;  2AX5 A;  2NPT B;  3JSV B;  2GMI C;  4GB9 A;  1MHX A;  1P52 A;  1NDD A;  4ITK A;  2BS2 B;  2PVG C;  3IG3 A;  2HE7 A;  1VZ7 A;  3LVW A;  4RGM A;  4YTM B;  1NEK B;  1VRA B;  3DBS A;  3MC9 A;  3GS2 A;  3U7Z A;  1V1P A;  1V97 A;  2YLM A;  3ZGZ A;  3IFW B;  1GC7 A;  3DVG X;  3UIP B;  1PGA A;  2N7E A;  4MJS A;  2DAF A;  3AEA B;  2LVP A;  2UU7 A;  1VRP A;  3WA0 A;  2K8H A;  1M15 A;  4W9H A;  1GOZ A;  1RFA A;  4QAY A;  1TKG A;  2GBK A;  2JSV X;  2XK5 B;  4JGH B;  2J0J A;  2GBR A;  3MHS D;  3VTU A;  3VUY A;  3KUC B;  1SF0 A;  1IBX B;  3HVZ A;  4W9G A;  1HQR D;  5E6P A;  3PRM B;  5BMI A;  2JZP A;  2D3B A;  4XDC A;  3WAN A;  3D32 A;  4LTU A;  3ZUN A;  4BKG A;  3AEG B;  2DBY A;  3JW0 X;  4ARC A;  5HFY A;  3RNG C;  1I7H A;  1ROE A;  4FJY A;  3UIN B;  2DYB A;  3DCG A;  2DAJ A;  4C56 C;  3GZN B;  3PHX B;  3AE5 B;  1KLG D;  5G2N A;  1YJI A;  5D3I B;  1ZXI A;  2RR9 A;  2WX1 A;  3M63 B;  2LGI A;  3KYD D;  2DZK A;  1MG4 A;  3QCA A;  4GDL A;  4XX5 A;  3NRZ A;  4S17 A;  1Q5W B;  1YN5 A;  4ANV A;  4E74 A;  1V9J A;  2D32 A;  3IAM 1;  1ZPS A;  3GE3 C;  3BVM A;  5TR5 A;  2WXO A;  4K7U A;  1JWM D;  2IZV B; 
#chains in the Genus database with same CATH homology
 1P52 A;  1G0W A;  1I0E A;  1FPY A;  4BG4 B;  2OJW A;  3JU6 A;  1SD0 A;  5J9A A;  4Q2R A;  2UU7 A;  4LNO A;  4S17 A;  3ZXV A;  4S0R A;  1P50 A;  1QH4 A;  1VRP A;  1M15 A;  4AM1 A;  1HTQ A;  1LGR A;  4XYC A;  4GVZ A;  1F52 A;  2CRK A;  4LNF A;  4ACF A;  4BHL A;  2GLS A;  3NG0 A;  4LNI A;  3DRE A;  2WGS A;  3FKY A;  4BAX A;  2WHI A;  2LGS A;  2D3A A;  1CRK A;  1F1H A;  1HTO A;  4BG4 A;  3JU5 A;  4GVY A;  1RL9 A;  3JQ3 A;  1U6R A;  4GW0 A;  4RF7 A;  4GW2 A;  3B6R A;  2D3C A;  3L2D A;  3L2E A;  4Z9M A;  2QC8 A;  2D3B A;  1QK1 A;  1BG0 A;  4HPP A;  3L2E B;  3M10 A;  4RF8 A;  3ZXR A;  4RF9 A;  5J99 A;  4LNK A;  3JPZ A;  2BVC A;  2J1Q A;  4RF6 A;  4LNN A;  3DRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...