4ACFA

Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with imidazopyridine inhibitor ((4-(6-bromo-3-(butylamino)imidazo(1,2-a)pyridin-2-yl)phenoxy) acetic acid) and l-methionine-s-sulfoximine phosphate.
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
475
structure length
475
Chain Sequence
KTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMINE SYNTHETASE 1
publication title Synthesis, Biological Evaluation and X-Ray Crystallographic Studies of Imidazo(1,2-A)Pyridine-Based Mycobacterium Tuberculosis Glutamine Synthetase Inhibitors
doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 155
structure length 475
sequence length 475
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 4acfA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 4acfA02
4LNIA 1HTQA 1P52A 3B6RA 3NG0A 3DRBA 1VRPA 4LNNA 3ZXVA 3DREA 4ACFA 5J9AA 3L2EB 2J1QA 2CRKA 1M15A 4BAXA 2WGSA 1RL9A 1CRKA 3FKYA 1HTOA 3ZXRA 1BG0A 4RF6A 4BG4B 4LNOA 2QC8A 4GW0A 2OJWA 4S17A 4S0RA 1P50A 4RF8A 2D3BA 1F52A 4AM1A 2D3CA 1LGRA 1F1HA 4Q2RA 4GVYA 1QK1A 5J99A 4GW2A 2BVCA 3JPZA 1FPYA 2LGSA 3L2EA 1G0WA 3L2DA 4RF7A 1I0EA 2D3AA 3M10A 4HPPA 4LNFA 4RF9A 1SD0A 3JU5A 4BHLA 1QH4A 3JQ3A 2GLSA 4BG4A 2UU7A 4XYCA 3JU6A 4Z9MA 4GVZA 2WHIA 1U6RA 4LNKA
chains in the Genus database with same CATH superfamily
1ACCA 3MC9A 4HLEA 1SIJA 2LFIA 3Q3NC 2V1YA 2WNMA 3RNCC 3ZDTA 1F77A 1KOTA 4IM3A 1C76A 4OZBA 2WXFA 3A4SC 4KIKB 4NJ7A 1AN8A 4EFOA 3LDZE 4HCNB 2JPHA 1KF6B 2HTME 4DHJD 1SGHA 1DOIA 2BPSA 2BYEA 3ZDMC 2RPQA 3B6RA 3DRBA 1DYQA 1FXTB 1X1MA 5LXIB 4REZA 3DQVA 4AP4C 2J1QA 1N5WA 2KLCA 1EO6A 3P4SB 3TSSA 4ZRPA 1H8CA 1WX9A 5BYRA 3URYA 1UBIA 4NNJB 3KWLA 3B1LX 1J7CA 4FJVB 3KUCB 4RM8A 4EOYA 4GW2A 2Y3AA 2K8HA 2IYDB 3Q8EA 3PZDA 4G3XB 1LO5D 2N9PC 4DHJB 3CWIA 3ML9A 2WWZA 4ZYNA 2M0AA 1C4PA 3P2BA 1UGMA 2KQSA 3U52E 1FD6A 3L08A 1WWTA 4X57B 3N1YC 4BZAA 3FILB 4RGMA 3V61A 4JGHB 3ZLZA 5MPOA 1ZW7A 2BBCA 1Z5SB 4GB9A 4FBJB 4NAWB 3UGBB 2UU7A 2IPKD 5G2NA 4K3CA 3PSEB 2JYTA 1UZXB 2OEDA 4LNKA 2L7RA 4L23A 3MTNB 1MJDA 4DWFA 3ZVVA 2Z8LA 5AUIA 2KT7A 1C9FA 1I0EA 1K52A 2CR5A 4P7IA 4WWOA 1JW9D 1KH0A 4P1BC 3ETRA 2YLMA 1J7AA 1C4AA 3U7ZA 1WR6E 1JWAD 3DBHB 3ZNGC 4I6LB 4TQ1A 3NHEB 2R61A 1QOGA 1LM8B 4GDLA 3CMMB 3IXSA 4TQ0A 4RNAA 4GOCA 2AEHA 3C8YA 3P63A 2HDEA 1ET9A 1WXVA 2I2YA 4Q2JA 3L54A 2N7JA 2XBBC 3HIZA 2V9HA 5KHOA 1JWMD 3PGEA 4CQNA 2GBRA 1ZDVA 3NVWA 3T9LA 2KDFB 1OEYJ 2L8JA 3TEZA 2H88B 1TBEA 1S3SG 3VVWB 3VFKA 3NOBA 1GAQB 3FILA 1VRPA 5AZGA 5IAAC 2NTSA 1JROA 3IG3A 3UI3A 4NAWA 2PKOA 3EA6A 1L4ZB 3ZKJC 2KMCA 2PE6B 5T8IA 2MRPA 2QEJC 1QZEA 5L95C 1FCLA 2PIAA 2O2VA 3V6CB 4M01A 4ITKA 2ZW1A 3X0WA 1ZP0B 1L5PA 1FO4A 1T5XD 3PS6A 5E6NA 3QARA 2SEBD 3ZIMA 4JLCA 4P16A 2PJHA 1IBXB 3ABVB 3ONSA 4K7UA 2KX0A 1GOZA 2K39A 1KLGD 4IWQA 3BINA 3NS8A 3R8BA 2RR9A 4JE3B 2L76A 2ZPNA 5DPRA 1FM0D 1DGJA 1SIFA 3H9DA 1OQQA 4A8XC 3PLUA 2LGYA 1WJNA 2BQQA 4KDLB 4J6IA 4YL8A 2BW2A 4EKUA 3V05A 2M56B 1QKZA 3EFCA 3NY5A 2KQ7A 1IPGA 2KO3A 4ZYSA 2G3QB 1WGYA 2K9XA 1BXTA 4MT5A 1XD3B 3KYCD 3HM3A 2LRUA 1WGGA 1EF1A 4QAYA 4RF7A 2MLBA 2Y5CA 4ASWC 1JALA 2JT4B 3M62B 2KNBA 3GE3C 3R2TA 5DPWA 2DLBA 1UH6A 2W9NA 1E8YA 1WSPA 4DQOC 2GWDA 2GB1A 4WQMA 1YMHE 2IY1B 3MC0B 2PW9A 2D11A 1DOYA 2ZCBA 3ENEA 4NAMA 2J0MA 1EM7A 3DHIC 1SE4A 3B9JA 2LJIA 4RF8A 4A9AA 5G55A 3FC4A 1ISNA 4KX6B 4BHLA 3JQ3A 3VR9B 3Q2AC 1VJKA 4KSLC 4KGRA 3QX1A 2MHJA 1MPEA 2G4SA 1A5RA 3AE8B 2LJ5A 3Q8AA 4XX5A 2WQYB 4LTUA 1YJIA 1WH3A 2VH2A 1IBXA 2JQRB 3L13A 1XLOA 4YWGG 2LZ6A 4PS8A 3APFA 1KTKA 2NBVB 1RYJA 1PYWD 3UQAA 2MH7A 4D2KA 1FNUA 2LUMA 2FCMA 2JWUA 4E71A 1V1OA 4US8A 4GDKB 1T0SC 3RZFA 1SF0A 1T6BX 1RLFA 3PZ7A 3DWMA 3HRDD 3KUZA 3S2AA 4J3OD 3AEAB 1YX6B 4EUTA 4KKIA 2BWES 3Q3JA 2ACZB 4LCDE 2PLPA 3I5JC 1WI0A 3U8ZA 4AJYB 3IVFA 2JZPA 2V3PA 2QMTA 1VZ7A 1HXYD 1N62A 2NS5A 3A9JB 4G50A 1NBFC 3JVZX 4IWOA 3R2IA 4HJKA 2FIFA 3MFGA 2NBWB 2BS3B 5IKCM 2BYFA 1ROEA 5C3JB 1A70A 4W9FA 1WF9A 5LNK1 2DYOA 4AJWA 2W82A 4W9IA 4II3B 1TS4A 4B9KA 5JXVA 1D6EC 4HXDA 2I1KA 1FXAA 3ZJVA 2J53A 2B3AA 2GI9A 4ICVA 1YNTE 4DDID 3NUHB 3IBEA 2G9HD 2L05A 1J0GA 4A6QA 1TZ1A 2N0SB 2JU6X 3N1ZC 3NS1A 4NY0A 1C1YB 3BY4B 2HJ1A 4YSYB 2EELA 1SE3A 1L2NA 5FR6A 2ZVNA 3W1SC 1SJED 2C7MB 4GVYA 3AEBB 2D3AA 4E74A 2DX5B 2KFJA 4C7ZA 1SXTA 2KDEB 3AEFB 2KJHB 3E56A 3L16A 5TSSA 2BKRB 1V49A 5E6OA 3NZ3A 2QCZA 3HHMA 3UQBA 3V3XA 2DNFA 3H8HA 3I9V1 1SE9A 1HA5A 4FADA 4DXAB 4LJPB 2EMTA 1XF5L 2K8CA 2AYOB 3H7SA 2KWUB 1GJZA 4NJCA 3ZTDA 1SD0A 3CIRB 2V4IB 1P9DU 1NENB 2GBKA 2JWZA 2SAKA 3O65B 1WR1A 3A33B 1GNUA 5IP4D 3DVNU 1J8CA 1FNVA 2K8BA 2V4LA 2BGFA 2MEKA 2IZVB 4S0RA 2RDBC 3EGRA 1E8ZA 2N1VA 2JXXA 1NEKB 5IO9A 3ZUNA 4XYCA 4OZCA 5FR3A 4Q2RA 1V5TA 2K3UA 2WDQB 5C2TB 4M0WB 4ZRKA 1GC6A 1TGZB 3GZNI 1E7UA 2MJ3A 3N32A 2WP9B 3AEDB 3BWUD 3AI5A 1TKYA 2C7NB 2WU2B 5BYQA 1UGJA 4TKNA 2RSUA 2MSED 3B08A 3N9YC 3VRAB 2K22A 5J9AA 4WH4A 1K53A 1FNWA 4HKQA 4C00A 3I3TB 4HCPB 4KDIC 2QIEB 3AE3B 5CHWA 1D5XC 3SR6A 1ZE3D 4NQLB 1RFAA 4RGNA 3R3MA 2ZW0A 2DZKA 5EE1A 4XC2A 5BMIA 3MP9A 4B0EA 1ZPSA 1YJ1A 2NR2A 1BMLC 4HDQA 2N9KA 3ZXVA 1JWSD 1I42A 2WX0A 3FKYA 4BKSD 3Q8BA 4ZRQA 1FRDA 2WXMA 3ZNZB 1LGRA 2IGGA 4GLSC 3PRZA 1YJJA 1Z2MA 3ZJUA 1H4RA 4LNFA 2ASQA 2BB5A 4EZKA 3WIMA 3AECB 3T8MA 3BVMA 4M8MA 5JHBA 5IN7A 4DBGA 3TBLD 1P7FA 1E7PB 5AZHA 4B95A 2L00B 1TY2A 3AULA 1VZ6A 5C1ZA 4A20A 3AM9A 1S1QB 1WFYA 3WCQA 4HJGE 2M0XA 3QHTA 4PYZA 4M8NA 3PHWB 3PTFC 2KTRB 1V97A 4RF0A 1XLPA 2KFKB 2CS4A 3X23A 2CRKA 5BMGA 3OG5A 3ZXRA 3OWEB 2MBQA 3P4QB 1EWCA 5G5GA 1K8RB 5J18A 2DYBA 4PS3A 1ZDXA 4O1NA 1MFWA 1PGBA 1JRPA 2D07B 2LVQA 2KVZA 1FPYA 2KAJA 3L2EA 4IG7B 4KKJA 3NJTA 1T0QC 4DXGA 4YSXB 2FCQA 1EUVB 1P3QU 2KX3A 4M00A 1L6VA 1HTQA 3NG0A 2BTEA 2WXJA 4N6EB 2IO1B 3N30A 3QIJA 3Q3OC 2XK5B 3BYTB 2NPTB 1NYRA 5CTRC 3TCAA 4URKA 2BKFA 2RMMA 3VDZA 1ENFA 2G45B 2AQ3B 3QC8B 2GBJA 4RMAA 3T3NA 3A9KA 2N9LA 2ZEQA 3ALBA 4WAFA 2X8XX 3W2DA 2J42A 2J0KA 2WXQA 2BF8B 4NJ6A 1XXGA 2KMAA 2KD0A 3IAS1 3ZRFA 3RNAC 4ZHOA 1R8GA 3L2DA 5EE0A 1OEYA 1VR9A 3DBHI 4W9CA 3HVDA 4IC7B 2E3TA 2MBEA 1E90A 1WRIA 2N9XA 3MJWA 1WZ0A 2IJ0A 4ANWA 2PVGC 2AQ1B 2CHXA 3V6EB 4W9GA 4GIVA 2MW5A 1N60A 2INCC 1JMLA 5H92C 2A5UA 1FFUA 1C79A 4KIKA 3D32A 1V5OA 1L6UA 2Q5WD 2ICIA 3NVVA 3Q69A 3UIOB 3ZGZA 2HJ8A 4A55A 2MP2B 4WJNA 2D5GA 1NDDA 2QJLA 4G11A 4WURA 3LB8C 3VRBB 4HDOA 4P1CC 3AU5A 3P4RB 1WYWB 2LHEA 3PO0A 2LEKA 3APDA 3U2SC 2AL6A 4FLHA 4DK5A 2INDC 3VR8B 4BAXA 3APCA 3QAQA 3TEWA 1R4NB 5D3DA 2I38A 2MJDA 2RD0A 2CU1A 4LLGM 1AW7A 4YTMB 4YTNB 1FMAD 3IT6B 3MJ5A 2L3ZA 4MDKE 4BBNF 4MGYE 3VXWA 2M4NA 1PGXA 1TT5B 1GC7A 3L17A 2KMMA 2N1WA 3GS2A 3W9CB 3LJ3A 1V2YA 2WXPA 4I6NB 4KZ0A 4LNOA 5TR5A 5D2MB 2EMSA 2N7EA 1WXAA 4JQWC 4B6WA 3QA8A 3NRZA 1MHHE 3DBSA 2J0JA 4K1RB 1RAXA 3N1XC 4XDDA 2DENB 2M17A 2BS2B 3HUIA 2CHWA 4YXDB 3TEXA 1F52A 2QHOA 3RNGC 4B0MA 3ZJTA 4F7ZA 3T3OA 1UD7A 3Q3FA 4HWIB 2VZKD 2N9EB 2B76B 2FAZA 4IUMB 5D6JB 3VTVA 1V1PB 1OGWA 1VLBA 2M1MA 4PT5A 1FEHA 1TYGB 1E10A 5CHVC 2KN5A 3IG8A 3Q14C 2L0FA 4W9DA 2K25A 1UNSA 2R2QA 3QCAA 2LHDA 2CU3A 2KDMA 3JU5A 2GLSA 1WYGA 2AX5A 3H6NA 3DCGA 3OJ4B 4WIPA 2JZZA 3RUIB 2WYQA 2VZKB 4W9LA 2BYVE 4N9F4 2KJ6A 1JCKB 1LXDA 1EWYC 2LXAA 4MEMA 4OZAA 3UF8A 2D33A 4I6PA 5DPSA 3RMKC 2IY0B 1OTRB 1WM3A 4YTPB 3I63C 3P42A 1Q0WB 3IT4B 1TKEA 1QF6A 2KN4A 3B0AA 3KYDD 2Z0DB 4BG4B 5E6PA 4ANVA 3EUB2 5GMVA 1FCCC 2IO0B 2LGXA 5H8YE 3JW0X 1PUTA 1V9JA 4HRSA 4ZDVA 1BT0A 3CSTA 5BYSA 3AE7B 3TUOA 3GOEA 3N3KB 2GBMA 1I35A 1WJ4A 4USAA 2A4ZA 1D3ZA 1F2RC 2KZRA 3MHZA 2JRHA 5AUKA 2KWDA 3DVNV 1I4GA 1SE2A 1SEBD 5L83A 2OJWA 3QK0A 4RGOS 3AH7A 2WDVB 4A3PA 3Q8CA 2PVOD 3AE5B 1NVID 2OHFA 3J9CA 5C23A 2DHZA 3WAPA 1CQVA 2FCNA 4IDIA 5IA7A 1T0RC 3PT2B 4EE2A 1QLBB 1CMXB 2QSDA 3RT3B 1E5WA 4HVBA 3DHGC 2L0TA 2FUHB 1WX8A 5JZEB 3ZYYX 4WWPA 2JY6A 4XDCA 3N20C 2K6DB 3M63B 4LNIA 1MHXA 1WE6A 4GSWA 1ESFA 3SD5A 2KACA 1V6EA 4W9EA 3AXCA 1L0XB 2C5LC 2GWCA 1N61A 2NTTA 1P50A 2RPVA 3K9OB 1STEA 3NVYA 2L32A 4PK1A 2OJRA 3Q6BA 4KGTA 4WJQA 4XWTA 3VTWA 2MJEA 1P52A 4LDTB 3DBRI 4GGQA 1G6JA 1J7BA 2EKEC 1IGDA 4JX1C 3WA0A 4GW0A 2GOWA 3RULA 1D4BA 3AN1A 3IHPC 2W55A 2WXRA 4GDKA 4HPPA 3JSVB 3ECIA 4NZLB 2J7QB 1L0VB 3RPFC 4JPSA 5D7GA 3PV1A 2DWQA 2LGDA 1F2RI 1I4PA 4RGTA 5HG2A 1MG8A 1RFKA 1HZ5A 2INNE 3EHVA 1L0YB 1I4HA 2V0GA 1RRBA 2KWCA 3A9JA 3C19A 3DBRB 1ZKHA 4AWJA 1G0WA 1TIFA 1WM2A 2DYMA 4ZRIA 3EECA 1HE8A 3OJ3A 5J17A 4FJZA 2AWTA 1E8WA 1CK1A 2ON8A 2R2OA 3DBLB 2PMVA 1XCQL 3PREA 1V4GA 3RFZB 3VH3B 1XT9B 1YD8U 1QK1A 5EE3A 1BUIC 1YOVB 4HPLB 4LNNA 1I4XA 2CJOA 2V3SA 5G5HA 3PHXB 3W1YA 4W9JA 2C9WB 5HHDG 5BO4B 2M19A 2X38A 3OAWA 4C80A 1YIWA 5I4DA 3LYYA 3DWGC 2K1FA 3QQ8B 2JXTA 4FJYA 3VUWA 3QWZB 3M3JA 1WXSA 3LN7A 1MVKA 1EU3A 2PEAA 1OQRA 4KGSA 4WWNA 3M95A 2IGHA 3WALA 1BG0A 1VCBA 3JSVA 1FFVA 1NI3A 2Y5BB 2J4XA 2Y5PA 1JQ4A 1QOBA 2N7DA 3ZQ4A 2D3CA 4HROA 3LVVA 4RM9A 4RH6A 5FKAC 3VHTC 2KQ4X 1TZOA 3KLSX 2UWQA 3V62A 2E6XA 2DAFA 1QOFA 1EU4A 1CRKA 2KK8A 2HTHA 1N5XA 4L2YA 4EZLA 1Y8RC 1ZXHA 1F1HA 4GMVA 1R7SA 3B2GA 2D32A 3VUYA 5D94A 3HM6X 3IG5A 2IO2B 2ZZPB 2KVRA 4MACA 1C3TA 1VDVA 3V60A 4FA6A 2PTLA 1R4MB 2XNAC 4BOSC 1ZOYB 2HD5B 2NVUI 2IGDA 4M0WA 1QILA 1ZXIA 1WGRA 3SEBA 1WE7A 1DOXA 4ZRJA 1P0RA 3W5UB 1XQQA 4EEWA 1YQ4B 3VUXA 1YN4A 3RI7C 1PFDA 1JWUD 1UUPA 4TSSA 4LK0M 4HEA1 1TKGA 3VQIA 1XLQA 4KV2A 4MM3B 5JH5C 4US9A 4OHJA 2DBYA 4F1SA 1IGCA 2JRIB 2WXHA 4F8CB 2EKIA 1WXMA 3AE9B 3AE4B 4RFBA 1QH4A 5FK9C 4GVZA 2CHZA 1WX7A 4MSMB 1GB4A 2ZPYA 4WWMA 3TL5A 1F0ZA 1B1ZA 2GMIC 3AMZA 4OVZA 4RF1A 3TEYA 1E6EB 1PGAA 4R3DA 1OQYA 3RD2A 3GP7A 4GU2A 2GRIA 2LGSA 1L7YA 4BFRA 2VRRB 4HKZE 2KXJA 4AUQC 2INPE 2M8SA 1CJEA 4GDLB 4AOFA 4KSKC 2H89B 4JWUC 4ANUA 4MSQB 2CKHB 3Q8FA 1PDXA 1KLVA 1E0ZA 3W1SA 1AYFA 3RCZA 1P7EA 3AE1B 2LASA 4ZOHC 2WXLA 4W9KA 1I4RA 2LGIA 2FNJB 4BKSA 2FUG1 5DCNA 2W54A 2WGSA 1ZUD2 2YVCA 3C0RB 2L83A 2ZNVC 2DZIA 4YSZB 4OVUA 2KTRA 2QILA 3NZUA 2KFKA 1NYQA 1L4DB 5AZFA 3SFEB 2REXA 1R4NI 4MM3A 3ZRCA 2O2VB 2NCNA 2K0PA 1YQBA 1E7VA 2YEPB 1MG4A 3GB1A 3H7PB 3U7DA 2BT6A 1TS3A 2LVPA 1XCTL 2WXKA 1WRDB 5BMHA 2KOXA 3ML8A 1WZ3A 4TMAB 4KZCA 2LI5A 2XK5A 1V8CA 4PS7A 2NPTA 3AU4A 2DZMA 2JUOA 3A1QB 4BBNC 3LXFA 4C4VB 2UYZB 4CHKA 1PQSA 4FULA 2MQJA 1UWMA 4IWPA 3RNFC 1UELA 5E6JA 5LXHA 2WXNA 3EFUA 1T0YA 4P6VF 1OFFA 4ARCA 3L0WB 2Z59B 1KM7A 2OOBB 3DOWA 2NMQA 1HTOA 3LVWA 3AEGB 1LQBA 1QQRA 4WJOA 2J52A 5AEKB 3P1MA 4A3OA 4K7SA 2MWSB 3SU8X 3RNEC 3RNBC 4HK2A 2JSVX 1HZ6A 4YT0B 3W5VB 3MC8A 3A4RA 1JRUA 1IUEA 3AEEB 3TJPA 2XN9C 2IBIB 3H1UA 2W3SA 4TUUA 1SBBB 2WXGA 4W9HA 3VTUA 2NBUA 2KJRA 1GUAB 2D10A 2WU5B 4M02A 2AQ2B 4DHZE 1TJEA 3NZTA 3H7PA 4XWWA 2L52A 2KWVB 3KVFB 2MP2A 2KYWA 2RDHA 4AM1A 4FHKA 3RN9C 4IOIE 3O13A 4XGAB 1RWSA 2ZVOA 2O6VD 3BIID 4MGZE 3R7RA 1GG3A 2DAJA 3A1QA 2G1EA 4C4VA 3JPZA 1QT9A 4WAAA 4OW0A 1C4CA 4NQKE 3KW5B 4G0NB 2ZNVB 4IM2A 4KVGB 3WANA 1TTNA 2IDYA 3KUDB 5D3IB 1N6ZA 5JHAA 3WAMA 2WLBA 1LFDA 4K81A 2O6VB 1VRAB 3RZWC 1F9JA 3BK2A 2DZJA 4JIOU 4ICUA 3JU6A 2MBBB 1XEEA 3BVGA 1B9RA 1TT4A 3DPDA 1WJ6A 3PPAA 4H2AA 1VD2A 1JWBD 1XLNA 2D3BA 4IW0A 3PZ8A 4XZ4A 1V80A 2KLGA 3TIXA 4C56C 3KH0A 2WXOA 2PPHA 1FIQA 1XO3A 1EF5A 2WHIA 1KRHA 4LJOB 1I4QA 3MHSD 3WAOA 1RL9A 4JWSC 4OVVA 1UF0A 2C60A 4BVUC 2JF5A 2QC8A 1Q5WB 4FHJA 4E3CA 1V1PA 3ZNID 2FBWB 4FN2A 2JZ3B 4DXFA 5J99A 1M4VA 2KC1A 3CSFA 2N4FA 3DHHC 1YX5B 3ZTCA 4S17A 4NPNA 5J2RA 3FAHA 2I1JA 3UINB 3IAM1 4LDTD 3E9SA 4GXBA 1ZGUB 5DPTA 2RDGA 1AWDA 3DVGX 2BB6A 3DREA 2O6VA 4ACFA 1WJUA 2KTFA 4FXCA 3SHQA 1V81A 2AL3A 2QDFA 1WMHB 2WXIA 1YN5A 3OLMD 1YQ3B 3RYTA 1E9MA 4ANXA 2WX1A 3NZSA 4BG4A 4XE0A 3AE6B 5CX3A 1FXIA 2VH1A 1NI2A 1WIAA 5IOIA 4N58A 3B2FA 1SB3C 1WGDA 4MH8A 4L1BA 3PLVA 2FIDA 3QJZA 3SDLC 4A90A 3DBLI 4C7YA 3R7QA 1TS5A 4WQOB 3AB5A 1WXQA 1C77A 4K3BA 1KJTA 4HPMB 3P4PB 2WDRB 3I57A 2IO3B 2BS4B 3BVZA 1P98A 1N63A 1WGHA 2FCSA 3ZNHB 4BKGA 1K50A 2KANA 1GB1A 1HEZE 2MA9B 3AE2B 3U30A 2LRWA 1GPXA 1MI0A 2JYEA 3EC8A 3SFDB 4EZJA 4WJPA 2TSSA 2LWPA 2MBHA 1HQRD 1KFYB 2JVCA 5LLIA 1J19A 3KWVA 2KHWB 2L1AA 4N59A 1I7HA 2C7HA 2FE8A 4UDUC 1TS2A 3IFWB 4II2B 3BK1A 4MJSB 5EE9A 2MCNB 1WMHA 3DVGY 4Z9MA 3ZW3A 4AS1A 2RGFA 1U4AA 3K9PB 4CO7A 1D5ZC 2CJNA 3DDCB 2LUEA 5GXGB 1UWXA 3TMPB 1P1AA 2D3GA 2LMCA 3JYUA 4MH0E 1IYFA 3NVZA 4DDGD 3VAWA 1M94A 1IP9A 2Z0EB 1E8XA 3PRMB 3UIPB 1TY0A 4JL9A 1Y56A 2KKCA 1WGKA 4MGIE 2MX2A 1QOAA 1YN3A 3R66C 4IM0A 2D2QA 3L4PA 3L10B 1R4MI 3PVLA 2HE7A 1VZ8A 3ZO5B 1V86A 4DHZB 4GN1A 1KLUD 3L2EB 1D5MC 3KQ4A 1FRRA 2ZCCA 2ZJDA 1VA6A 2BYTA 5HKHA 1ET6A 4RCOA 4AQ7A 2V3NA 2BVCA 3GZNB 3BZDB 2K5PA 1UBQA 1RM6C 2LD9A 3PRPB 1U6RA 2W3RA 5KHQA 1K51A 2GBNA 2WDTB 4RF6A 4MJSA 4BKTA 1C78A 1Q1OA 4PYUA 2WS3B 2LXCA 3AV8A 2KDBA 2BWFA 3A9KB 3BYYB 2JX5A 5EDSA 1WY8A 4BOZB 1CZPA 2G4DB 1SJHD 3U4EG 2K6QA 3LN6A 5HFYA 5CHFA 3HK0A 1M15A 4MGKE 1T3QA 2LVOA 2KC2A 4K7WA 4ARIA 3GE8C 2YEPF 4MELA 1AARA 3Q3MC 2MBOA 2ONQA 1SSNA 1Q10A 2PE9A 3CF6E 4ZHPA 3M10A 4CYEA 4RF9A 3VH4B 3HVZA 2KDIA 5HI1A 4TV3A 4IKGA 2XEWA
chains in the Genus database with same CATH topology
4LNIA 1HTQA 1P52A 3B6RA 3NG0A 3DRBA 1VRPA 4LNNA 3ZXVA 3DREA 4ACFA 5J9AA 3L2EB 2J1QA 2CRKA 1M15A 4BAXA 2WGSA 1RL9A 1CRKA 3FKYA 1HTOA 3ZXRA 1BG0A 4RF6A 4BG4B 4LNOA 2QC8A 4GW0A 2OJWA 4S17A 4S0RA 1P50A 4RF8A 2D3BA 1F52A 4AM1A 2D3CA 1LGRA 1F1HA 4Q2RA 4GVYA 1QK1A 5J99A 4GW2A 2BVCA 3JPZA 1FPYA 2LGSA 3L2EA 1G0WA 3L2DA 4RF7A 1I0EA 2D3AA 3M10A 4HPPA 4LNFA 4RF9A 1SD0A 3JU5A 4BHLA 1QH4A 3JQ3A 2GLSA 4BG4A 2UU7A 4XYCA 3JU6A 4Z9MA 4GVZA 2WHIA 1U6RA 4LNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LNI A;  1HTQ A;  1P52 A;  3B6R A;  3NG0 A;  3DRB A;  1VRP A;  4LNN A;  3ZXV A;  3DRE A;  4ACF A;  5J9A A;  3L2E B;  2J1Q A;  2CRK A;  1M15 A;  4BAX A;  2WGS A;  1RL9 A;  1CRK A;  3FKY A;  1HTO A;  3ZXR A;  1BG0 A;  4RF6 A;  4BG4 B;  4LNO A;  2QC8 A;  4GW0 A;  2OJW A;  4S17 A;  4S0R A;  1P50 A;  4RF8 A;  2D3B A;  1F52 A;  4AM1 A;  2D3C A;  1LGR A;  1F1H A;  4Q2R A;  4GVY A;  1QK1 A;  5J99 A;  4GW2 A;  2BVC A;  3JPZ A;  1FPY A;  2LGS A;  3L2E A;  1G0W A;  3L2D A;  4RF7 A;  1I0E A;  2D3A A;  3M10 A;  4HPP A;  4LNF A;  4RF9 A;  1SD0 A;  3JU5 A;  4BHL A;  1QH4 A;  3JQ3 A;  2GLS A;  4BG4 A;  2UU7 A;  4XYC A;  3JU6 A;  4Z9M A;  4GVZ A;  2WHI A;  1U6R A;  4LNK A; 
#chains in the Genus database with same CATH topology
 1ACC A;  3MC9 A;  4HLE A;  1SIJ A;  2LFI A;  3Q3N C;  2V1Y A;  2WNM A;  3RNC C;  3ZDT A;  1F77 A;  1KOT A;  4IM3 A;  1C76 A;  4OZB A;  2WXF A;  3A4S C;  4KIK B;  4NJ7 A;  1AN8 A;  4EFO A;  3LDZ E;  4HCN B;  2JPH A;  1KF6 B;  2HTM E;  4DHJ D;  1SGH A;  1DOI A;  2BPS A;  2BYE A;  3ZDM C;  2RPQ A;  3B6R A;  3DRB A;  1DYQ A;  1FXT B;  1X1M A;  5LXI B;  4REZ A;  3DQV A;  4AP4 C;  2J1Q A;  1N5W A;  2KLC A;  1EO6 A;  3P4S B;  3TSS A;  4ZRP A;  1H8C A;  1WX9 A;  5BYR A;  3URY A;  1UBI A;  4NNJ B;  3KWL A;  3B1L X;  1J7C A;  4FJV B;  3KUC B;  4RM8 A;  4EOY A;  4GW2 A;  2Y3A A;  2K8H A;  2IYD B;  3Q8E A;  3PZD A;  4G3X B;  1LO5 D;  2N9P C;  4DHJ B;  3CWI A;  3ML9 A;  2WWZ A;  4ZYN A;  2M0A A;  1C4P A;  3P2B A;  1UGM A;  2KQS A;  3U52 E;  1FD6 A;  3L08 A;  1WWT A;  4X57 B;  3N1Y C;  4BZA A;  3FIL B;  4RGM A;  3V61 A;  4JGH B;  3ZLZ A;  5MPO A;  1ZW7 A;  2BBC A;  1Z5S B;  4GB9 A;  4FBJ B;  4NAW B;  3UGB B;  2UU7 A;  2IPK D;  5G2N A;  4K3C A;  3PSE B;  2JYT A;  1UZX B;  2OED A;  4LNK A;  2L7R A;  4L23 A;  3MTN B;  1MJD A;  4DWF A;  3ZVV A;  2Z8L A;  5AUI A;  2KT7 A;  1C9F A;  1I0E A;  1K52 A;  2CR5 A;  4P7I A;  4WWO A;  1JW9 D;  1KH0 A;  4P1B C;  3ETR A;  2YLM A;  1J7A A;  1C4A A;  3U7Z A;  1WR6 E;  1JWA D;  3DBH B;  3ZNG C;  4I6L B;  4TQ1 A;  3NHE B;  2R61 A;  1QOG A;  1LM8 B;  4GDL A;  3CMM B;  3IXS A;  4TQ0 A;  4RNA A;  4GOC A;  2AEH A;  3C8Y A;  3P63 A;  2HDE A;  1ET9 A;  1WXV A;  2I2Y A;  4Q2J A;  3L54 A;  2N7J A;  2XBB C;  3HIZ A;  2V9H A;  5KHO A;  1JWM D;  3PGE A;  4CQN A;  2GBR A;  1ZDV A;  3NVW A;  3T9L A;  2KDF B;  1OEY J;  2L8J A;  3TEZ A;  2H88 B;  1TBE A;  1S3S G;  3VVW B;  3VFK A;  3NOB A;  1GAQ B;  3FIL A;  1VRP A;  5AZG A;  5IAA C;  2NTS A;  1JRO A;  3IG3 A;  3UI3 A;  4NAW A;  2PKO A;  3EA6 A;  1L4Z B;  3ZKJ C;  2KMC A;  2PE6 B;  5T8I A;  2MRP A;  2QEJ C;  1QZE A;  5L95 C;  1FCL A;  2PIA A;  2O2V A;  3V6C B;  4M01 A;  4ITK A;  2ZW1 A;  3X0W A;  1ZP0 B;  1L5P A;  1FO4 A;  1T5X D;  3PS6 A;  5E6N A;  3QAR A;  2SEB D;  3ZIM A;  4JLC A;  4P16 A;  2PJH A;  1IBX B;  3ABV B;  3ONS A;  4K7U A;  2KX0 A;  1GOZ A;  2K39 A;  1KLG D;  4IWQ A;  3BIN A;  3NS8 A;  3R8B A;  2RR9 A;  4JE3 B;  2L76 A;  2ZPN A;  5DPR A;  1FM0 D;  1DGJ A;  1SIF A;  3H9D A;  1OQQ A;  4A8X C;  3PLU A;  2LGY A;  1WJN A;  2BQQ A;  4KDL B;  4J6I A;  4YL8 A;  2BW2 A;  4EKU A;  3V05 A;  2M56 B;  1QKZ A;  3EFC A;  3NY5 A;  2KQ7 A;  1IPG A;  2KO3 A;  4ZYS A;  2G3Q B;  1WGY A;  2K9X A;  1BXT A;  4MT5 A;  1XD3 B;  3KYC D;  3HM3 A;  2LRU A;  1WGG A;  1EF1 A;  4QAY A;  4RF7 A;  2MLB A;  2Y5C A;  4ASW C;  1JAL A;  2JT4 B;  3M62 B;  2KNB A;  3GE3 C;  3R2T A;  5DPW A;  2DLB A;  1UH6 A;  2W9N A;  1E8Y A;  1WSP A;  4DQO C;  2GWD A;  2GB1 A;  4WQM A;  1YMH E;  2IY1 B;  3MC0 B;  2PW9 A;  2D11 A;  1DOY A;  2ZCB A;  3ENE A;  4NAM A;  2J0M A;  1EM7 A;  3DHI C;  1SE4 A;  3B9J A;  2LJI A;  4RF8 A;  4A9A A;  5G55 A;  3FC4 A;  1ISN A;  4KX6 B;  4BHL A;  3JQ3 A;  3VR9 B;  3Q2A C;  1VJK A;  4KSL C;  4KGR A;  3QX1 A;  2MHJ A;  1MPE A;  2G4S A;  1A5R A;  3AE8 B;  2LJ5 A;  3Q8A A;  4XX5 A;  2WQY B;  4LTU A;  1YJI A;  1WH3 A;  2VH2 A;  1IBX A;  2JQR B;  3L13 A;  1XLO A;  4YWG G;  2LZ6 A;  4PS8 A;  3APF A;  1KTK A;  2NBV B;  1RYJ A;  1PYW D;  3UQA A;  2MH7 A;  4D2K A;  1FNU A;  2LUM A;  2FCM A;  2JWU A;  4E71 A;  1V1O A;  4US8 A;  4GDK B;  1T0S C;  3RZF A;  1SF0 A;  1T6B X;  1RLF A;  3PZ7 A;  3DWM A;  3HRD D;  3KUZ A;  3S2A A;  4J3O D;  3AEA B;  1YX6 B;  4EUT A;  4KKI A;  2BWE S;  3Q3J A;  2ACZ B;  4LCD E;  2PLP A;  3I5J C;  1WI0 A;  3U8Z A;  4AJY B;  3IVF A;  2JZP A;  2V3P A;  2QMT A;  1VZ7 A;  1HXY D;  1N62 A;  2NS5 A;  3A9J B;  4G50 A;  1NBF C;  3JVZ X;  4IWO A;  3R2I A;  4HJK A;  2FIF A;  3MFG A;  2NBW B;  2BS3 B;  5IKC M;  2BYF A;  1ROE A;  5C3J B;  1A70 A;  4W9F A;  1WF9 A;  5LNK 1;  2DYO A;  4AJW A;  2W82 A;  4W9I A;  4II3 B;  1TS4 A;  4B9K A;  5JXV A;  1D6E C;  4HXD A;  2I1K A;  1FXA A;  3ZJV A;  2J53 A;  2B3A A;  2GI9 A;  4ICV A;  1YNT E;  4DDI D;  3NUH B;  3IBE A;  2G9H D;  2L05 A;  1J0G A;  4A6Q A;  1TZ1 A;  2N0S B;  2JU6 X;  3N1Z C;  3NS1 A;  4NY0 A;  1C1Y B;  3BY4 B;  2HJ1 A;  4YSY B;  2EEL A;  1SE3 A;  1L2N A;  5FR6 A;  2ZVN A;  3W1S C;  1SJE D;  2C7M B;  4GVY A;  3AEB B;  2D3A A;  4E74 A;  2DX5 B;  2KFJ A;  4C7Z A;  1SXT A;  2KDE B;  3AEF B;  2KJH B;  3E56 A;  3L16 A;  5TSS A;  2BKR B;  1V49 A;  5E6O A;  3NZ3 A;  2QCZ A;  3HHM A;  3UQB A;  3V3X A;  2DNF A;  3H8H A;  3I9V 1;  1SE9 A;  1HA5 A;  4FAD A;  4DXA B;  4LJP B;  2EMT A;  1XF5 L;  2K8C A;  2AYO B;  3H7S A;  2KWU B;  1GJZ A;  4NJC A;  3ZTD A;  1SD0 A;  3CIR B;  2V4I B;  1P9D U;  1NEN B;  2GBK A;  2JWZ A;  2SAK A;  3O65 B;  1WR1 A;  3A33 B;  1GNU A;  5IP4 D;  3DVN U;  1J8C A;  1FNV A;  2K8B A;  2V4L A;  2BGF A;  2MEK A;  2IZV B;  4S0R A;  2RDB C;  3EGR A;  1E8Z A;  2N1V A;  2JXX A;  1NEK B;  5IO9 A;  3ZUN A;  4XYC A;  4OZC A;  5FR3 A;  4Q2R A;  1V5T A;  2K3U A;  2WDQ B;  5C2T B;  4M0W B;  4ZRK A;  1GC6 A;  1TGZ B;  3GZN I;  1E7U A;  2MJ3 A;  3N32 A;  2WP9 B;  3AED B;  3BWU D;  3AI5 A;  1TKY A;  2C7N B;  2WU2 B;  5BYQ A;  1UGJ A;  4TKN A;  2RSU A;  2MSE D;  3B08 A;  3N9Y C;  3VRA B;  2K22 A;  5J9A A;  4WH4 A;  1K53 A;  1FNW A;  4HKQ A;  4C00 A;  3I3T B;  4HCP B;  4KDI C;  2QIE B;  3AE3 B;  5CHW A;  1D5X C;  3SR6 A;  1ZE3 D;  4NQL B;  1RFA A;  4RGN A;  3R3M A;  2ZW0 A;  2DZK A;  5EE1 A;  4XC2 A;  5BMI A;  3MP9 A;  4B0E A;  1ZPS A;  1YJ1 A;  2NR2 A;  1BML C;  4HDQ A;  2N9K A;  3ZXV A;  1JWS D;  1I42 A;  2WX0 A;  3FKY A;  4BKS D;  3Q8B A;  4ZRQ A;  1FRD A;  2WXM A;  3ZNZ B;  1LGR A;  2IGG A;  4GLS C;  3PRZ A;  1YJJ A;  1Z2M A;  3ZJU A;  1H4R A;  4LNF A;  2ASQ A;  2BB5 A;  4EZK A;  3WIM A;  3AEC B;  3T8M A;  3BVM A;  4M8M A;  5JHB A;  5IN7 A;  4DBG A;  3TBL D;  1P7F A;  1E7P B;  5AZH A;  4B95 A;  2L00 B;  1TY2 A;  3AUL A;  1VZ6 A;  5C1Z A;  4A20 A;  3AM9 A;  1S1Q B;  1WFY A;  3WCQ A;  4HJG E;  2M0X A;  3QHT A;  4PYZ A;  4M8N A;  3PHW B;  3PTF C;  2KTR B;  1V97 A;  4RF0 A;  1XLP A;  2KFK B;  2CS4 A;  3X23 A;  2CRK A;  5BMG A;  3OG5 A;  3ZXR A;  3OWE B;  2MBQ A;  3P4Q B;  1EWC A;  5G5G A;  1K8R B;  5J18 A;  2DYB A;  4PS3 A;  1ZDX A;  4O1N A;  1MFW A;  1PGB A;  1JRP A;  2D07 B;  2LVQ A;  2KVZ A;  1FPY A;  2KAJ A;  3L2E A;  4IG7 B;  4KKJ A;  3NJT A;  1T0Q C;  4DXG A;  4YSX B;  2FCQ A;  1EUV B;  1P3Q U;  2KX3 A;  4M00 A;  1L6V A;  1HTQ A;  3NG0 A;  2BTE A;  2WXJ A;  4N6E B;  2IO1 B;  3N30 A;  3QIJ A;  3Q3O C;  2XK5 B;  3BYT B;  2NPT B;  1NYR A;  5CTR C;  3TCA A;  4URK A;  2BKF A;  2RMM A;  3VDZ A;  1ENF A;  2G45 B;  2AQ3 B;  3QC8 B;  2GBJ A;  4RMA A;  3T3N A;  3A9K A;  2N9L A;  2ZEQ A;  3ALB A;  4WAF A;  2X8X X;  3W2D A;  2J42 A;  2J0K A;  2WXQ A;  2BF8 B;  4NJ6 A;  1XXG A;  2KMA A;  2KD0 A;  3IAS 1;  3ZRF A;  3RNA C;  4ZHO A;  1R8G A;  3L2D A;  5EE0 A;  1OEY A;  1VR9 A;  3DBH I;  4W9C A;  3HVD A;  4IC7 B;  2E3T A;  2MBE A;  1E90 A;  1WRI A;  2N9X A;  3MJW A;  1WZ0 A;  2IJ0 A;  4ANW A;  2PVG C;  2AQ1 B;  2CHX A;  3V6E B;  4W9G A;  4GIV A;  2MW5 A;  1N60 A;  2INC C;  1JML A;  5H92 C;  2A5U A;  1FFU A;  1C79 A;  4KIK A;  3D32 A;  1V5O A;  1L6U A;  2Q5W D;  2ICI A;  3NVV A;  3Q69 A;  3UIO B;  3ZGZ A;  2HJ8 A;  4A55 A;  2MP2 B;  4WJN A;  2D5G A;  1NDD A;  2QJL A;  4G11 A;  4WUR A;  3LB8 C;  3VRB B;  4HDO A;  4P1C C;  3AU5 A;  3P4R B;  1WYW B;  2LHE A;  3PO0 A;  2LEK A;  3APD A;  3U2S C;  2AL6 A;  4FLH A;  4DK5 A;  2IND C;  3VR8 B;  4BAX A;  3APC A;  3QAQ A;  3TEW A;  1R4N B;  5D3D A;  2I38 A;  2MJD A;  2RD0 A;  2CU1 A;  4LLG M;  1AW7 A;  4YTM B;  4YTN B;  1FMA D;  3IT6 B;  3MJ5 A;  2L3Z A;  4MDK E;  4BBN F;  4MGY E;  3VXW A;  2M4N A;  1PGX A;  1TT5 B;  1GC7 A;  3L17 A;  2KMM A;  2N1W A;  3GS2 A;  3W9C B;  3LJ3 A;  1V2Y A;  2WXP A;  4I6N B;  4KZ0 A;  4LNO A;  5TR5 A;  5D2M B;  2EMS A;  2N7E A;  1WXA A;  4JQW C;  4B6W A;  3QA8 A;  3NRZ A;  1MHH E;  3DBS A;  2J0J A;  4K1R B;  1RAX A;  3N1X C;  4XDD A;  2DEN B;  2M17 A;  2BS2 B;  3HUI A;  2CHW A;  4YXD B;  3TEX A;  1F52 A;  2QHO A;  3RNG C;  4B0M A;  3ZJT A;  4F7Z A;  3T3O A;  1UD7 A;  3Q3F A;  4HWI B;  2VZK D;  2N9E B;  2B76 B;  2FAZ A;  4IUM B;  5D6J B;  3VTV A;  1V1P B;  1OGW A;  1VLB A;  2M1M A;  4PT5 A;  1FEH A;  1TYG B;  1E10 A;  5CHV C;  2KN5 A;  3IG8 A;  3Q14 C;  2L0F A;  4W9D A;  2K25 A;  1UNS A;  2R2Q A;  3QCA A;  2LHD A;  2CU3 A;  2KDM A;  3JU5 A;  2GLS A;  1WYG A;  2AX5 A;  3H6N A;  3DCG A;  3OJ4 B;  4WIP A;  2JZZ A;  3RUI B;  2WYQ A;  2VZK B;  4W9L A;  2BYV E;  4N9F 4;  2KJ6 A;  1JCK B;  1LXD A;  1EWY C;  2LXA A;  4MEM A;  4OZA A;  3UF8 A;  2D33 A;  4I6P A;  5DPS A;  3RMK C;  2IY0 B;  1OTR B;  1WM3 A;  4YTP B;  3I63 C;  3P42 A;  1Q0W B;  3IT4 B;  1TKE A;  1QF6 A;  2KN4 A;  3B0A A;  3KYD D;  2Z0D B;  4BG4 B;  5E6P A;  4ANV A;  3EUB 2;  5GMV A;  1FCC C;  2IO0 B;  2LGX A;  5H8Y E;  3JW0 X;  1PUT A;  1V9J A;  4HRS A;  4ZDV A;  1BT0 A;  3CST A;  5BYS A;  3AE7 B;  3TUO A;  3GOE A;  3N3K B;  2GBM A;  1I35 A;  1WJ4 A;  4USA A;  2A4Z A;  1D3Z A;  1F2R C;  2KZR A;  3MHZ A;  2JRH A;  5AUK A;  2KWD A;  3DVN V;  1I4G A;  1SE2 A;  1SEB D;  5L83 A;  2OJW A;  3QK0 A;  4RGO S;  3AH7 A;  2WDV B;  4A3P A;  3Q8C A;  2PVO D;  3AE5 B;  1NVI D;  2OHF A;  3J9C A;  5C23 A;  2DHZ A;  3WAP A;  1CQV A;  2FCN A;  4IDI A;  5IA7 A;  1T0R C;  3PT2 B;  4EE2 A;  1QLB B;  1CMX B;  2QSD A;  3RT3 B;  1E5W A;  4HVB A;  3DHG C;  2L0T A;  2FUH B;  1WX8 A;  5JZE B;  3ZYY X;  4WWP A;  2JY6 A;  4XDC A;  3N20 C;  2K6D B;  3M63 B;  4LNI A;  1MHX A;  1WE6 A;  4GSW A;  1ESF A;  3SD5 A;  2KAC A;  1V6E A;  4W9E A;  3AXC A;  1L0X B;  2C5L C;  2GWC A;  1N61 A;  2NTT A;  1P50 A;  2RPV A;  3K9O B;  1STE A;  3NVY A;  2L32 A;  4PK1 A;  2OJR A;  3Q6B A;  4KGT A;  4WJQ A;  4XWT A;  3VTW A;  2MJE A;  1P52 A;  4LDT B;  3DBR I;  4GGQ A;  1G6J A;  1J7B A;  2EKE C;  1IGD A;  4JX1 C;  3WA0 A;  4GW0 A;  2GOW A;  3RUL A;  1D4B A;  3AN1 A;  3IHP C;  2W55 A;  2WXR A;  4GDK A;  4HPP A;  3JSV B;  3ECI A;  4NZL B;  2J7Q B;  1L0V B;  3RPF C;  4JPS A;  5D7G A;  3PV1 A;  2DWQ A;  2LGD A;  1F2R I;  1I4P A;  4RGT A;  5HG2 A;  1MG8 A;  1RFK A;  1HZ5 A;  2INN E;  3EHV A;  1L0Y B;  1I4H A;  2V0G A;  1RRB A;  2KWC A;  3A9J A;  3C19 A;  3DBR B;  1ZKH A;  4AWJ A;  1G0W A;  1TIF A;  1WM2 A;  2DYM A;  4ZRI A;  3EEC A;  1HE8 A;  3OJ3 A;  5J17 A;  4FJZ A;  2AWT A;  1E8W A;  1CK1 A;  2ON8 A;  2R2O A;  3DBL B;  2PMV A;  1XCQ L;  3PRE A;  1V4G A;  3RFZ B;  3VH3 B;  1XT9 B;  1YD8 U;  1QK1 A;  5EE3 A;  1BUI C;  1YOV B;  4HPL B;  4LNN A;  1I4X A;  2CJO A;  2V3S A;  5G5H A;  3PHX B;  3W1Y A;  4W9J A;  2C9W B;  5HHD G;  5BO4 B;  2M19 A;  2X38 A;  3OAW A;  4C80 A;  1YIW A;  5I4D A;  3LYY A;  3DWG C;  2K1F A;  3QQ8 B;  2JXT A;  4FJY A;  3VUW A;  3QWZ B;  3M3J A;  1WXS A;  3LN7 A;  1MVK A;  1EU3 A;  2PEA A;  1OQR A;  4KGS A;  4WWN A;  3M95 A;  2IGH A;  3WAL A;  1BG0 A;  1VCB A;  3JSV A;  1FFV A;  1NI3 A;  2Y5B B;  2J4X A;  2Y5P A;  1JQ4 A;  1QOB A;  2N7D A;  3ZQ4 A;  2D3C A;  4HRO A;  3LVV A;  4RM9 A;  4RH6 A;  5FKA C;  3VHT C;  2KQ4 X;  1TZO A;  3KLS X;  2UWQ A;  3V62 A;  2E6X A;  2DAF A;  1QOF A;  1EU4 A;  1CRK A;  2KK8 A;  2HTH A;  1N5X A;  4L2Y A;  4EZL A;  1Y8R C;  1ZXH A;  1F1H A;  4GMV A;  1R7S A;  3B2G A;  2D32 A;  3VUY A;  5D94 A;  3HM6 X;  3IG5 A;  2IO2 B;  2ZZP B;  2KVR A;  4MAC A;  1C3T A;  1VDV A;  3V60 A;  4FA6 A;  2PTL A;  1R4M B;  2XNA C;  4BOS C;  1ZOY B;  2HD5 B;  2NVU I;  2IGD A;  4M0W A;  1QIL A;  1ZXI A;  1WGR A;  3SEB A;  1WE7 A;  1DOX A;  4ZRJ A;  1P0R A;  3W5U B;  1XQQ A;  4EEW A;  1YQ4 B;  3VUX A;  1YN4 A;  3RI7 C;  1PFD A;  1JWU D;  1UUP A;  4TSS A;  4LK0 M;  4HEA 1;  1TKG A;  3VQI A;  1XLQ A;  4KV2 A;  4MM3 B;  5JH5 C;  4US9 A;  4OHJ A;  2DBY A;  4F1S A;  1IGC A;  2JRI B;  2WXH A;  4F8C B;  2EKI A;  1WXM A;  3AE9 B;  3AE4 B;  4RFB A;  1QH4 A;  5FK9 C;  4GVZ A;  2CHZ A;  1WX7 A;  4MSM B;  1GB4 A;  2ZPY A;  4WWM A;  3TL5 A;  1F0Z A;  1B1Z A;  2GMI C;  3AMZ A;  4OVZ A;  4RF1 A;  3TEY A;  1E6E B;  1PGA A;  4R3D A;  1OQY A;  3RD2 A;  3GP7 A;  4GU2 A;  2GRI A;  2LGS A;  1L7Y A;  4BFR A;  2VRR B;  4HKZ E;  2KXJ A;  4AUQ C;  2INP E;  2M8S A;  1CJE A;  4GDL B;  4AOF A;  4KSK C;  2H89 B;  4JWU C;  4ANU A;  4MSQ B;  2CKH B;  3Q8F A;  1PDX A;  1KLV A;  1E0Z A;  3W1S A;  1AYF A;  3RCZ A;  1P7E A;  3AE1 B;  2LAS A;  4ZOH C;  2WXL A;  4W9K A;  1I4R A;  2LGI A;  2FNJ B;  4BKS A;  2FUG 1;  5DCN A;  2W54 A;  2WGS A;  1ZUD 2;  2YVC A;  3C0R B;  2L83 A;  2ZNV C;  2DZI A;  4YSZ B;  4OVU A;  2KTR A;  2QIL A;  3NZU A;  2KFK A;  1NYQ A;  1L4D B;  5AZF A;  3SFE B;  2REX A;  1R4N I;  4MM3 A;  3ZRC A;  2O2V B;  2NCN A;  2K0P A;  1YQB A;  1E7V A;  2YEP B;  1MG4 A;  3GB1 A;  3H7P B;  3U7D A;  2BT6 A;  1TS3 A;  2LVP A;  1XCT L;  2WXK A;  1WRD B;  5BMH A;  2KOX A;  3ML8 A;  1WZ3 A;  4TMA B;  4KZC A;  2LI5 A;  2XK5 A;  1V8C A;  4PS7 A;  2NPT A;  3AU4 A;  2DZM A;  2JUO A;  3A1Q B;  4BBN C;  3LXF A;  4C4V B;  2UYZ B;  4CHK A;  1PQS A;  4FUL A;  2MQJ A;  1UWM A;  4IWP A;  3RNF C;  1UEL A;  5E6J A;  5LXH A;  2WXN A;  3EFU A;  1T0Y A;  4P6V F;  1OFF A;  4ARC A;  3L0W B;  2Z59 B;  1KM7 A;  2OOB B;  3DOW A;  2NMQ A;  1HTO A;  3LVW A;  3AEG B;  1LQB A;  1QQR A;  4WJO A;  2J52 A;  5AEK B;  3P1M A;  4A3O A;  4K7S A;  2MWS B;  3SU8 X;  3RNE C;  3RNB C;  4HK2 A;  2JSV X;  1HZ6 A;  4YT0 B;  3W5V B;  3MC8 A;  3A4R A;  1JRU A;  1IUE A;  3AEE B;  3TJP A;  2XN9 C;  2IBI B;  3H1U A;  2W3S A;  4TUU A;  1SBB B;  2WXG A;  4W9H A;  3VTU A;  2NBU A;  2KJR A;  1GUA B;  2D10 A;  2WU5 B;  4M02 A;  2AQ2 B;  4DHZ E;  1TJE A;  3NZT A;  3H7P A;  4XWW A;  2L52 A;  2KWV B;  3KVF B;  2MP2 A;  2KYW A;  2RDH A;  4AM1 A;  4FHK A;  3RN9 C;  4IOI E;  3O13 A;  4XGA B;  1RWS A;  2ZVO A;  2O6V D;  3BII D;  4MGZ E;  3R7R A;  1GG3 A;  2DAJ A;  3A1Q A;  2G1E A;  4C4V A;  3JPZ A;  1QT9 A;  4WAA A;  4OW0 A;  1C4C A;  4NQK E;  3KW5 B;  4G0N B;  2ZNV B;  4IM2 A;  4KVG B;  3WAN A;  1TTN A;  2IDY A;  3KUD B;  5D3I B;  1N6Z A;  5JHA A;  3WAM A;  2WLB A;  1LFD A;  4K81 A;  2O6V B;  1VRA B;  3RZW C;  1F9J A;  3BK2 A;  2DZJ A;  4JIO U;  4ICU A;  3JU6 A;  2MBB B;  1XEE A;  3BVG A;  1B9R A;  1TT4 A;  3DPD A;  1WJ6 A;  3PPA A;  4H2A A;  1VD2 A;  1JWB D;  1XLN A;  2D3B A;  4IW0 A;  3PZ8 A;  4XZ4 A;  1V80 A;  2KLG A;  3TIX A;  4C56 C;  3KH0 A;  2WXO A;  2PPH A;  1FIQ A;  1XO3 A;  1EF5 A;  2WHI A;  1KRH A;  4LJO B;  1I4Q A;  3MHS D;  3WAO A;  1RL9 A;  4JWS C;  4OVV A;  1UF0 A;  2C60 A;  4BVU C;  2JF5 A;  2QC8 A;  1Q5W B;  4FHJ A;  4E3C A;  1V1P A;  3ZNI D;  2FBW B;  4FN2 A;  2JZ3 B;  4DXF A;  5J99 A;  1M4V A;  2KC1 A;  3CSF A;  2N4F A;  3DHH C;  1YX5 B;  3ZTC A;  4S17 A;  4NPN A;  5J2R A;  3FAH A;  2I1J A;  3UIN B;  3IAM 1;  4LDT D;  3E9S A;  4GXB A;  1ZGU B;  5DPT A;  2RDG A;  1AWD A;  3DVG X;  2BB6 A;  3DRE A;  2O6V A;  4ACF A;  1WJU A;  2KTF A;  4FXC A;  3SHQ A;  1V81 A;  2AL3 A;  2QDF A;  1WMH B;  2WXI A;  1YN5 A;  3OLM D;  1YQ3 B;  3RYT A;  1E9M A;  4ANX A;  2WX1 A;  3NZS A;  4BG4 A;  4XE0 A;  3AE6 B;  5CX3 A;  1FXI A;  2VH1 A;  1NI2 A;  1WIA A;  5IOI A;  4N58 A;  3B2F A;  1SB3 C;  1WGD A;  4MH8 A;  4L1B A;  3PLV A;  2FID A;  3QJZ A;  3SDL C;  4A90 A;  3DBL I;  4C7Y A;  3R7Q A;  1TS5 A;  4WQO B;  3AB5 A;  1WXQ A;  1C77 A;  4K3B A;  1KJT A;  4HPM B;  3P4P B;  2WDR B;  3I57 A;  2IO3 B;  2BS4 B;  3BVZ A;  1P98 A;  1N63 A;  1WGH A;  2FCS A;  3ZNH B;  4BKG A;  1K50 A;  2KAN A;  1GB1 A;  1HEZ E;  2MA9 B;  3AE2 B;  3U30 A;  2LRW A;  1GPX A;  1MI0 A;  2JYE A;  3EC8 A;  3SFD B;  4EZJ A;  4WJP A;  2TSS A;  2LWP A;  2MBH A;  1HQR D;  1KFY B;  2JVC A;  5LLI A;  1J19 A;  3KWV A;  2KHW B;  2L1A A;  4N59 A;  1I7H A;  2C7H A;  2FE8 A;  4UDU C;  1TS2 A;  3IFW B;  4II2 B;  3BK1 A;  4MJS B;  5EE9 A;  2MCN B;  1WMH A;  3DVG Y;  4Z9M A;  3ZW3 A;  4AS1 A;  2RGF A;  1U4A A;  3K9P B;  4CO7 A;  1D5Z C;  2CJN A;  3DDC B;  2LUE A;  5GXG B;  1UWX A;  3TMP B;  1P1A A;  2D3G A;  2LMC A;  3JYU A;  4MH0 E;  1IYF A;  3NVZ A;  4DDG D;  3VAW A;  1M94 A;  1IP9 A;  2Z0E B;  1E8X A;  3PRM B;  3UIP B;  1TY0 A;  4JL9 A;  1Y56 A;  2KKC A;  1WGK A;  4MGI E;  2MX2 A;  1QOA A;  1YN3 A;  3R66 C;  4IM0 A;  2D2Q A;  3L4P A;  3L10 B;  1R4M I;  3PVL A;  2HE7 A;  1VZ8 A;  3ZO5 B;  1V86 A;  4DHZ B;  4GN1 A;  1KLU D;  3L2E B;  1D5M C;  3KQ4 A;  1FRR A;  2ZCC A;  2ZJD A;  1VA6 A;  2BYT A;  5HKH A;  1ET6 A;  4RCO A;  4AQ7 A;  2V3N A;  2BVC A;  3GZN B;  3BZD B;  2K5P A;  1UBQ A;  1RM6 C;  2LD9 A;  3PRP B;  1U6R A;  2W3R A;  5KHQ A;  1K51 A;  2GBN A;  2WDT B;  4RF6 A;  4MJS A;  4BKT A;  1C78 A;  1Q1O A;  4PYU A;  2WS3 B;  2LXC A;  3AV8 A;  2KDB A;  2BWF A;  3A9K B;  3BYY B;  2JX5 A;  5EDS A;  1WY8 A;  4BOZ B;  1CZP A;  2G4D B;  1SJH D;  3U4E G;  2K6Q A;  3LN6 A;  5HFY A;  5CHF A;  3HK0 A;  1M15 A;  4MGK E;  1T3Q A;  2LVO A;  2KC2 A;  4K7W A;  4ARI A;  3GE8 C;  2YEP F;  4MEL A;  1AAR A;  3Q3M C;  2MBO A;  2ONQ A;  1SSN A;  1Q10 A;  2PE9 A;  3CF6 E;  4ZHP A;  3M10 A;  4CYE A;  4RF9 A;  3VH4 B;  3HVZ A;  2KDI A;  5HI1 A;  4TV3 A;  4IKG A;  2XEW A; 
#chains in the Genus database with same CATH homology
 4LNI A;  1HTQ A;  1P52 A;  3B6R A;  3NG0 A;  3DRB A;  1VRP A;  4LNN A;  3ZXV A;  3DRE A;  4ACF A;  5J9A A;  3L2E B;  2J1Q A;  2CRK A;  1M15 A;  4BAX A;  2WGS A;  1RL9 A;  1CRK A;  3FKY A;  1HTO A;  3ZXR A;  1BG0 A;  4RF6 A;  4BG4 B;  4LNO A;  2QC8 A;  4GW0 A;  2OJW A;  4S17 A;  4S0R A;  1P50 A;  4RF8 A;  2D3B A;  1F52 A;  4AM1 A;  2D3C A;  1LGR A;  1F1H A;  4Q2R A;  4GVY A;  1QK1 A;  5J99 A;  4GW2 A;  2BVC A;  3JPZ A;  1FPY A;  2LGS A;  3L2E A;  1G0W A;  3L2D A;  4RF7 A;  1I0E A;  2D3A A;  3M10 A;  4HPP A;  4LNF A;  4RF9 A;  1SD0 A;  3JU5 A;  4BHL A;  1QH4 A;  3JQ3 A;  2GLS A;  4BG4 A;  2UU7 A;  4XYC A;  3JU6 A;  4Z9M A;  4GVZ A;  2WHI A;  1U6R A;  4LNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...