4ACKA

3d structure of dotu from francisella novicida
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
155
structure length
152
Chain Sequence
MKDFKEIEIILDIIKTTREIIENDNEKISYHRNNIRKSIFFLQEELLEKYSETVCKYIVFPLLAYVDEKLMLLREKSASNISWSLLQLEYYDRKDGGEYVFEITDNILSENIYPQICYQTISLILHNDFYGKYYDNIYNHSFLAYKKEIDKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Conserved Type Six Secretion Protein Tssl (Dotu) from Francisella Novicida
pubmed doi rcsb
source organism Francisella novicida
molecule tags Protein transport
molecule keywords TSSL
total genus 59
structure length 152
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.590 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ackA00
4V3IA 4ACKA 3U66A 4ACLA
chains in the Genus database with same CATH superfamily
4BETA 3F6QA 5BV1A 1VDYA 3UMVA 3DBSA 2HM8A 3BU8A 1QQEA 3O48A 3IV0A 4B8AA 4I6EA 2OEVA 2ZXWE 3MJWA 2AW6A 4WWNA 4N3CA 1OWLA 4GZ3A 4TXQA 3QNKA 2IFUA 1H6KA 3HVEA 3T5VA 1HO8A 3CV0A 4NQ0A 3L6AA 4I9EA 3RSEG 1IXVA 4CEMA 1LD7A 2J08A 3FFLA 3MV2B 3J5QB 5EYPF 2WQHA 3APDA 3C3OA 4G23A 5E76A 5LOZA 1OCZE 3U64A 3DEPA 2KZTB 3ABME 2WXFA 2BEDA 2R5SA 4I2ZA 5LCWC 3BQOA 3HXBA 3V31A 5ENSD 5JJ6A 3ZYMA 4UWLA 4GTQA 3IKOB 4YVQC 1MJ0A 3HRAA 1HFAA 4C0MA 5BV0A 4F53A 4JL0A 4EHMA 1EDUA 3FUJA 4JHJA 2IO2C 2X6IA 2XZDG 3B7UX 3O4ZA 1N52A 3ZHEB 1KZOA 5LCWJ 5KJMA 1TJCA 4HI8A 4ACLA 3Q75A 3T8KA 3TJPA 5CECB 4GYOA 4GTSA 4ME2A 4JPSA 1OT8A 4U63A 5J90A 1DC2A 4G8KA 3CHQA 4I6JA 2DIWA 3P1UA 3L13A 4ANUA 5CRUA 4B93B 5CMWA 2F37A 2BF0X 4HOQA 1S64A 4WNEA 5B1BE 1OWMA 3FU5A 3ASDA 3IXEA 2RFAA 3D9NA 5T4YA 3U9WA 5BUZA 2XCBA 2NXPA 4GZDA 3GZ1A 2V5QC 2R59A 1BPOA 5KWDA 2UY1A 1OCOE 4BX9A 4HOSA 3CGHA 2VGXB 3EHRA 1ELRA 3IBEA 2J07A 1IKND 1Q2ZA 3SNXA 3EJNA 3DXMG 2QC9A 2GROB 2ZU6B 1SA5A 4GZ5A 4UI9J 2CG3A 3EHQA 5ENNA 1WDYA 3UM3A 1HG5A 4MBGA 3FH8A 4A1GA 3B7TA 2MRIA 4GZCA 2Y1LE 3QDNA 2R17C 3QC1A 3ZXSA 3WXXA 3UTMA 2EILE 2FO7A 2KM4A 3JXIA 1S0PA 4MS6A 3UKUG 4MLPA 1E8ZA 2FULA 3UQ3A 3JQ0A 4GA1A 5AJLA 5JMND 4F7AA 5BNWA 3V79K 5ENTD 5FINA 1N9AA 2XPYA 2E0IA 2WXKA 3D3MA 1FT2A 3DEOA 4WNFA 4IN3B 5J08A 4HRNA 3ZN3A 2DCPA 3HYMB 3RU0A 3WG7E 3ZVVA 3PNTB 3R9AB 2FEZA 1QZ2A 3HXEA 2P9KG 3W9GA 2PQNA 3GZ2A 5KBAA 4FJYA 3PRZA 2J09A 2JABA 4L23A 2WM9A 3PVLA 2P9NG 2WMOA 4LNBA 2J9QA 1K1BA 3TAXA 2XCCA 2I1JA 3EIQC 3NOGD 4Q94A 3LY7A 1JPLA 4G1TA 3G2WA 3ZRHA 4AY5A 1EPUA 4BFRA 4DRXE 2WXRA 2I2OA 4HFGA 4WWOA 4CGVA 1NZNA 3TWXA 3UT7A 4HQDA 3QWPA 5FQ8A 3D9IA 3AU5A 4IULA 3P2BA 3RAUA 3VLFA 3ZYLA 3EU5A 3PS6A 2MHKA 4U8YD 2ETAA 4JVSA 2I1KA 4AJWA 4AV7A 5EN5D 3DXKG 3CK8A 5G2NA 4A1SA 5G05C 4KXKB 2C0LA 3QK0A 4FLBA 4DLOA 1TEZA 2QFCA 4CT4A 4OAVB 3UT8A 3EHNA 3UT4A 2XZTG 2EIKE 3FH7A 3TWWA 1H6PA 3QAQA 2ONDA 1IQUA 2L6BA 4BT8A 4JB8P 4CDMA 3L54A 5G05J 4L9PA 2NC9A 3NOCD 1N11A 1MHQA 4GA0A 5HQ8A 4GB9A 3AG2E 4G25A 3Q79A 1PY1A 4BWRA 1TNYA 3FP3A 3I4GA 3HIZA 4RLYA 4LSZE 4IYPA 2MOWA 5FJYA 4FADA 5AARA 3NF1A 4J0UA 4HLEA 2A5UA 3FH5A 5CMYA 3GW4A 5FQ7A 3DRAA 4JHRA 4XKCA 2YINA 3SFZA 4UWFA 2ETBA 4HS2A 2WXOA 4JXTA 1K3ZD 3B95A 3ASNE 1NA3A 3CVYA 4KVMA 3QWVA 3SGHA 4I9CA 1WAO1 1O5MA 3X2QE 5AAOA 3FTSA 4PDXA 3ZYKA 4K5AB 5HS0A 3AU4A 1UJKA 3ASFA 4I43A 1KLXA 3BG1B 5B1AE 2EIJE 3FWVA 2WXHA 2RD0A 4PS3A 2V8SE 1WM5A 1HE8A 4W9RA 3NQPA 1K8KG 3ZNGA 2KCKA 4WNGA 2GRQB 3CVNA 3U66A 2IONA 3CKCA 4G24A 3SBSA 3ZW3A 5KNHD 2XGOA 4NACA 3ULQA 1UW4B 4A3TA 4K03A 3MCXA 5AENA 4GTPA 5EX3A 3RJVA 1NL4A 3D9JA 2QY7A 4XX5A 2FF4A 5BW8C 2LSUA 3MYVA 3CR3A 3PUJA 3AG3E 1JWFA 4LNGA 4UI9K 2WPVA 5JJ7A 3EUVA 2P9PG 4XI9A 4AM9A 2R05A 1AP7A 3T5XA 3NB2A 1IYGA 4APOA 5EDSA 3DSTA 2KBXA 3FU3A 5CRVA 2NYJA 4I2WA 3IEGA 4EECA 2AXZA 3NZUA 3S2AA 3Q15A 4BTAA 1E90A 3UI2A 4AOFA 3G2TA 2WXMA 4J7WA 3Q4AB 2DYRE 1SZ9A 2DBAA 5FQ6A 1N4SA 3ASOE 2VTBB 1LF8A 2WXQA 5BT1A 3KSQA 3MKRA 3CKBA 4U0SA 5HKPA 3K9IA 3CHPA 1N94A 4I1OB 5EIDA 2R2LA 4GCOA 4MRUA 5ENOD 4KYOB 2VSOE 1JWGA 1INZA 4CDRA 2AXUA 3CHOA 1W3BA 2RKKA 4HOUA 1IQRA 5C2YA 1H2TC 3ZPJA 2PQRA 3HXDA 4OVVA 3E37A 5KJLA 4AVXA 1O1RA 2B0OE 2LXLA 1QYMA 3LJ3A 2VGEA 4DJAA 4UWHA 1H6OA 2XEEA 4L7TA 3HXFA 4ANWA 4TXPA 4YDOA 3JYSA 2Q7FA 2WXJA 2AJAA 2NSZA 2EQXA 4XKBA 3PUKA 4LEUA 3C98A 4V3IA 1BLXB 5G04J 2GRPB 3L16A 2MYOA 4Z68A 3CHMA 4J8SA 5IY5E 1BI8B 2F0YA 1DNPA 3ZIMA 4F6RD 2Y4TA 4LUNU 1D9SA 4DLQA 3PE4A 3ULYA 4ATZD 2VSXE 2HYZA 4DUIA 2GGFA 2WXPA 3CVWA 2L9BA 3LKUA 3OTNA 3U4TA 3T8MA 2VYIA 1TJFA 5FTPA 2YNQA 1Z5SC 2X6KA 5E75A 4B94A 2XENA 3Q9NC 2J8SD 5CEDB 1Z3XA 4QQIA 4J8EA 2CG2A 3UIOC 3SHFA 4WAFA 3PZ3A 5FT9A 4ACKA 3TWTA 3APCA 4N3BA 4GZ6A 3SI5A 5EIBE 3MKQB 3OXFA 2QYUA 3ZGQA 3DSWA 4G8LA 4BT9A 2XRYA 2FBNA 4XIFA 5AYWD 2P9UG 1N4PA 3DSXA 2F8YA 2IOLA 3FHEA 5T8IA 3UXGA 4FP7A 1KPSB 2X6HA 1U3DA 3FUNA 1NA0A 2XGSA 3FEXA 5D0QD 3G2SA 3NAWA 2WXIA 3V2OA 3FDHA 4F3VA 3LVRE 3TWQA 4AIFA 2BKGA 3KAEA 3ZKJA 4ANVA 4YDYA 1JCQA 1KT1A 2P58C 1IHBA 3AS4A 1RZ4A 3RRMB 3L9TA 3QB2A 3BEEA 4GAAA 4M7CA 3LXUX 3D9MA 2LNIA 2KATA 4U0UA 3FTVA 4J8DA 3PE3A 3SQVA 4FA6A 2FO1E 1Y8MA 4CRWA 2VSNA 3LDZA 5AIJA 4EPZA 5LP0A 3VLEA 4RVBA 3L82A 5JJTA 3N71A 2CHZA 2PM6A 3FUKA 4C48B 5ENRD 3TWUA 2H6IA 3E30A 1E7UA 3LJNA 4HRLA 4EBAG 5ITZF 3QOUA 3FUFA 1UG3A 4EBAA 4B8CB 3TXNA 2P2CP 4G26A 1LD8A 2P9LG 4UWKA 2XEVA 3OAWA 4APFA 5CBOA 3ZU7B 1E96B 3LPZA 4DX6D 3ZFWA 4CCAA 1BD8A 2LAHA 4ATGA 3AG1E 4JZYA 1E8WA 1N95A 1SZAA 2I6HA 1YA0A 3ASHA 5HRYA 4KBQA 2V4LA 1LTXA 1JCSA 5C1DA 5FZQA 3DPDA 5ENPD 3MZLB 2DYSE 3LVQE 1TN7A 2VTBA 4FC8A 3AS8A 3HHMA 2XHEA 1H0AA 3UINC 2QZAA 2VQ2A 4B0ZA 4BERA 4BY6A 4LCTA 3SF4A 3IHYA 1O1SA 3UPVA 1OCCE 4EZJA 5LFAA 4WWPA 3Q9UC 4O1PA 3PZ1A 1D8DA 3UX4A 3DWLG 2YQ8A 4K5BA 4CYMD 5ANLA 3B7BA 2I9CA 3D9LA 3ZUVB 4NRHB 2X6FA 2ILRA 4DX7D 1OY3D 3G2UA 4GYWA 3JQ1A 4FULA 2IEJA 4N3AA 2OV8A 1X81A 4DX5D 1A17A 3ML9A 5KCMA 3QKYA 4JD2G 4KT6B 3KD7A 4FLHA 2IF4A 4JEHA 3RKVA 3KS2A 3CK7A 3B7RL 1S63A 1G3NB 1Z3YA 4F1PA 1FCHA 1XGWA 2WXNA 4ILIA 4DPRA 2ZGGA 5FIOA 4JW1A 3SO8A 3Q47B 3UIPC 1SA4A 5A23A 3C5RA 3FU6A 5D2MC 4I6GA 2YHEA 3DSVA 3Q7AA 4GA2A 1N0QA 2WVIA 4WUYA 1E8YA 3LCAA 1GW6A 1AWCB 2IO3C 2LXMA 2P9IG 4YDEA 1HF8A 5AJDA 4Y6WA 1HU3A 1BI7B 2VSYA 3I5PA 2XS8A 4F1SA 3ESKA 1PC2A 1V54E 2VGXA 2IOSA 5CCMA 3E32A 4UQZA 2X6JA 3ZXPA 5JA4D 5CERB 2JEKA 4D10C 3ABLE 3MV3B 3PZ4A 5FZSA 1UN8A 2RFMA 3OXGA 3LY9A 3CLJA 4U95D 3D9KA 3ULEG 3EHMA 3V30A 1KT0A 1MQSA 1ELWA 3FUEA 1N4RA 2OOEA 4B89A 1KZPA 2H6HA 3FTUA 2JLBA 2XRZA 4HLLA 3JUEA 2UWJG 4GMRA 4GPKA 2WMNA 2R02A 5B3SE 4NURA 3CK9A 2Y4UA 4H7YA 1EF1C 4XZ4A 3I4RB 4OAUC 1OWPA 2LO6A 4GCNA 1V55E 2HE0A 3C3QA 1EYHA 2CFUA 3TWRA 4HORA 3UM2A 2XPIA 4U04A 5AN8A 2LSVA 1Z6TA 4JEUA 3TWVA 5EX0A 2L0IA 2AWIA 3D9OA 3LYAA 4TUMA 3VLDA 3EU9A 2LAIA 1U3CA 3BG0B 3CHRA 3JXJA 2ZGDA 5JHAA 1WY6A 2EIME 4I1AA 3QWWA 2CHXA 4BEPA 2GRMA 2M63A 4P29A 3CVQA 4GTTA 5KNGA 3ISMC 2ZISA 1OWNA 3LS8A 3DSUA 5G55A 1MX6A 3L22A 1HZ4A 4CDNA 2L0TB 1QNFA 2C0MA 3CEQA 3Q78A 3L17A 4DK5A 4UUCA 4HVBA 1A5EA 2KZTA 4A3VA 4BSZB 2WXLA 4N39A 3E34A 4ILHB 4C9BB 4CZ2D 1IHGA 1NP7A 3Q7FA 4JC8A 1HX8A 4XEIG 3JUIA 3QJZA 2FI7A 2V5FA 1MZCA 2BKKB 4LG6A 5CBNA 4FHKA 3NBNB 4ABNA 3EDTB 4U07A 4KZCA 3UM0A 4U8VD 1TNOA 2J4BA 1TR4A 4OVUA 2PL2A 1HH8A 5ARGA 1DCQA 3ASGA 3KSLA 4AXHA 3B13A 2HR2A 4KMOA 4EZLA 3D9PA 4I17A 2GRNB 1MYOA 1NFIE 3RIBA 2A4ZA 3RO3A 3CQGB 3ONLA 3PEUB 4ZFHA 3CSFA 3W9FA 3CIAA 5KJNA 1FVFA 2BUGA 5A7DB 1O1TA 4HB5A 1X5BA 2PM7A 3HDXA 4H7XA 3CVVA 4J6IA 4M3OA 4UQXA 3FTYA 4DI4A 4RSYA 5EYLA 2KCLA 1FVHA 3EIJA 1OUVA 3PEVB 4BX8A 1TN8A 4XI0A 4ILGA 2CFZA 2XPZA 5D0OD 2WQ7A 3UKRG 4Y6CA 1SQMA 3LY8A 4Q96A 4TRQA 1TNUA 3T9KA 4E6HA 4A63B 3MA5A 4L1BA 1FT1A 3FTZA 1ZU2A 5CHEE 3SZ7A 5CCLA 1N54A 2KC7A 4HXIA 3RO2A 3E4BA 1XNFA 4RQIA 3R7RA 4LRZA 3SY2A 2KXPC 1H2VC 4GU5A 4HNAD 3B7SA 4L2YA 4GMJA 4FU3A 5FQ4A 2DZNA 4PS8A 4GMLA 1FPPA 4LERA 1L5JA 3RK6A 3VTXA 3CQCB 4HI9A 4GTVA 3FTXA 4J8YA 3ZYQA 2DZOA 4WNDA 4KVOA 4AP2A 5FWQA 3KEAA 4FHJA 2IU1A 3UUXA 3PREA 5DIZA 2VJ8A 5KJKA 1Y6IA 4A55A 3DSSA 4DI3A 4HOTA 4GPMA 3CSTA 4N5CA 3FTWA 2C2LA 5HI7A 4JHKA 5ANRA 2J4DA 3S7DA 4URKA 4G2VA 2X3MA 2CHWA 2XGMA 2DVWA 4UQYA 2KCVA 2OCCE 3J5PA 5EILA 3C72A 2OEWA 4AY6A 4RG9A 3PZ2A 3FULA 3AG4E 3ABKE 4JA9A 5D66A 5BXUA 4BTBA 3HVEB 1BU9A 2OVFA 1ELKA 5EKQD 3GYZA 5M72A 3TWSA 2Y3AA 2XS1A 2PNNA 4TXRA 2BTDA 3ESLA 4PS7A 5H7PA 2P9SG 3S7FA 2AVPA 1MX4A 2RG8A 4I1MA 2XQ0A 4U7EB 1NI1A 1PAQA 1DCEA 3HXCA 3ZEFA 2GRLA 2B6CA 2Y69E 2UY1B 3FUIA 3MGBA 2ETCA 1WG0A 4GTRA 2WXGA 1YMPA 4N5QA 3S7JA 4G11A 5ENQD 4U0ZA 4HBDA 3L08A 3R9MA 3PZDA 5BPPA 4GTOA 2HO1A 3ML8A 4LNUD 2ZIRA 2YHCA 3C3RA 1QBQA 5AQ9A 4JA7A 4YDWA 2WQ6A 3SD5A 3BUAA 2VGYA 2L6JA 3FY4A 4K0RA 4E85A 2EINE 2WB2A 2A5EA 3FU0A 3RRNB 4X8QA 1H19A 4FJZA 5A6CA 3CVPA 2J49A 1JUQA 5FZRA 3VTYA 5JHBA 1RW2A 4NIKA 3PDNA 1SW6A 2V4HC 3TGOA 4EZKA 2H6GA 3KEZA 2PZIA 1UJJA 4BESA 5ARFA 5BXOA 1HG2A 2Y0BG 3E33A 4Q69A 5AQ7A 1D8EA 4O1OA 1MX2A 4L2LA 4RG6A 1UOHA 4O60A 3S7BA 1OWOA 3LEWA 3D9HA 2LUHA 1S70B 3APFA 3AAAC 1HXIA 1TYQG 4U96D 1E8XA 5G04C 3HG0D 3URZA 4GTMA 3TXMA 2R03A 3PH0C 3GZSA 2X38A 4BSXA 3TL5A 3CVUA 2V0PA 2H6FA 4YNDA 3ZHEA 4DX2A 3MKQA 1OXJA 3UM1A 3G2VA 4XE0A 4QFVA 3TG4A 4C0EA 3V2XA 2GW1A 4K5CA 4MKTA 2OVBA 3DPYA 3MEKA 4GYYA 2IJGX 3IHVA 3RRUA 3CHSA 1U2VG 5T3RA 1TNZA 3TG5A 1ZB1A 3OXLA 5LX8A 3U3WA 4ANXA 3ONKA 2QYJA 3FUMA 1JCRA 3I3NA 3FUDA 4N2SA 2F8XK 1E7VA 4PUCA 3SBTB 4UWGA 3QARA 3SFYA 4CT0A 5AQBA 3CVXA 3Q73A 1B89A 3MX3A 2GRRB 2E2EA 1N4QA 4TV3A 3PNLB 4EQFA 1YCSB 2XEHA 4OYSA 4IRUA 4U8HA 2AXVA 2DWZA 4CGWA 4AEZC 1UN9A 4J8FA 3Q49B 4N2QA 3CVLA 5DBKA 1P5QA 3FUHA 3Q5MA 1SVXA 1YYHA 4PH4B 1N0RA 3JCKC 4KZ0A 4DX1A 1H2UA 3SFXA 1OCRE 2IQCA 2IY0C 4YVOA 1HS6A 1DVPA 4O6FA 3ENEA 5CEAA 4R7LA 5AQAA 1TN6A 1K1AA 4ZHBA 4HRMB 3AJIA 1ZBPA 4UI9C 3NZSA 4TUUA 3AS5A 3R7QA 3FEYA 1TNBA
chains in the Genus database with same CATH topology
2YINA 3MA5A 1YA0A 3SFZA 4L1BA 3ASHA 5BV1A 1VDYA 4UWFA 3UMVA 3DBSA 3FTZA 2HM8A 4HS2A 1QQEA 2WXOA 2V4LA 4JXTA 4KBQA 3O48A 1ZU2A 3IV0A 5CHEE 4B8AA 3SZ7A 4I6EA 5FZQA 5C1DA 5CCLA 1N54A 2KC7A 3DPDA 1NA3A 4HXIA 3CVYA 4KVMA 3MZLB 3QWVA 3RO2A 3SGHA 4I9CA 1WAO1 3MJWA 3E4BA 1XNFA 3LVQE 2AW6A 3R7RA 4LRZA 2VTBA 4WWNA 4N3CA 1OWLA 4FC8A 1H2VC 3AS8A 3FTSA 3HHMA 2XHEA 4GU5A 3B7SA 4PDXA 1H0AA 4GZ3A 3ZYKA 3AU4A 2VQ2A 3QNKA 2IFUA 1H6KA 4B0ZA 1UJKA 4L2YA 4GMJA 4BY6A 4LCTA 3SF4A 3ASFA 4FU3A 3HVEA 4I43A 3T5VA 1KLXA 3BG1B 3IHYA 1HO8A 3CV0A 5FQ4A 4NQ0A 3UPVA 3L6AA 4EZJA 3FWVA 2WXHA 5LFAA 4PS8A 2RD0A 4WWPA 4I9EA 4GMLA 4PS3A 4LERA 1L5JA 3RK6A 2V8SE 2J08A 3VTXA 4CEMA 1WM5A 1HE8A 3UX4A 3FFLA 3CQCB 2YQ8A 3MV2B 4W9RA 3NQPA 2WQHA 5ANLA 3APDA 4G23A 2KCKA 5E76A 3FTXA 4WNGA 5LOZA 2I9CA 3D9LA 4NRHB 3U64A 3ZYQA 3CVNA 4WNDA 2KZTB 2X6FA 4KVOA 3U66A 2ILRA 4AP2A 2IONA 3CKCA 5FWQA 4G24A 2WXFA 3SBSA 3G2UA 3ZW3A 2R5SA 2XGOA 4GYWA 4I2ZA 4NACA 5LCWC 3JQ1A 4FULA 3ULQA 4FHJA 1UW4B 4N3AA 2IU1A 2OV8A 3UUXA 1A17A 3ML9A 5JJ6A 3PREA 3ZYMA 4UWLA 4A3TA 4K03A 3IKOB 4YVQC 3MCXA 5DIZA 5KCMA 2VJ8A 3QKYA 5AENA 5KJKA 3RJVA 5EX3A 1HFAA 4C0MA 4KT6B 3KD7A 4FLHA 1Y6IA 4A55A 2IF4A 4JEHA 3D9JA 3RKVA 2QY7A 4XX5A 2FF4A 5BW8C 4DI3A 4HOTA 5BV0A 2LSUA 4F53A 3MYVA 4JL0A 3CR3A 3KS2A 3CK7A 1EDUA 3PUJA 3CSTA 3FUJA 4JHJA 3B7RL 4N5CA 2X6IA 1JWFA 1Z3YA 3FTWA 2C2LA 4UI9K 2WPVA 1FCHA 5JJ7A 1XGWA 2WXNA 3B7UX 4ILIA 5HI7A 4JHKA 4DPRA 5ANRA 3O4ZA 4JW1A 2J4DA 1N52A 3ZHEB 4XI9A 3S7DA 4AM9A 5LCWJ 4URKA 5KJMA 3Q47B 1TJCA 3T5XA 4ACLA 1IYGA 4G2VA 2X3MA 2CHWA 4APOA 2XGMA 3TJPA 5EDSA 4UQYA 2KCVA 4GYOA 5A23A 3FU3A 4ME2A 3FU6A 4JPSA 4U63A 4AY6A 4RG9A 4I6GA 4I2WA 3FULA 3IEGA 5J90A 4EECA 2AXZA 4JA9A 3CHQA 3NZUA 4I6JA 2DIWA 3S2AA 3Q15A 2YHEA 4BTAA 3P1UA 1E90A 3HVEB 4BTBA 4AOFA 3L13A 2OVFA 4GA2A 4ANUA 3G2TA 1ELKA 5EKQD 2WXMA 3GYZA 5CMWA 5M72A 2BF0X 4HOQA 2WVIA 4WUYA 1E8YA 4WNEA 3Q4AB 2Y3AA 1SZ9A 2DBAA 1OWMA 3FU5A 3ASDA 3LCAA 1GW6A 5FQ6A 3D9NA 2BTDA 3ESLA 4PS7A 1HF8A 5T4YA 5AJDA 3U9WA 2VTBB 1LF8A 5BUZA 2WXQA 2XCBA 1HU3A 2NXPA 4Y6WA 2VSYA 3I5PA 3S7FA 4GZDA 2AVPA 3GZ1A 2RG8A 2R59A 5BT1A 3MKRA 4I1MA 1BPOA 2XQ0A 3CKBA 4U0SA 4F1SA 3ESKA 2UY1A 1PC2A 3K9IA 4BX9A 1PAQA 3CHPA 4HOSA 2VGXA 3ZEFA 2IOSA 3CGHA 5CCMA 2VGXB 4I1OB 2GRLA 4UQZA 2UY1B 4GCOA 3FUIA 4MRUA 4KYOB 2VSOE 2X6JA 3MGBA 1JWGA 1INZA 1ELRA 4CDRA 2JEKA 2AXUA 3IBEA 2WXGA 4D10C 3CHOA 3MV3B 1W3BA 2J07A 4HOUA 1IQRA 5C2YA 1H2TC 3S7JA 3EJNA 4G11A 3SNXA 5FZSA 1UN8A 3ZPJA 2PQRA 4U0ZA 3L08A 2ZU6B 3PZDA 5BPPA 2HO1A 3OXGA 3LY9A 4GZ5A 4OVVA 4UI9J 5KJLA 4AVXA 2CG3A 5ENNA 3CLJA 3ML8A 1HG5A 3D9KA 3EHMA 2YHCA 3FH8A 3LJ3A 1KT0A 4A1GA 3B7TA 1MQSA 2MRIA 4DJAA 1ELWA 3FUEA 4UWHA 2OOEA 4GZCA 4JA7A 4B89A 3QDNA 2R17C 3FTUA 3QC1A 3ZXSA 2JLBA 4L7TA 2VGYA 3SD5A 2L6JA 3WXXA 2FO7A 2WQ6A 2UWJG 2XRZA 3FY4A 4ANWA 4K0RA 2KM4A 4E85A 3JYSA 4GPKA 2Q7FA 4AEZC 1S0PA 2WXJA 2WMNA 4MS6A 2NSZA 2EQXA 2WB2A 4XKBA 3PUKA 4LEUA 3FU0A 3C98A 3CK9A 4MLPA 4NURA 2Y4UA 4V3IA 1E8ZA 2FULA 3RRNB 4H7YA 1H19A 4FJZA 3JQ0A 3UQ3A 5A6CA 3CVPA 1EF1C 2J49A 4GA1A 1JUQA 5FZRA 5AJLA 3VTYA 5JHBA 4XZ4A 3I4RB 4F7AA 5BNWA 3PDNA 1OWPA 5G04J 2LO6A 2XPYA 4GCNA 2E0IA 3TGOA 4EZKA 2WXKA 3L16A 3D3MA 1EYHA 2CFUA 3KEZA 4WNFA 4IN3B 2PZIA 1UJJA 4HORA 3CHMA 2XPIA 5J08A 4U04A 5ARFA 4J8SA 1HG2A 4Q69A 3ZN3A 2LSVA 1Z6TA 2DCPA 4JEUA 5EX0A 1DNPA 3HYMB 3RU0A 2L0IA 3ZIMA 2AWIA 3D9OA 3LYAA 2Y4TA 4LUNU 3VLDA 3PNTB 4L2LA 2LAIA 1U3CA 3BG0B 3ZVVA 3R9AB 3CHRA 2FEZA 4DLQA 1QZ2A 3PE4A 4RG6A 4EZLA 5JHAA 1WY6A 3S7BA 1OWOA 3LEWA 4I1AA 3QWWA 2CHXA 2PQNA 2VSXE 2HYZA 3GZ2A 4FJYA 2GGFA 2GRMA 2M63A 4P29A 3CVQA 2WXPA 2J09A 3APFA 3PRZA 3CVWA 4L23A 1HXIA 2L9BA 3LKUA 3OTNA 3U4TA 3T8MA 2WM9A 3PVLA 1E8XA 2VYIA 2WMOA 5G04C 1TJFA 1OWNA 5FTPA 3LS8A 2YNQA 3URZA 2X6KA 2J9QA 5E75A 5G55A 4B94A 3TXMA 3TAXA 2XCCA 1Z3XA 3L22A 4J8EA 1HZ4A 3PH0C 2CG2A 4CDNA 2L0TB 1QNFA 2I1JA 3EIQC 3SHFA 4Q94A 3LY7A 1JPLA 4G1TA 3G2WA 3GZSA 3ZRHA 4AY5A 4WAFA 2C0MA 5FT9A 4ACKA 1EPUA 4BFRA 2WXRA 3APCA 2X38A 3CEQA 4BSXA 2I2OA 3L17A 4HFGA 4N3BA 4WWOA 3TL5A 4DK5A 3CVUA 2V0PA 4GZ6A 4YNDA 3ZHEA 4CGVA 4HVBA 3SI5A 3MKQA 3MKQB 1NZNA 2KZTA 3OXFA 3ZGQA 4A3VA 3UT7A 3G2VA 3QWPA 4XE0A 2WXLA 4QFVA 3D9IA 5FQ8A 3TG4A 4C0EA 4BT9A 2XRYA 2FBNA 4N39A 2GW1A 3AU5A 4XIFA 4IULA 3P2BA 5AYWD 3VLFA 4MKTA 3ZYLA 2OVBA 4ILHB 4C9BB 3PS6A 2MHKA 1IHGA 3MEKA 4JVSA 4GYYA 2I1KA 1NP7A 2IJGX 3IHVA 4AJWA 3RRUA 4JC8A 1HX8A 2IOLA 3CHSA 4AV7A 3FHEA 3JUIA 3QJZA 5T8IA 5T3RA 3CK8A 3TG5A 2FI7A 4FP7A 2V5FA 5G2NA 4A1SA 3OXLA 5LX8A 3U3WA 4ANXA 3ONKA 4FHKA 2X6HA 1U3DA 3FUNA 3FUMA 4ABNA 1NA0A 2XGSA 3FEXA 3EDTB 3FUDA 3I3NA 5D0QD 3G2SA 4KXKB 5G05C 4N2SA 2C0LA 4U07A 3QK0A 1E7VA 4PUCA 2WXIA 3SBTB 3FDHA 4UWGA 3QARA 3LVRE 4CT0A 4F3VA 4AIFA 4FLBA 4DLOA 3KAEA 4KZCA 3CVXA 1TEZA 2QFCA 4CT4A 4ANVA 1B89A 1KT1A 2P58C 3MX3A 3UT8A 2J4BA 3AS4A 3EHNA 4OVUA 2PL2A 3RRMB 3UT4A 1HH8A 3QB2A 3BEEA 4GAAA 5ARGA 2E2EA 3ASGA 3FH7A 3LXUX 4TV3A 3D9MA 3PNLB 2LNIA 2KATA 4EQFA 4U0UA 4OYSA 4IRUA 4U8HA 4AXHA 3B13A 2AXVA 2HR2A 4KMOA 4CGWA 3D9PA 3FTVA 4J8DA 1UN9A 2ONDA 3QAQA 3PE3A 4I17A 1IQUA 4J8FA 4BT8A 4FA6A 3Q49B 4N2QA 1Y8MA 3CVLA 4CDMA 3RIBA 3L54A 5DBKA 5G05J 4CRWA 1P5QA 2NC9A 2VSNA 2A4ZA 3FUHA 3Q5MA 3LDZA 3RO3A 5AIJA 3CQGB 3ONLA 4EPZA 4PH4B 3PEUB 1MHQA 4GA0A 3CSFA 5LP0A 3VLEA 3CIAA 5HQ8A 4RVBA 5JJTA 4GB9A 5KJNA 3N71A 2CHZA 2PM6A 3FUKA 1FVFA 2BUGA 4G25A 3JCKC 1PY1A 5A7DB 4KZ0A 1X5BA 2PM7A 3HDXA 4BWRA 1H2UA 3FP3A 3I4GA 3HIZA 4H7XA 1E7UA 2IQCA 3CVVA 4EBAG 4J6IA 3QOUA 4M3OA 4UQXA 3FTYA 3FUFA 4IYPA 1UG3A 4DI4A 4RSYA 4EBAA 4B8CB 2MOWA 4YVOA 2KCLA 5FJYA 1HS6A 3TXNA 1FVHA 1DVPA 4O6FA 4FADA 3EIJA 3ENEA 1OUVA 3NF1A 4R7LA 3PEVB 4J0UA 4G26A 4HLEA 4BX8A 2A5UA 3FH5A 4UWKA 2XEVA 4ILGA 4XI0A 3OAWA 4APFA 2CFZA 2XPZA 5D0OD 1E96B 5CMYA 3LPZA 2WQ7A 3ZFWA 3GW4A 4CCAA 4Y6CA 1SQMA 5FQ7A 3LY8A 1ZBPA 2LAHA 4Q96A 4UI9C 3NZSA 4JHRA 4ATGA 4TRQA 4TUUA 3AS5A 1E8WA 4JZYA 3R7QA 3FEYA 4XKCA 4E6HA 1SZAA 2I6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V3I A;  4ACK A;  3U66 A;  4ACL A; 
#chains in the Genus database with same CATH topology
 4BET A;  3F6Q A;  5BV1 A;  1VDY A;  3UMV A;  3DBS A;  2HM8 A;  3BU8 A;  1QQE A;  3O48 A;  3IV0 A;  4B8A A;  4I6E A;  2OEV A;  2ZXW E;  3MJW A;  2AW6 A;  4WWN A;  4N3C A;  1OWL A;  4GZ3 A;  4TXQ A;  3QNK A;  2IFU A;  1H6K A;  3HVE A;  3T5V A;  1HO8 A;  3CV0 A;  4NQ0 A;  3L6A A;  4I9E A;  3RSE G;  1IXV A;  4CEM A;  1LD7 A;  2J08 A;  3FFL A;  3MV2 B;  3J5Q B;  5EYP F;  2WQH A;  3APD A;  3C3O A;  4G23 A;  5E76 A;  5LOZ A;  1OCZ E;  3U64 A;  3DEP A;  2KZT B;  3ABM E;  2WXF A;  2BED A;  2R5S A;  4I2Z A;  5LCW C;  3BQO A;  3HXB A;  3V31 A;  5ENS D;  5JJ6 A;  3ZYM A;  4UWL A;  4GTQ A;  3IKO B;  4YVQ C;  1MJ0 A;  3HRA A;  1HFA A;  4C0M A;  5BV0 A;  4F53 A;  4JL0 A;  4EHM A;  1EDU A;  3FUJ A;  4JHJ A;  2IO2 C;  2X6I A;  2XZD G;  3B7U X;  3O4Z A;  1N52 A;  3ZHE B;  1KZO A;  5LCW J;  5KJM A;  1TJC A;  4HI8 A;  4ACL A;  3Q75 A;  3T8K A;  3TJP A;  5CEC B;  4GYO A;  4GTS A;  4ME2 A;  4JPS A;  1OT8 A;  4U63 A;  5J90 A;  1DC2 A;  4G8K A;  3CHQ A;  4I6J A;  2DIW A;  3P1U A;  3L13 A;  4ANU A;  5CRU A;  4B93 B;  5CMW A;  2F37 A;  2BF0 X;  4HOQ A;  1S64 A;  4WNE A;  5B1B E;  1OWM A;  3FU5 A;  3ASD A;  3IXE A;  2RFA A;  3D9N A;  5T4Y A;  3U9W A;  5BUZ A;  2XCB A;  2NXP A;  4GZD A;  3GZ1 A;  2V5Q C;  2R59 A;  1BPO A;  5KWD A;  2UY1 A;  1OCO E;  4BX9 A;  4HOS A;  3CGH A;  2VGX B;  3EHR A;  1ELR A;  3IBE A;  2J07 A;  1IKN D;  1Q2Z A;  3SNX A;  3EJN A;  3DXM G;  2QC9 A;  2GRO B;  2ZU6 B;  1SA5 A;  4GZ5 A;  4UI9 J;  2CG3 A;  3EHQ A;  5ENN A;  1WDY A;  3UM3 A;  1HG5 A;  4MBG A;  3FH8 A;  4A1G A;  3B7T A;  2MRI A;  4GZC A;  2Y1L E;  3QDN A;  2R17 C;  3QC1 A;  3ZXS A;  3WXX A;  3UTM A;  2EIL E;  2FO7 A;  2KM4 A;  3JXI A;  1S0P A;  4MS6 A;  3UKU G;  4MLP A;  1E8Z A;  2FUL A;  3UQ3 A;  3JQ0 A;  4GA1 A;  5AJL A;  5JMN D;  4F7A A;  5BNW A;  3V79 K;  5ENT D;  5FIN A;  1N9A A;  2XPY A;  2E0I A;  2WXK A;  3D3M A;  1FT2 A;  3DEO A;  4WNF A;  4IN3 B;  5J08 A;  4HRN A;  3ZN3 A;  2DCP A;  3HYM B;  3RU0 A;  3WG7 E;  3ZVV A;  3PNT B;  3R9A B;  2FEZ A;  1QZ2 A;  3HXE A;  2P9K G;  3W9G A;  2PQN A;  3GZ2 A;  5KBA A;  4FJY A;  3PRZ A;  2J09 A;  2JAB A;  4L23 A;  2WM9 A;  3PVL A;  2P9N G;  2WMO A;  4LNB A;  2J9Q A;  1K1B A;  3TAX A;  2XCC A;  2I1J A;  3EIQ C;  3NOG D;  4Q94 A;  3LY7 A;  1JPL A;  4G1T A;  3G2W A;  3ZRH A;  4AY5 A;  1EPU A;  4BFR A;  4DRX E;  2WXR A;  2I2O A;  4HFG A;  4WWO A;  4CGV A;  1NZN A;  3TWX A;  3UT7 A;  4HQD A;  3QWP A;  5FQ8 A;  3D9I A;  3AU5 A;  4IUL A;  3P2B A;  3RAU A;  3VLF A;  3ZYL A;  3EU5 A;  3PS6 A;  2MHK A;  4U8Y D;  2ETA A;  4JVS A;  2I1K A;  4AJW A;  4AV7 A;  5EN5 D;  3DXK G;  3CK8 A;  5G2N A;  4A1S A;  5G05 C;  4KXK B;  2C0L A;  3QK0 A;  4FLB A;  4DLO A;  1TEZ A;  2QFC A;  4CT4 A;  4OAV B;  3UT8 A;  3EHN A;  3UT4 A;  2XZT G;  2EIK E;  3FH7 A;  3TWW A;  1H6P A;  3QAQ A;  2OND A;  1IQU A;  2L6B A;  4BT8 A;  4JB8 P;  4CDM A;  3L54 A;  5G05 J;  4L9P A;  2NC9 A;  3NOC D;  1N11 A;  1MHQ A;  4GA0 A;  5HQ8 A;  4GB9 A;  3AG2 E;  4G25 A;  3Q79 A;  1PY1 A;  4BWR A;  1TNY A;  3FP3 A;  3I4G A;  3HIZ A;  4RLY A;  4LSZ E;  4IYP A;  2MOW A;  5FJY A;  4FAD A;  5AAR A;  3NF1 A;  4J0U A;  4HLE A;  2A5U A;  3FH5 A;  5CMY A;  3GW4 A;  5FQ7 A;  3DRA A;  4JHR A;  4XKC A;  2YIN A;  3SFZ A;  4UWF A;  2ETB A;  4HS2 A;  2WXO A;  4JXT A;  1K3Z D;  3B95 A;  3ASN E;  1NA3 A;  3CVY A;  4KVM A;  3QWV A;  3SGH A;  4I9C A;  1WAO 1;  1O5M A;  3X2Q E;  5AAO A;  3FTS A;  4PDX A;  3ZYK A;  4K5A B;  5HS0 A;  3AU4 A;  1UJK A;  3ASF A;  4I43 A;  1KLX A;  3BG1 B;  5B1A E;  2EIJ E;  3FWV A;  2WXH A;  2RD0 A;  4PS3 A;  2V8S E;  1WM5 A;  1HE8 A;  4W9R A;  3NQP A;  1K8K G;  3ZNG A;  2KCK A;  4WNG A;  2GRQ B;  3CVN A;  3U66 A;  2ION A;  3CKC A;  4G24 A;  3SBS A;  3ZW3 A;  5KNH D;  2XGO A;  4NAC A;  3ULQ A;  1UW4 B;  4A3T A;  4K03 A;  3MCX A;  5AEN A;  4GTP A;  5EX3 A;  3RJV A;  1NL4 A;  3D9J A;  2QY7 A;  4XX5 A;  2FF4 A;  5BW8 C;  2LSU A;  3MYV A;  3CR3 A;  3PUJ A;  3AG3 E;  1JWF A;  4LNG A;  4UI9 K;  2WPV A;  5JJ7 A;  3EUV A;  2P9P G;  4XI9 A;  4AM9 A;  2R05 A;  1AP7 A;  3T5X A;  3NB2 A;  1IYG A;  4APO A;  5EDS A;  3DST A;  2KBX A;  3FU3 A;  5CRV A;  2NYJ A;  4I2W A;  3IEG A;  4EEC A;  2AXZ A;  3NZU A;  3S2A A;  3Q15 A;  4BTA A;  1E90 A;  3UI2 A;  4AOF A;  3G2T A;  2WXM A;  4J7W A;  3Q4A B;  2DYR E;  1SZ9 A;  2DBA A;  5FQ6 A;  1N4S A;  3ASO E;  2VTB B;  1LF8 A;  2WXQ A;  5BT1 A;  3KSQ A;  3MKR A;  3CKB A;  4U0S A;  5HKP A;  3K9I A;  3CHP A;  1N94 A;  4I1O B;  5EID A;  2R2L A;  4GCO A;  4MRU A;  5ENO D;  4KYO B;  2VSO E;  1JWG A;  1INZ A;  4CDR A;  2AXU A;  3CHO A;  1W3B A;  2RKK A;  4HOU A;  1IQR A;  5C2Y A;  1H2T C;  3ZPJ A;  2PQR A;  3HXD A;  4OVV A;  3E37 A;  5KJL A;  4AVX A;  1O1R A;  2B0O E;  2LXL A;  1QYM A;  3LJ3 A;  2VGE A;  4DJA A;  4UWH A;  1H6O A;  2XEE A;  4L7T A;  3HXF A;  4ANW A;  4TXP A;  4YDO A;  3JYS A;  2Q7F A;  2WXJ A;  2AJA A;  2NSZ A;  2EQX A;  4XKB A;  3PUK A;  4LEU A;  3C98 A;  4V3I A;  1BLX B;  5G04 J;  2GRP B;  3L16 A;  2MYO A;  4Z68 A;  3CHM A;  4J8S A;  5IY5 E;  1BI8 B;  2F0Y A;  1DNP A;  3ZIM A;  4F6R D;  2Y4T A;  4LUN U;  1D9S A;  4DLQ A;  3PE4 A;  3ULY A;  4ATZ D;  2VSX E;  2HYZ A;  4DUI A;  2GGF A;  2WXP A;  3CVW A;  2L9B A;  3LKU A;  3OTN A;  3U4T A;  3T8M A;  2VYI A;  1TJF A;  5FTP A;  2YNQ A;  1Z5S C;  2X6K A;  5E75 A;  4B94 A;  2XEN A;  3Q9N C;  2J8S D;  5CED B;  1Z3X A;  4QQI A;  4J8E A;  2CG2 A;  3UIO C;  3SHF A;  4WAF A;  3PZ3 A;  5FT9 A;  4ACK A;  3TWT A;  3APC A;  4N3B A;  4GZ6 A;  3SI5 A;  5EIB E;  3MKQ B;  3OXF A;  2QYU A;  3ZGQ A;  3DSW A;  4G8L A;  4BT9 A;  2XRY A;  2FBN A;  4XIF A;  5AYW D;  2P9U G;  1N4P A;  3DSX A;  2F8Y A;  2IOL A;  3FHE A;  5T8I A;  3UXG A;  4FP7 A;  1KPS B;  2X6H A;  1U3D A;  3FUN A;  1NA0 A;  2XGS A;  3FEX A;  5D0Q D;  3G2S A;  3NAW A;  2WXI A;  3V2O A;  3FDH A;  4F3V A;  3LVR E;  3TWQ A;  4AIF A;  2BKG A;  3KAE A;  3ZKJ A;  4ANV A;  4YDY A;  1JCQ A;  1KT1 A;  2P58 C;  1IHB A;  3AS4 A;  1RZ4 A;  3RRM B;  3L9T A;  3QB2 A;  3BEE A;  4GAA A;  4M7C A;  3LXU X;  3D9M A;  2LNI A;  2KAT A;  4U0U A;  3FTV A;  4J8D A;  3PE3 A;  3SQV A;  4FA6 A;  2FO1 E;  1Y8M A;  4CRW A;  2VSN A;  3LDZ A;  5AIJ A;  4EPZ A;  5LP0 A;  3VLE A;  4RVB A;  3L82 A;  5JJT A;  3N71 A;  2CHZ A;  2PM6 A;  3FUK A;  4C48 B;  5ENR D;  3TWU A;  2H6I A;  3E30 A;  1E7U A;  3LJN A;  4HRL A;  4EBA G;  5ITZ F;  3QOU A;  3FUF A;  1UG3 A;  4EBA A;  4B8C B;  3TXN A;  2P2C P;  4G26 A;  1LD8 A;  2P9L G;  4UWK A;  2XEV A;  3OAW A;  4APF A;  5CBO A;  3ZU7 B;  1E96 B;  3LPZ A;  4DX6 D;  3ZFW A;  4CCA A;  1BD8 A;  2LAH A;  4ATG A;  3AG1 E;  4JZY A;  1E8W A;  1N95 A;  1SZA A;  2I6H A;  1YA0 A;  3ASH A;  5HRY A;  4KBQ A;  2V4L A;  1LTX A;  1JCS A;  5C1D A;  5FZQ A;  3DPD A;  5ENP D;  3MZL B;  2DYS E;  3LVQ E;  1TN7 A;  2VTB A;  4FC8 A;  3AS8 A;  3HHM A;  2XHE A;  1H0A A;  3UIN C;  2QZA A;  2VQ2 A;  4B0Z A;  4BER A;  4BY6 A;  4LCT A;  3SF4 A;  3IHY A;  1O1S A;  3UPV A;  1OCC E;  4EZJ A;  5LFA A;  4WWP A;  3Q9U C;  4O1P A;  3PZ1 A;  1D8D A;  3UX4 A;  3DWL G;  2YQ8 A;  4K5B A;  4CYM D;  5ANL A;  3B7B A;  2I9C A;  3D9L A;  3ZUV B;  4NRH B;  2X6F A;  2ILR A;  4DX7 D;  1OY3 D;  3G2U A;  4GYW A;  3JQ1 A;  4FUL A;  2IEJ A;  4N3A A;  2OV8 A;  1X81 A;  4DX5 D;  1A17 A;  3ML9 A;  5KCM A;  3QKY A;  4JD2 G;  4KT6 B;  3KD7 A;  4FLH A;  2IF4 A;  4JEH A;  3RKV A;  3KS2 A;  3CK7 A;  3B7R L;  1S63 A;  1G3N B;  1Z3Y A;  4F1P A;  1FCH A;  1XGW A;  2WXN A;  4ILI A;  4DPR A;  2ZGG A;  5FIO A;  4JW1 A;  3SO8 A;  3Q47 B;  3UIP C;  1SA4 A;  5A23 A;  3C5R A;  3FU6 A;  5D2M C;  4I6G A;  2YHE A;  3DSV A;  3Q7A A;  4GA2 A;  1N0Q A;  2WVI A;  4WUY A;  1E8Y A;  3LCA A;  1GW6 A;  1AWC B;  2IO3 C;  2LXM A;  2P9I G;  4YDE A;  1HF8 A;  5AJD A;  4Y6W A;  1HU3 A;  1BI7 B;  2VSY A;  3I5P A;  2XS8 A;  4F1S A;  3ESK A;  1PC2 A;  1V54 E;  2VGX A;  2IOS A;  5CCM A;  3E32 A;  4UQZ A;  2X6J A;  3ZXP A;  5JA4 D;  5CER B;  2JEK A;  4D10 C;  3ABL E;  3MV3 B;  3PZ4 A;  5FZS A;  1UN8 A;  2RFM A;  3OXG A;  3LY9 A;  3CLJ A;  4U95 D;  3D9K A;  3ULE G;  3EHM A;  3V30 A;  1KT0 A;  1MQS A;  1ELW A;  3FUE A;  1N4R A;  2OOE A;  4B89 A;  1KZP A;  2H6H A;  3FTU A;  2JLB A;  2XRZ A;  4HLL A;  3JUE A;  2UWJ G;  4GMR A;  4GPK A;  2WMN A;  2R02 A;  5B3S E;  4NUR A;  3CK9 A;  2Y4U A;  4H7Y A;  1EF1 C;  4XZ4 A;  3I4R B;  4OAU C;  1OWP A;  2LO6 A;  4GCN A;  1V55 E;  2HE0 A;  3C3Q A;  1EYH A;  2CFU A;  3TWR A;  4HOR A;  3UM2 A;  2XPI A;  4U04 A;  5AN8 A;  2LSV A;  1Z6T A;  4JEU A;  3TWV A;  5EX0 A;  2L0I A;  2AWI A;  3D9O A;  3LYA A;  4TUM A;  3VLD A;  3EU9 A;  2LAI A;  1U3C A;  3BG0 B;  3CHR A;  3JXJ A;  2ZGD A;  5JHA A;  1WY6 A;  2EIM E;  4I1A A;  3QWW A;  2CHX A;  4BEP A;  2GRM A;  2M63 A;  4P29 A;  3CVQ A;  4GTT A;  5KNG A;  3ISM C;  2ZIS A;  1OWN A;  3LS8 A;  3DSU A;  5G55 A;  1MX6 A;  3L22 A;  1HZ4 A;  4CDN A;  2L0T B;  1QNF A;  2C0M A;  3CEQ A;  3Q78 A;  3L17 A;  4DK5 A;  4UUC A;  4HVB A;  1A5E A;  2KZT A;  4A3V A;  4BSZ B;  2WXL A;  4N39 A;  3E34 A;  4ILH B;  4C9B B;  4CZ2 D;  1IHG A;  1NP7 A;  3Q7F A;  4JC8 A;  1HX8 A;  4XEI G;  3JUI A;  3QJZ A;  2FI7 A;  2V5F A;  1MZC A;  2BKK B;  4LG6 A;  5CBN A;  4FHK A;  3NBN B;  4ABN A;  3EDT B;  4U07 A;  4KZC A;  3UM0 A;  4U8V D;  1TNO A;  2J4B A;  1TR4 A;  4OVU A;  2PL2 A;  1HH8 A;  5ARG A;  1DCQ A;  3ASG A;  3KSL A;  4AXH A;  3B13 A;  2HR2 A;  4KMO A;  4EZL A;  3D9P A;  4I17 A;  2GRN B;  1MYO A;  1NFI E;  3RIB A;  2A4Z A;  3RO3 A;  3CQG B;  3ONL A;  3PEU B;  4ZFH A;  3CSF A;  3W9F A;  3CIA A;  5KJN A;  1FVF A;  2BUG A;  5A7D B;  1O1T A;  4HB5 A;  1X5B A;  2PM7 A;  3HDX A;  4H7X A;  3CVV A;  4J6I A;  4M3O A;  4UQX A;  3FTY A;  4DI4 A;  4RSY A;  5EYL A;  2KCL A;  1FVH A;  3EIJ A;  1OUV A;  3PEV B;  4BX8 A;  1TN8 A;  4XI0 A;  4ILG A;  2CFZ A;  2XPZ A;  5D0O D;  2WQ7 A;  3UKR G;  4Y6C A;  1SQM A;  3LY8 A;  4Q96 A;  4TRQ A;  1TNU A;  3T9K A;  4E6H A;  4A63 B;  3MA5 A;  4L1B A;  1FT1 A;  3FTZ A;  1ZU2 A;  5CHE E;  3SZ7 A;  5CCL A;  1N54 A;  2KC7 A;  4HXI A;  3RO2 A;  3E4B A;  1XNF A;  4RQI A;  3R7R A;  4LRZ A;  3SY2 A;  2KXP C;  1H2V C;  4GU5 A;  4HNA D;  3B7S A;  4L2Y A;  4GMJ A;  4FU3 A;  5FQ4 A;  2DZN A;  4PS8 A;  4GML A;  1FPP A;  4LER A;  1L5J A;  3RK6 A;  3VTX A;  3CQC B;  4HI9 A;  4GTV A;  3FTX A;  4J8Y A;  3ZYQ A;  2DZO A;  4WND A;  4KVO A;  4AP2 A;  5FWQ A;  3KEA A;  4FHJ A;  2IU1 A;  3UUX A;  3PRE A;  5DIZ A;  2VJ8 A;  5KJK A;  1Y6I A;  4A55 A;  3DSS A;  4DI3 A;  4HOT A;  4GPM A;  3CST A;  4N5C A;  3FTW A;  2C2L A;  5HI7 A;  4JHK A;  5ANR A;  2J4D A;  3S7D A;  4URK A;  4G2V A;  2X3M A;  2CHW A;  2XGM A;  2DVW A;  4UQY A;  2KCV A;  2OCC E;  3J5P A;  5EIL A;  3C72 A;  2OEW A;  4AY6 A;  4RG9 A;  3PZ2 A;  3FUL A;  3AG4 E;  3ABK E;  4JA9 A;  5D66 A;  5BXU A;  4BTB A;  3HVE B;  1BU9 A;  2OVF A;  1ELK A;  5EKQ D;  3GYZ A;  5M72 A;  3TWS A;  2Y3A A;  2XS1 A;  2PNN A;  4TXR A;  2BTD A;  3ESL A;  4PS7 A;  5H7P A;  2P9S G;  3S7F A;  2AVP A;  1MX4 A;  2RG8 A;  4I1M A;  2XQ0 A;  4U7E B;  1NI1 A;  1PAQ A;  1DCE A;  3HXC A;  3ZEF A;  2GRL A;  2B6C A;  2Y69 E;  2UY1 B;  3FUI A;  3MGB A;  2ETC A;  1WG0 A;  4GTR A;  2WXG A;  1YMP A;  4N5Q A;  3S7J A;  4G11 A;  5ENQ D;  4U0Z A;  4HBD A;  3L08 A;  3R9M A;  3PZD A;  5BPP A;  4GTO A;  2HO1 A;  3ML8 A;  4LNU D;  2ZIR A;  2YHC A;  3C3R A;  1QBQ A;  5AQ9 A;  4JA7 A;  4YDW A;  2WQ6 A;  3SD5 A;  3BUA A;  2VGY A;  2L6J A;  3FY4 A;  4K0R A;  4E85 A;  2EIN E;  2WB2 A;  2A5E A;  3FU0 A;  3RRN B;  4X8Q A;  1H19 A;  4FJZ A;  5A6C A;  3CVP A;  2J49 A;  1JUQ A;  5FZR A;  3VTY A;  5JHB A;  1RW2 A;  4NIK A;  3PDN A;  1SW6 A;  2V4H C;  3TGO A;  4EZK A;  2H6G A;  3KEZ A;  2PZI A;  1UJJ A;  4BES A;  5ARF A;  5BXO A;  1HG2 A;  2Y0B G;  3E33 A;  4Q69 A;  5AQ7 A;  1D8E A;  4O1O A;  1MX2 A;  4L2L A;  4RG6 A;  1UOH A;  4O60 A;  3S7B A;  1OWO A;  3LEW A;  3D9H A;  2LUH A;  1S70 B;  3APF A;  3AAA C;  1HXI A;  1TYQ G;  4U96 D;  1E8X A;  5G04 C;  3HG0 D;  3URZ A;  4GTM A;  3TXM A;  2R03 A;  3PH0 C;  3GZS A;  2X38 A;  4BSX A;  3TL5 A;  3CVU A;  2V0P A;  2H6F A;  4YND A;  3ZHE A;  4DX2 A;  3MKQ A;  1OXJ A;  3UM1 A;  3G2V A;  4XE0 A;  4QFV A;  3TG4 A;  4C0E A;  3V2X A;  2GW1 A;  4K5C A;  4MKT A;  2OVB A;  3DPY A;  3MEK A;  4GYY A;  2IJG X;  3IHV A;  3RRU A;  3CHS A;  1U2V G;  5T3R A;  1TNZ A;  3TG5 A;  1ZB1 A;  3OXL A;  5LX8 A;  3U3W A;  4ANX A;  3ONK A;  2QYJ A;  3FUM A;  1JCR A;  3I3N A;  3FUD A;  4N2S A;  2F8X K;  1E7V A;  4PUC A;  3SBT B;  4UWG A;  3QAR A;  3SFY A;  4CT0 A;  5AQB A;  3CVX A;  3Q73 A;  1B89 A;  3MX3 A;  2GRR B;  2E2E A;  1N4Q A;  4TV3 A;  3PNL B;  4EQF A;  1YCS B;  2XEH A;  4OYS A;  4IRU A;  4U8H A;  2AXV A;  2DWZ A;  4CGW A;  4AEZ C;  1UN9 A;  4J8F A;  3Q49 B;  4N2Q A;  3CVL A;  5DBK A;  1P5Q A;  3FUH A;  3Q5M A;  1SVX A;  1YYH A;  4PH4 B;  1N0R A;  3JCK C;  4KZ0 A;  4DX1 A;  1H2U A;  3SFX A;  1OCR E;  2IQC A;  2IY0 C;  4YVO A;  1HS6 A;  1DVP A;  4O6F A;  3ENE A;  5CEA A;  4R7L A;  5AQA A;  1TN6 A;  1K1A A;  4ZHB A;  4HRM B;  3AJI A;  1ZBP A;  4UI9 C;  3NZS A;  4TUU A;  3AS5 A;  3R7Q A;  3FEY A;  1TNB A; 
#chains in the Genus database with same CATH homology
 2YIN A;  3MA5 A;  1YA0 A;  3SFZ A;  4L1B A;  3ASH A;  5BV1 A;  1VDY A;  4UWF A;  3UMV A;  3DBS A;  3FTZ A;  2HM8 A;  4HS2 A;  1QQE A;  2WXO A;  2V4L A;  4JXT A;  4KBQ A;  3O48 A;  1ZU2 A;  3IV0 A;  5CHE E;  4B8A A;  3SZ7 A;  4I6E A;  5FZQ A;  5C1D A;  5CCL A;  1N54 A;  2KC7 A;  3DPD A;  1NA3 A;  4HXI A;  3CVY A;  4KVM A;  3MZL B;  3QWV A;  3RO2 A;  3SGH A;  4I9C A;  1WAO 1;  3MJW A;  3E4B A;  1XNF A;  3LVQ E;  2AW6 A;  3R7R A;  4LRZ A;  2VTB A;  4WWN A;  4N3C A;  1OWL A;  4FC8 A;  1H2V C;  3AS8 A;  3FTS A;  3HHM A;  2XHE A;  4GU5 A;  3B7S A;  4PDX A;  1H0A A;  4GZ3 A;  3ZYK A;  3AU4 A;  2VQ2 A;  3QNK A;  2IFU A;  1H6K A;  4B0Z A;  1UJK A;  4L2Y A;  4GMJ A;  4BY6 A;  4LCT A;  3SF4 A;  3ASF A;  4FU3 A;  3HVE A;  4I43 A;  3T5V A;  1KLX A;  3BG1 B;  3IHY A;  1HO8 A;  3CV0 A;  5FQ4 A;  4NQ0 A;  3UPV A;  3L6A A;  4EZJ A;  3FWV A;  2WXH A;  5LFA A;  4PS8 A;  2RD0 A;  4WWP A;  4I9E A;  4GML A;  4PS3 A;  4LER A;  1L5J A;  3RK6 A;  2V8S E;  2J08 A;  3VTX A;  4CEM A;  1WM5 A;  1HE8 A;  3UX4 A;  3FFL A;  3CQC B;  2YQ8 A;  3MV2 B;  4W9R A;  3NQP A;  2WQH A;  5ANL A;  3APD A;  4G23 A;  2KCK A;  5E76 A;  3FTX A;  4WNG A;  5LOZ A;  2I9C A;  3D9L A;  4NRH B;  3U64 A;  3ZYQ A;  3CVN A;  4WND A;  2KZT B;  2X6F A;  4KVO A;  3U66 A;  2ILR A;  4AP2 A;  2ION A;  3CKC A;  5FWQ A;  4G24 A;  2WXF A;  3SBS A;  3G2U A;  3ZW3 A;  2R5S A;  2XGO A;  4GYW A;  4I2Z A;  4NAC A;  5LCW C;  3JQ1 A;  4FUL A;  3ULQ A;  4FHJ A;  1UW4 B;  4N3A A;  2IU1 A;  2OV8 A;  3UUX A;  1A17 A;  3ML9 A;  5JJ6 A;  3PRE A;  3ZYM A;  4UWL A;  4A3T A;  4K03 A;  3IKO B;  4YVQ C;  3MCX A;  5DIZ A;  5KCM A;  2VJ8 A;  3QKY A;  5AEN A;  5KJK A;  3RJV A;  5EX3 A;  1HFA A;  4C0M A;  4KT6 B;  3KD7 A;  4FLH A;  1Y6I A;  4A55 A;  2IF4 A;  4JEH A;  3D9J A;  3RKV A;  2QY7 A;  4XX5 A;  2FF4 A;  5BW8 C;  4DI3 A;  4HOT A;  5BV0 A;  2LSU A;  4F53 A;  3MYV A;  4JL0 A;  3CR3 A;  3KS2 A;  3CK7 A;  1EDU A;  3PUJ A;  3CST A;  3FUJ A;  4JHJ A;  3B7R L;  4N5C A;  2X6I A;  1JWF A;  1Z3Y A;  3FTW A;  2C2L A;  4UI9 K;  2WPV A;  1FCH A;  5JJ7 A;  1XGW A;  2WXN A;  3B7U X;  4ILI A;  5HI7 A;  4JHK A;  4DPR A;  5ANR A;  3O4Z A;  4JW1 A;  2J4D A;  1N52 A;  3ZHE B;  4XI9 A;  3S7D A;  4AM9 A;  5LCW J;  4URK A;  5KJM A;  3Q47 B;  1TJC A;  3T5X A;  4ACL A;  1IYG A;  4G2V A;  2X3M A;  2CHW A;  4APO A;  2XGM A;  3TJP A;  5EDS A;  4UQY A;  2KCV A;  4GYO A;  5A23 A;  3FU3 A;  4ME2 A;  3FU6 A;  4JPS A;  4U63 A;  4AY6 A;  4RG9 A;  4I6G A;  4I2W A;  3FUL A;  3IEG A;  5J90 A;  4EEC A;  2AXZ A;  4JA9 A;  3CHQ A;  3NZU A;  4I6J A;  2DIW A;  3S2A A;  3Q15 A;  2YHE A;  4BTA A;  3P1U A;  1E90 A;  3HVE B;  4BTB A;  4AOF A;  3L13 A;  2OVF A;  4GA2 A;  4ANU A;  3G2T A;  1ELK A;  5EKQ D;  2WXM A;  3GYZ A;  5CMW A;  5M72 A;  2BF0 X;  4HOQ A;  2WVI A;  4WUY A;  1E8Y A;  4WNE A;  3Q4A B;  2Y3A A;  1SZ9 A;  2DBA A;  1OWM A;  3FU5 A;  3ASD A;  3LCA A;  1GW6 A;  5FQ6 A;  3D9N A;  2BTD A;  3ESL A;  4PS7 A;  1HF8 A;  5T4Y A;  5AJD A;  3U9W A;  2VTB B;  1LF8 A;  5BUZ A;  2WXQ A;  2XCB A;  1HU3 A;  2NXP A;  4Y6W A;  2VSY A;  3I5P A;  3S7F A;  4GZD A;  2AVP A;  3GZ1 A;  2RG8 A;  2R59 A;  5BT1 A;  3MKR A;  4I1M A;  1BPO A;  2XQ0 A;  3CKB A;  4U0S A;  4F1S A;  3ESK A;  2UY1 A;  1PC2 A;  3K9I A;  4BX9 A;  1PAQ A;  3CHP A;  4HOS A;  2VGX A;  3ZEF A;  2IOS A;  3CGH A;  5CCM A;  2VGX B;  4I1O B;  2GRL A;  4UQZ A;  2UY1 B;  4GCO A;  3FUI A;  4MRU A;  4KYO B;  2VSO E;  2X6J A;  3MGB A;  1JWG A;  1INZ A;  1ELR A;  4CDR A;  2JEK A;  2AXU A;  3IBE A;  2WXG A;  4D10 C;  3CHO A;  3MV3 B;  1W3B A;  2J07 A;  4HOU A;  1IQR A;  5C2Y A;  1H2T C;  3S7J A;  3EJN A;  4G11 A;  3SNX A;  5FZS A;  1UN8 A;  3ZPJ A;  2PQR A;  4U0Z A;  3L08 A;  2ZU6 B;  3PZD A;  5BPP A;  2HO1 A;  3OXG A;  3LY9 A;  4GZ5 A;  4OVV A;  4UI9 J;  5KJL A;  4AVX A;  2CG3 A;  5ENN A;  3CLJ A;  3ML8 A;  1HG5 A;  3D9K A;  3EHM A;  2YHC A;  3FH8 A;  3LJ3 A;  1KT0 A;  4A1G A;  3B7T A;  1MQS A;  2MRI A;  4DJA A;  1ELW A;  3FUE A;  4UWH A;  2OOE A;  4GZC A;  4JA7 A;  4B89 A;  3QDN A;  2R17 C;  3FTU A;  3QC1 A;  3ZXS A;  2JLB A;  4L7T A;  2VGY A;  3SD5 A;  2L6J A;  3WXX A;  2FO7 A;  2WQ6 A;  2UWJ G;  2XRZ A;  3FY4 A;  4ANW A;  4K0R A;  2KM4 A;  4E85 A;  3JYS A;  4GPK A;  2Q7F A;  4AEZ C;  1S0P A;  2WXJ A;  2WMN A;  4MS6 A;  2NSZ A;  2EQX A;  2WB2 A;  4XKB A;  3PUK A;  4LEU A;  3FU0 A;  3C98 A;  3CK9 A;  4MLP A;  4NUR A;  2Y4U A;  4V3I A;  1E8Z A;  2FUL A;  3RRN B;  4H7Y A;  1H19 A;  4FJZ A;  3JQ0 A;  3UQ3 A;  5A6C A;  3CVP A;  1EF1 C;  2J49 A;  4GA1 A;  1JUQ A;  5FZR A;  5AJL A;  3VTY A;  5JHB A;  4XZ4 A;  3I4R B;  4F7A A;  5BNW A;  3PDN A;  1OWP A;  5G04 J;  2LO6 A;  2XPY A;  4GCN A;  2E0I A;  3TGO A;  4EZK A;  2WXK A;  3L16 A;  3D3M A;  1EYH A;  2CFU A;  3KEZ A;  4WNF A;  4IN3 B;  2PZI A;  1UJJ A;  4HOR A;  3CHM A;  2XPI A;  5J08 A;  4U04 A;  5ARF A;  4J8S A;  1HG2 A;  4Q69 A;  3ZN3 A;  2LSV A;  1Z6T A;  2DCP A;  4JEU A;  5EX0 A;  1DNP A;  3HYM B;  3RU0 A;  2L0I A;  3ZIM A;  2AWI A;  3D9O A;  3LYA A;  2Y4T A;  4LUN U;  3VLD A;  3PNT B;  4L2L A;  2LAI A;  1U3C A;  3BG0 B;  3ZVV A;  3R9A B;  3CHR A;  2FEZ A;  4DLQ A;  1QZ2 A;  3PE4 A;  4RG6 A;  4EZL A;  5JHA A;  1WY6 A;  3S7B A;  1OWO A;  3LEW A;  4I1A A;  3QWW A;  2CHX A;  2PQN A;  2VSX E;  2HYZ A;  3GZ2 A;  4FJY A;  2GGF A;  2GRM A;  2M63 A;  4P29 A;  3CVQ A;  2WXP A;  2J09 A;  3APF A;  3PRZ A;  3CVW A;  4L23 A;  1HXI A;  2L9B A;  3LKU A;  3OTN A;  3U4T A;  3T8M A;  2WM9 A;  3PVL A;  1E8X A;  2VYI A;  2WMO A;  5G04 C;  1TJF A;  1OWN A;  5FTP A;  3LS8 A;  2YNQ A;  3URZ A;  2X6K A;  2J9Q A;  5E75 A;  5G55 A;  4B94 A;  3TXM A;  3TAX A;  2XCC A;  1Z3X A;  3L22 A;  4J8E A;  1HZ4 A;  3PH0 C;  2CG2 A;  4CDN A;  2L0T B;  1QNF A;  2I1J A;  3EIQ C;  3SHF A;  4Q94 A;  3LY7 A;  1JPL A;  4G1T A;  3G2W A;  3GZS A;  3ZRH A;  4AY5 A;  4WAF A;  2C0M A;  5FT9 A;  4ACK A;  1EPU A;  4BFR A;  2WXR A;  3APC A;  2X38 A;  3CEQ A;  4BSX A;  2I2O A;  3L17 A;  4HFG A;  4N3B A;  4WWO A;  3TL5 A;  4DK5 A;  3CVU A;  2V0P A;  4GZ6 A;  4YND A;  3ZHE A;  4CGV A;  4HVB A;  3SI5 A;  3MKQ A;  3MKQ B;  1NZN A;  2KZT A;  3OXF A;  3ZGQ A;  4A3V A;  3UT7 A;  3G2V A;  3QWP A;  4XE0 A;  2WXL A;  4QFV A;  3D9I A;  5FQ8 A;  3TG4 A;  4C0E A;  4BT9 A;  2XRY A;  2FBN A;  4N39 A;  2GW1 A;  3AU5 A;  4XIF A;  4IUL A;  3P2B A;  5AYW D;  3VLF A;  4MKT A;  3ZYL A;  2OVB A;  4ILH B;  4C9B B;  3PS6 A;  2MHK A;  1IHG A;  3MEK A;  4JVS A;  4GYY A;  2I1K A;  1NP7 A;  2IJG X;  3IHV A;  4AJW A;  3RRU A;  4JC8 A;  1HX8 A;  2IOL A;  3CHS A;  4AV7 A;  3FHE A;  3JUI A;  3QJZ A;  5T8I A;  5T3R A;  3CK8 A;  3TG5 A;  2FI7 A;  4FP7 A;  2V5F A;  5G2N A;  4A1S A;  3OXL A;  5LX8 A;  3U3W A;  4ANX A;  3ONK A;  4FHK A;  2X6H A;  1U3D A;  3FUN A;  3FUM A;  4ABN A;  1NA0 A;  2XGS A;  3FEX A;  3EDT B;  3FUD A;  3I3N A;  5D0Q D;  3G2S A;  4KXK B;  5G05 C;  4N2S A;  2C0L A;  4U07 A;  3QK0 A;  1E7V A;  4PUC A;  2WXI A;  3SBT B;  3FDH A;  4UWG A;  3QAR A;  3LVR E;  4CT0 A;  4F3V A;  4AIF A;  4FLB A;  4DLO A;  3KAE A;  4KZC A;  3CVX A;  1TEZ A;  2QFC A;  4CT4 A;  4ANV A;  1B89 A;  1KT1 A;  2P58 C;  3MX3 A;  3UT8 A;  2J4B A;  3AS4 A;  3EHN A;  4OVU A;  2PL2 A;  3RRM B;  3UT4 A;  1HH8 A;  3QB2 A;  3BEE A;  4GAA A;  5ARG A;  2E2E A;  3ASG A;  3FH7 A;  3LXU X;  4TV3 A;  3D9M A;  3PNL B;  2LNI A;  2KAT A;  4EQF A;  4U0U A;  4OYS A;  4IRU A;  4U8H A;  4AXH A;  3B13 A;  2AXV A;  2HR2 A;  4KMO A;  4CGW A;  3D9P A;  3FTV A;  4J8D A;  1UN9 A;  2OND A;  3QAQ A;  3PE3 A;  4I17 A;  1IQU A;  4J8F A;  4BT8 A;  4FA6 A;  3Q49 B;  4N2Q A;  1Y8M A;  3CVL A;  4CDM A;  3RIB A;  3L54 A;  5DBK A;  5G05 J;  4CRW A;  1P5Q A;  2NC9 A;  2VSN A;  2A4Z A;  3FUH A;  3Q5M A;  3LDZ A;  3RO3 A;  5AIJ A;  3CQG B;  3ONL A;  4EPZ A;  4PH4 B;  3PEU B;  1MHQ A;  4GA0 A;  3CSF A;  5LP0 A;  3VLE A;  3CIA A;  5HQ8 A;  4RVB A;  5JJT A;  4GB9 A;  5KJN A;  3N71 A;  2CHZ A;  2PM6 A;  3FUK A;  1FVF A;  2BUG A;  4G25 A;  3JCK C;  1PY1 A;  5A7D B;  4KZ0 A;  1X5B A;  2PM7 A;  3HDX A;  4BWR A;  1H2U A;  3FP3 A;  3I4G A;  3HIZ A;  4H7X A;  1E7U A;  2IQC A;  3CVV A;  4EBA G;  4J6I A;  3QOU A;  4M3O A;  4UQX A;  3FTY A;  3FUF A;  4IYP A;  1UG3 A;  4DI4 A;  4RSY A;  4EBA A;  4B8C B;  2MOW A;  4YVO A;  2KCL A;  5FJY A;  1HS6 A;  3TXN A;  1FVH A;  1DVP A;  4O6F A;  4FAD A;  3EIJ A;  3ENE A;  1OUV A;  3NF1 A;  4R7L A;  3PEV B;  4J0U A;  4G26 A;  4HLE A;  4BX8 A;  2A5U A;  3FH5 A;  4UWK A;  2XEV A;  4ILG A;  4XI0 A;  3OAW A;  4APF A;  2CFZ A;  2XPZ A;  5D0O D;  1E96 B;  5CMY A;  3LPZ A;  2WQ7 A;  3ZFW A;  3GW4 A;  4CCA A;  4Y6C A;  1SQM A;  5FQ7 A;  3LY8 A;  1ZBP A;  2LAH A;  4Q96 A;  4UI9 C;  3NZS A;  4JHR A;  4ATG A;  4TRQ A;  4TUU A;  3AS5 A;  1E8W A;  4JZY A;  3R7Q A;  3FEY A;  4XKC A;  4E6H A;  1SZA A;  2I6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...