4ACKA

3d structure of dotu from francisella novicida
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
155
structure length
152
Chain Sequence
MKDFKEIEIILDIIKTTREIIENDNEKISYHRNNIRKSIFFLQEELLEKYSETVCKYIVFPLLAYVDEKLMLLREKSASNISWSLLQLEYYDRKDGGEYVFEITDNILSENIYPQICYQTISLILHNDFYGKYYDNIYNHSFLAYKKEIDKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Conserved Type Six Secretion Protein Tssl (Dotu) from Francisella Novicida
pubmed doi rcsb
source organism Francisella novicida
molecule tags Protein transport
molecule keywords TSSL
total genus 59
structure length 152
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.590 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ackA00
4V3IA 3U66A 4ACLA 4ACKA
chains in the Genus database with same CATH superfamily
4ILGA 1TNYA 4FC8A 5HI7A 5G04C 3QB2A 3L82A 1N4QA 3PE3A 5EYPF 2AJAA 3HDXA 3L9TA 3NBNB 1U3CA 4EECA 4JEHA 1EF1C 3B7TA 2VSYA 1O5MA 5B3SE 2OEWA 5KJNA 4ANXA 4GTVA 2KCKA 3PE4A 1HG5A 5ITZF 4XX5A 1V55E 3EHMA 1HO8A 1N54A 2J9QA 2P9KG 1SZ9A 1FPPA 4M3OA 4LG6A 2CG2A 2DWZA 4FJYA 3ZXSA 5B1AE 4J8YA 2I9CA 1X5BA 3SHFA 4HBDA 1H6PA 2I6HA 4QFVA 3TWXA 3I5PA 2R02A 5C1DA 4GTOA 2P2CP 3NB2A 4YVOA 3LXUX 2R2LA 1MZCA 4G24A 4O1PA 2A4ZA 3TWQA 2WXRA 4TUMA 1TNZA 2Y1LE 4F3VA 4AOFA 2HYZA 2ZXWE 2VTBA 2FO7A 4HOTA 3FUHA 4DX1A 2DYRE 4N39A 3EHNA 3FUMA 3KD7A 2X3MA 1HX8A 2F37A 3DXKG 3NZSA 4J8DA 3OTNA 2WXHA 2OVBA 3UM0A 3JXIA 1O1SA 5CEDB 3LS8A 4XE0A 5T4YA 2GRQB 2LUHA 3QJZA 3GZ1A 3Q5MA 2VGEA 2KCVA 2WXMA 2XZTG 4G8KA 1EPUA 4GTSA 3DXMG 1UJJA 1ZBPA 3GZSA 2GW1A 4GPKA 4B0ZA 3PZDA 3SY2A 4LEUA 5ANLA 3BEEA 3T8KA 2EINE 1LTXA 2CHWA 4JC8A 5JHAA 3P1UA 5AN8A 3AG3E 5FZSA 4M7CA 3NQPA 4HXIA 4K0RA 3UM2A 4LRZA 2B6CA 2X6IA 3IHVA 2C0MA 4JVSA 2ILRA 4CZ2D 2EIJE 3CKBA 3CVQA 1NFIE 2VTBB 4JA7A 3ZYMA 3CVLA 3EUVA 3QWWA 3N71A 3VTXA 2RKKA 3ZEFA 1U2VG 1UJKA 5EX0A 3MKQB 4CYMD 3UT4A 2IO2C 4JD2G 3PS6A 2V0PA 1UW4B 1DCEA 3OXFA 2BKKB 1VDYA 3CSTA 3PEUB 4UQYA 1PC2A 2FULA 3ASNE 4AXHA 4DPRA 4JPSA 3ZIMA 5M72A 4AEZC 3ZYQA 3CSFA 1TR4A 2ETCA 3LYAA 4ZHBA 4UWKA 2H6IA 5AQBA 3IHYA 2WXKA 4DI3A 4AJWA 3HXFA 3S7BA 1XNFA 3FEXA 3LKUA 3MZLB 5ARFA 5JMND 3RO2A 4KXKB 4AVXA 4N2SA 3BU8A 1UN8A 3R7RA 5BV1A 3O4ZA 4APFA 4OVVA 2YNQA 2L6JA 2AXVA 1Z3YA 3FFLA 3QOUA 3C3QA 4Y6WA 5HKPA 3FH5A 3G2UA 3QK0A 5E75A 1BPOA 1O1RA 3AU5A 3ONLA 5FWQA 1N9AA 2F8XK 3JCKC 1KT0A 2CFZA 2XS1A 1N0RA 2QY7A 2WXNA 2XCBA 1KT1A 3HRAA 3TAXA 4FHKA 4UI9J 4LSZE 4CDNA 4J8EA 3C98A 4FP7A 5ENQD 1HS6A 3TWRA 2RD0A 3TWTA 4BFRA 1A5EA 3PUJA 2BTDA 2VQ2A 1YCSB 2YQ8A 4A1GA 1WAO1 3URZA 4EZKA 3CHOA 3MCXA 3DSWA 3RU0A 3CEQA 3HHMA 3PZ3A 4UQZA 4F53A 5BPPA 3FU5A 3FDHA 4FLBA 2F8YA 1Z3XA 3DPDA 3NOCD 4GA0A 3FTZA 2Y3AA 3UM3A 4L7TA 5JA4D 3QWVA 3ZN3A 1X81A 2NYJA 2Q7FA 1NA3A 3TJPA 2F0YA 4FA6A 3ZUVB 5AQAA 4EBAG 3ZXPA 4GA2A 3SFZA 4U95D 3JQ0A 5IY5E 3ASFA 4U63A 5D0OD 3RRUA 4UI9K 4I6GA 5A23A 4E6HA 4U8VD 4BX9A 4I9EA 3W9GA 2L9BA 2PM7A 3TWVA 4CRWA 3ZNGA 3AS5A 4PS3A 4ACKA 5G05J 4N2QA 2NSZA 5EIBE 4IYPA 5DIZA 3ZGQA 3D9LA 2KXPC 3S7DA 5A7DB 2MHKA 3CHQA 1RZ4A 1HFAA 3UXGA 5FQ6A 2KZTB 4CDRA 4OVUA 2LSVA 3PZ4A 5CBOA 4WNFA 3E30A 2HO1A 3B7UX 4F1SA 4TUUA 3NZUA 4HB5A 4WWNA 5AJLA 1AWCB 3DEOA 3MX3A 3FTUA 2AXZA 5ARGA 3IXEA 3WG7E 2CG3A 3U66A 4L1BA 3EU5A 4NQ0A 2MRIA 4GTRA 4CGWA 3I3NA 3FUKA 3BG0B 5CBNA 3ASHA 4LCTA 1MQSA 3SNXA 2VSNA 1GW6A 4CT0A 4B8CB 4DX6D 5JJTA 1OWMA 1YMPA 4MKTA 3MV2B 1NA0A 2IQCA 4K5BA 4U96D 4RVBA 3G2TA 4I17A 3DSVA 1E8YA 4UWLA 2V4HC 1TJFA 4Q94A 4GTQA 3APCA 2PQRA 1HG2A 3AS8A 2V4LA 3AU4A 4GYOA 1AP7A 4XEIG 5CERB 2IF4A 3ESLA 4ILHB 2XHEA 5KWDA 2DZNA 1D8EA 3IV0A 2OOEA 2DIWA 1OCCE 1K1BA 4CCAA 3ZYLA 1SZAA 2J09A 5EYLA 5J90A 1BLXB 5BV0A 4AM9A 4WWOA 4DX5D 2WVIA 1B89A 5CMYA 3AJIA 3QWPA 4KMOA 3KEZA 1NZNA 4HOSA 3OXGA 3TG4A 2XPYA 3ULEG 1BD8A 1E8XA 2EQXA 3MYVA 4J7WA 2J07A 1P5QA 4DUIA 2PM6A 4DJAA 4BT9A 2QYJA 3U9WA 1D8DA 1E8ZA 4G2VA 1IHGA 2DCPA 3LPZA 4BTAA 2IO3C 4HVBA 3FH7A 4U0SA 1TEZA 3MGBA 3L54A 5FQ4A 4LNGA 2GROB 3QDNA 4KT6B 4I1OB 1SA4A 2P9PG 2Y69E 3UIPC 2KM4A 3B7SA 4V3IA 2PZIA 1ELWA 2E0IA 4UQXA 5BT1A 1MX2A 4EBAA 4K03A 4GZDA 3TWSA 1EDUA 2KBXA 3FH8A 4J0UA 3ONKA 1OCRE 4XIFA 1S64A 2XPZA 3I4GA 3SF4A 4U04A 4A63B 1EYHA 1FCHA 4UWGA 4C0MA 2BUGA 3UKRG 1QBQA 2WXQA 3FULA 4A3TA 5LFAA 5FTPA 3SFYA 5BUZA 3HXBA 4JHJA 5CMWA 2KATA 2AXUA 2ZIRA 3PVLA 1E8WA 2IFUA 3NF1A 2DZOA 1KZPA 3ZKJA 3E34A 3JUEA 3I4RB 1OCZE 4D10C 2ZGGA 3FY4A 2NC9A 4WWPA 2L0TB 2VSXE 3DSUA 3CHMA 3MKRA 1S63A 4PH4B 3MKQA 4PS7A 2J49A 1XGWA 3CLJA 1JCRA 3OAWA 3T5VA 3RJVA 3VLFA 5ANRA 3JYSA 3RRNB 2C0LA 2XPIA 2XGMA 4UWFA 1V54E 3FTVA 3TXNA 1JCSA 1N95A 1QQEA 2UWJG 4F1PA 2M63A 2GRRB 3VTYA 1WY6A 4C9BB 3PRZA 4HORA 1TNOA 5BW8C 4MBGA 3AG1E 1PAQA 3DSSA 3VLEA 3LEWA 2VGXB 4GYYA 2YHEA 2XENA 5KNGA 4GMLA 4RQIA 4L2LA 3AG2E 4J8FA 3CK7A 2GRNB 4JXTA 4BWRA 3QKYA 5AJDA 4G8LA 1HH8A 3CQGB 5KNHD 1ZU2A 4X8QA 5FT9A 1BI7B 4AY5A 2NXPA 4CT4A 3QAQA 4WUYA 4G1TA 5ENRD 2FI7A 4RSYA 2C2LA 3EJNA 3UM1A 2L0IA 1INZA 5T8IA 3JXJA 4YDEA 3T8MA 1QNFA 3SD5A 1DNPA 3U3WA 4BSXA 3FHEA 1H6OA 2V5FA 5KJMA 1OWOA 2WQHA 4JB8P 1IKND 2J8SD 3IKOB 3CVUA 2HM8A 3ASDA 2J4BA 3ENEA 3APDA 1N4RA 1Z6TA 2X6JA 2YHCA 3AG4E 2XQ0A 3HVEA 4Y6CA 5CCLA 3Q9NC 2OEVA 3ZPJA 4APOA 2DVWA 5DBKA 1MJ0A 4U8YD 1UN9A 4RLYA 3UTMA 3UPVA 2V8SE 3MJWA 5KCMA 3PNLB 1N52A 1N94A 2P58C 1H2TC 2VSOE 3DEPA 4U8HA 3CVYA 1LF8A 3CVPA 3IBEA 3Q4AB 3CVXA 1IQRA 3DSTA 4UUCA 4UWHA 2P9IG 3E33A 2JABA 2R05A 1LD8A 2ETAA 1H2VC 5T3RA 5BNWA 5EDSA 3FUEA 3RSEG 3D9JA 1TYQG 4JL0A 2Y0BG 5ENTD 3IEGA 3CHPA 2H6HA 4BEPA 2BEDA 5D2MC 4XI0A 3B13A 2LAHA 2IU1A 4I6JA 1UG3A 3HIZA 2PL2A 4EQFA 3FP3A 4AIFA 4GZ6A 2BF0X 3UINC 1MHQA 3LJ3A 4ILIA 4IULA 5LP0A 3LJNA 2VYIA 4FHJA 3ZW3A 3TWUA 1H6KA 4OAUC 4ME2A 5BXOA 2IOLA 4N5CA 2GGFA 3C3RA 3ASOE 4WNGA 4I9CA 2FEZA 2XGSA 3D9IA 4JEUA 3ULQA 4GA1A 2ETBA 4YDWA 2P9NG 5H7PA 4U7EB 3SBTB 2IY0C 1KPSB 4BESA 3SI5A 1WG0A 4I6EA 4K5CA 1Y8MA 5JJ7A 2KZTA 1IXVA 2Y4TA 3HG0D 1YA0A 4B89A 1OWNA 3KSLA 2J08A 3APFA 3EIJA 4EZLA 3D9PA 3J5PA 2VGXA 4H7XA 5CCMA 3R9AB 5E76A 1FVFA 4BY6A 3EDTB 2FBNA 1SVXA 3ZRHA 4A1SA 3BQOA 3S2AA 4OAVB 2IJGX 3VLDA 4BERA 1QYMA 3PEVB 2R17C 1OXJA 3FTXA 1LD7A 3FEYA 1L5JA 3E4BA 3DWLG 4I43A 2EIME 3V79K 4GYWA 1ELKA 5HQ8A 3KS2A 2XGOA 3AS4A 3HYMB 3EU9A 3Q79A 4LNUD 3K9IA 1ELRA 4G25A 4P29A 3Q78A 3S7JA 4LUNU 3SBSA 2FF4A 4G26A 3SO8A 1K8KG 3FTWA 3DBSA 4GAAA 3KAEA 4JW1A 2VGYA 4XZ4A 2IEJA 5EN5D 1FT1A 3GW4A 5D0QD 2ZGDA 4Z68A 5EILA 5G2NA 2XRYA 4JZYA 3V2OA 5LOZA 5ENOD 3Q7FA 3W9FA 3HXCA 3EIQC 4QQIA 3NAWA 5ENSD 2AWIA 3DRAA 3V2XA 4GTPA 4ACLA 2BKGA 2WB2A 4AP2A 4XKBA 2JEKA 3ML8A 4F6RD 5C2YA 3FUIA 2XS8A 2E2EA 3E32A 4L9PA 3PZ1A 4MRUA 3R7QA 2VJ8A 3BUAA 5KBAA 5G55A 2RFMA 4ANUA 2WM9A 3SQVA 1A17A 3PUKA 3TL5A 3BG1B 3Q15A 3T5XA 2GRMA 1HZ4A 3SFXA 1D9SA 5AARA 2AVPA 4GMJA 4HFGA 3DPYA 4RG6A 3CK9A 2ONDA 2AW6A 2A5UA 3RIBA 1PY1A 2PNNA 3GZ2A 3FU0A 2WPVA 3NOGD 2IONA 3KSQA 4B94A 2X6KA 3C3OA 1H2UA 3CQCB 4KVMA 3AAAC 4JHRA 2H6FA 1IQUA 3UUXA 3CHRA 1KZOA 4HI8A 4C48B 2DYSE 4U07A 4TXRA 4DLOA 2WXLA 3B7BA 3R9MA 2X6FA 3CGHA 3QARA 5FIOA 2UY1B 3EHQA 3FUNA 4N5QA 2HE0A 4R7LA 4EZJA 4U0ZA 5AIJA 3UT7A 3RO3A 3ZVVA 4A3VA 4ANVA 4GCOA 2QZAA 3ZFWA 1TN6A 4HI9A 5FJYA 3ABLE 3ML9A 2J4DA 4FU3A 4GZCA 4U0UA 2B0OE 4GCNA 1Q2ZA 2XEHA 5KJLA 4BTBA 4DX2A 4CEMA 5FZQA 1N0QA 4LERA 4HS2A 5KJKA 2XCCA 4PDXA 4OYSA 2OCCE 4A55A 4HLLA 2KCLA 4E85A 3UKUG 3E37A 4L23A 3GYZA 3EHRA 4FJZA 3PDNA 1WM5A 4W9RA 3RKVA 3UIOC 1TN7A 4HOQA 2QYUA 1MYOA 5FZRA 3ABME 3TG5A 1HE8A 4ATZD 3FUJA 3G2WA 2Y4UA 2UY1A 3Q7AA 1Y6IA 3CHSA 3CIAA 2V5QC 3X2QE 3LY7A 3WXXA 2RFAA 3D9NA 3ISMC 1WDYA 4KZ0A 4BSZB 2LXMA 3Q49B 1E90A 2H6GA 1OUVA 5CHEE 4O1OA 3L17A 4TRQA 1E7UA 2I1JA 2P9UG 3ULYA 2WXGA 4GTTA 3ESKA 1BI8B 5JJ6A 4K5AB 4GZ5A 3L16A 3FTSA 3HVEB 2IOSA 1RW2A 3PREA 4FULA 3D9HA 1K1AA 1BU9A 4H7YA 2LO6A 4I1MA 2X6HA 3ASGA 4GPMA 3UI2A 2MOWA 3F6QA 4GTMA 5AQ9A 3D9MA 5BXUA 2CHZA 1NP7A 5G05C 3FTYA 4TXQA 3U64A 1DC2A 1DVPA 4NURA 2XZDG 3FWVA 5ENNA 5LCWJ 3OXLA 3P2BA 3FU6A 3T9KA 2GRLA 4TXPA 3PH0C 3B7RL 5FQ7A 2P9SG 1IYGA 3S7FA 1JWFA 3CVWA 3MEKA 1KLXA 2I2OA 4KYOB 2EILE 4TV3A 4NACA 5HS0A 4BETA 1OY3D 3V30A 4ABNA 2WXFA 1OWLA 2WXIA 5AENA 3U4TA 4J6IA 4FLHA 4GU5A 3ABKE 3JUIA 4JA9A 1HU3A 2QFCA 3FUDA 3LCAA 1TNBA 1Z5SC 4WNEA 2QC9A 2WXPA 3MV3B 4NRHB 3UMVA 4HRMB 3KEAA 4XI9A 4YDYA 4RG9A 2WMNA 5FQ8A 2R03A 3Q9UC 4WNDA 5CEAA 1SW6A 4KBQA 2RG8A 1W3BA 4NIKA 5A6CA 5B1BE 3UT8A 1N4PA 4ANWA 1G3NB 4HQDA 4AV7A 4XKCA 3CV0A 3V31A 2WXOA 1JUQA 4CDMA 1S0PA 3CKCA 3PNTB 4WAFA 1MX6A 3Q73A 4MLPA 3ZHEA 4MS6A 1NI1A 4Q69A 1JCQA 1S70B 2LNIA 5EX3A 2JLBA 2LSUA 3C5RA 4DX7D 3CVNA 3L22A 4GZ3A 1MX4A 4O60A 3TGOA 3J5QB 1SA5A 1TN8A 2HR2A 5AAOA 5J08A 1O1TA 1JPLA 1UOHA 2WMOA 5CRVA 3CR3A 5LX8A 5CECB 4F7AA 1ZB1A 5G04J 2WQ6A 4HNAD 3PZ2A 3L6AA 4HRLA 5LCWC 4N3BA 2R59A 4DI4A 1H19A 3LY9A 3UQ3A 2L6BA 3G2SA 4FADA 2R5SA 3Q75A 4HRNA 4I2WA 5AQ7A 1SQMA 2LXLA 4BX8A 2WQ7A 3UX4A 1FVHA 4ATGA 1K3ZD 4I2ZA 4PS8A 4EHMA 2KC7A 5HRYA 4BT8A 3HXDA 1OT8A 3D9KA 4DK5A 2ZU6B 1HF8A 4LNBA 4J8SA 3RAUA 4UI9C 3O48A 5AYWD 4N3CA 4L2YA 3G2VA 4HLEA 4C0EA 4YDOA 1DCQA 2P9LG 4G23A 4GMRA 4YNDA 3QC1A 1OWPA 3RRMB 1TNUA 3TXMA 3LY8A 1OCOE 3ZU7B 4EPZA 2DBAA 2CHXA 1U3DA 3LVRE 1E96B 1QZ2A 3B95A 4CGVA 2CFUA 3CVVA 4KZCA 3HXEA 4KVOA 2A5EA 3RK6A 2EIKE 4N3AA 4B93B 3LVQE 1H0AA 1N4SA 5D66A 1E7VA 1HXIA 4DLQA 4URKA 4O6FA 4AY6A 3ZYKA 2OVFA 5CRUA 3FU3A 3C72A 1JWGA 2OV8A 3Q47B 4IN3B 3L08A 3ZHEB 5FINA 1YYHA 2YINA 4YVQC 4PUCA 4B8AA 5JHBA 3D3MA 1N11A 3QNKA 3CK8A 3TWWA 2X38A 4IRUA 3L13A 5ENPD 2XRZA 2PQNA 2ZISA 1FT2A 2MYOA 2WXJA 2LAIA 5EIDA 4GB9A 4I1AA 2I1KA 1IHBA 4G11A 1NL4A 3MA5A 4ZFHA 2FO1E 4JHKA 3DSXA 3SZ7A 4HOUA 3LDZA 4Q96A 2GRPB 2XEEA 2XEVA 1TJCA 5EKQD 3D9OA 3SGHA 4DRXE 3JQ1A 3FUFA
chains in the Genus database with same CATH topology
2HO1A 4ILGA 3B7UX 4CEMA 5FZQA 4F1SA 4LERA 3ZPJA 4HS2A 5KJKA 4TUUA 2XCCA 4APOA 5DBKA 4PDXA 3NZUA 4OYSA 4FC8A 5HI7A 5G04C 4A55A 1UN9A 2KCLA 4WWNA 5AJLA 3MX3A 3FTUA 4E85A 3QB2A 2AXZA 3UPVA 5ARGA 3PE3A 2V8SE 3MJWA 5KCMA 3PNLB 2CG3A 3HDXA 3U66A 1N52A 4L23A 2P58C 1U3CA 3GYZA 4L1BA 4EECA 4JEHA 1H2TC 1EF1C 3B7TA 4FJZA 2VSYA 2VSOE 1WM5A 3PDNA 4NQ0A 4W9RA 2MRIA 5KJNA 4ANXA 3RKVA 4U8HA 2KCKA 3PE4A 4HOQA 1HG5A 3CVYA 1LF8A 3CVPA 3IBEA 4XX5A 4CGWA 5FZRA 3Q4AB 3TG5A 3CVXA 3I3NA 1HE8A 3EHMA 1IQRA 1HO8A 3FUJA 3G2WA 2Y4UA 2UY1A 1N54A 2J9QA 3FUKA 1SZ9A 4M3OA 4UWHA 3BG0B 1Y6IA 2CG2A 4FJYA 3ZXSA 3CHSA 3CIAA 3ASHA 4LCTA 2I9CA 1X5BA 1H2VC 3SHFA 1MQSA 3LY7A 3SNXA 2VSNA 5T3RA 1GW6A 4CT0A 4B8CB 3WXXA 2I6HA 5JJTA 3D9NA 5BNWA 5EDSA 1OWMA 3FUEA 4MKTA 3D9JA 4KZ0A 4JL0A 4QFVA 3MV2B 3Q49B 1NA0A 3IEGA 2IQCA 1E90A 3CHPA 1OUVA 5CHEE 3I5PA 5C1DA 4RVBA 3L17A 4TRQA 4XI0A 3G2TA 4YVOA 4I17A 3B13A 3LXUX 1E7UA 2I1JA 2LAHA 2IU1A 4G24A 4I6JA 1UG3A 1E8YA 2WXGA 3HIZA 2PL2A 3ESKA 4UWLA 4EQFA 5JJ6A 3FP3A 2A4ZA 4AIFA 4GZ6A 2BF0X 1TJFA 2WXRA 4Q94A 4GZ5A 3L16A 3APCA 3FTSA 4F3VA 2PQRA 4AOFA 1MHQA 2IOSA 3HVEB 1HG2A 2HYZA 3AS8A 2V4LA 3PREA 2VTBA 4FULA 2FO7A 4HOTA 3FUHA 3AU4A 3LJ3A 4ILIA 4N39A 4GYOA 3EHNA 4IULA 4H7YA 2LO6A 4I1MA 2X6HA 5LP0A 3FUMA 3ASGA 3KD7A 2X3MA 1HX8A 2MOWA 2IF4A 2VYIA 3ESLA 3NZSA 4ILHB 2XHEA 3OTNA 4J8DA 2WXHA 2OVBA 4FHJA 3D9MA 2CHZA 1NP7A 3ZW3A 1H6KA 5G05C 3FTYA 3IV0A 4ME2A 2OOEA 2IOLA 3LS8A 2DIWA 2GGFA 4N5CA 4XE0A 5T4YA 4WNGA 3QJZA 3U64A 4I9CA 2FEZA 2XGSA 4CCAA 1DVPA 3D9IA 4JEUA 4NURA 3GZ1A 3ZYLA 1SZAA 3FWVA 2J09A 5ENNA 5J90A 3Q5MA 3ULQA 5LCWJ 4GA1A 5BV0A 3OXLA 2KCVA 3P2BA 4AM9A 2WXMA 3FU6A 4WWOA 2WVIA 1B89A 1EPUA 2GRLA 3SBTB 5CMYA 3QWPA 3PH0C 3B7RL 4KMOA 5FQ7A 1UJJA 1ZBPA 3GZSA 2GW1A 4GPKA 1IYGA 3KEZA 4B0ZA 3PZDA 4LEUA 3SI5A 1NZNA 5ANLA 3S7FA 3BEEA 4I6EA 1JWFA 4HOSA 3OXGA 3CVWA 3TG4A 1Y8MA 2XPYA 2CHWA 5JJ7A 2KZTA 4JC8A 5JHAA 2Y4TA 3MEKA 1E8XA 1KLXA 3P1UA 2EQXA 2I2OA 3MYVA 4KYOB 4TV3A 5FZSA 2J07A 1P5QA 3NQPA 4HXIA 4K0RA 4NACA 4LRZA 1YA0A 2PM6A 4B89A 1OWNA 4DJAA 2J08A 2X6IA 4ABNA 2WXFA 1OWLA 3U9WA 3APFA 4BT9A 3IHVA 2C0MA 3EIJA 1E8ZA 4JVSA 2WXIA 4G2VA 4EZLA 5AENA 3D9PA 1IHGA 2ILRA 3U4TA 4J6IA 4FLHA 2DCPA 3LPZA 4GU5A 4BTAA 4HVBA 3FH7A 3CKBA 3CVQA 4U0SA 2VGXA 4H7XA 5CCMA 3R9AB 1TEZA 5E76A 3MGBA 1FVFA 3JUIA 3L54A 4JA9A 1HU3A 2QFCA 4BY6A 3FUDA 3LCAA 5FQ4A 3EDTB 2FBNA 3ZRHA 4WNEA 2VTBB 3QDNA 2WXPA 4JA7A 3ZYMA 4A1SA 3MV3B 3CVLA 3S2AA 4NRHB 3UMVA 3QWWA 2IJGX 4KT6B 4XI9A 3VLDA 4I1OB 4RG9A 2WMNA 5FQ8A 3N71A 3VTXA 3PEVB 2R17C 3ZEFA 1UJKA 3FTXA 3FEYA 4WNDA 1L5JA 3E4BA 5EX0A 2KM4A 3MKQB 2RG8A 1W3BA 4KBQA 3B7SA 4I43A 5A6CA 4V3IA 2PZIA 1ELWA 3UT8A 4ANWA 4AV7A 3UT4A 4XKCA 4GYWA 3CV0A 2E0IA 4UQXA 5BT1A 3PS6A 4EBAA 4K03A 2V0PA 1UW4B 2WXOA 1ELKA 5HQ8A 3KS2A 4GZDA 2XGOA 3AS4A 3HYMB 3OXFA 1JUQA 1EDUA 1S0PA 3CKCA 4MLPA 3PNTB 4WAFA 4CDMA 3FH8A 4J0UA 3ZHEA 4MS6A 1VDYA 4Q69A 3K9IA 1ELRA 2LNIA 5EX3A 3CSTA 4G25A 4P29A 2JLBA 2LSUA 3PEUB 3CVNA 3ONKA 4UQYA 3L22A 4GZ3A 3S7JA 4LUNU 3SBSA 2FF4A 4G26A 3TGOA 4XIFA 1PC2A 2FULA 3FTWA 3DBSA 4AXHA 4DPRA 4GAAA 4JPSA 3ZIMA 5M72A 4AEZC 3KAEA 4JW1A 3ZYQA 2VGYA 4XZ4A 2XPZA 3CSFA 2HR2A 3I4GA 3SF4A 5J08A 4U04A 3LYAA 1JPLA 2WMOA 1EYHA 1FCHA 4UWKA 3CR3A 5LX8A 4F7AA 3GW4A 4UWGA 5D0QD 5G04J 2WQ6A 4C0MA 3L6AA 3IHYA 5LCWC 4N3BA 2WXKA 2R59A 4DI3A 4AJWA 5G2NA 4DI4A 1H19A 2BUGA 3LY9A 2XRYA 4JZYA 5LOZA 3UQ3A 3S7BA 2WXQA 3FULA 4A3TA 1XNFA 3FEXA 3LKUA 3G2SA 5LFAA 3MZLB 5ARFA 5FTPA 3RO2A 4KXKB 4FADA 3EIQC 4AVXA 4N2SA 5BUZA 2R5SA 1UN8A 2AWIA 4JHJA 3R7RA 5BV1A 4I2WA 5CMWA 2KATA 3O4ZA 2AXUA 1SQMA 4APFA 4ACLA 4OVVA 4BX8A 2WB2A 3PVLA 4AP2A 1E8WA 4XKBA 2IFUA 2YNQA 3NF1A 2L6JA 3UX4A 2AXVA 2WQ7A 1FVHA 4ATGA 2JEKA 3ML8A 1Z3YA 5C2YA 4I2ZA 3FFLA 3QOUA 3FUIA 4PS8A 4Y6WA 2KC7A 3I4RB 3FH5A 4BT8A 4D10C 3FY4A 2NC9A 4WWPA 2L0TB 3D9KA 4DK5A 2E2EA 3G2UA 2VSXE 3QK0A 1BPOA 3ONLA 2ZU6B 1HF8A 3AU5A 3CHMA 3MKRA 5E75A 4J8SA 4PH4B 3MKQA 4PS7A 2J49A 5FWQA 1XGWA 4UI9C 3CLJA 3OAWA 3JCKC 3T5VA 1KT0A 3RJVA 2CFZA 3O48A 4MRUA 5AYWD 3VLFA 5ANRA 3R7QA 3JYSA 4N3CA 3RRNB 2VJ8A 4L2YA 3G2VA 2QY7A 2C0LA 4HLEA 4C0EA 2WXNA 2XCBA 1KT1A 2XPIA 5G55A 2XGMA 4UWFA 3FTVA 4G23A 4ANUA 2WM9A 4YNDA 3TAXA 3TXNA 3QC1A 1OWPA 1QQEA 4FHKA 4UI9J 3RRMB 3TXMA 1A17A 2UWJG 3PUKA 3TL5A 4CDNA 2M63A 4J8EA 3LY8A 3C98A 3VTYA 4FP7A 3BG1B 3Q15A 1HS6A 1WY6A 3T5XA 4C9BB 4EPZA 3PRZA 4HORA 2GRMA 2DBAA 1HZ4A 5BW8C 2RD0A 2CHXA 1U3DA 1PAQA 3VLEA 3LEWA 2VGXB 3LVRE 2AVPA 4BFRA 3PUJA 2YHEA 4GMJA 2BTDA 2VQ2A 4GYYA 1E96B 4HFGA 2YQ8A 4A1GA 4RG6A 1WAO1 3URZA 4EZKA 1QZ2A 2ONDA 3CK9A 2AW6A 3CHOA 3MCXA 4CGVA 2A5UA 2CFUA 3RU0A 3CVVA 3RIBA 3CEQA 4GMLA 4KZCA 1PY1A 3HHMA 4L2LA 4UQZA 3GZ2A 4KVOA 4J8FA 3RK6A 3CK7A 4F53A 3FU0A 4JXTA 2WPVA 5BPPA 4N3AA 4BWRA 3FU5A 3QKYA 5AJDA 2IONA 3FDHA 3LVQE 1H0AA 4FLBA 4B94A 1E7VA 2X6KA 1HXIA 4DLQA 1Z3XA 4URKA 1H2UA 4O6FA 3DPDA 1HH8A 3CQGB 3CQCB 1ZU2A 4GA0A 4KVMA 3FTZA 5FT9A 4AY6A 4JHRA 3ZYKA 2OVFA 2Y3AA 3FU3A 4AY5A 2NXPA 4L7TA 1JWGA 4CT4A 2OV8A 3QAQA 3Q47B 4IN3B 3L08A 4WUYA 1IQUA 3ZHEB 4G1TA 3QWVA 3UUXA 3ZN3A 3CHRA 2FI7A 4RSYA 2Q7FA 2YINA 2C2LA 1NA3A 3EJNA 4YVQC 3TJPA 4FA6A 4PUCA 4B8AA 5JHBA 3D3MA 4U07A 4EBAG 4DLOA 3QNKA 3CK8A 2L0IA 4GA2A 3SFZA 2WXLA 1INZA 2X38A 3JQ0A 4IRUA 3L13A 5T8IA 3ASFA 2X6FA 3T8MA 2XRZA 3CGHA 2PQNA 3QARA 2UY1B 1QNFA 4U63A 5D0OD 3RRUA 4UI9K 1DNPA 3SD5A 3FUNA 4I6GA 3U3WA 5A23A 4BSXA 4R7LA 2WXJA 2LAIA 4E6HA 3FHEA 4BX9A 2V5FA 4I9EA 5KJMA 2L9BA 1OWOA 4EZJA 4U0ZA 5AIJA 4GB9A 2WQHA 2PM7A 4I1AA 3UT7A 2I1KA 3RO3A 3ZVVA 4CRWA 4A3VA 3AS5A 4PS3A 4ANVA 4GCOA 4G11A 4ACKA 5G05J 3MA5A 2NSZA 4N2QA 4IYPA 5DIZA 3ZGQA 3D9LA 3S7DA 3ZFWA 3IKOB 4JHKA 2HM8A 5A7DB 2MHKA 3CHQA 3CVUA 3ASDA 1HFAA 2J4BA 3ENEA 3APDA 3SZ7A 5FQ6A 5FJYA 2KZTB 4CDRA 4OVUA 1Z6TA 2LSVA 2X6JA 3ML9A 4HOUA 2J4DA 2YHCA 3LDZA 4FU3A 4Q96A 4GZCA 2XQ0A 4U0UA 2XEVA 3HVEA 1TJCA 4GCNA 5EKQD 3D9OA 4WNFA 3SGHA 5KJLA 3JQ1A 3FUFA 4Y6CA 4BTBA 5CCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V3I A;  3U66 A;  4ACL A;  4ACK A; 
#chains in the Genus database with same CATH topology
 4ILG A;  1TNY A;  4FC8 A;  5HI7 A;  5G04 C;  3QB2 A;  3L82 A;  1N4Q A;  3PE3 A;  5EYP F;  2AJA A;  3HDX A;  3L9T A;  3NBN B;  1U3C A;  4EEC A;  4JEH A;  1EF1 C;  3B7T A;  2VSY A;  1O5M A;  5B3S E;  2OEW A;  5KJN A;  4ANX A;  4GTV A;  2KCK A;  3PE4 A;  1HG5 A;  5ITZ F;  4XX5 A;  1V55 E;  3EHM A;  1HO8 A;  1N54 A;  2J9Q A;  2P9K G;  1SZ9 A;  1FPP A;  4M3O A;  4LG6 A;  2CG2 A;  2DWZ A;  4FJY A;  3ZXS A;  5B1A E;  4J8Y A;  2I9C A;  1X5B A;  3SHF A;  4HBD A;  1H6P A;  2I6H A;  4QFV A;  3TWX A;  3I5P A;  2R02 A;  5C1D A;  4GTO A;  2P2C P;  3NB2 A;  4YVO A;  3LXU X;  2R2L A;  1MZC A;  4G24 A;  4O1P A;  2A4Z A;  3TWQ A;  2WXR A;  4TUM A;  1TNZ A;  2Y1L E;  4F3V A;  4AOF A;  2HYZ A;  2ZXW E;  2VTB A;  2FO7 A;  4HOT A;  3FUH A;  4DX1 A;  2DYR E;  4N39 A;  3EHN A;  3FUM A;  3KD7 A;  2X3M A;  1HX8 A;  2F37 A;  3DXK G;  3NZS A;  4J8D A;  3OTN A;  2WXH A;  2OVB A;  3UM0 A;  3JXI A;  1O1S A;  5CED B;  3LS8 A;  4XE0 A;  5T4Y A;  2GRQ B;  2LUH A;  3QJZ A;  3GZ1 A;  3Q5M A;  2VGE A;  2KCV A;  2WXM A;  2XZT G;  4G8K A;  1EPU A;  4GTS A;  3DXM G;  1UJJ A;  1ZBP A;  3GZS A;  2GW1 A;  4GPK A;  4B0Z A;  3PZD A;  3SY2 A;  4LEU A;  5ANL A;  3BEE A;  3T8K A;  2EIN E;  1LTX A;  2CHW A;  4JC8 A;  5JHA A;  3P1U A;  5AN8 A;  3AG3 E;  5FZS A;  4M7C A;  3NQP A;  4HXI A;  4K0R A;  3UM2 A;  4LRZ A;  2B6C A;  2X6I A;  3IHV A;  2C0M A;  4JVS A;  2ILR A;  4CZ2 D;  2EIJ E;  3CKB A;  3CVQ A;  1NFI E;  2VTB B;  4JA7 A;  3ZYM A;  3CVL A;  3EUV A;  3QWW A;  3N71 A;  3VTX A;  2RKK A;  3ZEF A;  1U2V G;  1UJK A;  5EX0 A;  3MKQ B;  4CYM D;  3UT4 A;  2IO2 C;  4JD2 G;  3PS6 A;  2V0P A;  1UW4 B;  1DCE A;  3OXF A;  2BKK B;  1VDY A;  3CST A;  3PEU B;  4UQY A;  1PC2 A;  2FUL A;  3ASN E;  4AXH A;  4DPR A;  4JPS A;  3ZIM A;  5M72 A;  4AEZ C;  3ZYQ A;  3CSF A;  1TR4 A;  2ETC A;  3LYA A;  4ZHB A;  4UWK A;  2H6I A;  5AQB A;  3IHY A;  2WXK A;  4DI3 A;  4AJW A;  3HXF A;  3S7B A;  1XNF A;  3FEX A;  3LKU A;  3MZL B;  5ARF A;  5JMN D;  3RO2 A;  4KXK B;  4AVX A;  4N2S A;  3BU8 A;  1UN8 A;  3R7R A;  5BV1 A;  3O4Z A;  4APF A;  4OVV A;  2YNQ A;  2L6J A;  2AXV A;  1Z3Y A;  3FFL A;  3QOU A;  3C3Q A;  4Y6W A;  5HKP A;  3FH5 A;  3G2U A;  3QK0 A;  5E75 A;  1BPO A;  1O1R A;  3AU5 A;  3ONL A;  5FWQ A;  1N9A A;  2F8X K;  3JCK C;  1KT0 A;  2CFZ A;  2XS1 A;  1N0R A;  2QY7 A;  2WXN A;  2XCB A;  1KT1 A;  3HRA A;  3TAX A;  4FHK A;  4UI9 J;  4LSZ E;  4CDN A;  4J8E A;  3C98 A;  4FP7 A;  5ENQ D;  1HS6 A;  3TWR A;  2RD0 A;  3TWT A;  4BFR A;  1A5E A;  3PUJ A;  2BTD A;  2VQ2 A;  1YCS B;  2YQ8 A;  4A1G A;  1WAO 1;  3URZ A;  4EZK A;  3CHO A;  3MCX A;  3DSW A;  3RU0 A;  3CEQ A;  3HHM A;  3PZ3 A;  4UQZ A;  4F53 A;  5BPP A;  3FU5 A;  3FDH A;  4FLB A;  2F8Y A;  1Z3X A;  3DPD A;  3NOC D;  4GA0 A;  3FTZ A;  2Y3A A;  3UM3 A;  4L7T A;  5JA4 D;  3QWV A;  3ZN3 A;  1X81 A;  2NYJ A;  2Q7F A;  1NA3 A;  3TJP A;  2F0Y A;  4FA6 A;  3ZUV B;  5AQA A;  4EBA G;  3ZXP A;  4GA2 A;  3SFZ A;  4U95 D;  3JQ0 A;  5IY5 E;  3ASF A;  4U63 A;  5D0O D;  3RRU A;  4UI9 K;  4I6G A;  5A23 A;  4E6H A;  4U8V D;  4BX9 A;  4I9E A;  3W9G A;  2L9B A;  2PM7 A;  3TWV A;  4CRW A;  3ZNG A;  3AS5 A;  4PS3 A;  4ACK A;  5G05 J;  4N2Q A;  2NSZ A;  5EIB E;  4IYP A;  5DIZ A;  3ZGQ A;  3D9L A;  2KXP C;  3S7D A;  5A7D B;  2MHK A;  3CHQ A;  1RZ4 A;  1HFA A;  3UXG A;  5FQ6 A;  2KZT B;  4CDR A;  4OVU A;  2LSV A;  3PZ4 A;  5CBO A;  4WNF A;  3E30 A;  2HO1 A;  3B7U X;  4F1S A;  4TUU A;  3NZU A;  4HB5 A;  4WWN A;  5AJL A;  1AWC B;  3DEO A;  3MX3 A;  3FTU A;  2AXZ A;  5ARG A;  3IXE A;  3WG7 E;  2CG3 A;  3U66 A;  4L1B A;  3EU5 A;  4NQ0 A;  2MRI A;  4GTR A;  4CGW A;  3I3N A;  3FUK A;  3BG0 B;  5CBN A;  3ASH A;  4LCT A;  1MQS A;  3SNX A;  2VSN A;  1GW6 A;  4CT0 A;  4B8C B;  4DX6 D;  5JJT A;  1OWM A;  1YMP A;  4MKT A;  3MV2 B;  1NA0 A;  2IQC A;  4K5B A;  4U96 D;  4RVB A;  3G2T A;  4I17 A;  3DSV A;  1E8Y A;  4UWL A;  2V4H C;  1TJF A;  4Q94 A;  4GTQ A;  3APC A;  2PQR A;  1HG2 A;  3AS8 A;  2V4L A;  3AU4 A;  4GYO A;  1AP7 A;  4XEI G;  5CER B;  2IF4 A;  3ESL A;  4ILH B;  2XHE A;  5KWD A;  2DZN A;  1D8E A;  3IV0 A;  2OOE A;  2DIW A;  1OCC E;  1K1B A;  4CCA A;  3ZYL A;  1SZA A;  2J09 A;  5EYL A;  5J90 A;  1BLX B;  5BV0 A;  4AM9 A;  4WWO A;  4DX5 D;  2WVI A;  1B89 A;  5CMY A;  3AJI A;  3QWP A;  4KMO A;  3KEZ A;  1NZN A;  4HOS A;  3OXG A;  3TG4 A;  2XPY A;  3ULE G;  1BD8 A;  1E8X A;  2EQX A;  3MYV A;  4J7W A;  2J07 A;  1P5Q A;  4DUI A;  2PM6 A;  4DJA A;  4BT9 A;  2QYJ A;  3U9W A;  1D8D A;  1E8Z A;  4G2V A;  1IHG A;  2DCP A;  3LPZ A;  4BTA A;  2IO3 C;  4HVB A;  3FH7 A;  4U0S A;  1TEZ A;  3MGB A;  3L54 A;  5FQ4 A;  4LNG A;  2GRO B;  3QDN A;  4KT6 B;  4I1O B;  1SA4 A;  2P9P G;  2Y69 E;  3UIP C;  2KM4 A;  3B7S A;  4V3I A;  2PZI A;  1ELW A;  2E0I A;  4UQX A;  5BT1 A;  1MX2 A;  4EBA A;  4K03 A;  4GZD A;  3TWS A;  1EDU A;  2KBX A;  3FH8 A;  4J0U A;  3ONK A;  1OCR E;  4XIF A;  1S64 A;  2XPZ A;  3I4G A;  3SF4 A;  4U04 A;  4A63 B;  1EYH A;  1FCH A;  4UWG A;  4C0M A;  2BUG A;  3UKR G;  1QBQ A;  2WXQ A;  3FUL A;  4A3T A;  5LFA A;  5FTP A;  3SFY A;  5BUZ A;  3HXB A;  4JHJ A;  5CMW A;  2KAT A;  2AXU A;  2ZIR A;  3PVL A;  1E8W A;  2IFU A;  3NF1 A;  2DZO A;  1KZP A;  3ZKJ A;  3E34 A;  3JUE A;  3I4R B;  1OCZ E;  4D10 C;  2ZGG A;  3FY4 A;  2NC9 A;  4WWP A;  2L0T B;  2VSX E;  3DSU A;  3CHM A;  3MKR A;  1S63 A;  4PH4 B;  3MKQ A;  4PS7 A;  2J49 A;  1XGW A;  3CLJ A;  1JCR A;  3OAW A;  3T5V A;  3RJV A;  3VLF A;  5ANR A;  3JYS A;  3RRN B;  2C0L A;  2XPI A;  2XGM A;  4UWF A;  1V54 E;  3FTV A;  3TXN A;  1JCS A;  1N95 A;  1QQE A;  2UWJ G;  4F1P A;  2M63 A;  2GRR B;  3VTY A;  1WY6 A;  4C9B B;  3PRZ A;  4HOR A;  1TNO A;  5BW8 C;  4MBG A;  3AG1 E;  1PAQ A;  3DSS A;  3VLE A;  3LEW A;  2VGX B;  4GYY A;  2YHE A;  2XEN A;  5KNG A;  4GML A;  4RQI A;  4L2L A;  3AG2 E;  4J8F A;  3CK7 A;  2GRN B;  4JXT A;  4BWR A;  3QKY A;  5AJD A;  4G8L A;  1HH8 A;  3CQG B;  5KNH D;  1ZU2 A;  4X8Q A;  5FT9 A;  1BI7 B;  4AY5 A;  2NXP A;  4CT4 A;  3QAQ A;  4WUY A;  4G1T A;  5ENR D;  2FI7 A;  4RSY A;  2C2L A;  3EJN A;  3UM1 A;  2L0I A;  1INZ A;  5T8I A;  3JXJ A;  4YDE A;  3T8M A;  1QNF A;  3SD5 A;  1DNP A;  3U3W A;  4BSX A;  3FHE A;  1H6O A;  2V5F A;  5KJM A;  1OWO A;  2WQH A;  4JB8 P;  1IKN D;  2J8S D;  3IKO B;  3CVU A;  2HM8 A;  3ASD A;  2J4B A;  3ENE A;  3APD A;  1N4R A;  1Z6T A;  2X6J A;  2YHC A;  3AG4 E;  2XQ0 A;  3HVE A;  4Y6C A;  5CCL A;  3Q9N C;  2OEV A;  3ZPJ A;  4APO A;  2DVW A;  5DBK A;  1MJ0 A;  4U8Y D;  1UN9 A;  4RLY A;  3UTM A;  3UPV A;  2V8S E;  3MJW A;  5KCM A;  3PNL B;  1N52 A;  1N94 A;  2P58 C;  1H2T C;  2VSO E;  3DEP A;  4U8H A;  3CVY A;  1LF8 A;  3CVP A;  3IBE A;  3Q4A B;  3CVX A;  1IQR A;  3DST A;  4UUC A;  4UWH A;  2P9I G;  3E33 A;  2JAB A;  2R05 A;  1LD8 A;  2ETA A;  1H2V C;  5T3R A;  5BNW A;  5EDS A;  3FUE A;  3RSE G;  3D9J A;  1TYQ G;  4JL0 A;  2Y0B G;  5ENT D;  3IEG A;  3CHP A;  2H6H A;  4BEP A;  2BED A;  5D2M C;  4XI0 A;  3B13 A;  2LAH A;  2IU1 A;  4I6J A;  1UG3 A;  3HIZ A;  2PL2 A;  4EQF A;  3FP3 A;  4AIF A;  4GZ6 A;  2BF0 X;  3UIN C;  1MHQ A;  3LJ3 A;  4ILI A;  4IUL A;  5LP0 A;  3LJN A;  2VYI A;  4FHJ A;  3ZW3 A;  3TWU A;  1H6K A;  4OAU C;  4ME2 A;  5BXO A;  2IOL A;  4N5C A;  2GGF A;  3C3R A;  3ASO E;  4WNG A;  4I9C A;  2FEZ A;  2XGS A;  3D9I A;  4JEU A;  3ULQ A;  4GA1 A;  2ETB A;  4YDW A;  2P9N G;  5H7P A;  4U7E B;  3SBT B;  2IY0 C;  1KPS B;  4BES A;  3SI5 A;  1WG0 A;  4I6E A;  4K5C A;  1Y8M A;  5JJ7 A;  2KZT A;  1IXV A;  2Y4T A;  3HG0 D;  1YA0 A;  4B89 A;  1OWN A;  3KSL A;  2J08 A;  3APF A;  3EIJ A;  4EZL A;  3D9P A;  3J5P A;  2VGX A;  4H7X A;  5CCM A;  3R9A B;  5E76 A;  1FVF A;  4BY6 A;  3EDT B;  2FBN A;  1SVX A;  3ZRH A;  4A1S A;  3BQO A;  3S2A A;  4OAV B;  2IJG X;  3VLD A;  4BER A;  1QYM A;  3PEV B;  2R17 C;  1OXJ A;  3FTX A;  1LD7 A;  3FEY A;  1L5J A;  3E4B A;  3DWL G;  4I43 A;  2EIM E;  3V79 K;  4GYW A;  1ELK A;  5HQ8 A;  3KS2 A;  2XGO A;  3AS4 A;  3HYM B;  3EU9 A;  3Q79 A;  4LNU D;  3K9I A;  1ELR A;  4G25 A;  4P29 A;  3Q78 A;  3S7J A;  4LUN U;  3SBS A;  2FF4 A;  4G26 A;  3SO8 A;  1K8K G;  3FTW A;  3DBS A;  4GAA A;  3KAE A;  4JW1 A;  2VGY A;  4XZ4 A;  2IEJ A;  5EN5 D;  1FT1 A;  3GW4 A;  5D0Q D;  2ZGD A;  4Z68 A;  5EIL A;  5G2N A;  2XRY A;  4JZY A;  3V2O A;  5LOZ A;  5ENO D;  3Q7F A;  3W9F A;  3HXC A;  3EIQ C;  4QQI A;  3NAW A;  5ENS D;  2AWI A;  3DRA A;  3V2X A;  4GTP A;  4ACL A;  2BKG A;  2WB2 A;  4AP2 A;  4XKB A;  2JEK A;  3ML8 A;  4F6R D;  5C2Y A;  3FUI A;  2XS8 A;  2E2E A;  3E32 A;  4L9P A;  3PZ1 A;  4MRU A;  3R7Q A;  2VJ8 A;  3BUA A;  5KBA A;  5G55 A;  2RFM A;  4ANU A;  2WM9 A;  3SQV A;  1A17 A;  3PUK A;  3TL5 A;  3BG1 B;  3Q15 A;  3T5X A;  2GRM A;  1HZ4 A;  3SFX A;  1D9S A;  5AAR A;  2AVP A;  4GMJ A;  4HFG A;  3DPY A;  4RG6 A;  3CK9 A;  2OND A;  2AW6 A;  2A5U A;  3RIB A;  1PY1 A;  2PNN A;  3GZ2 A;  3FU0 A;  2WPV A;  3NOG D;  2ION A;  3KSQ A;  4B94 A;  2X6K A;  3C3O A;  1H2U A;  3CQC B;  4KVM A;  3AAA C;  4JHR A;  2H6F A;  1IQU A;  3UUX A;  3CHR A;  1KZO A;  4HI8 A;  4C48 B;  2DYS E;  4U07 A;  4TXR A;  4DLO A;  2WXL A;  3B7B A;  3R9M A;  2X6F A;  3CGH A;  3QAR A;  5FIO A;  2UY1 B;  3EHQ A;  3FUN A;  4N5Q A;  2HE0 A;  4R7L A;  4EZJ A;  4U0Z A;  5AIJ A;  3UT7 A;  3RO3 A;  3ZVV A;  4A3V A;  4ANV A;  4GCO A;  2QZA A;  3ZFW A;  1TN6 A;  4HI9 A;  5FJY A;  3ABL E;  3ML9 A;  2J4D A;  4FU3 A;  4GZC A;  4U0U A;  2B0O E;  4GCN A;  1Q2Z A;  2XEH A;  5KJL A;  4BTB A;  4DX2 A;  4CEM A;  5FZQ A;  1N0Q A;  4LER A;  4HS2 A;  5KJK A;  2XCC A;  4PDX A;  4OYS A;  2OCC E;  4A55 A;  4HLL A;  2KCL A;  4E85 A;  3UKU G;  3E37 A;  4L23 A;  3GYZ A;  3EHR A;  4FJZ A;  3PDN A;  1WM5 A;  4W9R A;  3RKV A;  3UIO C;  1TN7 A;  4HOQ A;  2QYU A;  1MYO A;  5FZR A;  3ABM E;  3TG5 A;  1HE8 A;  4ATZ D;  3FUJ A;  3G2W A;  2Y4U A;  2UY1 A;  3Q7A A;  1Y6I A;  3CHS A;  3CIA A;  2V5Q C;  3X2Q E;  3LY7 A;  3WXX A;  2RFA A;  3D9N A;  3ISM C;  1WDY A;  4KZ0 A;  4BSZ B;  2LXM A;  3Q49 B;  1E90 A;  2H6G A;  1OUV A;  5CHE E;  4O1O A;  3L17 A;  4TRQ A;  1E7U A;  2I1J A;  2P9U G;  3ULY A;  2WXG A;  4GTT A;  3ESK A;  1BI8 B;  5JJ6 A;  4K5A B;  4GZ5 A;  3L16 A;  3FTS A;  3HVE B;  2IOS A;  1RW2 A;  3PRE A;  4FUL A;  3D9H A;  1K1A A;  1BU9 A;  4H7Y A;  2LO6 A;  4I1M A;  2X6H A;  3ASG A;  4GPM A;  3UI2 A;  2MOW A;  3F6Q A;  4GTM A;  5AQ9 A;  3D9M A;  5BXU A;  2CHZ A;  1NP7 A;  5G05 C;  3FTY A;  4TXQ A;  3U64 A;  1DC2 A;  1DVP A;  4NUR A;  2XZD G;  3FWV A;  5ENN A;  5LCW J;  3OXL A;  3P2B A;  3FU6 A;  3T9K A;  2GRL A;  4TXP A;  3PH0 C;  3B7R L;  5FQ7 A;  2P9S G;  1IYG A;  3S7F A;  1JWF A;  3CVW A;  3MEK A;  1KLX A;  2I2O A;  4KYO B;  2EIL E;  4TV3 A;  4NAC A;  5HS0 A;  4BET A;  1OY3 D;  3V30 A;  4ABN A;  2WXF A;  1OWL A;  2WXI A;  5AEN A;  3U4T A;  4J6I A;  4FLH A;  4GU5 A;  3ABK E;  3JUI A;  4JA9 A;  1HU3 A;  2QFC A;  3FUD A;  3LCA A;  1TNB A;  1Z5S C;  4WNE A;  2QC9 A;  2WXP A;  3MV3 B;  4NRH B;  3UMV A;  4HRM B;  3KEA A;  4XI9 A;  4YDY A;  4RG9 A;  2WMN A;  5FQ8 A;  2R03 A;  3Q9U C;  4WND A;  5CEA A;  1SW6 A;  4KBQ A;  2RG8 A;  1W3B A;  4NIK A;  5A6C A;  5B1B E;  3UT8 A;  1N4P A;  4ANW A;  1G3N B;  4HQD A;  4AV7 A;  4XKC A;  3CV0 A;  3V31 A;  2WXO A;  1JUQ A;  4CDM A;  1S0P A;  3CKC A;  3PNT B;  4WAF A;  1MX6 A;  3Q73 A;  4MLP A;  3ZHE A;  4MS6 A;  1NI1 A;  4Q69 A;  1JCQ A;  1S70 B;  2LNI A;  5EX3 A;  2JLB A;  2LSU A;  3C5R A;  4DX7 D;  3CVN A;  3L22 A;  4GZ3 A;  1MX4 A;  4O60 A;  3TGO A;  3J5Q B;  1SA5 A;  1TN8 A;  2HR2 A;  5AAO A;  5J08 A;  1O1T A;  1JPL A;  1UOH A;  2WMO A;  5CRV A;  3CR3 A;  5LX8 A;  5CEC B;  4F7A A;  1ZB1 A;  5G04 J;  2WQ6 A;  4HNA D;  3PZ2 A;  3L6A A;  4HRL A;  5LCW C;  4N3B A;  2R59 A;  4DI4 A;  1H19 A;  3LY9 A;  3UQ3 A;  2L6B A;  3G2S A;  4FAD A;  2R5S A;  3Q75 A;  4HRN A;  4I2W A;  5AQ7 A;  1SQM A;  2LXL A;  4BX8 A;  2WQ7 A;  3UX4 A;  1FVH A;  4ATG A;  1K3Z D;  4I2Z A;  4PS8 A;  4EHM A;  2KC7 A;  5HRY A;  4BT8 A;  3HXD A;  1OT8 A;  3D9K A;  4DK5 A;  2ZU6 B;  1HF8 A;  4LNB A;  4J8S A;  3RAU A;  4UI9 C;  3O48 A;  5AYW D;  4N3C A;  4L2Y A;  3G2V A;  4HLE A;  4C0E A;  4YDO A;  1DCQ A;  2P9L G;  4G23 A;  4GMR A;  4YND A;  3QC1 A;  1OWP A;  3RRM B;  1TNU A;  3TXM A;  3LY8 A;  1OCO E;  3ZU7 B;  4EPZ A;  2DBA A;  2CHX A;  1U3D A;  3LVR E;  1E96 B;  1QZ2 A;  3B95 A;  4CGV A;  2CFU A;  3CVV A;  4KZC A;  3HXE A;  4KVO A;  2A5E A;  3RK6 A;  2EIK E;  4N3A A;  4B93 B;  3LVQ E;  1H0A A;  1N4S A;  5D66 A;  1E7V A;  1HXI A;  4DLQ A;  4URK A;  4O6F A;  4AY6 A;  3ZYK A;  2OVF A;  5CRU A;  3FU3 A;  3C72 A;  1JWG A;  2OV8 A;  3Q47 B;  4IN3 B;  3L08 A;  3ZHE B;  5FIN A;  1YYH A;  2YIN A;  4YVQ C;  4PUC A;  4B8A A;  5JHB A;  3D3M A;  1N11 A;  3QNK A;  3CK8 A;  3TWW A;  2X38 A;  4IRU A;  3L13 A;  5ENP D;  2XRZ A;  2PQN A;  2ZIS A;  1FT2 A;  2MYO A;  2WXJ A;  2LAI A;  5EID A;  4GB9 A;  4I1A A;  2I1K A;  1IHB A;  4G11 A;  1NL4 A;  3MA5 A;  4ZFH A;  2FO1 E;  4JHK A;  3DSX A;  3SZ7 A;  4HOU A;  3LDZ A;  4Q96 A;  2GRP B;  2XEE A;  2XEV A;  1TJC A;  5EKQ D;  3D9O A;  3SGH A;  4DRX E;  3JQ1 A;  3FUF A; 
#chains in the Genus database with same CATH homology
 2HO1 A;  4ILG A;  3B7U X;  4CEM A;  5FZQ A;  4F1S A;  4LER A;  3ZPJ A;  4HS2 A;  5KJK A;  4TUU A;  2XCC A;  4APO A;  5DBK A;  4PDX A;  3NZU A;  4OYS A;  4FC8 A;  5HI7 A;  5G04 C;  4A55 A;  1UN9 A;  2KCL A;  4WWN A;  5AJL A;  3MX3 A;  3FTU A;  4E85 A;  3QB2 A;  2AXZ A;  3UPV A;  5ARG A;  3PE3 A;  2V8S E;  3MJW A;  5KCM A;  3PNL B;  2CG3 A;  3HDX A;  3U66 A;  1N52 A;  4L23 A;  2P58 C;  1U3C A;  3GYZ A;  4L1B A;  4EEC A;  4JEH A;  1H2T C;  1EF1 C;  3B7T A;  4FJZ A;  2VSY A;  2VSO E;  1WM5 A;  3PDN A;  4NQ0 A;  4W9R A;  2MRI A;  5KJN A;  4ANX A;  3RKV A;  4U8H A;  2KCK A;  3PE4 A;  4HOQ A;  1HG5 A;  3CVY A;  1LF8 A;  3CVP A;  3IBE A;  4XX5 A;  4CGW A;  5FZR A;  3Q4A B;  3TG5 A;  3CVX A;  3I3N A;  1HE8 A;  3EHM A;  1IQR A;  1HO8 A;  3FUJ A;  3G2W A;  2Y4U A;  2UY1 A;  1N54 A;  2J9Q A;  3FUK A;  1SZ9 A;  4M3O A;  4UWH A;  3BG0 B;  1Y6I A;  2CG2 A;  4FJY A;  3ZXS A;  3CHS A;  3CIA A;  3ASH A;  4LCT A;  2I9C A;  1X5B A;  1H2V C;  3SHF A;  1MQS A;  3LY7 A;  3SNX A;  2VSN A;  5T3R A;  1GW6 A;  4CT0 A;  4B8C B;  3WXX A;  2I6H A;  5JJT A;  3D9N A;  5BNW A;  5EDS A;  1OWM A;  3FUE A;  4MKT A;  3D9J A;  4KZ0 A;  4JL0 A;  4QFV A;  3MV2 B;  3Q49 B;  1NA0 A;  3IEG A;  2IQC A;  1E90 A;  3CHP A;  1OUV A;  5CHE E;  3I5P A;  5C1D A;  4RVB A;  3L17 A;  4TRQ A;  4XI0 A;  3G2T A;  4YVO A;  4I17 A;  3B13 A;  3LXU X;  1E7U A;  2I1J A;  2LAH A;  2IU1 A;  4G24 A;  4I6J A;  1UG3 A;  1E8Y A;  2WXG A;  3HIZ A;  2PL2 A;  3ESK A;  4UWL A;  4EQF A;  5JJ6 A;  3FP3 A;  2A4Z A;  4AIF A;  4GZ6 A;  2BF0 X;  1TJF A;  2WXR A;  4Q94 A;  4GZ5 A;  3L16 A;  3APC A;  3FTS A;  4F3V A;  2PQR A;  4AOF A;  1MHQ A;  2IOS A;  3HVE B;  1HG2 A;  2HYZ A;  3AS8 A;  2V4L A;  3PRE A;  2VTB A;  4FUL A;  2FO7 A;  4HOT A;  3FUH A;  3AU4 A;  3LJ3 A;  4ILI A;  4N39 A;  4GYO A;  3EHN A;  4IUL A;  4H7Y A;  2LO6 A;  4I1M A;  2X6H A;  5LP0 A;  3FUM A;  3ASG A;  3KD7 A;  2X3M A;  1HX8 A;  2MOW A;  2IF4 A;  2VYI A;  3ESL A;  3NZS A;  4ILH B;  2XHE A;  3OTN A;  4J8D A;  2WXH A;  2OVB A;  4FHJ A;  3D9M A;  2CHZ A;  1NP7 A;  3ZW3 A;  1H6K A;  5G05 C;  3FTY A;  3IV0 A;  4ME2 A;  2OOE A;  2IOL A;  3LS8 A;  2DIW A;  2GGF A;  4N5C A;  4XE0 A;  5T4Y A;  4WNG A;  3QJZ A;  3U64 A;  4I9C A;  2FEZ A;  2XGS A;  4CCA A;  1DVP A;  3D9I A;  4JEU A;  4NUR A;  3GZ1 A;  3ZYL A;  1SZA A;  3FWV A;  2J09 A;  5ENN A;  5J90 A;  3Q5M A;  3ULQ A;  5LCW J;  4GA1 A;  5BV0 A;  3OXL A;  2KCV A;  3P2B A;  4AM9 A;  2WXM A;  3FU6 A;  4WWO A;  2WVI A;  1B89 A;  1EPU A;  2GRL A;  3SBT B;  5CMY A;  3QWP A;  3PH0 C;  3B7R L;  4KMO A;  5FQ7 A;  1UJJ A;  1ZBP A;  3GZS A;  2GW1 A;  4GPK A;  1IYG A;  3KEZ A;  4B0Z A;  3PZD A;  4LEU A;  3SI5 A;  1NZN A;  5ANL A;  3S7F A;  3BEE A;  4I6E A;  1JWF A;  4HOS A;  3OXG A;  3CVW A;  3TG4 A;  1Y8M A;  2XPY A;  2CHW A;  5JJ7 A;  2KZT A;  4JC8 A;  5JHA A;  2Y4T A;  3MEK A;  1E8X A;  1KLX A;  3P1U A;  2EQX A;  2I2O A;  3MYV A;  4KYO B;  4TV3 A;  5FZS A;  2J07 A;  1P5Q A;  3NQP A;  4HXI A;  4K0R A;  4NAC A;  4LRZ A;  1YA0 A;  2PM6 A;  4B89 A;  1OWN A;  4DJA A;  2J08 A;  2X6I A;  4ABN A;  2WXF A;  1OWL A;  3U9W A;  3APF A;  4BT9 A;  3IHV A;  2C0M A;  3EIJ A;  1E8Z A;  4JVS A;  2WXI A;  4G2V A;  4EZL A;  5AEN A;  3D9P A;  1IHG A;  2ILR A;  3U4T A;  4J6I A;  4FLH A;  2DCP A;  3LPZ A;  4GU5 A;  4BTA A;  4HVB A;  3FH7 A;  3CKB A;  3CVQ A;  4U0S A;  2VGX A;  4H7X A;  5CCM A;  3R9A B;  1TEZ A;  5E76 A;  3MGB A;  1FVF A;  3JUI A;  3L54 A;  4JA9 A;  1HU3 A;  2QFC A;  4BY6 A;  3FUD A;  3LCA A;  5FQ4 A;  3EDT B;  2FBN A;  3ZRH A;  4WNE A;  2VTB B;  3QDN A;  2WXP A;  4JA7 A;  3ZYM A;  4A1S A;  3MV3 B;  3CVL A;  3S2A A;  4NRH B;  3UMV A;  3QWW A;  2IJG X;  4KT6 B;  4XI9 A;  3VLD A;  4I1O B;  4RG9 A;  2WMN A;  5FQ8 A;  3N71 A;  3VTX A;  3PEV B;  2R17 C;  3ZEF A;  1UJK A;  3FTX A;  3FEY A;  4WND A;  1L5J A;  3E4B A;  5EX0 A;  2KM4 A;  3MKQ B;  2RG8 A;  1W3B A;  4KBQ A;  3B7S A;  4I43 A;  5A6C A;  4V3I A;  2PZI A;  1ELW A;  3UT8 A;  4ANW A;  4AV7 A;  3UT4 A;  4XKC A;  4GYW A;  3CV0 A;  2E0I A;  4UQX A;  5BT1 A;  3PS6 A;  4EBA A;  4K03 A;  2V0P A;  1UW4 B;  2WXO A;  1ELK A;  5HQ8 A;  3KS2 A;  4GZD A;  2XGO A;  3AS4 A;  3HYM B;  3OXF A;  1JUQ A;  1EDU A;  1S0P A;  3CKC A;  4MLP A;  3PNT B;  4WAF A;  4CDM A;  3FH8 A;  4J0U A;  3ZHE A;  4MS6 A;  1VDY A;  4Q69 A;  3K9I A;  1ELR A;  2LNI A;  5EX3 A;  3CST A;  4G25 A;  4P29 A;  2JLB A;  2LSU A;  3PEU B;  3CVN A;  3ONK A;  4UQY A;  3L22 A;  4GZ3 A;  3S7J A;  4LUN U;  3SBS A;  2FF4 A;  4G26 A;  3TGO A;  4XIF A;  1PC2 A;  2FUL A;  3FTW A;  3DBS A;  4AXH A;  4DPR A;  4GAA A;  4JPS A;  3ZIM A;  5M72 A;  4AEZ C;  3KAE A;  4JW1 A;  3ZYQ A;  2VGY A;  4XZ4 A;  2XPZ A;  3CSF A;  2HR2 A;  3I4G A;  3SF4 A;  5J08 A;  4U04 A;  3LYA A;  1JPL A;  2WMO A;  1EYH A;  1FCH A;  4UWK A;  3CR3 A;  5LX8 A;  4F7A A;  3GW4 A;  4UWG A;  5D0Q D;  5G04 J;  2WQ6 A;  4C0M A;  3L6A A;  3IHY A;  5LCW C;  4N3B A;  2WXK A;  2R59 A;  4DI3 A;  4AJW A;  5G2N A;  4DI4 A;  1H19 A;  2BUG A;  3LY9 A;  2XRY A;  4JZY A;  5LOZ A;  3UQ3 A;  3S7B A;  2WXQ A;  3FUL A;  4A3T A;  1XNF A;  3FEX A;  3LKU A;  3G2S A;  5LFA A;  3MZL B;  5ARF A;  5FTP A;  3RO2 A;  4KXK B;  4FAD A;  3EIQ C;  4AVX A;  4N2S A;  5BUZ A;  2R5S A;  1UN8 A;  2AWI A;  4JHJ A;  3R7R A;  5BV1 A;  4I2W A;  5CMW A;  2KAT A;  3O4Z A;  2AXU A;  1SQM A;  4APF A;  4ACL A;  4OVV A;  4BX8 A;  2WB2 A;  3PVL A;  4AP2 A;  1E8W A;  4XKB A;  2IFU A;  2YNQ A;  3NF1 A;  2L6J A;  3UX4 A;  2AXV A;  2WQ7 A;  1FVH A;  4ATG A;  2JEK A;  3ML8 A;  1Z3Y A;  5C2Y A;  4I2Z A;  3FFL A;  3QOU A;  3FUI A;  4PS8 A;  4Y6W A;  2KC7 A;  3I4R B;  3FH5 A;  4BT8 A;  4D10 C;  3FY4 A;  2NC9 A;  4WWP A;  2L0T B;  3D9K A;  4DK5 A;  2E2E A;  3G2U A;  2VSX E;  3QK0 A;  1BPO A;  3ONL A;  2ZU6 B;  1HF8 A;  3AU5 A;  3CHM A;  3MKR A;  5E75 A;  4J8S A;  4PH4 B;  3MKQ A;  4PS7 A;  2J49 A;  5FWQ A;  1XGW A;  4UI9 C;  3CLJ A;  3OAW A;  3JCK C;  3T5V A;  1KT0 A;  3RJV A;  2CFZ A;  3O48 A;  4MRU A;  5AYW D;  3VLF A;  5ANR A;  3R7Q A;  3JYS A;  4N3C A;  3RRN B;  2VJ8 A;  4L2Y A;  3G2V A;  2QY7 A;  2C0L A;  4HLE A;  4C0E A;  2WXN A;  2XCB A;  1KT1 A;  2XPI A;  5G55 A;  2XGM A;  4UWF A;  3FTV A;  4G23 A;  4ANU A;  2WM9 A;  4YND A;  3TAX A;  3TXN A;  3QC1 A;  1OWP A;  1QQE A;  4FHK A;  4UI9 J;  3RRM B;  3TXM A;  1A17 A;  2UWJ G;  3PUK A;  3TL5 A;  4CDN A;  2M63 A;  4J8E A;  3LY8 A;  3C98 A;  3VTY A;  4FP7 A;  3BG1 B;  3Q15 A;  1HS6 A;  1WY6 A;  3T5X A;  4C9B B;  4EPZ A;  3PRZ A;  4HOR A;  2GRM A;  2DBA A;  1HZ4 A;  5BW8 C;  2RD0 A;  2CHX A;  1U3D A;  1PAQ A;  3VLE A;  3LEW A;  2VGX B;  3LVR E;  2AVP A;  4BFR A;  3PUJ A;  2YHE A;  4GMJ A;  2BTD A;  2VQ2 A;  4GYY A;  1E96 B;  4HFG A;  2YQ8 A;  4A1G A;  4RG6 A;  1WAO 1;  3URZ A;  4EZK A;  1QZ2 A;  2OND A;  3CK9 A;  2AW6 A;  3CHO A;  3MCX A;  4CGV A;  2A5U A;  2CFU A;  3RU0 A;  3CVV A;  3RIB A;  3CEQ A;  4GML A;  4KZC A;  1PY1 A;  3HHM A;  4L2L A;  4UQZ A;  3GZ2 A;  4KVO A;  4J8F A;  3RK6 A;  3CK7 A;  4F53 A;  3FU0 A;  4JXT A;  2WPV A;  5BPP A;  4N3A A;  4BWR A;  3FU5 A;  3QKY A;  5AJD A;  2ION A;  3FDH A;  3LVQ E;  1H0A A;  4FLB A;  4B94 A;  1E7V A;  2X6K A;  1HXI A;  4DLQ A;  1Z3X A;  4URK A;  1H2U A;  4O6F A;  3DPD A;  1HH8 A;  3CQG B;  3CQC B;  1ZU2 A;  4GA0 A;  4KVM A;  3FTZ A;  5FT9 A;  4AY6 A;  4JHR A;  3ZYK A;  2OVF A;  2Y3A A;  3FU3 A;  4AY5 A;  2NXP A;  4L7T A;  1JWG A;  4CT4 A;  2OV8 A;  3QAQ A;  3Q47 B;  4IN3 B;  3L08 A;  4WUY A;  1IQU A;  3ZHE B;  4G1T A;  3QWV A;  3UUX A;  3ZN3 A;  3CHR A;  2FI7 A;  4RSY A;  2Q7F A;  2YIN A;  2C2L A;  1NA3 A;  3EJN A;  4YVQ C;  3TJP A;  4FA6 A;  4PUC A;  4B8A A;  5JHB A;  3D3M A;  4U07 A;  4EBA G;  4DLO A;  3QNK A;  3CK8 A;  2L0I A;  4GA2 A;  3SFZ A;  2WXL A;  1INZ A;  2X38 A;  3JQ0 A;  4IRU A;  3L13 A;  5T8I A;  3ASF A;  2X6F A;  3T8M A;  2XRZ A;  3CGH A;  2PQN A;  3QAR A;  2UY1 B;  1QNF A;  4U63 A;  5D0O D;  3RRU A;  4UI9 K;  1DNP A;  3SD5 A;  3FUN A;  4I6G A;  3U3W A;  5A23 A;  4BSX A;  4R7L A;  2WXJ A;  2LAI A;  4E6H A;  3FHE A;  4BX9 A;  2V5F A;  4I9E A;  5KJM A;  2L9B A;  1OWO A;  4EZJ A;  4U0Z A;  5AIJ A;  4GB9 A;  2WQH A;  2PM7 A;  4I1A A;  3UT7 A;  2I1K A;  3RO3 A;  3ZVV A;  4CRW A;  4A3V A;  3AS5 A;  4PS3 A;  4ANV A;  4GCO A;  4G11 A;  4ACK A;  5G05 J;  3MA5 A;  2NSZ A;  4N2Q A;  4IYP A;  5DIZ A;  3ZGQ A;  3D9L A;  3S7D A;  3ZFW A;  3IKO B;  4JHK A;  2HM8 A;  5A7D B;  2MHK A;  3CHQ A;  3CVU A;  3ASD A;  1HFA A;  2J4B A;  3ENE A;  3APD A;  3SZ7 A;  5FQ6 A;  5FJY A;  2KZT B;  4CDR A;  4OVU A;  1Z6T A;  2LSV A;  2X6J A;  3ML9 A;  4HOU A;  2J4D A;  2YHC A;  3LDZ A;  4FU3 A;  4Q96 A;  4GZC A;  2XQ0 A;  4U0U A;  2XEV A;  3HVE A;  1TJC A;  4GCN A;  5EKQ D;  3D9O A;  4WNF A;  3SGH A;  5KJL A;  3JQ1 A;  3FUF A;  4Y6C A;  4BTB A;  5CCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...