4ACFA

Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with imidazopyridine inhibitor ((4-(6-bromo-3-(butylamino)imidazo(1,2-a)pyridin-2-yl)phenoxy) acetic acid) and l-methionine-s-sulfoximine phosphate.
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
475
structure length
475
Chain Sequence
KTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMINE SYNTHETASE 1
publication title Synthesis, Biological Evaluation and X-Ray Crystallographic Studies of Imidazo(1,2-A)Pyridine-Based Mycobacterium Tuberculosis Glutamine Synthetase Inhibitors
doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 155
structure length 475
sequence length 475
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 4acfA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 4acfA02
2WGSA 1F1HA 1LGRA 4GW0A 1M15A 4AM1A 1P50A 4LNIA 4GVYA 4RF8A 1RL9A 4LNFA 2GLSA 4S17A 4LNKA 1HTOA 3FKYA 2D3BA 4GVZA 1FPYA 4Z9MA 3NG0A 3DRBA 4S0RA 2LGSA 4RF7A 3JQ3A 4HPPA 1HTQA 3L2DA 4LNNA 4GW2A 4Q2RA 4BAXA 2OJWA 3ZXRA 2CRKA 3JU5A 2D3CA 3M10A 4RF9A 1BG0A 1G0WA 3JU6A 3JPZA 1SD0A 4BG4B 5J99A 5J9AA 2QC8A 1F52A 4BG4A 4ACFA 1U6RA 3B6RA 1VRPA 3L2EA 2BVCA 1I0EA 3L2EB 4LNOA 1CRKA 1QK1A 2WHIA 1P52A 3ZXVA 2UU7A 4XYCA 2J1QA 4RF6A 4BHLA 1QH4A 2D3AA 3DREA
chains in the Genus database with same CATH superfamily
2PKOA 1WZ0A 2IO3B 2C5LC 1ZGUB 1HZ5A 5D7GA 3NZSA 2L05A 1D5ZC 2BYTA 2LGDA 4PS8A 1YN4A 3Q3FA 1RRBA 2CU3A 1V49A 4YL8A 3RNCC 1V81A 3ZJVA 3A4RA 5DPWA 3IHPC 1D5XC 3ZNGC 3N32A 1EU4A 3B1LX 5AUIA 1HEZE 4HDQA 4LNFA 4GDLA 1IBXB 2JWZA 1EUVB 1YJ1A 2WXQA 3PZ7A 3VRBB 1YN5A 2BGFA 4ZHPA 4C7YA 3SFEB 3UQBA 1UWMA 2ZPNA 5C1ZA 3JSVB 3ONSA 1XO3A 2VZKD 4CQNA 3PHWB 1Q5WB 2K5PA 2DNFA 3I57A 3ZXVA 3AB5A 2FUG1 1P50A 5BYRA 1CJEA 3VQIA 2LGXA 3BVGA 4XZ4A 1ZPSA 2IO1B 2J42A 1OGWA 4KGSA 3ZJTA 3T9LA 1E8YA 1E8WA 4K81A 4HWIB 2JF5A 3EFCA 2J4XA 3WA0A 2PVGC 2JUOA 1ET9A 4D2KA 3AH7A 3DWMA 2QJLA 3NS8A 4YTMB 2KFKB 3R8BA 3ZKJC 4OVVA 4E71A 3DHGC 3AECB 4Z9MA 2D3GA 5CHWA 2Y5PA 1G6JA 4FA6A 4RFBA 1T0SC 3OJ4B 4RF9A 4HCNB 1MVKA 3VUYA 3L4PA 4F1SA 4GDKB 4OZCA 2BF8B 2KX0A 1YN3A 4WQOB 1I0EA 3HVDA 4DHJD 1DOXA 2QILA 4K7SA 1NEKB 3Q14C 2ZPYA 2ZW0A 4IM3A 1C3TA 1XQQA 2C7MB 1JRUA 1SE2A 4YWGG 1MI0A 2V3NA 3RUIB 4EZJA 1E0ZA 4AJYB 2J52A 3QQ8B 3JYUA 5EE3A 1QK1A 5E6JA 1V2YA 2WGSA 5IKCM 2KANA 1GC7A 1XF5L 4G11A 4CYEA 2RDBC 2CU1A 1L0YB 3PLUA 1J19A 3WAOA 1WGRA 4KKIA 5DPTA 1TY0A 4PYUA 2CJOA 3JSVA 2PJHA 2ZCCA 1UGJA 4JE3B 2K39A 3RNEC 2GBMA 1EWYC 4K7UA 3IT4B 1ZDXA 1FNVA 1EU3A 5MPOA 2FCMA 2O2VB 4S0RA 3CIRB 4DWFA 4M01A 4BAXA 4HDOA 3K9OB 2W54A 4KSLC 2K9XA 3KUDB 2KWVB 1C79A 3ZGZA 2M0XA 2N4FA 5FR3A 2LD9A 1FFVA 1RL9A 4YSYB 2KD0A 3M95A 1OQYA 4KDIC 2BKRB 5BMIA 4JGHB 1HTQA 3DHIC 3V62A 1R4MI 3SFDB 2J53A 2PVOD 1JWUD 4USAA 3RMKC 1JWSD 4GDKA 4Q2JA 2LI5A 4EZLA 4BG4A 3B6RA 3H7PB 2OEDA 5KHOA 3T3OA 2SEBD 4DK5A 4MEMA 2BS3B 1ROEA 5GMVA 3JW0X 1TS2A 2WDVB 3FKYA 4G50A 4MJSB 4A20A 1NDDA 5TSSA 2NR2A 1GOZA 2GBRA 2KK8A 3UINB 2QCZA 3AE4B 4ARCA 3BINA 3RFZB 1WF9A 3D32A 4RF6A 2K8CA 4KIKA 4K3BA 3GE8C 4J6IA 1SF0A 2GOWA 3IAM1 2DLBA 5HHDG 4MT5A 5G55A 2ASQA 4L1BA 3TEZA 2MBBB 2MCNB 2LZ6A 4US9A 2QSDA 3TBLD 1KLVA 3RN9C 5CTRC 3DCGA 3S2AA 2KMAA 1SE9A 3UIOB 1KM7A 2DX5B 4N6EB 2IO0B 3RD2A 2CS4A 1G0WA 5HG2A 1EM7A 1I4RA 2VH1A 3L2EB 2K25A 1FM0D 4HPLB 4AJWA 2GMIC 3QWZB 3P42A 1SB3C 3DREA 2W9NA 3LVVA 2BW2A 2WLBA 1WJ6A 1WR6E 4IDIA 2X38A 2JZ3B 2NPTA 2Y5BB 3AE6B 4NAWB 1FXAA 1HA5A 2LGYA 3T8MA 4G0NB 1YOVB 3ECIA 3RYTA 4W9DA 1SXTA 1VA6A 4LNOA 1D3ZA 2WWZA 3T3NA 4OVUA 3C0RB 5IAAC 4RH6A 2LEKA 2WXJA 1DOIA 4NPNA 2VZKB 3GZNI 4P16A 4M8MA 2EMSA 2GWCA 3VR9B 4MSQB 3BIID 1B9RA 3ZTCA 2PPHA 2SAKA 3ZTDA 2B76B 2KC1A 1NENB 1F52A 1Q10A 4R3DA 1VRPA 3VR8B 2IDYA 4HLEA 2YVCA 3ZDTA 3OWEB 1ZUD2 3APFA 4LNKA 1HTOA 4JL9A 3DVGY 3DRBA 4C4VB 2KDEB 1J7CA 3NVVA 2RPQA 4A55A 3B2FA 4HKQA 3JU6A 5C23A 1FXIA 3R3MA 3APCA 1L6UA 3L16A 2JX5A 3U8ZA 2YLMA 1BUIC 2OJRA 1N61A 1OFFA 2MP2B 1NYRA 1TS4A 4BKGA 1I35A 2JWUA 4A8XC 3WANA 2N7DA 4ANWA 1WMHA 4RF1A 3A9JA 2MJ3A 4A6QA 2C9WB 4DHJB 2LUEA 2KXJA 3U7ZA 3L2EA 3KH0A 2OOBB 4TUUA 1FRRA 3AMZA 1UWXA 4HK2A 4GVYA 2NMQA 1BMLC 4TSSA 5L83A 4AWJA 1JMLA 5H8YE 4NAWA 2NVUI 4Q2RA 2K6DB 3HK0A 3N20C 4DHZE 5JHBA 2IGDA 1I42A 3HHMA 1P7EA 1C78A 4F7ZA 3KW5B 1NYQA 1JW9D 1GAQB 4A90A 2LMCA 4FJYA 2INPE 3B0AA 4RGMA 2GLSA 1ZP0B 4DBGA 4IM0A 4EEWA 1MG4A 3PPAA 1FIQA 3AULA 2DYOA 1QILA 1YJJA 3VUXA 4ZRKA 1I4QA 1RYJA 2WHIA 1EWCA 3RULA 4LTUA 4JX1C 1KRHA 1WY8A 4F8CB 2GBNA 4GVZA 1SJED 1X1MA 3L2DA 4HCPB 2JRHA 3JU5A 3AEEB 3GP7A 4PS3A 1GNUA 1QT9A 2Q5WD 3PGEA 2HTHA 3Q8BA 4WWPA 2R2QA 3FAHA 3MJ5A 3RNFC 1YNTE 1CRKA 2MP2A 4A9AA 2DZJA 2O6VB 3P4QB 3KVFB 4FXCA 4B0MA 1WWTA 2KQ4X 2L7RA 1AW7A 1K8RB 3H1UA 4DQOC 2N7JA 1M4VA 2AQ2B 1FMAD 3N30A 3A9KA 2INCC 4RMAA 1N62A 2WXPA 2Z0DB 5FR6A 1XLQA 2MX2A 1IP9A 4GSWA 2WU2B 1U6RA 3QARA 4IW0A 2BVCA 3MC9A 4MGIE 2REXA 4XDDA 2I1KA 2HTME 4I6NB 1WE6A 3WIMA 2QEJC 1GB4A 2MW5A 1FPYA 4ZYNA 1WIAA 2VH2A 1XEEA 2IY1B 1DGJA 2HJ1A 2KWCA 1FNUA 1D5MC 1YQ4B 1MHXA 2CHXA 2FBWB 3SHQA 4ARIA 5HKHA 2AEHA 1RWSA 3L08A 4RCOA 3CWIA 2INNE 4NNJB 2AL6A 1J0GA 2M56B 4GMVA 1SSNA 4OW0A 2FAZA 4GW2A 4JQWC 2MH7A 3U52E 4IWOA 4MM3B 5GXGB 2N0SB 3EUB2 1WX9A 1N60A 3MP9A 1WX8A 1VLBA 2KTRA 3AE3B 1ZDVA 1ZW7A 2EELA 4P1BC 1T3QA 1XLPA 1RFKA 1KLGD 2AQ1B 3VTWA 2HE7A 1WXSA 3PLVA 3TIXA 1UF0A 5J17A 1RLFA 4WJNA 3A1QB 4FJZA 1R4MB 3W1YA 3L17A 4M00A 3DDCB 1STEA 2N1VA 2M4NA 1J8CA 1ZOYB 3VRAB 1MFWA 2NTSA 3LYYA 2BQQA 3QK0A 4PT5A 3H9DA 1TZOA 4GU2A 1Y8RC 3QC8B 2W3RA 1JQ4A 2WXMA 1FEHA 5KHQA 1ENFA 4KX6B 3V60A 1E5WA 4RF8A 3AU5A 2V9HA 1JWBD 2WXLA 4IG7B 3P63A 2LGSA 1RFAA 5J2RA 1NBFC 3DBRI 1L6VA 2JPHA 4DXAB 2I38A 3X23A 3VFKA 1IUEA 2BB6A 1ACCA 4WQMA 3P2BA 4ANXA 4M0WB 1JROA 2K22A 3H6NA 3QHTA 3IFWB 1P52A 2D2QA 1L5PA 3A4SC 3DBLI 2DHZA 1JCKB 2ZNVB 3H7SA 3KLSX 4CO7A 1RM6C 2UYZB 1TYGB 3R66C 3TUOA 5IP4D 4XWWA 3PZDA 2WDTB 5C2TB 2JT4B 4HJKA 3R7RA 3PRMB 2DENB 1MHHE 3OJ3A 3ZJUA 4LCDE 1TT5B 1T6BX 1Q1OA 3AN1A 5IA7A 1NVID 3DBHI 2MBOA 3GOEA 1C9FA 4XX5A 2N9XA 2QMTA 2OHFA 4WWMA 1YD8U 2L83A 1LQBA 1WH3A 3U30A 5AZFA 5LXHA 1FFUA 1T0QC 1QOFA 3HUIA 3MTNB 3VDZA 3W5VB 2RR9A 5BO4B 3SU8X 2Y5CA 1EF5A 2LUMA 2CHWA 2KKCA 1IBXA 1BXTA 1I4PA 2DZKA 1GB1A 2BYEA 4ZRQA 1F2RI 3SD5A 3GZNB 1C77A 3KYCD 4W9CA 2L8JA 3KWLA 2KJ6A 1C4AA 1ET6A 3PS6A 4GXBA 4GIVA 4AM1A 1F77A 1PQSA 3BWUD 2Z0EB 1F0ZA 1V1OA 2KACA 3WCQA 3ZO5B 2MJEA 3AEDB 1GPXA 4ANVA 4PYZA 3N1ZC 4ZRPA 3I5JC 2PE6B 4TV3A 2XN9C 5CHFA 5G5GA 1WGYA 2KQSA 5IO9A 2E6XA 1H8CA 2LGIA 2KNBA 2D07B 3AE5B 3PHXB 3AM9A 1I4HA 3PRPB 3UGBB 2PLPA 2KFKA 1P9DU 3TSSA 4P1CC 4N9F4 3AEAB 2WXIA 4MACA 4N58A 1UNSA 3I63C 2E3TA 1MG8A 2WDRB 1OEYA 1PGBA 1D6EC 3NZ3A 3GS2A 3Q3JA 1S3SG 2GBKA 2O6VD 1KJTA 4FN2A 4NAMA 4G3XB 1VCBA 2KHWB 1P3QU 4IWQA 3WAPA 3FILB 4W9GA 1K50A 2WXRA 4B9KA 4AOFA 3NY5A 5JH5C 3HVZA 3A33B 3ZIMA 2FCNA 1A70A 2L52A 3MC8A 1JWAD 4K3CA 4FBJB 3W1SA 4MH0E 1SGHA 3BVMA 3IG8A 1WR1A 2ZW1A 1V80A 3H8HA 2KVRA 3R2TA 1WGKA 2IY0B 3RZFA 3RNAC 5AZHA 2EKIA 1HE8A 2C7NB 5TR5A 3AE1B 3ML8A 3Q6BA 2G4DB 1ESFA 1PGXA 3ZRFA 5LLIA 4BBNF 1R8GA 2DBYA 4DDGD 5D94A 3ZVVA 4YSZB 1BG0A 2JYTA 4X57B 3MFGA 3TCAA 4W9EA 4H2AA 4KSKC 1SIJA 2JXXA 2FCSA 3NJTA 2GBJA 5JHAA 1V97A 2IZVB 3M62B 2O2VA 2KN4A 3Q8FA 3HIZA 3B08A 3RPFC 1SE4A 2QC8A 3Q8AA 2R61A 2RDHA 3BK2A 3W1SC 3QX1A 2H89B 3AEFB 2J0JA 2AX5A 4KZCA 1V9JA 1WGGA 2LWPA 3QJZA 5AEKB 1P7FA 1IYFA 1T0YA 3AXCA 2MJDA 4BBNC 5D2MB 4KVGB 1LXDA 3MHZA 2PTLA 2LXAA 5J9AA 2CHZA 3NVYA 4RGTA 3TL5A 3H7PA 2UU7A 4EZKA 2J1QA 2XEWA 2VRRB 2WNMA 1CMXB 3AE7B 1ZXIA 5D3DA 1AN8A 5LXIB 3B9JA 1PFDA 4MJSA 3L10B 1V1PB 4URKA 3SDLC 5EE1A 3ZXRA 4RF0A 4N59A 4EOYA 5IOIA 2ON8A 1YIWA 3EA6A 1T5XD 4WURA 2PEAA 2W82A 4ZRJA 3O13A 2LHEA 2RGFA 3Q69A 1HXYD 2N9EB 1WM2A 1V6EA 2JQRB 2KC2A 2WXNA 3B2GA 1EF1A 1SIFA 2L76A 4I6LB 3MJWA 1Z5SB 4CHKA 3HM3A 2KMMA 2V4IB 2WXGA 1R7SA 3ZLZA 2EKEC 4II3B 3V61A 3VH4B 2CR5A 3APDA 1ZKHA 4M8NA 4B6WA 4GB9A 5EDSA 2JYEA 3IG5A 1AWDA 1UD7A 3VAWA 3PREA 1GJZA 2BWES 4GGQA 4WAAA 1FD6A 1KLUD 1HZ6A 2BBCA 2QHOA 3TEXA 3BK1A 1WFYA 3KYDD 3E56A 1PGAA 1QQRA 3FC4A 3M63B 2R2OA 2JVCA 2L0TA 2RSUA 2RMMA 5CX3A 3PO0A 1U4AA 3L54A 3DOWA 2WX0A 4KGRA 2N9KA 1J7BA 5J18A 4WH4A 3M10A 1YQBA 2ZCBA 2BYFA 3IT6B 3DWGC 4IC7B 3LDZE 4IUMB 2UWQA 1RAXA 2XK5B 4TQ0A 4GW0A 2BS2B 1TZ1A 2AYOB 3NZUA 1WJNA 1V5TA 1R4NI 4UDUC 3VXWA 4YTNB 4OHJA 4W9HA 3ZYYX 2MBHA 1P1AA 3AE9B 3RI7C 2BKFA 4XC2A 5C3JB 2G45B 1F9JA 1XD3B 5E6PA 3PV1A 2JU6X 4BHLA 3DBRB 1E7PB 4DXFA 1E7UA 4W9LA 2L3ZA 3CSFA 4FJVB 3ENEA 1TTNA 4C4VA 4A3OA 1UELA 3W9CB 1J7AA 3TMPB 2PIAA 3DBLB 2J0KA 1QOAA 4DDID 3KUCB 1UGMA 3RCZA 4MGKE 1YQ3B 5LNK1 2KLGA 3VH3B 1WI0A 3BYYB 5AZGA 2GI9A 3NVZA 1WZ3A 3CSTA 1FO4A 1NI3A 3OLMD 4RM8A 2L00B 2ZVOA 2KJHB 1WM3A 5DPRA 1I7HA 3V3XA 2D3CA 4II2B 1I4GA 3IBEA 2V0GA 2QIEB 2ZEQA 1M94A 4MSMB 3ZQ4A 3DBHB 2WDQB 1M15A 2WX1A 3EHVA 1P0RA 1L4DB 1C1YB 3ZDMC 2FIDA 2CRKA 2KLCA 4FHKA 3K9PB 4GLSC 2NBWB 2J7QB 1TS5A 3WAMA 2WS3B 2V1YA 1TKYA 2W55A 4BKSD 4WJPA 1MJDA 1IGDA 1XCTL 3HRDD 4RGNA 2KMCA 4KKJA 2WXHA 4JIOU 3ZW3A 2G3QB 2ZVNA 1E9MA 2JRIB 3IG3A 1VZ8A 4WJQA 4C80A 4TMAB 1GG3A 3LB8C 3NOBA 2K1FA 3VTUA 4IOIE 2ZZPB 4MELA 4YTPB 1K53A 1TKEA 4US8A 4AUQC 1P98A 3O65B 5EE0A 1WJ4A 1C4PA 4HROA 1LO5D 1WXQA 4WJOA 1XXGA 2XBBC 1TJEA 1WYWB 3PZ8A 2KDFB 3QAQA 1B1ZA 3NVWA 5JZEB 3KUZA 4ICVA 5HFYA 3DBSA 3KQ4A 3I3TB 2K8BA 2O6VA 1FCLA 3P1MA 1JALA 3GE3C 2GRIA 2KZRA 3C8YA 1VD2A 3EGRA 3N1YC 1V4GA 4LJPB 2MBQA 2FE8A 1JWMD 3AE8B 2RD0A 3P4RB 2N7EA 5FK9C 1Y56A 3BZDB 1VZ6A 1UZXB 2BYVE 4ZYSA 2KN5A 3LN6A 2K8HA 2N1WA 1V5OA 4NQLB 1WE7A 2KX3A 4TKNA 2MQJA 4KGTA 2LXCA 1MPEA 1XT9B 2FIFA 4IM2A 5J99A 2MSED 2C60A 1DYQA 2M19A 2MBEA 5BYSA 1QOBA 1N5WA 4XYCA 4L2YA 2DZMA 2AL3A 3NS1A 4ZDVA 3NUHB 1FXTB 4QAYA 2KO3A 1NI2A 4MH8A 4HEA1 2ONQA 4WAFA 3L13A 3N9YC 5L95C 4MM3A 1KTKA 4EFOA 3TJPA 2KWDA 4OZBA 1UH6A 4J3OD 3V6CB 1QLBB 1VRAB 2DAFA 3NHEB 2BS4B 2DZIA 4P6VF 3E9SA 1I4XA 1H4RA 4REZA 1TGZB 2LHDA 1YMHE 1K52A 2BB5A 1S1QB 4RNAA 2K0PA 3IXSA 4K7WA 4W9IA 1WYGA 3JPZA 3VHTC 2PW9A 4BG4B 4EKUA 2D33A 1E7VA 1SE3A 3L0WB 3A1QA 1GUAB 4LK0M 2MRPA 1KOTA 2J0MA 1OQQA 2HD5B 4BOZB 3P4PB 2IYDB 4PS7A 4YSXB 1QF6A 3KWVA 4HKZE 3OG5A 1SBBB 4XDCA 1F2RC 4ASWC 2NS5A 2LJ5A 5AUKA 2LVPA 1L2NA 1YJIA 2WXKA 3W5UB 3BYTB 1TBEA 3BY4B 2KQ7A 3I9V1 2NBUA 2BT6A 4KIKB 4W9FA 1WXAA 4AP4C 2RPVA 1LFDA 2ZJDA 5HI1A 3TEYA 2NCNA 4OZAA 2EMTA 4LDTB 2RDGA 4DXGA 3UQAA 2LVQA 4PK1A 4ITKA 3P4SB 3RT3B 2D32A 4LLGM 2A4ZA 4M0WA 5I4DA 4JWUC 2BPSA 4GOCA 3RZWC 3M3JA 2N9PC 4LNIA 3EFUA 5JXVA 4ZHOA 5E6OA 3J9CA 5CHVC 2KOXA 4FLHA 2I2YA 4ICUA 4RF7A 2Z59B 3TEWA 4YT0B 1XLNA 4NJ7A 1E6EB 2JXTA 4P7IA 4AS1A 1XLOA 2B3AA 4BZAA 2JY6A 2KWUB 4RGOS 2C7HA 3AU4A 3Q3MC 1BT0A 1LGRA 2HDEA 4I6PA 3SR6A 4WWNA 2NPTB 2IBIB 4WWOA 1FCCC 2IPKD 4BOSC 1OEYJ 4C00A 4W9JA 5G2NA 3UF8A 4NQKE 3PSEB 1HQRD 4HPMB 1C4CA 4M02A 2L1AA 1KH0A 3ML9A 3Q3NC 3W2DA 3IAS1 1TY2A 2YEPB 4MGYE 2M1MA 4K1RB 1WSPA 1QOGA 5T8IA 1EO6A 1R4NB 3AEGB 2KFJA 2ZNVC 3C19A 2PMVA 3DVNU 2BWFA 3VVWB 3N1XC 4B0EA 4WIPA 2GB1A 3PT2B 3DQVA 3RNBC 4FADA 3HM6X 4XGAB 4HPPA 1VR9A 2D10A 2KAJA 1TS3A 3DPDA 4OVZA 4NJ6A 1WXMA 1L4ZB 3NZTA 2Z8LA 2CKHB 4IKGA 4NZLB 4ZRIA 1FNWA 2D3AA 2IJ0A 3U7DA 4HVBA 4AQ7A 3PVLA 1WMHB 1CZPA 3A9JB 2WQYB 2XNAC 4EE2A 1V8CA 2G1EA 2OJWA 2LFIA 3EECA 1L0VB 2WXFA 3NRZA 1V86A 4JPSA 4MDKE 1WRIA 1ISNA 3QCAA 3MC0B 3DVNV 2WXOA 4E3CA 2IO2B 3FILA 4NY0A 3V05A 3QA8A 4BFRA 1KF6B 2A5UA 2CJNA 3CF6E 1E8XA 1WGHA 2BTEA 2KDBA 1L0XB 1SD0A 1WRDB 2JZPA 4KDLB 1N6ZA 1TKGA 3Q8EA 2QDFA 4FULA 2MA9B 3VUWA 3RNGC 2KDMA 3U4EG 2PE9A 5BMGA 3AE2B 2DWQA 3EC8A 2ACZB 4TQ1A 3UI3A 2D3BA 2JSVX 1L7YA 3SEBA 4BKSA 3MHSD 3V6EB 2L32A 3ZUNA 1PUTA 5D6JB 2FUHB 2X8XX 4DHZB 2D5GA 1WJUA 2YEPF 3OAWA 4ACFA 2LRUA 1UUPA 4ANUA 4MGZE 3ZNID 3BVZA 3VTVA 1QH4A 1CK1A 4IWPA 1Z2MA 2K3UA 3LVWA 2NTTA 4W9KA 3ZRCA 3JQ3A 3URYA 5E6NA 4A3PA 4KV2A 1E90A 4C7ZA 3LN7A 5IN7A 1DOYA 3LJ3A 1IPGA 1WX7A 1AARA 4L23A 1GC6A 2DYBA 3A9KB 1E10A 2AQ3B 1ZXHA 3R7QA 4LNNA 4JLCA 5D3IB 2INDC 1YX5B 2KJRA 3Q2AC 2LASA 2G9HD 1TT4A 1UBIA 2WYQA 2MWSB 3ALBA 3DHHC 3NG0A 1JRPA 2MLBA 2KTFA 2NBVB 2D11A 2GWDA 4E74A 1V1PA 2N9LA 5EE9A 2KT7A 3AV8A 3Q8CA 3PTFC 2LVOA 4LDTD 1A5RA 2G4SA 2H88B 1YX6B 4S17A 1VJKA 4O1NA 2L0FA 5DPSA 1Q0WB 4YXDB 4GN1A 2MEKA 2M8SA 4BKTA 4ZOHC 1XCQL 4XWTA 2Y3AA 1N5XA 2KTRB 2I1JA 1ZE3D 4FHJA 4JWSC 3PRZA 4HXDA 1CQVA 2WP9B 2LRWA 1F1HA 2DAJA 4B95A 3GB1A 3AI5A 3X0WA 2WU5B 3LXFA 3QIJA 4RM9A 3WALA 1WGDA 1OTRB 1E8ZA 1IGCA 3ETRA 3ZNHB 1SJHD 1WXVA 1UBQA 2HJ8A 1VZ7A 2M0AA 4NJCA 1FRDA 3CMMB 4XE0A 2DYMA 2V3SA 2FCQA 5BYQA 4KZ0A 1VDVA 4GDLB 2LJIA 1QKZA 2W3SA 3AEBB 2AWTA 2FNJB 1AYFA 3R2IA 5FKAC 3DVGX 3Q3OC 2KDIA 2KVZA 2XK5A 2JZZA 2KYWA 5DCNA 2TSSA 3U2SC 2IGGA 1PYWD 2V4LA 1K51A 2V3PA 1C76A 3N3KB 4C56C 5G5HA 2M17A 4LJOB 3ZNZB 1TIFA 5H92C 1QZEA 1PDXA 1D4BA 2K6QA 2ICIA 1SEBD 4HJGE 5BMHA 1N63A 1OQRA 4HRSA 4BVUC 3UIPB 1LM8B 1T0RC 3ABVB 3JVZX 2MHJA 3IVFA 4EUTA 1KFYB 2IGHA
chains in the Genus database with same CATH topology
2WGSA 1F1HA 1LGRA 4GW0A 1M15A 4AM1A 1P50A 4LNIA 4GVYA 4RF8A 1RL9A 4LNFA 2GLSA 4S17A 4LNKA 1HTOA 3FKYA 2D3BA 4GVZA 1FPYA 4Z9MA 3NG0A 3DRBA 4S0RA 2LGSA 4RF7A 3JQ3A 4HPPA 1HTQA 3L2DA 4LNNA 4GW2A 4Q2RA 4BAXA 2OJWA 3ZXRA 2CRKA 3JU5A 2D3CA 3M10A 4RF9A 1BG0A 1G0WA 3JU6A 3JPZA 1SD0A 4BG4B 5J99A 5J9AA 2QC8A 1F52A 4BG4A 4ACFA 1U6RA 3B6RA 1VRPA 3L2EA 2BVCA 1I0EA 3L2EB 4LNOA 1CRKA 1QK1A 2WHIA 1P52A 3ZXVA 2UU7A 4XYCA 2J1QA 4RF6A 4BHLA 1QH4A 2D3AA 3DREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WGS A;  1F1H A;  1LGR A;  4GW0 A;  1M15 A;  4AM1 A;  1P50 A;  4LNI A;  4GVY A;  4RF8 A;  1RL9 A;  4LNF A;  2GLS A;  4S17 A;  4LNK A;  1HTO A;  3FKY A;  2D3B A;  4GVZ A;  1FPY A;  4Z9M A;  3NG0 A;  3DRB A;  4S0R A;  2LGS A;  4RF7 A;  3JQ3 A;  4HPP A;  1HTQ A;  3L2D A;  4LNN A;  4GW2 A;  4Q2R A;  4BAX A;  2OJW A;  3ZXR A;  2CRK A;  3JU5 A;  2D3C A;  3M10 A;  4RF9 A;  1BG0 A;  1G0W A;  3JU6 A;  3JPZ A;  1SD0 A;  4BG4 B;  5J99 A;  5J9A A;  2QC8 A;  1F52 A;  4BG4 A;  4ACF A;  1U6R A;  3B6R A;  1VRP A;  3L2E A;  2BVC A;  1I0E A;  3L2E B;  4LNO A;  1CRK A;  1QK1 A;  2WHI A;  1P52 A;  3ZXV A;  2UU7 A;  4XYC A;  2J1Q A;  4RF6 A;  4BHL A;  1QH4 A;  2D3A A;  3DRE A; 
#chains in the Genus database with same CATH topology
 2PKO A;  1WZ0 A;  2IO3 B;  2C5L C;  1ZGU B;  1HZ5 A;  5D7G A;  3NZS A;  2L05 A;  1D5Z C;  2BYT A;  2LGD A;  4PS8 A;  1YN4 A;  3Q3F A;  1RRB A;  2CU3 A;  1V49 A;  4YL8 A;  3RNC C;  1V81 A;  3ZJV A;  3A4R A;  5DPW A;  3IHP C;  1D5X C;  3ZNG C;  3N32 A;  1EU4 A;  3B1L X;  5AUI A;  1HEZ E;  4HDQ A;  4LNF A;  4GDL A;  1IBX B;  2JWZ A;  1EUV B;  1YJ1 A;  2WXQ A;  3PZ7 A;  3VRB B;  1YN5 A;  2BGF A;  4ZHP A;  4C7Y A;  3SFE B;  3UQB A;  1UWM A;  2ZPN A;  5C1Z A;  3JSV B;  3ONS A;  1XO3 A;  2VZK D;  4CQN A;  3PHW B;  1Q5W B;  2K5P A;  2DNF A;  3I57 A;  3ZXV A;  3AB5 A;  2FUG 1;  1P50 A;  5BYR A;  1CJE A;  3VQI A;  2LGX A;  3BVG A;  4XZ4 A;  1ZPS A;  2IO1 B;  2J42 A;  1OGW A;  4KGS A;  3ZJT A;  3T9L A;  1E8Y A;  1E8W A;  4K81 A;  4HWI B;  2JF5 A;  3EFC A;  2J4X A;  3WA0 A;  2PVG C;  2JUO A;  1ET9 A;  4D2K A;  3AH7 A;  3DWM A;  2QJL A;  3NS8 A;  4YTM B;  2KFK B;  3R8B A;  3ZKJ C;  4OVV A;  4E71 A;  3DHG C;  3AEC B;  4Z9M A;  2D3G A;  5CHW A;  2Y5P A;  1G6J A;  4FA6 A;  4RFB A;  1T0S C;  3OJ4 B;  4RF9 A;  4HCN B;  1MVK A;  3VUY A;  3L4P A;  4F1S A;  4GDK B;  4OZC A;  2BF8 B;  2KX0 A;  1YN3 A;  4WQO B;  1I0E A;  3HVD A;  4DHJ D;  1DOX A;  2QIL A;  4K7S A;  1NEK B;  3Q14 C;  2ZPY A;  2ZW0 A;  4IM3 A;  1C3T A;  1XQQ A;  2C7M B;  1JRU A;  1SE2 A;  4YWG G;  1MI0 A;  2V3N A;  3RUI B;  4EZJ A;  1E0Z A;  4AJY B;  2J52 A;  3QQ8 B;  3JYU A;  5EE3 A;  1QK1 A;  5E6J A;  1V2Y A;  2WGS A;  5IKC M;  2KAN A;  1GC7 A;  1XF5 L;  4G11 A;  4CYE A;  2RDB C;  2CU1 A;  1L0Y B;  3PLU A;  1J19 A;  3WAO A;  1WGR A;  4KKI A;  5DPT A;  1TY0 A;  4PYU A;  2CJO A;  3JSV A;  2PJH A;  2ZCC A;  1UGJ A;  4JE3 B;  2K39 A;  3RNE C;  2GBM A;  1EWY C;  4K7U A;  3IT4 B;  1ZDX A;  1FNV A;  1EU3 A;  5MPO A;  2FCM A;  2O2V B;  4S0R A;  3CIR B;  4DWF A;  4M01 A;  4BAX A;  4HDO A;  3K9O B;  2W54 A;  4KSL C;  2K9X A;  3KUD B;  2KWV B;  1C79 A;  3ZGZ A;  2M0X A;  2N4F A;  5FR3 A;  2LD9 A;  1FFV A;  1RL9 A;  4YSY B;  2KD0 A;  3M95 A;  1OQY A;  4KDI C;  2BKR B;  5BMI A;  4JGH B;  1HTQ A;  3DHI C;  3V62 A;  1R4M I;  3SFD B;  2J53 A;  2PVO D;  1JWU D;  4USA A;  3RMK C;  1JWS D;  4GDK A;  4Q2J A;  2LI5 A;  4EZL A;  4BG4 A;  3B6R A;  3H7P B;  2OED A;  5KHO A;  3T3O A;  2SEB D;  4DK5 A;  4MEM A;  2BS3 B;  1ROE A;  5GMV A;  3JW0 X;  1TS2 A;  2WDV B;  3FKY A;  4G50 A;  4MJS B;  4A20 A;  1NDD A;  5TSS A;  2NR2 A;  1GOZ A;  2GBR A;  2KK8 A;  3UIN B;  2QCZ A;  3AE4 B;  4ARC A;  3BIN A;  3RFZ B;  1WF9 A;  3D32 A;  4RF6 A;  2K8C A;  4KIK A;  4K3B A;  3GE8 C;  4J6I A;  1SF0 A;  2GOW A;  3IAM 1;  2DLB A;  5HHD G;  4MT5 A;  5G55 A;  2ASQ A;  4L1B A;  3TEZ A;  2MBB B;  2MCN B;  2LZ6 A;  4US9 A;  2QSD A;  3TBL D;  1KLV A;  3RN9 C;  5CTR C;  3DCG A;  3S2A A;  2KMA A;  1SE9 A;  3UIO B;  1KM7 A;  2DX5 B;  4N6E B;  2IO0 B;  3RD2 A;  2CS4 A;  1G0W A;  5HG2 A;  1EM7 A;  1I4R A;  2VH1 A;  3L2E B;  2K25 A;  1FM0 D;  4HPL B;  4AJW A;  2GMI C;  3QWZ B;  3P42 A;  1SB3 C;  3DRE A;  2W9N A;  3LVV A;  2BW2 A;  2WLB A;  1WJ6 A;  1WR6 E;  4IDI A;  2X38 A;  2JZ3 B;  2NPT A;  2Y5B B;  3AE6 B;  4NAW B;  1FXA A;  1HA5 A;  2LGY A;  3T8M A;  4G0N B;  1YOV B;  3ECI A;  3RYT A;  4W9D A;  1SXT A;  1VA6 A;  4LNO A;  1D3Z A;  2WWZ A;  3T3N A;  4OVU A;  3C0R B;  5IAA C;  4RH6 A;  2LEK A;  2WXJ A;  1DOI A;  4NPN A;  2VZK B;  3GZN I;  4P16 A;  4M8M A;  2EMS A;  2GWC A;  3VR9 B;  4MSQ B;  3BII D;  1B9R A;  3ZTC A;  2PPH A;  2SAK A;  3ZTD A;  2B76 B;  2KC1 A;  1NEN B;  1F52 A;  1Q10 A;  4R3D A;  1VRP A;  3VR8 B;  2IDY A;  4HLE A;  2YVC A;  3ZDT A;  3OWE B;  1ZUD 2;  3APF A;  4LNK A;  1HTO A;  4JL9 A;  3DVG Y;  3DRB A;  4C4V B;  2KDE B;  1J7C A;  3NVV A;  2RPQ A;  4A55 A;  3B2F A;  4HKQ A;  3JU6 A;  5C23 A;  1FXI A;  3R3M A;  3APC A;  1L6U A;  3L16 A;  2JX5 A;  3U8Z A;  2YLM A;  1BUI C;  2OJR A;  1N61 A;  1OFF A;  2MP2 B;  1NYR A;  1TS4 A;  4BKG A;  1I35 A;  2JWU A;  4A8X C;  3WAN A;  2N7D A;  4ANW A;  1WMH A;  4RF1 A;  3A9J A;  2MJ3 A;  4A6Q A;  2C9W B;  4DHJ B;  2LUE A;  2KXJ A;  3U7Z A;  3L2E A;  3KH0 A;  2OOB B;  4TUU A;  1FRR A;  3AMZ A;  1UWX A;  4HK2 A;  4GVY A;  2NMQ A;  1BML C;  4TSS A;  5L83 A;  4AWJ A;  1JML A;  5H8Y E;  4NAW A;  2NVU I;  4Q2R A;  2K6D B;  3HK0 A;  3N20 C;  4DHZ E;  5JHB A;  2IGD A;  1I42 A;  3HHM A;  1P7E A;  1C78 A;  4F7Z A;  3KW5 B;  1NYQ A;  1JW9 D;  1GAQ B;  4A90 A;  2LMC A;  4FJY A;  2INP E;  3B0A A;  4RGM A;  2GLS A;  1ZP0 B;  4DBG A;  4IM0 A;  4EEW A;  1MG4 A;  3PPA A;  1FIQ A;  3AUL A;  2DYO A;  1QIL A;  1YJJ A;  3VUX A;  4ZRK A;  1I4Q A;  1RYJ A;  2WHI A;  1EWC A;  3RUL A;  4LTU A;  4JX1 C;  1KRH A;  1WY8 A;  4F8C B;  2GBN A;  4GVZ A;  1SJE D;  1X1M A;  3L2D A;  4HCP B;  2JRH A;  3JU5 A;  3AEE B;  3GP7 A;  4PS3 A;  1GNU A;  1QT9 A;  2Q5W D;  3PGE A;  2HTH A;  3Q8B A;  4WWP A;  2R2Q A;  3FAH A;  3MJ5 A;  3RNF C;  1YNT E;  1CRK A;  2MP2 A;  4A9A A;  2DZJ A;  2O6V B;  3P4Q B;  3KVF B;  4FXC A;  4B0M A;  1WWT A;  2KQ4 X;  2L7R A;  1AW7 A;  1K8R B;  3H1U A;  4DQO C;  2N7J A;  1M4V A;  2AQ2 B;  1FMA D;  3N30 A;  3A9K A;  2INC C;  4RMA A;  1N62 A;  2WXP A;  2Z0D B;  5FR6 A;  1XLQ A;  2MX2 A;  1IP9 A;  4GSW A;  2WU2 B;  1U6R A;  3QAR A;  4IW0 A;  2BVC A;  3MC9 A;  4MGI E;  2REX A;  4XDD A;  2I1K A;  2HTM E;  4I6N B;  1WE6 A;  3WIM A;  2QEJ C;  1GB4 A;  2MW5 A;  1FPY A;  4ZYN A;  1WIA A;  2VH2 A;  1XEE A;  2IY1 B;  1DGJ A;  2HJ1 A;  2KWC A;  1FNU A;  1D5M C;  1YQ4 B;  1MHX A;  2CHX A;  2FBW B;  3SHQ A;  4ARI A;  5HKH A;  2AEH A;  1RWS A;  3L08 A;  4RCO A;  3CWI A;  2INN E;  4NNJ B;  2AL6 A;  1J0G A;  2M56 B;  4GMV A;  1SSN A;  4OW0 A;  2FAZ A;  4GW2 A;  4JQW C;  2MH7 A;  3U52 E;  4IWO A;  4MM3 B;  5GXG B;  2N0S B;  3EUB 2;  1WX9 A;  1N60 A;  3MP9 A;  1WX8 A;  1VLB A;  2KTR A;  3AE3 B;  1ZDV A;  1ZW7 A;  2EEL A;  4P1B C;  1T3Q A;  1XLP A;  1RFK A;  1KLG D;  2AQ1 B;  3VTW A;  2HE7 A;  1WXS A;  3PLV A;  3TIX A;  1UF0 A;  5J17 A;  1RLF A;  4WJN A;  3A1Q B;  4FJZ A;  1R4M B;  3W1Y A;  3L17 A;  4M00 A;  3DDC B;  1STE A;  2N1V A;  2M4N A;  1J8C A;  1ZOY B;  3VRA B;  1MFW A;  2NTS A;  3LYY A;  2BQQ A;  3QK0 A;  4PT5 A;  3H9D A;  1TZO A;  4GU2 A;  1Y8R C;  3QC8 B;  2W3R A;  1JQ4 A;  2WXM A;  1FEH A;  5KHQ A;  1ENF A;  4KX6 B;  3V60 A;  1E5W A;  4RF8 A;  3AU5 A;  2V9H A;  1JWB D;  2WXL A;  4IG7 B;  3P63 A;  2LGS A;  1RFA A;  5J2R A;  1NBF C;  3DBR I;  1L6V A;  2JPH A;  4DXA B;  2I38 A;  3X23 A;  3VFK A;  1IUE A;  2BB6 A;  1ACC A;  4WQM A;  3P2B A;  4ANX A;  4M0W B;  1JRO A;  2K22 A;  3H6N A;  3QHT A;  3IFW B;  1P52 A;  2D2Q A;  1L5P A;  3A4S C;  3DBL I;  2DHZ A;  1JCK B;  2ZNV B;  3H7S A;  3KLS X;  4CO7 A;  1RM6 C;  2UYZ B;  1TYG B;  3R66 C;  3TUO A;  5IP4 D;  4XWW A;  3PZD A;  2WDT B;  5C2T B;  2JT4 B;  4HJK A;  3R7R A;  3PRM B;  2DEN B;  1MHH E;  3OJ3 A;  3ZJU A;  4LCD E;  1TT5 B;  1T6B X;  1Q1O A;  3AN1 A;  5IA7 A;  1NVI D;  3DBH I;  2MBO A;  3GOE A;  1C9F A;  4XX5 A;  2N9X A;  2QMT A;  2OHF A;  4WWM A;  1YD8 U;  2L83 A;  1LQB A;  1WH3 A;  3U30 A;  5AZF A;  5LXH A;  1FFU A;  1T0Q C;  1QOF A;  3HUI A;  3MTN B;  3VDZ A;  3W5V B;  2RR9 A;  5BO4 B;  3SU8 X;  2Y5C A;  1EF5 A;  2LUM A;  2CHW A;  2KKC A;  1IBX A;  1BXT A;  1I4P A;  2DZK A;  1GB1 A;  2BYE A;  4ZRQ A;  1F2R I;  3SD5 A;  3GZN B;  1C77 A;  3KYC D;  4W9C A;  2L8J A;  3KWL A;  2KJ6 A;  1C4A A;  1ET6 A;  3PS6 A;  4GXB A;  4GIV A;  4AM1 A;  1F77 A;  1PQS A;  3BWU D;  2Z0E B;  1F0Z A;  1V1O A;  2KAC A;  3WCQ A;  3ZO5 B;  2MJE A;  3AED B;  1GPX A;  4ANV A;  4PYZ A;  3N1Z C;  4ZRP A;  3I5J C;  2PE6 B;  4TV3 A;  2XN9 C;  5CHF A;  5G5G A;  1WGY A;  2KQS A;  5IO9 A;  2E6X A;  1H8C A;  2LGI A;  2KNB A;  2D07 B;  3AE5 B;  3PHX B;  3AM9 A;  1I4H A;  3PRP B;  3UGB B;  2PLP A;  2KFK A;  1P9D U;  3TSS A;  4P1C C;  4N9F 4;  3AEA B;  2WXI A;  4MAC A;  4N58 A;  1UNS A;  3I63 C;  2E3T A;  1MG8 A;  2WDR B;  1OEY A;  1PGB A;  1D6E C;  3NZ3 A;  3GS2 A;  3Q3J A;  1S3S G;  2GBK A;  2O6V D;  1KJT A;  4FN2 A;  4NAM A;  4G3X B;  1VCB A;  2KHW B;  1P3Q U;  4IWQ A;  3WAP A;  3FIL B;  4W9G A;  1K50 A;  2WXR A;  4B9K A;  4AOF A;  3NY5 A;  5JH5 C;  3HVZ A;  3A33 B;  3ZIM A;  2FCN A;  1A70 A;  2L52 A;  3MC8 A;  1JWA D;  4K3C A;  4FBJ B;  3W1S A;  4MH0 E;  1SGH A;  3BVM A;  3IG8 A;  1WR1 A;  2ZW1 A;  1V80 A;  3H8H A;  2KVR A;  3R2T A;  1WGK A;  2IY0 B;  3RZF A;  3RNA C;  5AZH A;  2EKI A;  1HE8 A;  2C7N B;  5TR5 A;  3AE1 B;  3ML8 A;  3Q6B A;  2G4D B;  1ESF A;  1PGX A;  3ZRF A;  5LLI A;  4BBN F;  1R8G A;  2DBY A;  4DDG D;  5D94 A;  3ZVV A;  4YSZ B;  1BG0 A;  2JYT A;  4X57 B;  3MFG A;  3TCA A;  4W9E A;  4H2A A;  4KSK C;  1SIJ A;  2JXX A;  2FCS A;  3NJT A;  2GBJ A;  5JHA A;  1V97 A;  2IZV B;  3M62 B;  2O2V A;  2KN4 A;  3Q8F A;  3HIZ A;  3B08 A;  3RPF C;  1SE4 A;  2QC8 A;  3Q8A A;  2R61 A;  2RDH A;  3BK2 A;  3W1S C;  3QX1 A;  2H89 B;  3AEF B;  2J0J A;  2AX5 A;  4KZC A;  1V9J A;  1WGG A;  2LWP A;  3QJZ A;  5AEK B;  1P7F A;  1IYF A;  1T0Y A;  3AXC A;  2MJD A;  4BBN C;  5D2M B;  4KVG B;  1LXD A;  3MHZ A;  2PTL A;  2LXA A;  5J9A A;  2CHZ A;  3NVY A;  4RGT A;  3TL5 A;  3H7P A;  2UU7 A;  4EZK A;  2J1Q A;  2XEW A;  2VRR B;  2WNM A;  1CMX B;  3AE7 B;  1ZXI A;  5D3D A;  1AN8 A;  5LXI B;  3B9J A;  1PFD A;  4MJS A;  3L10 B;  1V1P B;  4URK A;  3SDL C;  5EE1 A;  3ZXR A;  4RF0 A;  4N59 A;  4EOY A;  5IOI A;  2ON8 A;  1YIW A;  3EA6 A;  1T5X D;  4WUR A;  2PEA A;  2W82 A;  4ZRJ A;  3O13 A;  2LHE A;  2RGF A;  3Q69 A;  1HXY D;  2N9E B;  1WM2 A;  1V6E A;  2JQR B;  2KC2 A;  2WXN A;  3B2G A;  1EF1 A;  1SIF A;  2L76 A;  4I6L B;  3MJW A;  1Z5S B;  4CHK A;  3HM3 A;  2KMM A;  2V4I B;  2WXG A;  1R7S A;  3ZLZ A;  2EKE C;  4II3 B;  3V61 A;  3VH4 B;  2CR5 A;  3APD A;  1ZKH A;  4M8N A;  4B6W A;  4GB9 A;  5EDS A;  2JYE A;  3IG5 A;  1AWD A;  1UD7 A;  3VAW A;  3PRE A;  1GJZ A;  2BWE S;  4GGQ A;  4WAA A;  1FD6 A;  1KLU D;  1HZ6 A;  2BBC A;  2QHO A;  3TEX A;  3BK1 A;  1WFY A;  3KYD D;  3E56 A;  1PGA A;  1QQR A;  3FC4 A;  3M63 B;  2R2O A;  2JVC A;  2L0T A;  2RSU A;  2RMM A;  5CX3 A;  3PO0 A;  1U4A A;  3L54 A;  3DOW A;  2WX0 A;  4KGR A;  2N9K A;  1J7B A;  5J18 A;  4WH4 A;  3M10 A;  1YQB A;  2ZCB A;  2BYF A;  3IT6 B;  3DWG C;  4IC7 B;  3LDZ E;  4IUM B;  2UWQ A;  1RAX A;  2XK5 B;  4TQ0 A;  4GW0 A;  2BS2 B;  1TZ1 A;  2AYO B;  3NZU A;  1WJN A;  1V5T A;  1R4N I;  4UDU C;  3VXW A;  4YTN B;  4OHJ A;  4W9H A;  3ZYY X;  2MBH A;  1P1A A;  3AE9 B;  3RI7 C;  2BKF A;  4XC2 A;  5C3J B;  2G45 B;  1F9J A;  1XD3 B;  5E6P A;  3PV1 A;  2JU6 X;  4BHL A;  3DBR B;  1E7P B;  4DXF A;  1E7U A;  4W9L A;  2L3Z A;  3CSF A;  4FJV B;  3ENE A;  1TTN A;  4C4V A;  4A3O A;  1UEL A;  3W9C B;  1J7A A;  3TMP B;  2PIA A;  3DBL B;  2J0K A;  1QOA A;  4DDI D;  3KUC B;  1UGM A;  3RCZ A;  4MGK E;  1YQ3 B;  5LNK 1;  2KLG A;  3VH3 B;  1WI0 A;  3BYY B;  5AZG A;  2GI9 A;  3NVZ A;  1WZ3 A;  3CST A;  1FO4 A;  1NI3 A;  3OLM D;  4RM8 A;  2L00 B;  2ZVO A;  2KJH B;  1WM3 A;  5DPR A;  1I7H A;  3V3X A;  2D3C A;  4II2 B;  1I4G A;  3IBE A;  2V0G A;  2QIE B;  2ZEQ A;  1M94 A;  4MSM B;  3ZQ4 A;  3DBH B;  2WDQ B;  1M15 A;  2WX1 A;  3EHV A;  1P0R A;  1L4D B;  1C1Y B;  3ZDM C;  2FID A;  2CRK A;  2KLC A;  4FHK A;  3K9P B;  4GLS C;  2NBW B;  2J7Q B;  1TS5 A;  3WAM A;  2WS3 B;  2V1Y A;  1TKY A;  2W55 A;  4BKS D;  4WJP A;  1MJD A;  1IGD A;  1XCT L;  3HRD D;  4RGN A;  2KMC A;  4KKJ A;  2WXH A;  4JIO U;  3ZW3 A;  2G3Q B;  2ZVN A;  1E9M A;  2JRI B;  3IG3 A;  1VZ8 A;  4WJQ A;  4C80 A;  4TMA B;  1GG3 A;  3LB8 C;  3NOB A;  2K1F A;  3VTU A;  4IOI E;  2ZZP B;  4MEL A;  4YTP B;  1K53 A;  1TKE A;  4US8 A;  4AUQ C;  1P98 A;  3O65 B;  5EE0 A;  1WJ4 A;  1C4P A;  4HRO A;  1LO5 D;  1WXQ A;  4WJO A;  1XXG A;  2XBB C;  1TJE A;  1WYW B;  3PZ8 A;  2KDF B;  3QAQ A;  1B1Z A;  3NVW A;  5JZE B;  3KUZ A;  4ICV A;  5HFY A;  3DBS A;  3KQ4 A;  3I3T B;  2K8B A;  2O6V A;  1FCL A;  3P1M A;  1JAL A;  3GE3 C;  2GRI A;  2KZR A;  3C8Y A;  1VD2 A;  3EGR A;  3N1Y C;  1V4G A;  4LJP B;  2MBQ A;  2FE8 A;  1JWM D;  3AE8 B;  2RD0 A;  3P4R B;  2N7E A;  5FK9 C;  1Y56 A;  3BZD B;  1VZ6 A;  1UZX B;  2BYV E;  4ZYS A;  2KN5 A;  3LN6 A;  2K8H A;  2N1W A;  1V5O A;  4NQL B;  1WE7 A;  2KX3 A;  4TKN A;  2MQJ A;  4KGT A;  2LXC A;  1MPE A;  1XT9 B;  2FIF A;  4IM2 A;  5J99 A;  2MSE D;  2C60 A;  1DYQ A;  2M19 A;  2MBE A;  5BYS A;  1QOB A;  1N5W A;  4XYC A;  4L2Y A;  2DZM A;  2AL3 A;  3NS1 A;  4ZDV A;  3NUH B;  1FXT B;  4QAY A;  2KO3 A;  1NI2 A;  4MH8 A;  4HEA 1;  2ONQ A;  4WAF A;  3L13 A;  3N9Y C;  5L95 C;  4MM3 A;  1KTK A;  4EFO A;  3TJP A;  2KWD A;  4OZB A;  1UH6 A;  4J3O D;  3V6C B;  1QLB B;  1VRA B;  2DAF A;  3NHE B;  2BS4 B;  2DZI A;  4P6V F;  3E9S A;  1I4X A;  1H4R A;  4REZ A;  1TGZ B;  2LHD A;  1YMH E;  1K52 A;  2BB5 A;  1S1Q B;  4RNA A;  2K0P A;  3IXS A;  4K7W A;  4W9I A;  1WYG A;  3JPZ A;  3VHT C;  2PW9 A;  4BG4 B;  4EKU A;  2D33 A;  1E7V A;  1SE3 A;  3L0W B;  3A1Q A;  1GUA B;  4LK0 M;  2MRP A;  1KOT A;  2J0M A;  1OQQ A;  2HD5 B;  4BOZ B;  3P4P B;  2IYD B;  4PS7 A;  4YSX B;  1QF6 A;  3KWV A;  4HKZ E;  3OG5 A;  1SBB B;  4XDC A;  1F2R C;  4ASW C;  2NS5 A;  2LJ5 A;  5AUK A;  2LVP A;  1L2N A;  1YJI A;  2WXK A;  3W5U B;  3BYT B;  1TBE A;  3BY4 B;  2KQ7 A;  3I9V 1;  2NBU A;  2BT6 A;  4KIK B;  4W9F A;  1WXA A;  4AP4 C;  2RPV A;  1LFD A;  2ZJD A;  5HI1 A;  3TEY A;  2NCN A;  4OZA A;  2EMT A;  4LDT B;  2RDG A;  4DXG A;  3UQA A;  2LVQ A;  4PK1 A;  4ITK A;  3P4S B;  3RT3 B;  2D32 A;  4LLG M;  2A4Z A;  4M0W A;  5I4D A;  4JWU C;  2BPS A;  4GOC A;  3RZW C;  3M3J A;  2N9P C;  4LNI A;  3EFU A;  5JXV A;  4ZHO A;  5E6O A;  3J9C A;  5CHV C;  2KOX A;  4FLH A;  2I2Y A;  4ICU A;  4RF7 A;  2Z59 B;  3TEW A;  4YT0 B;  1XLN A;  4NJ7 A;  1E6E B;  2JXT A;  4P7I A;  4AS1 A;  1XLO A;  2B3A A;  4BZA A;  2JY6 A;  2KWU B;  4RGO S;  2C7H A;  3AU4 A;  3Q3M C;  1BT0 A;  1LGR A;  2HDE A;  4I6P A;  3SR6 A;  4WWN A;  2NPT B;  2IBI B;  4WWO A;  1FCC C;  2IPK D;  4BOS C;  1OEY J;  4C00 A;  4W9J A;  5G2N A;  3UF8 A;  4NQK E;  3PSE B;  1HQR D;  4HPM B;  1C4C A;  4M02 A;  2L1A A;  1KH0 A;  3ML9 A;  3Q3N C;  3W2D A;  3IAS 1;  1TY2 A;  2YEP B;  4MGY E;  2M1M A;  4K1R B;  1WSP A;  1QOG A;  5T8I A;  1EO6 A;  1R4N B;  3AEG B;  2KFJ A;  2ZNV C;  3C19 A;  2PMV A;  3DVN U;  2BWF A;  3VVW B;  3N1X C;  4B0E A;  4WIP A;  2GB1 A;  3PT2 B;  3DQV A;  3RNB C;  4FAD A;  3HM6 X;  4XGA B;  4HPP A;  1VR9 A;  2D10 A;  2KAJ A;  1TS3 A;  3DPD A;  4OVZ A;  4NJ6 A;  1WXM A;  1L4Z B;  3NZT A;  2Z8L A;  2CKH B;  4IKG A;  4NZL B;  4ZRI A;  1FNW A;  2D3A A;  2IJ0 A;  3U7D A;  4HVB A;  4AQ7 A;  3PVL A;  1WMH B;  1CZP A;  3A9J B;  2WQY B;  2XNA C;  4EE2 A;  1V8C A;  2G1E A;  2OJW A;  2LFI A;  3EEC A;  1L0V B;  2WXF A;  3NRZ A;  1V86 A;  4JPS A;  4MDK E;  1WRI A;  1ISN A;  3QCA A;  3MC0 B;  3DVN V;  2WXO A;  4E3C A;  2IO2 B;  3FIL A;  4NY0 A;  3V05 A;  3QA8 A;  4BFR A;  1KF6 B;  2A5U A;  2CJN A;  3CF6 E;  1E8X A;  1WGH A;  2BTE A;  2KDB A;  1L0X B;  1SD0 A;  1WRD B;  2JZP A;  4KDL B;  1N6Z A;  1TKG A;  3Q8E A;  2QDF A;  4FUL A;  2MA9 B;  3VUW A;  3RNG C;  2KDM A;  3U4E G;  2PE9 A;  5BMG A;  3AE2 B;  2DWQ A;  3EC8 A;  2ACZ B;  4TQ1 A;  3UI3 A;  2D3B A;  2JSV X;  1L7Y A;  3SEB A;  4BKS A;  3MHS D;  3V6E B;  2L32 A;  3ZUN A;  1PUT A;  5D6J B;  2FUH B;  2X8X X;  4DHZ B;  2D5G A;  1WJU A;  2YEP F;  3OAW A;  4ACF A;  2LRU A;  1UUP A;  4ANU A;  4MGZ E;  3ZNI D;  3BVZ A;  3VTV A;  1QH4 A;  1CK1 A;  4IWP A;  1Z2M A;  2K3U A;  3LVW A;  2NTT A;  4W9K A;  3ZRC A;  3JQ3 A;  3URY A;  5E6N A;  4A3P A;  4KV2 A;  1E90 A;  4C7Z A;  3LN7 A;  5IN7 A;  1DOY A;  3LJ3 A;  1IPG A;  1WX7 A;  1AAR A;  4L23 A;  1GC6 A;  2DYB A;  3A9K B;  1E10 A;  2AQ3 B;  1ZXH A;  3R7Q A;  4LNN A;  4JLC A;  5D3I B;  2IND C;  1YX5 B;  2KJR A;  3Q2A C;  2LAS A;  2G9H D;  1TT4 A;  1UBI A;  2WYQ A;  2MWS B;  3ALB A;  3DHH C;  3NG0 A;  1JRP A;  2MLB A;  2KTF A;  2NBV B;  2D11 A;  2GWD A;  4E74 A;  1V1P A;  2N9L A;  5EE9 A;  2KT7 A;  3AV8 A;  3Q8C A;  3PTF C;  2LVO A;  4LDT D;  1A5R A;  2G4S A;  2H88 B;  1YX6 B;  4S17 A;  1VJK A;  4O1N A;  2L0F A;  5DPS A;  1Q0W B;  4YXD B;  4GN1 A;  2MEK A;  2M8S A;  4BKT A;  4ZOH C;  1XCQ L;  4XWT A;  2Y3A A;  1N5X A;  2KTR B;  2I1J A;  1ZE3 D;  4FHJ A;  4JWS C;  3PRZ A;  4HXD A;  1CQV A;  2WP9 B;  2LRW A;  1F1H A;  2DAJ A;  4B95 A;  3GB1 A;  3AI5 A;  3X0W A;  2WU5 B;  3LXF A;  3QIJ A;  4RM9 A;  3WAL A;  1WGD A;  1OTR B;  1E8Z A;  1IGC A;  3ETR A;  3ZNH B;  1SJH D;  1WXV A;  1UBQ A;  2HJ8 A;  1VZ7 A;  2M0A A;  4NJC A;  1FRD A;  3CMM B;  4XE0 A;  2DYM A;  2V3S A;  2FCQ A;  5BYQ A;  4KZ0 A;  1VDV A;  4GDL B;  2LJI A;  1QKZ A;  2W3S A;  3AEB B;  2AWT A;  2FNJ B;  1AYF A;  3R2I A;  5FKA C;  3DVG X;  3Q3O C;  2KDI A;  2KVZ A;  2XK5 A;  2JZZ A;  2KYW A;  5DCN A;  2TSS A;  3U2S C;  2IGG A;  1PYW D;  2V4L A;  1K51 A;  2V3P A;  1C76 A;  3N3K B;  4C56 C;  5G5H A;  2M17 A;  4LJO B;  3ZNZ B;  1TIF A;  5H92 C;  1QZE A;  1PDX A;  1D4B A;  2K6Q A;  2ICI A;  1SEB D;  4HJG E;  5BMH A;  1N63 A;  1OQR A;  4HRS A;  4BVU C;  3UIP B;  1LM8 B;  1T0R C;  3ABV B;  3JVZ X;  2MHJ A;  3IVF A;  4EUT A;  1KFY B;  2IGH A; 
#chains in the Genus database with same CATH homology
 2WGS A;  1F1H A;  1LGR A;  4GW0 A;  1M15 A;  4AM1 A;  1P50 A;  4LNI A;  4GVY A;  4RF8 A;  1RL9 A;  4LNF A;  2GLS A;  4S17 A;  4LNK A;  1HTO A;  3FKY A;  2D3B A;  4GVZ A;  1FPY A;  4Z9M A;  3NG0 A;  3DRB A;  4S0R A;  2LGS A;  4RF7 A;  3JQ3 A;  4HPP A;  1HTQ A;  3L2D A;  4LNN A;  4GW2 A;  4Q2R A;  4BAX A;  2OJW A;  3ZXR A;  2CRK A;  3JU5 A;  2D3C A;  3M10 A;  4RF9 A;  1BG0 A;  1G0W A;  3JU6 A;  3JPZ A;  1SD0 A;  4BG4 B;  5J99 A;  5J9A A;  2QC8 A;  1F52 A;  4BG4 A;  4ACF A;  1U6R A;  3B6R A;  1VRP A;  3L2E A;  2BVC A;  1I0E A;  3L2E B;  4LNO A;  1CRK A;  1QK1 A;  2WHI A;  1P52 A;  3ZXV A;  2UU7 A;  4XYC A;  2J1Q A;  4RF6 A;  4BHL A;  1QH4 A;  2D3A A;  3DRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...