4ACKA

3d structure of dotu from francisella novicida
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
155
structure length
152
Chain Sequence
MKDFKEIEIILDIIKTTREIIENDNEKISYHRNNIRKSIFFLQEELLEKYSETVCKYIVFPLLAYVDEKLMLLREKSASNISWSLLQLEYYDRKDGGEYVFEITDNILSENIYPQICYQTISLILHNDFYGKYYDNIYNHSFLAYKKEIDKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Conserved Type Six Secretion Protein Tssl (Dotu) from Francisella Novicida
pubmed doi rcsb
source organism Francisella novicida
molecule tags Protein transport
molecule keywords TSSL
total genus 59
structure length 152
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.590 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ackA00
4ACKA 4ACLA 4V3IA 3U66A
chains in the Genus database with same CATH superfamily
3CVLA 2VJ8A 1N4PA 3E30A 4B89A 3HXCA 4HVBA 5JHBA 3ZRHA 4BFRA 3VTYA 2QYJA 5JMND 2KCVA 2XQ0A 2ONDA 3DWLG 4ABNA 4IN3B 3CQCB 2AXZA 2EILE 4TRQA 4C9BB 5AN8A 4ZFHA 2AXVA 1K3ZD 3MX3A 4BSXA 1TR4A 2AWIA 1TN8A 1WG0A 1V55E 2AXUA 2R03A 5FTPA 2XPIA 2JLBA 3DPYA 5CRVA 2WQHA 3TL5A 3PZ4A 3KD7A 4HRMB 3HYMB 2OOEA 2V4HC 3MGBA 2C0MA 4I9CA 3U9WA 4TXRA 5CMYA 2KZTB 2IO3C 2KBXA 4RVBA 4U8VD 4GMRA 5CBNA 1UG3A 2KATA 4U04A 4ME2A 4DX7D 3FUNA 3I4GA 3ZYLA 3V79K 2VSOE 3UT4A 3LDZA 4MRUA 1O5MA 2V5QC 3TG5A 3ZEFA 1JWFA 4UWKA 2LSVA 3RKVA 4PH4B 1HFAA 5AQ7A 2HYZA 2J07A 1ZU2A 3I5PA 3FH7A 2NC9A 3IEGA 3KAEA 4GYOA 2PZIA 3EHQA 4FC8A 2R05A 3KSQA 4U8HA 3LCAA 2XZTG 1U2VG 2ZXWE 4CGWA 4JHKA 5BV1A 3RIBA 2Y69E 2P2CP 2XRZA 4BTAA 2P58C 1BI7B 3CGHA 3EIQC 3BU8A 2HO1A 5ENTD 5KCMA 3UKRG 1DCEA 4GZ6A 4K5AB 3FH8A 2JEKA 4AJWA 3T5VA 4AY5A 3L6AA 3BEEA 1OT8A 2R02A 5ENQD 4F6RD 2IQCA 3HXFA 5FJYA 3ASHA 1D9SA 3L9TA 4LNUD 3UT8A 3V2OA 5HS0A 4CGVA 2V0PA 4FHJA 3PRZA 3AG3E 3ASOE 5ENPD 3Q9UC 3CHSA 1FT1A 1V54E 3R7RA 3R9AB 4YDWA 2VGEA 4GTQA 5BT1A 2CHZA 4G2VA 1Q2ZA 3EHMA 4CEMA 2QFCA 4O60A 1MJ0A 3Q75A 1UJKA 4BESA 2X3MA 4HNAD 3HRAA 5DBKA 2OEWA 3IV0A 3LPZA 4KT6B 3IHYA 3QKYA 2WPVA 5KWDA 3QWPA 3LXUX 4J7WA 3CVXA 4I2WA 3ENEA 2QYUA 1OWLA 2L9BA 4UI9K 3I3NA 3FUFA 2NSZA 1SQMA 4U95D 5C1DA 1X5BA 3NQPA 1Z6TA 3UINC 3CV0A 3FDHA 1JWGA 4U96D 3GZ1A 5ENSD 5CECB 4J8FA 4HOUA 2LNIA 2BTDA 2IONA 3CHRA 3RO3A 1KZOA 3PNLB 1HO8A 4JZYA 4I1MA 3JUEA 3QOUA 1ELKA 4N3CA 3KS2A 4A63B 4I6EA 4G11A 3C3QA 2M63A 3B13A 4Z68A 3B7UX 4R7LA 5AYWD 2OVBA 2GRRB 5CCLA 1O1SA 3G2UA 5FZRA 1DC2A 1BI8B 3PS6A 4I6JA 4E6HA 3HVEB 3ZGQA 3RRNB 3ML9A 3P2BA 2OVFA 4ZHBA 5FT9A 1DCQA 5D0QD 3CVQA 2WVIA 3PE4A 3FTUA 3UX4A 3VLFA 4I2ZA 3ZHEA 3CVYA 3DSTA 2E0IA 3OTNA 1INZA 4YNDA 2DVWA 1IYGA 4ANUA 3QC1A 4DRXE 3BG0B 2Y4UA 3CSTA 5G04J 2FI7A 4Y6CA 2IOSA 3FP3A 3U64A 3CVPA 3LVRE 2A4ZA 3EU9A 3MEKA 3ESKA 4K5BA 5A7DB 3ZUVB 3MA5A 3ASNE 3FTVA 3FTYA 5AAOA 3Q5MA 4GA2A 3B7RL 5AQAA 4JD2G 3HXBA 5EN5D 5CERB 4HLEA 1E8YA 4LSZE 5LCWC 2YINA 4RG6A 5CHEE 3Q9NC 4AV7A 3FHEA 3GZSA 2MYOA 3D9OA 3FTXA 3ZIMA 3FTZA 4U07A 3WG7E 2H6GA 2XGOA 1SVXA 4MS6A 2P9SG 4CRWA 3ABKE 4W9RA 3MKRA 4CZ2D 4HOTA 4ANWA 2FF4A 1NA0A 4RG9A 4UQYA 4EHMA 3BG1B 2J09A 3OXFA 2R17C 2WXIA 3UXGA 1H2UA 3PEUB 2P9UG 2XGSA 3PEVB 2P9IG 3EJNA 1D8DA 2XPZA 4U0ZA 5ENOD 3QDNA 5CEAA 3LY8A 3CVNA 3DSSA 4JEHA 5EKQD 4EQFA 4N3AA 2X6FA 5FINA 4BSZB 1LD8A 3FEXA 1G3NB 4HOSA 5T3RA 3HVEA 4NRHB 4AXHA 2EIKE 3O48A 1IXVA 3JUIA 4O1OA 4PS8A 5DIZA 1SZ9A 3AJIA 4APFA 4A3TA 4NIKA 4GZDA 3J5PA 3IKOB 5BPPA 3LVQE 3ZNGA 2ETCA 3EIJA 3BUAA 3DXKG 5BW8C 1PY1A 3RRUA 2XGMA 2L0TB 3MYVA 5LOZA 2XZDG 3AU5A 4ACLA 2VGXB 3DEOA 1EF1C 2VSXE 1WY6A 3G2SA 4ILHB 3TWTA 4KBQA 3ULEG 5C2YA 3ESLA 2CFZA 3QAQA 1KT0A 2ZU6B 4BERA 4PDXA 4ANXA 1FCHA 4G24A 2H6HA 1FVHA 2LXMA 5FWQA 3S7JA 2WXHA 3ZVVA 5AQ9A 2PQRA 2AVPA 2UY1A 5CMWA 2F37A 3Q4AB 5KJMA 3ABLE 2OEVA 4UWFA 4DK5A 3L82A 3SHFA 4LRZA 4GMJA 5CRUA 3PZDA 4CT4A 1OUVA 5HRYA 3P1UA 3JYSA 5AARA 3HG0D 4HI8A 4DJAA 4GMLA 2HR2A 5LP0A 2YNQA 3AU4A 2BEDA 1L5JA 3NOCD 4GPMA 4PUCA 3S7DA 2L6JA 3VLDA 2IEJA 1TNZA 4BX8A 3QARA 1H6OA 4DI3A 3IBEA 5CBOA 2I9CA 3TJPA 4H7YA 4AEZC 4UWGA 3DSXA 5FQ6A 1YMPA 5EYLA 2DYSE 2P9NG 2FEZA 5LCWJ 4YDOA 1HXIA 4GA1A 3U66A 2I1JA 3QNKA 1TJCA 1N4RA 2A5UA 3SFZA 1S70B 3EDTB 3Q73A 4HLLA 1SZAA 4DX1A 3SD5A 1GW6A 1E8XA 2L6BA 4GU5A 3D9IA 4UQXA 4EBAG 3CR3A 4LERA 3ONLA 3RU0A 2WXOA 4QFVA 1SA4A 4OAUC 3QWVA 4AM9A 4BX9A 1UN8A 2CG2A 2XCCA 3EU5A 4KYOB 4JXTA 4L2LA 1JCSA 2J9QA 4X8QA 2X6JA 2QZAA 5FIOA 1N0QA 3FUHA 2B6CA 3CHMA 3C5RA 2Q7FA 1K1BA 3SGHA 3D9HA 4XX5A 3B95A 2V8SE 1H2TC 3DBSA 4EECA 3L22A 5EYPF 3W9FA 2Y3AA 1HZ4A 3CQGB 3HXEA 3FY4A 4BETA 3CHOA 4TUUA 2F8XK 1KPSB 2BF0X 2IF4A 3AS8A 2I1KA 2KZTA 5HQ8A 1X81A 3UT7A 5G55A 1DNPA 4BY6A 1Y6IA 4GTVA 4GTPA 4JL0A 1H6KA 2KXPC 2DZNA 4DLQA 2A5EA 4JA9A 2P9PG 4Q94A 3VTXA 3Q49B 5G04C 3V2XA 4HB5A 1E96B 2X6KA 2L0IA 3FTWA 1H0AA 5FQ4A 4AP2A 3DSVA 2WXJA 2GGFA 1AWCB 3TAXA 3SBSA 2GRPB 1HE8A 4YVOA 4UI9J 1YCSB 4DX2A 2Y0BG 2R5SA 5HI7A 3NZUA 3HXDA 4LCTA 4HRNA 2WXKA 3ZYMA 1OWNA 5ITZF 4L2YA 1LF8A 2OV8A 3ABME 2QC9A 5BUZA 3PUJA 5KJLA 4ANVA 4IRUA 3T8KA 3ZYQA 2LAHA 4CDNA 3FEYA 1N95A 3CK8A 3GYZA 3U4TA 4N2QA 4GAAA 2LUHA 3J5QB 1AP7A 3D9JA 4GCOA 3FTSA 4LEUA 4MBGA 1N4QA 2J49A 5IY5E 1QBQA 1SW6A 1D8EA 3BQOA 2XENA 2VSYA 2I6HA 4DI4A 5JA4D 2IU1A 2R59A 4GTRA 5FQ8A 5CCMA 5B1AE 4BTBA 4RLYA 1ZB1A 4I9EA 4AVXA 1RW2A 1UJJA 2X6IA 3UTMA 3PH0C 5JHAA 4J8EA 5J90A 3CK9A 5D0OD 4N39A 3CVUA 1HF8A 4FADA 1BLXB 3D9LA 3UIOC 1OY3D 2WM9A 4CT0A 3MCXA 3MJWA 3FFLA 4U63A 1IQUA 2WQ7A 2GRNB 3SY2A 3AS5A 3UQ3A 5KNGA 3URZA 2VTBA 2XEEA 1XNFA 2RD0A 3CK7A 1NZNA 4U0SA 4F3VA 4A1GA 2PL2A 3Q79A 2P9LG 3E33A 2Y1LE 2WXRA 2PQNA 4HQDA 4AOFA 3FUMA 2IOLA 3UI2A 1OCOE 4HI9A 2PNNA 4GTMA 1WM5A 3FULA 3RSEG 4F1SA 1TNBA 3D9MA 3KEZA 3SZ7A 5ARFA 1Y8MA 4OVUA 4ILIA 2GRQB 1IHGA 5A6CA 3U3WA 3SNXA 1IQRA 4UI9C 5JJ7A 4XE0A 2X6HA 4LNGA 1NI1A 2NYJA 3IHVA 4DLOA 4XI0A 2RFMA 4YDYA 5EILA 1IHBA 4WWNA 3SQVA 3QB2A 1TJFA 2V5FA 3CEQA 2CG3A 5LFAA 3ZW3A 3D9NA 2XEHA 5M72A 1O1TA 1EPUA 1S64A 4WNDA 5LX8A 5ENRD 2ETAA 3N71A 1H6PA 4A1SA 5FZSA 2XS8A 4WUYA 4L1BA 5FQ7A 3L13A 3SF4A 3E32A 4PS3A 4NQ0A 2P9KG 4WNFA 3O4ZA 1TYQG 3B7TA 3SI5A 4GZ3A 3QWWA 3CKCA 1NFIE 2WXFA 4B94A 5EX0A 4HS2A 3UM2A 3ZN3A 5BNWA 1P5QA 2V4LA 1OCZE 3APCA 1E8WA 2VGYA 4JA7A 3KSLA 3ULYA 3E34A 1TNOA 5J08A 5BXUA 5G05C 1U3CA 1TN7A 3ASGA 3FUIA 3ZXSA 3TWUA 4GYWA 4JC8A 4RSYA 2YHCA 4C0MA 3UKUG 4TXPA 1FT2A 5CEDB 1SA5A 2DYRE 4I1AA 3CSFA 4WNGA 2LAIA 3UM0A 3JXIA 4K5CA 4G1TA 4G8KA 1JUQA 1NA3A 1OWPA 1TN6A 4N2SA 4DUIA 4RQIA 3VLEA 4EZKA 3PZ3A 4G23A 4J8YA 4U8YD 4J0UA 4G25A 3C3RA 3UUXA 4B8AA 2X38A 1HX8A 2GROB 1N94A 3CVWA 2I2OA 1ZBPA 3AG1E 3TWSA 2EQXA 4B8CB 2DIWA 3UM1A 5AQBA 3EHNA 3PDNA 4Y6WA 5ANRA 2WXLA 4JHJA 5T8IA 4B0ZA 3FUEA 3LY9A 1KZPA 3UIPC 2KC7A 3V31A 3ZFWA 2BUGA 4H7XA 3JCKC 1HH8A 3LS8A 3I4RB 5D66A 4GZ5A 1BU9A 1OCCE 3B7BA 5B3SE 4CDRA 3X2QE 2BKGA 1HG2A 1N54A 4AIFA 4BT8A 1O1RA 4JVSA 5E75A 3LYAA 4YVQC 1MX2A 3OXLA 3C3OA 2XRYA 4K0RA 1HS6A 3C98A 3HHMA 3ASDA 3MKQB 3RJVA 2WB2A 3L16A 1S63A 3PREA 1BPOA 3G2WA 2CHWA 1K1AA 3PZ1A 4I17A 2PM6A 5KBAA 2UY1B 4U7EB 3Q15A 1OXJA 2HE0A 4HOQA 4G8LA 3KEAA 4FHKA 3G2VA 2YQ8A 2IFUA 4JEUA 3SO8A 2ZISA 2XPYA 3AG2E 1N4SA 3MZLB 2NXPA 1LD7A 2LSUA 3Q78A 3OAWA 3S2AA 3TWQA 3FU6A 3Q7AA 3SFYA 3NBNB 3JXJA 2IY0C 5A23A 4L23A 4HBDA 4M3OA 1N52A 3T5XA 4M7CA 3CVVA 4Q96A 4N3BA 1OWOA 2EINE 1U3DA 2OCCE 3GZ2A 5H7PA 1XGWA 2IJGX 3JQ1A 3PNTB 4TXQA 4QQIA 4XKCA 3FUDA 2LXLA 3OXGA 3NB2A 1NL4A 4GTOA 2C2LA 1JCRA 2WXQA 3TWRA 2QY7A 1Z3XA 2GRMA 4D10C 4A55A 4JW1A 1UW4B 3RRMB 3E4BA 4FP7A 1PC2A 2MHKA 5ARGA 2ILRA 4FLHA 2XCBA 2F8YA 5AENA 3R7QA 4ATZD 4FA6A 3LJNA 3S7BA 4MKTA 2LO6A 3LKUA 1A17A 4WWPA 1EYHA 4NURA 5JJ6A 2MOWA 3ONKA 4XKBA 4KZCA 5BXOA 1N11A 3FU3A 3T9KA 3CHPA 1A5EA 5BV0A 3PVLA 1EDUA 4FJYA 5D2MC 4GA0A 1JCQA 4F53A 3DRAA 4DPRA 4CCAA 3R9MA 3NAWA 3HIZA 3DSWA 3FU5A 2RG8A 4WAFA 3UPVA 4HXIA 3EUVA 2ZIRA 5KJNA 3MKQA 2CFUA 3TXMA 3TWWA 3AS4A 5EDSA 2XS1A 2H6FA 4JB8P 3Q47B 1MX4A 1E8ZA 4NACA 1PAQA 1MZCA 3LY7A 5G2NA 3LEWA 4LG6A 3ZYKA 3APFA 4CDMA 2H6IA 4XIFA 4O6FA 4AY6A 3MV3B 1KT1A 3CHQA 4JHRA 3PZ2A 5EX3A 2WQ6A 4ILGA 1E7UA 4KXKB 3TGOA 4PS7A 2MRIA 3DPDA 2E2EA 4JPSA 5KJKA 2J4DA 1K8KG 1RZ4A 4GCNA 5ENNA 1TNUA 2VGXA 4KMOA 3TWXA 2BKKB 2ZGDA 1NP7A 2C0LA 5AIJA 2UWJG 1DVPA 4GTSA 1E90A 4C0EA 4J8SA 5HKPA 4FULA 3APDA 4LNBA 4XEIG 2J08A 3L08A 2CHXA 2XEVA 1B89A 2B0OE 4KVOA 4UUCA 4UWHA 4YDEA 4J6IA 5FZQA 4F7AA 3L54A 1ELWA 3UMVA 2AW6A 2WXPA 1MYOA 3ZHEB 1IKND 2ETBA 4UQZA 1HU3A 5G05J 3CIAA 4GZCA 3RAUA 5AJDA 1YYHA 4B93B 1ELRA 1QYMA 4APOA 2HM8A 3NF1A 2VTBB 4EPZA 1N9AA 3F6QA 3ZKJA 4IYPA 4J8DA 3PUKA 4O1PA 2FULA 4I43A 3EHRA 3ML8A 4GPKA 4C48B 5KNHD 1LTXA 4V3IA 3GW4A 4U0UA 1Z3YA 4UWLA 2IO2C 3B7SA 1HG5A 3DSUA 4LUNU 2VQ2A 4G26A 3QJZA 3NZSA 1QZ2A 2WXNA 3HDXA 4FJZA 4KZ0A 2WMOA 2WXGA 2WMNA 4KVMA 3K9IA 2PM7A 1KLXA 4FU3A 4OAVB 3FUKA 5AJLA 1YA0A 4K03A 5B1BE 4I6GA 3ASFA 1FPPA 3NOGD 4HFGA 2EIJE 3AG4E 3CLJA 3ZXPA 1FVFA 3FU0A 2Y4TA 3RO2A 4TUMA 4Q69A 5T4YA 3AAAC 5E76A 1VDYA 1OCRE 2VSNA 1S0PA 1WDYA 1OWMA 2VYIA 4OVVA 3G2TA 2F0YA 4IULA 3L17A 3FUJA 4DX5D 1MHQA 3T8MA 3DXMG 3V30A 2R2LA 3FH5A 2YHEA 4L7TA 2FO1E 2JABA 1MQSA 2DWZA 2GW1A 4EZJA 3RK6A 4ATGA 2RFAA 3C72A 3UM3A 1TEZA 3E37A 1H19A 1UN9A 4A3VA 3D9KA 3TWVA 2DCPA 3IXEA 2FO7A 2AJAA 4GYYA 3S7FA 1TNYA 4E85A 2EIME 2FBNA 4MLPA 4OYSA 3SFXA 1N0RA 3Q7FA 2KCLA 4I1OB 3QK0A 4WNEA 4HORA 2XHEA 2KM4A 2J4BA 1MX6A 4WWOA 1BD8A 4BWRA 4P29A 4URKA 1QNFA 4DX6D 4BT9A 4N5QA 2RKKA 4GTTA 1JPLA 1WAO1 3TXNA 4EZLA 3FWVA 2WXMA 1UOHA 5EIBE 3ULQA 5ANLA 1H2VC 2DZOA 3ZU7B 1W3BA 2DBAA 5EIDA 3LJ3A 4L9PA 3ZPJA 3SBTB 3JQ0A 3D9PA 3D3MA 5JJTA 3PE3A 3DEPA 1E7VA 2J8SD 2KCKA 4N5CA 3W9GA 4FLBA 4CYMD 4XZ4A 1Z5SC 4BEPA 4EBAA 3ISMC 4GB9A 4F1PA 3WXXA 3TG4A 4HRLA 3MV2B 2ZGGA 4TV3A 4XI9A 2GRLA 4ACKA 1QQEA 3CKBA
chains in the Genus database with same CATH topology
3PVLA 4CRWA 1EDUA 3CVLA 2VJ8A 3PH0C 4FJYA 4GA0A 4F53A 5JHAA 4W9RA 3MKRA 4B89A 4DPRA 4HVBA 4HOTA 4J8EA 4ANWA 4CCAA 5JHBA 2FF4A 1NA0A 3ZRHA 4BFRA 3VTYA 5J90A 3CK9A 5D0OD 2KCVA 4N39A 3CVUA 1HF8A 4RG9A 4UQYA 4FADA 2XQ0A 3HIZA 3BG1B 2J09A 3FU5A 3D9LA 2RG8A 4WAFA 2ONDA 3UPVA 3OXFA 2WM9A 4HXIA 4ABNA 4IN3B 4CT0A 3MCXA 3CQCB 2AXZA 3MJWA 5KJNA 3FFLA 2CFUA 2R17C 3MKQA 4U63A 3TXMA 2WXIA 1H2UA 1IQUA 4TRQA 3PEUB 2WQ7A 2XGSA 3PEVB 4C9BB 3AS4A 3EJNA 2XPZA 3AS5A 4U0ZA 2AXVA 5EDSA 3UQ3A 3MX3A 3URZA 2VTBA 4BSXA 3Q47B 3QDNA 1XNFA 1E8ZA 2RD0A 4NACA 3LY8A 3CK7A 1PAQA 1NZNA 3CVNA 4JEHA 4U0SA 4F3VA 5EKQD 3LY7A 4A1GA 2PL2A 4EQFA 5G2NA 4N3AA 2X6FA 3LEWA 3ZYKA 3APFA 2AWIA 3FEXA 4CDMA 4HOSA 2AXUA 4XIFA 4O6FA 5FTPA 2XPIA 5T3RA 2WXRA 2JLBA 3HVEA 3MV3B 4AY6A 2PQNA 4NRHB 1KT1A 4AXHA 3CHQA 4JHRA 3O48A 4AOFA 2WQHA 3FUMA 5EX3A 4ILGA 2WQ6A 1E7UA 3JUIA 4KXKB 3TL5A 2IOLA 3KD7A 3TGOA 4PS8A 4PS7A 3HYMB 5DIZA 1SZ9A 2OOEA 2MRIA 1WM5A 3MGBA 4APFA 4A3TA 3FULA 3DPDA 2E2EA 2C0MA 4JPSA 4F1SA 2J4DA 5KJKA 4GZDA 4I9CA 3U9WA 3SZ7A 3D9MA 3KEZA 5CMYA 2KZTB 4GCNA 5ARFA 1Y8MA 4RVBA 3IKOB 5ENNA 5BPPA 4OVUA 4ILIA 3LVQE 1IHGA 5A6CA 3U3WA 3SNXA 2VGXA 1UG3A 4KMOA 2KATA 3EIJA 1IQRA 4U04A 4ME2A 4UI9C 5JJ7A 3FUNA 4XE0A 3I4GA 2X6HA 3ZYLA 3IHVA 5BW8C 4DLOA 2VSOE 1PY1A 1NP7A 4XI0A 3RRUA 2C0LA 3UT4A 3LDZA 4WWNA 2XGMA 5AIJA 4MRUA 2UWJG 1DVPA 3QB2A 1E90A 1TJFA 2V5FA 2L0TB 3CEQA 3TG5A 3MYVA 3ZEFA 4C0EA 2CG3A 5LFAA 3ZW3A 1JWFA 4UWKA 3D9NA 2LSVA 4J8SA 5LOZA 5M72A 3AU5A 4FULA 4ACLA 2VGXB 3RKVA 1EPUA 4PH4B 1EF1C 3APDA 4WNDA 2VSXE 5LX8A 1HFAA 1WY6A 2J08A 3L08A 3G2SA 3N71A 4ILHB 4A1SA 5FZSA 2CHXA 2HYZA 2J07A 1ZU2A 3I5PA 4WUYA 4L1BA 5FQ7A 3FH7A 2XEVA 1B89A 4KBQA 2NC9A 5C2YA 3ESLA 3L13A 4KVOA 4PS3A 3SF4A 3IEGA 2CFZA 3KAEA 3QAQA 4NQ0A 4GYOA 1KT0A 4UWHA 2PZIA 4FC8A 4WNFA 2ZU6B 4J6IA 3O4ZA 3B7TA 4PDXA 5FZQA 4ANXA 4U8HA 1FCHA 4GZ3A 3SI5A 3LCAA 3QWWA 4F7AA 4G24A 3CKCA 3L54A 1ELWA 3UMVA 2AW6A 2WXFA 4JHKA 5BV1A 4CGWA 2WXPA 3RIBA 4B94A 1FVHA 5EX0A 3ZHEB 2XRZA 5FWQA 4HS2A 3ZN3A 3S7JA 4BTAA 2P58C 2WXHA 5BNWA 1P5QA 2V4LA 3APCA 3ZVVA 4UQZA 1HU3A 3CGHA 3EIQC 5G05J 3CIAA 1E8WA 2PQRA 2VGYA 2AVPA 2UY1A 4GZCA 5CMWA 5AJDA 4JA7A 2HO1A 1ELRA 3Q4AB 4APOA 5KJMA 2HM8A 5KCMA 3NF1A 4UWFA 4DK5A 5J08A 3SHFA 2VTBB 4EPZA 4LRZA 4GMJA 3PZDA 5G05C 1U3CA 4CT4A 4GZ6A 1OUVA 3FH8A 4IYPA 2JEKA 3ASGA 4AJWA 3FUIA 3ZXSA 3T5VA 3P1UA 4J8DA 3JYSA 3PUKA 4GYWA 3L6AA 3BEEA 4JC8A 4RSYA 4AY5A 2YHCA 2FULA 4I43A 4C0MA 4DJAA 4GMLA 2HR2A 2IQCA 5LP0A 3ML8A 4GPKA 2YNQA 5FJYA 3ASHA 3UT8A 4I1AA 3CSFA 3AU4A 4WNGA 1L5JA 2LAIA 4CGVA 4V3IA 4PUCA 3S7DA 4G1TA 2L6JA 2V0PA 3GW4A 1JUQA 1NA3A 1OWPA 4U0UA 3VLDA 4FHJA 4N2SA 1Z3YA 4UWLA 3PRZA 3B7SA 4BX8A 3QARA 3VLEA 1HG5A 4DI3A 4EZKA 4G23A 3IBEA 2I9CA 4LUNU 2VQ2A 4J0UA 4G26A 3TJPA 3CHSA 4G25A 4H7YA 3QJZA 4AEZC 4UWGA 3R7RA 5FQ6A 3UUXA 3NZSA 1QZ2A 2WXNA 4B8AA 3HDXA 2X38A 4FJZA 4KZ0A 3R9AB 2WMOA 1HX8A 2WXGA 2WMNA 3CVWA 5BT1A 2CHZA 4G2VA 2I2OA 2FEZA 5LCWJ 3EHMA 1ZBPA 1HXIA 4KVMA 4CEMA 4GA1A 3K9IA 2PM7A 2QFCA 1KLXA 3U66A 2I1JA 2EQXA 4FU3A 3QNKA 4B8CB 1TJCA 2DIWA 2A5UA 1UJKA 3SFZA 2X3MA 3FUKA 3EDTB 5AJLA 1YA0A 4K03A 5DBKA 3IV0A 3LPZA 3EHNA 4I6GA 3PDNA 1SZAA 4Y6WA 4KT6B 5ANRA 3SD5A 2WXLA 4JHJA 3ASFA 5T8IA 3IHYA 1GW6A 4HFGA 4B0ZA 3QKYA 3FUEA 2WPVA 3CLJA 1E8XA 3QWPA 1FVFA 3LXUX 3FU0A 4GU5A 3D9IA 2Y4TA 3LY9A 4UQXA 3CVXA 4I2WA 3ENEA 4EBAG 2KC7A 3RO2A 3ZFWA 2BUGA 4H7XA 3JCKC 1HH8A 4Q69A 5T4YA 3CR3A 4LERA 3ONLA 1OWLA 3LS8A 5E76A 2L9BA 4UI9K 1VDYA 3I3NA 3FUFA 3RU0A 2NSZA 2WXOA 3I4RB 4QFVA 1SQMA 2VSNA 4GZ5A 5C1DA 1X5BA 3QWVA 1S0PA 1Z6TA 3NQPA 1OWMA 4AM9A 4BX9A 4CDRA 3CV0A 2VYIA 1HG2A 1N54A 4OVVA 4AIFA 4BT8A 3G2TA 1UN8A 2CG2A 3FDHA 2XCCA 4IULA 1JWGA 4KYOB 3GZ1A 4JVSA 4J8FA 3L17A 3FUJA 4JXTA 5E75A 4HOUA 4L2LA 1MHQA 3T8MA 2LNIA 3LYAA 2J9QA 2BTDA 2X6JA 2IONA 4YVQC 3CHRA 3RO3A 3OXLA 3FH5A 2YHEA 3FUHA 2XRYA 4L7TA 4K0RA 1HS6A 3C98A 3CHMA 1MQSA 2Q7FA 3HHMA 3SGHA 3ASDA 2GW1A 3PNLB 4XX5A 1HO8A 3MKQB 4JZYA 3RJVA 2V8SE 1H2TC 3L16A 3PREA 4I1MA 4EZJA 2WB2A 3QOUA 1ELKA 4N3CA 3KS2A 1BPOA 3DBSA 4I6EA 4G11A 4EECA 3L22A 2Y3AA 3G2WA 2M63A 1HZ4A 3B13A 3CQGB 2CHWA 3FY4A 3RK6A 3CHOA 4TUUA 3B7UX 4ATGA 4R7LA 5AYWD 4I17A 2PM6A 2UY1B 2BF0X 2IF4A 3AS8A 2OVBA 3Q15A 1TEZA 2I1KA 2KZTA 4HOQA 5CCLA 5HQ8A 1H19A 3G2UA 5FZRA 1UN9A 3UT7A 4FHKA 4A3VA 3PS6A 5G55A 3D9KA 1DNPA 4I6JA 4BY6A 4E6HA 3HVEB 3G2VA 3ZGQA 2DCPA 1Y6IA 3RRNB 3ML9A 2YQ8A 2IFUA 2FO7A 4JL0A 3P2BA 1H6KA 2OVFA 4JEUA 5FT9A 4GYYA 2XPYA 3S7FA 4DLQA 5D0QD 4JA9A 3CVQA 3MZLB 2WVIA 4Q94A 2NXPA 3PE4A 3FTUA 3UX4A 3VLFA 4E85A 2LSUA 4I2ZA 3VTXA 4MLPA 2FBNA 3ZHEA 3Q49B 4AVXA 4OYSA 3OAWA 3CVYA 5G04C 2E0IA 3OTNA 1INZA 3S2AA 4YNDA 1E96B 3FU6A 2X6KA 2L0IA 3FTWA 1H0AA 5FQ4A 4AP2A 2KCLA 1IYGA 4I1OB 4ANUA 3QC1A 4L23A 5A23A 4M3OA 2WXJA 2GGFA 1N52A 3BG0B 3QK0A 4WNEA 3T5XA 3TAXA 2XHEA 2Y4UA 3SBSA 4HORA 3CSTA 2KM4A 1HE8A 2FI7A 4Q96A 2J4BA 4YVOA 4N3BA 5G04J 4UI9J 4Y6CA 1OWOA 3CVVA 4WWOA 4BWRA 4P29A 1U3DA 2IOSA 3FP3A 4URKA 1QNFA 3GZ2A 2R5SA 3U64A 5HI7A 4BT9A 1XGWA 2IJGX 3CVPA 3JQ1A 3LVRE 3NZUA 3PNTB 2A4ZA 3MEKA 1JPLA 3ESKA 4XKCA 5A7DB 4LCTA 1WAO1 2WXKA 3TXNA 3ZYMA 4EZLA 3FUDA 1OWNA 3FWVA 3OXGA 4L2YA 2WXMA 3MA5A 1LF8A 3ULQA 2OV8A 5ANLA 3FTVA 1H2VC 3FTYA 3Q5MA 4GA2A 2C2LA 3B7RL 2WXQA 2QY7A 1W3BA 5BUZA 1Z3XA 2GRMA 2DBAA 3PUJA 4D10C 4HLEA 5KJLA 1E8YA 4ANVA 4IRUA 4A55A 3ZYQA 2LAHA 4JW1A 3LJ3A 4CDNA 5LCWC 3FEYA 1UW4B 3RRMB 3E4BA 3CK8A 3GYZA 4FP7A 3U4TA 4N2QA 1PC2A 2MHKA 5ARGA 4GAAA 2YINA 2ILRA 3D9JA 4FLHA 2XCBA 4GCOA 3ZPJA 3FTSA 4RG6A 4LEUA 5CHEE 3SBTB 5AENA 3R7QA 4AV7A 4FA6A 3JQ0A 3D9PA 3S7BA 3D3MA 4MKTA 5JJTA 2LO6A 3LKUA 1A17A 2J49A 3PE3A 3FHEA 1E7VA 2KCKA 4N5CA 4FLBA 4WWPA 3GZSA 4XZ4A 1EYHA 4NURA 5JJ6A 2MOWA 4EBAA 3D9OA 4GB9A 2VSYA 2I6HA 3WXXA 3FTXA 3ONKA 4DI4A 3TG4A 3MV2B 2IU1A 2R59A 3ZIMA 5FQ8A 3FTZA 5CCMA 4XKBA 4U07A 4BTBA 4KZCA 4TV3A 4XI9A 3FU3A 4I9EA 2GRLA 3CHPA 2XGOA 4ACKA 1UJJA 5BV0A 1QQEA 2X6IA 3CKBA 4MS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ACK A;  4ACL A;  4V3I A;  3U66 A; 
#chains in the Genus database with same CATH topology
 3CVL A;  2VJ8 A;  1N4P A;  3E30 A;  4B89 A;  3HXC A;  4HVB A;  5JHB A;  3ZRH A;  4BFR A;  3VTY A;  2QYJ A;  5JMN D;  2KCV A;  2XQ0 A;  2OND A;  3DWL G;  4ABN A;  4IN3 B;  3CQC B;  2AXZ A;  2EIL E;  4TRQ A;  4C9B B;  5AN8 A;  4ZFH A;  2AXV A;  1K3Z D;  3MX3 A;  4BSX A;  1TR4 A;  2AWI A;  1TN8 A;  1WG0 A;  1V55 E;  2AXU A;  2R03 A;  5FTP A;  2XPI A;  2JLB A;  3DPY A;  5CRV A;  2WQH A;  3TL5 A;  3PZ4 A;  3KD7 A;  4HRM B;  3HYM B;  2OOE A;  2V4H C;  3MGB A;  2C0M A;  4I9C A;  3U9W A;  4TXR A;  5CMY A;  2KZT B;  2IO3 C;  2KBX A;  4RVB A;  4U8V D;  4GMR A;  5CBN A;  1UG3 A;  2KAT A;  4U04 A;  4ME2 A;  4DX7 D;  3FUN A;  3I4G A;  3ZYL A;  3V79 K;  2VSO E;  3UT4 A;  3LDZ A;  4MRU A;  1O5M A;  2V5Q C;  3TG5 A;  3ZEF A;  1JWF A;  4UWK A;  2LSV A;  3RKV A;  4PH4 B;  1HFA A;  5AQ7 A;  2HYZ A;  2J07 A;  1ZU2 A;  3I5P A;  3FH7 A;  2NC9 A;  3IEG A;  3KAE A;  4GYO A;  2PZI A;  3EHQ A;  4FC8 A;  2R05 A;  3KSQ A;  4U8H A;  3LCA A;  2XZT G;  1U2V G;  2ZXW E;  4CGW A;  4JHK A;  5BV1 A;  3RIB A;  2Y69 E;  2P2C P;  2XRZ A;  4BTA A;  2P58 C;  1BI7 B;  3CGH A;  3EIQ C;  3BU8 A;  2HO1 A;  5ENT D;  5KCM A;  3UKR G;  1DCE A;  4GZ6 A;  4K5A B;  3FH8 A;  2JEK A;  4AJW A;  3T5V A;  4AY5 A;  3L6A A;  3BEE A;  1OT8 A;  2R02 A;  5ENQ D;  4F6R D;  2IQC A;  3HXF A;  5FJY A;  3ASH A;  1D9S A;  3L9T A;  4LNU D;  3UT8 A;  3V2O A;  5HS0 A;  4CGV A;  2V0P A;  4FHJ A;  3PRZ A;  3AG3 E;  3ASO E;  5ENP D;  3Q9U C;  3CHS A;  1FT1 A;  1V54 E;  3R7R A;  3R9A B;  4YDW A;  2VGE A;  4GTQ A;  5BT1 A;  2CHZ A;  4G2V A;  1Q2Z A;  3EHM A;  4CEM A;  2QFC A;  4O60 A;  1MJ0 A;  3Q75 A;  1UJK A;  4BES A;  2X3M A;  4HNA D;  3HRA A;  5DBK A;  2OEW A;  3IV0 A;  3LPZ A;  4KT6 B;  3IHY A;  3QKY A;  2WPV A;  5KWD A;  3QWP A;  3LXU X;  4J7W A;  3CVX A;  4I2W A;  3ENE A;  2QYU A;  1OWL A;  2L9B A;  4UI9 K;  3I3N A;  3FUF A;  2NSZ A;  1SQM A;  4U95 D;  5C1D A;  1X5B A;  3NQP A;  1Z6T A;  3UIN C;  3CV0 A;  3FDH A;  1JWG A;  4U96 D;  3GZ1 A;  5ENS D;  5CEC B;  4J8F A;  4HOU A;  2LNI A;  2BTD A;  2ION A;  3CHR A;  3RO3 A;  1KZO A;  3PNL B;  1HO8 A;  4JZY A;  4I1M A;  3JUE A;  3QOU A;  1ELK A;  4N3C A;  3KS2 A;  4A63 B;  4I6E A;  4G11 A;  3C3Q A;  2M63 A;  3B13 A;  4Z68 A;  3B7U X;  4R7L A;  5AYW D;  2OVB A;  2GRR B;  5CCL A;  1O1S A;  3G2U A;  5FZR A;  1DC2 A;  1BI8 B;  3PS6 A;  4I6J A;  4E6H A;  3HVE B;  3ZGQ A;  3RRN B;  3ML9 A;  3P2B A;  2OVF A;  4ZHB A;  5FT9 A;  1DCQ A;  5D0Q D;  3CVQ A;  2WVI A;  3PE4 A;  3FTU A;  3UX4 A;  3VLF A;  4I2Z A;  3ZHE A;  3CVY A;  3DST A;  2E0I A;  3OTN A;  1INZ A;  4YND A;  2DVW A;  1IYG A;  4ANU A;  3QC1 A;  4DRX E;  3BG0 B;  2Y4U A;  3CST A;  5G04 J;  2FI7 A;  4Y6C A;  2IOS A;  3FP3 A;  3U64 A;  3CVP A;  3LVR E;  2A4Z A;  3EU9 A;  3MEK A;  3ESK A;  4K5B A;  5A7D B;  3ZUV B;  3MA5 A;  3ASN E;  3FTV A;  3FTY A;  5AAO A;  3Q5M A;  4GA2 A;  3B7R L;  5AQA A;  4JD2 G;  3HXB A;  5EN5 D;  5CER B;  4HLE A;  1E8Y A;  4LSZ E;  5LCW C;  2YIN A;  4RG6 A;  5CHE E;  3Q9N C;  4AV7 A;  3FHE A;  3GZS A;  2MYO A;  3D9O A;  3FTX A;  3ZIM A;  3FTZ A;  4U07 A;  3WG7 E;  2H6G A;  2XGO A;  1SVX A;  4MS6 A;  2P9S G;  4CRW A;  3ABK E;  4W9R A;  3MKR A;  4CZ2 D;  4HOT A;  4ANW A;  2FF4 A;  1NA0 A;  4RG9 A;  4UQY A;  4EHM A;  3BG1 B;  2J09 A;  3OXF A;  2R17 C;  2WXI A;  3UXG A;  1H2U A;  3PEU B;  2P9U G;  2XGS A;  3PEV B;  2P9I G;  3EJN A;  1D8D A;  2XPZ A;  4U0Z A;  5ENO D;  3QDN A;  5CEA A;  3LY8 A;  3CVN A;  3DSS A;  4JEH A;  5EKQ D;  4EQF A;  4N3A A;  2X6F A;  5FIN A;  4BSZ B;  1LD8 A;  3FEX A;  1G3N B;  4HOS A;  5T3R A;  3HVE A;  4NRH B;  4AXH A;  2EIK E;  3O48 A;  1IXV A;  3JUI A;  4O1O A;  4PS8 A;  5DIZ A;  1SZ9 A;  3AJI A;  4APF A;  4A3T A;  4NIK A;  4GZD A;  3J5P A;  3IKO B;  5BPP A;  3LVQ E;  3ZNG A;  2ETC A;  3EIJ A;  3BUA A;  3DXK G;  5BW8 C;  1PY1 A;  3RRU A;  2XGM A;  2L0T B;  3MYV A;  5LOZ A;  2XZD G;  3AU5 A;  4ACL A;  2VGX B;  3DEO A;  1EF1 C;  2VSX E;  1WY6 A;  3G2S A;  4ILH B;  3TWT A;  4KBQ A;  3ULE G;  5C2Y A;  3ESL A;  2CFZ A;  3QAQ A;  1KT0 A;  2ZU6 B;  4BER A;  4PDX A;  4ANX A;  1FCH A;  4G24 A;  2H6H A;  1FVH A;  2LXM A;  5FWQ A;  3S7J A;  2WXH A;  3ZVV A;  5AQ9 A;  2PQR A;  2AVP A;  2UY1 A;  5CMW A;  2F37 A;  3Q4A B;  5KJM A;  3ABL E;  2OEV A;  4UWF A;  4DK5 A;  3L82 A;  3SHF A;  4LRZ A;  4GMJ A;  5CRU A;  3PZD A;  4CT4 A;  1OUV A;  5HRY A;  3P1U A;  3JYS A;  5AAR A;  3HG0 D;  4HI8 A;  4DJA A;  4GML A;  2HR2 A;  5LP0 A;  2YNQ A;  3AU4 A;  2BED A;  1L5J A;  3NOC D;  4GPM A;  4PUC A;  3S7D A;  2L6J A;  3VLD A;  2IEJ A;  1TNZ A;  4BX8 A;  3QAR A;  1H6O A;  4DI3 A;  3IBE A;  5CBO A;  2I9C A;  3TJP A;  4H7Y A;  4AEZ C;  4UWG A;  3DSX A;  5FQ6 A;  1YMP A;  5EYL A;  2DYS E;  2P9N G;  2FEZ A;  5LCW J;  4YDO A;  1HXI A;  4GA1 A;  3U66 A;  2I1J A;  3QNK A;  1TJC A;  1N4R A;  2A5U A;  3SFZ A;  1S70 B;  3EDT B;  3Q73 A;  4HLL A;  1SZA A;  4DX1 A;  3SD5 A;  1GW6 A;  1E8X A;  2L6B A;  4GU5 A;  3D9I A;  4UQX A;  4EBA G;  3CR3 A;  4LER A;  3ONL A;  3RU0 A;  2WXO A;  4QFV A;  1SA4 A;  4OAU C;  3QWV A;  4AM9 A;  4BX9 A;  1UN8 A;  2CG2 A;  2XCC A;  3EU5 A;  4KYO B;  4JXT A;  4L2L A;  1JCS A;  2J9Q A;  4X8Q A;  2X6J A;  2QZA A;  5FIO A;  1N0Q A;  3FUH A;  2B6C A;  3CHM A;  3C5R A;  2Q7F A;  1K1B A;  3SGH A;  3D9H A;  4XX5 A;  3B95 A;  2V8S E;  1H2T C;  3DBS A;  4EEC A;  3L22 A;  5EYP F;  3W9F A;  2Y3A A;  1HZ4 A;  3CQG B;  3HXE A;  3FY4 A;  4BET A;  3CHO A;  4TUU A;  2F8X K;  1KPS B;  2BF0 X;  2IF4 A;  3AS8 A;  2I1K A;  2KZT A;  5HQ8 A;  1X81 A;  3UT7 A;  5G55 A;  1DNP A;  4BY6 A;  1Y6I A;  4GTV A;  4GTP A;  4JL0 A;  1H6K A;  2KXP C;  2DZN A;  4DLQ A;  2A5E A;  4JA9 A;  2P9P G;  4Q94 A;  3VTX A;  3Q49 B;  5G04 C;  3V2X A;  4HB5 A;  1E96 B;  2X6K A;  2L0I A;  3FTW A;  1H0A A;  5FQ4 A;  4AP2 A;  3DSV A;  2WXJ A;  2GGF A;  1AWC B;  3TAX A;  3SBS A;  2GRP B;  1HE8 A;  4YVO A;  4UI9 J;  1YCS B;  4DX2 A;  2Y0B G;  2R5S A;  5HI7 A;  3NZU A;  3HXD A;  4LCT A;  4HRN A;  2WXK A;  3ZYM A;  1OWN A;  5ITZ F;  4L2Y A;  1LF8 A;  2OV8 A;  3ABM E;  2QC9 A;  5BUZ A;  3PUJ A;  5KJL A;  4ANV A;  4IRU A;  3T8K A;  3ZYQ A;  2LAH A;  4CDN A;  3FEY A;  1N95 A;  3CK8 A;  3GYZ A;  3U4T A;  4N2Q A;  4GAA A;  2LUH A;  3J5Q B;  1AP7 A;  3D9J A;  4GCO A;  3FTS A;  4LEU A;  4MBG A;  1N4Q A;  2J49 A;  5IY5 E;  1QBQ A;  1SW6 A;  1D8E A;  3BQO A;  2XEN A;  2VSY A;  2I6H A;  4DI4 A;  5JA4 D;  2IU1 A;  2R59 A;  4GTR A;  5FQ8 A;  5CCM A;  5B1A E;  4BTB A;  4RLY A;  1ZB1 A;  4I9E A;  4AVX A;  1RW2 A;  1UJJ A;  2X6I A;  3UTM A;  3PH0 C;  5JHA A;  4J8E A;  5J90 A;  3CK9 A;  5D0O D;  4N39 A;  3CVU A;  1HF8 A;  4FAD A;  1BLX B;  3D9L A;  3UIO C;  1OY3 D;  2WM9 A;  4CT0 A;  3MCX A;  3MJW A;  3FFL A;  4U63 A;  1IQU A;  2WQ7 A;  2GRN B;  3SY2 A;  3AS5 A;  3UQ3 A;  5KNG A;  3URZ A;  2VTB A;  2XEE A;  1XNF A;  2RD0 A;  3CK7 A;  1NZN A;  4U0S A;  4F3V A;  4A1G A;  2PL2 A;  3Q79 A;  2P9L G;  3E33 A;  2Y1L E;  2WXR A;  2PQN A;  4HQD A;  4AOF A;  3FUM A;  2IOL A;  3UI2 A;  1OCO E;  4HI9 A;  2PNN A;  4GTM A;  1WM5 A;  3FUL A;  3RSE G;  4F1S A;  1TNB A;  3D9M A;  3KEZ A;  3SZ7 A;  5ARF A;  1Y8M A;  4OVU A;  4ILI A;  2GRQ B;  1IHG A;  5A6C A;  3U3W A;  3SNX A;  1IQR A;  4UI9 C;  5JJ7 A;  4XE0 A;  2X6H A;  4LNG A;  1NI1 A;  2NYJ A;  3IHV A;  4DLO A;  4XI0 A;  2RFM A;  4YDY A;  5EIL A;  1IHB A;  4WWN A;  3SQV A;  3QB2 A;  1TJF A;  2V5F A;  3CEQ A;  2CG3 A;  5LFA A;  3ZW3 A;  3D9N A;  2XEH A;  5M72 A;  1O1T A;  1EPU A;  1S64 A;  4WND A;  5LX8 A;  5ENR D;  2ETA A;  3N71 A;  1H6P A;  4A1S A;  5FZS A;  2XS8 A;  4WUY A;  4L1B A;  5FQ7 A;  3L13 A;  3SF4 A;  3E32 A;  4PS3 A;  4NQ0 A;  2P9K G;  4WNF A;  3O4Z A;  1TYQ G;  3B7T A;  3SI5 A;  4GZ3 A;  3QWW A;  3CKC A;  1NFI E;  2WXF A;  4B94 A;  5EX0 A;  4HS2 A;  3UM2 A;  3ZN3 A;  5BNW A;  1P5Q A;  2V4L A;  1OCZ E;  3APC A;  1E8W A;  2VGY A;  4JA7 A;  3KSL A;  3ULY A;  3E34 A;  1TNO A;  5J08 A;  5BXU A;  5G05 C;  1U3C A;  1TN7 A;  3ASG A;  3FUI A;  3ZXS A;  3TWU A;  4GYW A;  4JC8 A;  4RSY A;  2YHC A;  4C0M A;  3UKU G;  4TXP A;  1FT2 A;  5CED B;  1SA5 A;  2DYR E;  4I1A A;  3CSF A;  4WNG A;  2LAI A;  3UM0 A;  3JXI A;  4K5C A;  4G1T A;  4G8K A;  1JUQ A;  1NA3 A;  1OWP A;  1TN6 A;  4N2S A;  4DUI A;  4RQI A;  3VLE A;  4EZK A;  3PZ3 A;  4G23 A;  4J8Y A;  4U8Y D;  4J0U A;  4G25 A;  3C3R A;  3UUX A;  4B8A A;  2X38 A;  1HX8 A;  2GRO B;  1N94 A;  3CVW A;  2I2O A;  1ZBP A;  3AG1 E;  3TWS A;  2EQX A;  4B8C B;  2DIW A;  3UM1 A;  5AQB A;  3EHN A;  3PDN A;  4Y6W A;  5ANR A;  2WXL A;  4JHJ A;  5T8I A;  4B0Z A;  3FUE A;  3LY9 A;  1KZP A;  3UIP C;  2KC7 A;  3V31 A;  3ZFW A;  2BUG A;  4H7X A;  3JCK C;  1HH8 A;  3LS8 A;  3I4R B;  5D66 A;  4GZ5 A;  1BU9 A;  1OCC E;  3B7B A;  5B3S E;  4CDR A;  3X2Q E;  2BKG A;  1HG2 A;  1N54 A;  4AIF A;  4BT8 A;  1O1R A;  4JVS A;  5E75 A;  3LYA A;  4YVQ C;  1MX2 A;  3OXL A;  3C3O A;  2XRY A;  4K0R A;  1HS6 A;  3C98 A;  3HHM A;  3ASD A;  3MKQ B;  3RJV A;  2WB2 A;  3L16 A;  1S63 A;  3PRE A;  1BPO A;  3G2W A;  2CHW A;  1K1A A;  3PZ1 A;  4I17 A;  2PM6 A;  5KBA A;  2UY1 B;  4U7E B;  3Q15 A;  1OXJ A;  2HE0 A;  4HOQ A;  4G8L A;  3KEA A;  4FHK A;  3G2V A;  2YQ8 A;  2IFU A;  4JEU A;  3SO8 A;  2ZIS A;  2XPY A;  3AG2 E;  1N4S A;  3MZL B;  2NXP A;  1LD7 A;  2LSU A;  3Q78 A;  3OAW A;  3S2A A;  3TWQ A;  3FU6 A;  3Q7A A;  3SFY A;  3NBN B;  3JXJ A;  2IY0 C;  5A23 A;  4L23 A;  4HBD A;  4M3O A;  1N52 A;  3T5X A;  4M7C A;  3CVV A;  4Q96 A;  4N3B A;  1OWO A;  2EIN E;  1U3D A;  2OCC E;  3GZ2 A;  5H7P A;  1XGW A;  2IJG X;  3JQ1 A;  3PNT B;  4TXQ A;  4QQI A;  4XKC A;  3FUD A;  2LXL A;  3OXG A;  3NB2 A;  1NL4 A;  4GTO A;  2C2L A;  1JCR A;  2WXQ A;  3TWR A;  2QY7 A;  1Z3X A;  2GRM A;  4D10 C;  4A55 A;  4JW1 A;  1UW4 B;  3RRM B;  3E4B A;  4FP7 A;  1PC2 A;  2MHK A;  5ARG A;  2ILR A;  4FLH A;  2XCB A;  2F8Y A;  5AEN A;  3R7Q A;  4ATZ D;  4FA6 A;  3LJN A;  3S7B A;  4MKT A;  2LO6 A;  3LKU A;  1A17 A;  4WWP A;  1EYH A;  4NUR A;  5JJ6 A;  2MOW A;  3ONK A;  4XKB A;  4KZC A;  5BXO A;  1N11 A;  3FU3 A;  3T9K A;  3CHP A;  1A5E A;  5BV0 A;  3PVL A;  1EDU A;  4FJY A;  5D2M C;  4GA0 A;  1JCQ A;  4F53 A;  3DRA A;  4DPR A;  4CCA A;  3R9M A;  3NAW A;  3HIZ A;  3DSW A;  3FU5 A;  2RG8 A;  4WAF A;  3UPV A;  4HXI A;  3EUV A;  2ZIR A;  5KJN A;  3MKQ A;  2CFU A;  3TXM A;  3TWW A;  3AS4 A;  5EDS A;  2XS1 A;  2H6F A;  4JB8 P;  3Q47 B;  1MX4 A;  1E8Z A;  4NAC A;  1PAQ A;  1MZC A;  3LY7 A;  5G2N A;  3LEW A;  4LG6 A;  3ZYK A;  3APF A;  4CDM A;  2H6I A;  4XIF A;  4O6F A;  4AY6 A;  3MV3 B;  1KT1 A;  3CHQ A;  4JHR A;  3PZ2 A;  5EX3 A;  2WQ6 A;  4ILG A;  1E7U A;  4KXK B;  3TGO A;  4PS7 A;  2MRI A;  3DPD A;  2E2E A;  4JPS A;  5KJK A;  2J4D A;  1K8K G;  1RZ4 A;  4GCN A;  5ENN A;  1TNU A;  2VGX A;  4KMO A;  3TWX A;  2BKK B;  2ZGD A;  1NP7 A;  2C0L A;  5AIJ A;  2UWJ G;  1DVP A;  4GTS A;  1E90 A;  4C0E A;  4J8S A;  5HKP A;  4FUL A;  3APD A;  4LNB A;  4XEI G;  2J08 A;  3L08 A;  2CHX A;  2XEV A;  1B89 A;  2B0O E;  4KVO A;  4UUC A;  4UWH A;  4YDE A;  4J6I A;  5FZQ A;  4F7A A;  3L54 A;  1ELW A;  3UMV A;  2AW6 A;  2WXP A;  1MYO A;  3ZHE B;  1IKN D;  2ETB A;  4UQZ A;  1HU3 A;  5G05 J;  3CIA A;  4GZC A;  3RAU A;  5AJD A;  1YYH A;  4B93 B;  1ELR A;  1QYM A;  4APO A;  2HM8 A;  3NF1 A;  2VTB B;  4EPZ A;  1N9A A;  3F6Q A;  3ZKJ A;  4IYP A;  4J8D A;  3PUK A;  4O1P A;  2FUL A;  4I43 A;  3EHR A;  3ML8 A;  4GPK A;  4C48 B;  5KNH D;  1LTX A;  4V3I A;  3GW4 A;  4U0U A;  1Z3Y A;  4UWL A;  2IO2 C;  3B7S A;  1HG5 A;  3DSU A;  4LUN U;  2VQ2 A;  4G26 A;  3QJZ A;  3NZS A;  1QZ2 A;  2WXN A;  3HDX A;  4FJZ A;  4KZ0 A;  2WMO A;  2WXG A;  2WMN A;  4KVM A;  3K9I A;  2PM7 A;  1KLX A;  4FU3 A;  4OAV B;  3FUK A;  5AJL A;  1YA0 A;  4K03 A;  5B1B E;  4I6G A;  3ASF A;  1FPP A;  3NOG D;  4HFG A;  2EIJ E;  3AG4 E;  3CLJ A;  3ZXP A;  1FVF A;  3FU0 A;  2Y4T A;  3RO2 A;  4TUM A;  4Q69 A;  5T4Y A;  3AAA C;  5E76 A;  1VDY A;  1OCR E;  2VSN A;  1S0P A;  1WDY A;  1OWM A;  2VYI A;  4OVV A;  3G2T A;  2F0Y A;  4IUL A;  3L17 A;  3FUJ A;  4DX5 D;  1MHQ A;  3T8M A;  3DXM G;  3V30 A;  2R2L A;  3FH5 A;  2YHE A;  4L7T A;  2FO1 E;  2JAB A;  1MQS A;  2DWZ A;  2GW1 A;  4EZJ A;  3RK6 A;  4ATG A;  2RFA A;  3C72 A;  3UM3 A;  1TEZ A;  3E37 A;  1H19 A;  1UN9 A;  4A3V A;  3D9K A;  3TWV A;  2DCP A;  3IXE A;  2FO7 A;  2AJA A;  4GYY A;  3S7F A;  1TNY A;  4E85 A;  2EIM E;  2FBN A;  4MLP A;  4OYS A;  3SFX A;  1N0R A;  3Q7F A;  2KCL A;  4I1O B;  3QK0 A;  4WNE A;  4HOR A;  2XHE A;  2KM4 A;  2J4B A;  1MX6 A;  4WWO A;  1BD8 A;  4BWR A;  4P29 A;  4URK A;  1QNF A;  4DX6 D;  4BT9 A;  4N5Q A;  2RKK A;  4GTT A;  1JPL A;  1WAO 1;  3TXN A;  4EZL A;  3FWV A;  2WXM A;  1UOH A;  5EIB E;  3ULQ A;  5ANL A;  1H2V C;  2DZO A;  3ZU7 B;  1W3B A;  2DBA A;  5EID A;  3LJ3 A;  4L9P A;  3ZPJ A;  3SBT B;  3JQ0 A;  3D9P A;  3D3M A;  5JJT A;  3PE3 A;  3DEP A;  1E7V A;  2J8S D;  2KCK A;  4N5C A;  3W9G A;  4FLB A;  4CYM D;  4XZ4 A;  1Z5S C;  4BEP A;  4EBA A;  3ISM C;  4GB9 A;  4F1P A;  3WXX A;  3TG4 A;  4HRL A;  3MV2 B;  2ZGG A;  4TV3 A;  4XI9 A;  2GRL A;  4ACK A;  1QQE A;  3CKB A; 
#chains in the Genus database with same CATH homology
 3PVL A;  4CRW A;  1EDU A;  3CVL A;  2VJ8 A;  3PH0 C;  4FJY A;  4GA0 A;  4F53 A;  5JHA A;  4W9R A;  3MKR A;  4B89 A;  4DPR A;  4HVB A;  4HOT A;  4J8E A;  4ANW A;  4CCA A;  5JHB A;  2FF4 A;  1NA0 A;  3ZRH A;  4BFR A;  3VTY A;  5J90 A;  3CK9 A;  5D0O D;  2KCV A;  4N39 A;  3CVU A;  1HF8 A;  4RG9 A;  4UQY A;  4FAD A;  2XQ0 A;  3HIZ A;  3BG1 B;  2J09 A;  3FU5 A;  3D9L A;  2RG8 A;  4WAF A;  2OND A;  3UPV A;  3OXF A;  2WM9 A;  4HXI A;  4ABN A;  4IN3 B;  4CT0 A;  3MCX A;  3CQC B;  2AXZ A;  3MJW A;  5KJN A;  3FFL A;  2CFU A;  2R17 C;  3MKQ A;  4U63 A;  3TXM A;  2WXI A;  1H2U A;  1IQU A;  4TRQ A;  3PEU B;  2WQ7 A;  2XGS A;  3PEV B;  4C9B B;  3AS4 A;  3EJN A;  2XPZ A;  3AS5 A;  4U0Z A;  2AXV A;  5EDS A;  3UQ3 A;  3MX3 A;  3URZ A;  2VTB A;  4BSX A;  3Q47 B;  3QDN A;  1XNF A;  1E8Z A;  2RD0 A;  4NAC A;  3LY8 A;  3CK7 A;  1PAQ A;  1NZN A;  3CVN A;  4JEH A;  4U0S A;  4F3V A;  5EKQ D;  3LY7 A;  4A1G A;  2PL2 A;  4EQF A;  5G2N A;  4N3A A;  2X6F A;  3LEW A;  3ZYK A;  3APF A;  2AWI A;  3FEX A;  4CDM A;  4HOS A;  2AXU A;  4XIF A;  4O6F A;  5FTP A;  2XPI A;  5T3R A;  2WXR A;  2JLB A;  3HVE A;  3MV3 B;  4AY6 A;  2PQN A;  4NRH B;  1KT1 A;  4AXH A;  3CHQ A;  4JHR A;  3O48 A;  4AOF A;  2WQH A;  3FUM A;  5EX3 A;  4ILG A;  2WQ6 A;  1E7U A;  3JUI A;  4KXK B;  3TL5 A;  2IOL A;  3KD7 A;  3TGO A;  4PS8 A;  4PS7 A;  3HYM B;  5DIZ A;  1SZ9 A;  2OOE A;  2MRI A;  1WM5 A;  3MGB A;  4APF A;  4A3T A;  3FUL A;  3DPD A;  2E2E A;  2C0M A;  4JPS A;  4F1S A;  2J4D A;  5KJK A;  4GZD A;  4I9C A;  3U9W A;  3SZ7 A;  3D9M A;  3KEZ A;  5CMY A;  2KZT B;  4GCN A;  5ARF A;  1Y8M A;  4RVB A;  3IKO B;  5ENN A;  5BPP A;  4OVU A;  4ILI A;  3LVQ E;  1IHG A;  5A6C A;  3U3W A;  3SNX A;  2VGX A;  1UG3 A;  4KMO A;  2KAT A;  3EIJ A;  1IQR A;  4U04 A;  4ME2 A;  4UI9 C;  5JJ7 A;  3FUN A;  4XE0 A;  3I4G A;  2X6H A;  3ZYL A;  3IHV A;  5BW8 C;  4DLO A;  2VSO E;  1PY1 A;  1NP7 A;  4XI0 A;  3RRU A;  2C0L A;  3UT4 A;  3LDZ A;  4WWN A;  2XGM A;  5AIJ A;  4MRU A;  2UWJ G;  1DVP A;  3QB2 A;  1E90 A;  1TJF A;  2V5F A;  2L0T B;  3CEQ A;  3TG5 A;  3MYV A;  3ZEF A;  4C0E A;  2CG3 A;  5LFA A;  3ZW3 A;  1JWF A;  4UWK A;  3D9N A;  2LSV A;  4J8S A;  5LOZ A;  5M72 A;  3AU5 A;  4FUL A;  4ACL A;  2VGX B;  3RKV A;  1EPU A;  4PH4 B;  1EF1 C;  3APD A;  4WND A;  2VSX E;  5LX8 A;  1HFA A;  1WY6 A;  2J08 A;  3L08 A;  3G2S A;  3N71 A;  4ILH B;  4A1S A;  5FZS A;  2CHX A;  2HYZ A;  2J07 A;  1ZU2 A;  3I5P A;  4WUY A;  4L1B A;  5FQ7 A;  3FH7 A;  2XEV A;  1B89 A;  4KBQ A;  2NC9 A;  5C2Y A;  3ESL A;  3L13 A;  4KVO A;  4PS3 A;  3SF4 A;  3IEG A;  2CFZ A;  3KAE A;  3QAQ A;  4NQ0 A;  4GYO A;  1KT0 A;  4UWH A;  2PZI A;  4FC8 A;  4WNF A;  2ZU6 B;  4J6I A;  3O4Z A;  3B7T A;  4PDX A;  5FZQ A;  4ANX A;  4U8H A;  1FCH A;  4GZ3 A;  3SI5 A;  3LCA A;  3QWW A;  4F7A A;  4G24 A;  3CKC A;  3L54 A;  1ELW A;  3UMV A;  2AW6 A;  2WXF A;  4JHK A;  5BV1 A;  4CGW A;  2WXP A;  3RIB A;  4B94 A;  1FVH A;  5EX0 A;  3ZHE B;  2XRZ A;  5FWQ A;  4HS2 A;  3ZN3 A;  3S7J A;  4BTA A;  2P58 C;  2WXH A;  5BNW A;  1P5Q A;  2V4L A;  3APC A;  3ZVV A;  4UQZ A;  1HU3 A;  3CGH A;  3EIQ C;  5G05 J;  3CIA A;  1E8W A;  2PQR A;  2VGY A;  2AVP A;  2UY1 A;  4GZC A;  5CMW A;  5AJD A;  4JA7 A;  2HO1 A;  1ELR A;  3Q4A B;  4APO A;  5KJM A;  2HM8 A;  5KCM A;  3NF1 A;  4UWF A;  4DK5 A;  5J08 A;  3SHF A;  2VTB B;  4EPZ A;  4LRZ A;  4GMJ A;  3PZD A;  5G05 C;  1U3C A;  4CT4 A;  4GZ6 A;  1OUV A;  3FH8 A;  4IYP A;  2JEK A;  3ASG A;  4AJW A;  3FUI A;  3ZXS A;  3T5V A;  3P1U A;  4J8D A;  3JYS A;  3PUK A;  4GYW A;  3L6A A;  3BEE A;  4JC8 A;  4RSY A;  4AY5 A;  2YHC A;  2FUL A;  4I43 A;  4C0M A;  4DJA A;  4GML A;  2HR2 A;  2IQC A;  5LP0 A;  3ML8 A;  4GPK A;  2YNQ A;  5FJY A;  3ASH A;  3UT8 A;  4I1A A;  3CSF A;  3AU4 A;  4WNG A;  1L5J A;  2LAI A;  4CGV A;  4V3I A;  4PUC A;  3S7D A;  4G1T A;  2L6J A;  2V0P A;  3GW4 A;  1JUQ A;  1NA3 A;  1OWP A;  4U0U A;  3VLD A;  4FHJ A;  4N2S A;  1Z3Y A;  4UWL A;  3PRZ A;  3B7S A;  4BX8 A;  3QAR A;  3VLE A;  1HG5 A;  4DI3 A;  4EZK A;  4G23 A;  3IBE A;  2I9C A;  4LUN U;  2VQ2 A;  4J0U A;  4G26 A;  3TJP A;  3CHS A;  4G25 A;  4H7Y A;  3QJZ A;  4AEZ C;  4UWG A;  3R7R A;  5FQ6 A;  3UUX A;  3NZS A;  1QZ2 A;  2WXN A;  4B8A A;  3HDX A;  2X38 A;  4FJZ A;  4KZ0 A;  3R9A B;  2WMO A;  1HX8 A;  2WXG A;  2WMN A;  3CVW A;  5BT1 A;  2CHZ A;  4G2V A;  2I2O A;  2FEZ A;  5LCW J;  3EHM A;  1ZBP A;  1HXI A;  4KVM A;  4CEM A;  4GA1 A;  3K9I A;  2PM7 A;  2QFC A;  1KLX A;  3U66 A;  2I1J A;  2EQX A;  4FU3 A;  3QNK A;  4B8C B;  1TJC A;  2DIW A;  2A5U A;  1UJK A;  3SFZ A;  2X3M A;  3FUK A;  3EDT B;  5AJL A;  1YA0 A;  4K03 A;  5DBK A;  3IV0 A;  3LPZ A;  3EHN A;  4I6G A;  3PDN A;  1SZA A;  4Y6W A;  4KT6 B;  5ANR A;  3SD5 A;  2WXL A;  4JHJ A;  3ASF A;  5T8I A;  3IHY A;  1GW6 A;  4HFG A;  4B0Z A;  3QKY A;  3FUE A;  2WPV A;  3CLJ A;  1E8X A;  3QWP A;  1FVF A;  3LXU X;  3FU0 A;  4GU5 A;  3D9I A;  2Y4T A;  3LY9 A;  4UQX A;  3CVX A;  4I2W A;  3ENE A;  4EBA G;  2KC7 A;  3RO2 A;  3ZFW A;  2BUG A;  4H7X A;  3JCK C;  1HH8 A;  4Q69 A;  5T4Y A;  3CR3 A;  4LER A;  3ONL A;  1OWL A;  3LS8 A;  5E76 A;  2L9B A;  4UI9 K;  1VDY A;  3I3N A;  3FUF A;  3RU0 A;  2NSZ A;  2WXO A;  3I4R B;  4QFV A;  1SQM A;  2VSN A;  4GZ5 A;  5C1D A;  1X5B A;  3QWV A;  1S0P A;  1Z6T A;  3NQP A;  1OWM A;  4AM9 A;  4BX9 A;  4CDR A;  3CV0 A;  2VYI A;  1HG2 A;  1N54 A;  4OVV A;  4AIF A;  4BT8 A;  3G2T A;  1UN8 A;  2CG2 A;  3FDH A;  2XCC A;  4IUL A;  1JWG A;  4KYO B;  3GZ1 A;  4JVS A;  4J8F A;  3L17 A;  3FUJ A;  4JXT A;  5E75 A;  4HOU A;  4L2L A;  1MHQ A;  3T8M A;  2LNI A;  3LYA A;  2J9Q A;  2BTD A;  2X6J A;  2ION A;  4YVQ C;  3CHR A;  3RO3 A;  3OXL A;  3FH5 A;  2YHE A;  3FUH A;  2XRY A;  4L7T A;  4K0R A;  1HS6 A;  3C98 A;  3CHM A;  1MQS A;  2Q7F A;  3HHM A;  3SGH A;  3ASD A;  2GW1 A;  3PNL B;  4XX5 A;  1HO8 A;  3MKQ B;  4JZY A;  3RJV A;  2V8S E;  1H2T C;  3L16 A;  3PRE A;  4I1M A;  4EZJ A;  2WB2 A;  3QOU A;  1ELK A;  4N3C A;  3KS2 A;  1BPO A;  3DBS A;  4I6E A;  4G11 A;  4EEC A;  3L22 A;  2Y3A A;  3G2W A;  2M63 A;  1HZ4 A;  3B13 A;  3CQG B;  2CHW A;  3FY4 A;  3RK6 A;  3CHO A;  4TUU A;  3B7U X;  4ATG A;  4R7L A;  5AYW D;  4I17 A;  2PM6 A;  2UY1 B;  2BF0 X;  2IF4 A;  3AS8 A;  2OVB A;  3Q15 A;  1TEZ A;  2I1K A;  2KZT A;  4HOQ A;  5CCL A;  5HQ8 A;  1H19 A;  3G2U A;  5FZR A;  1UN9 A;  3UT7 A;  4FHK A;  4A3V A;  3PS6 A;  5G55 A;  3D9K A;  1DNP A;  4I6J A;  4BY6 A;  4E6H A;  3HVE B;  3G2V A;  3ZGQ A;  2DCP A;  1Y6I A;  3RRN B;  3ML9 A;  2YQ8 A;  2IFU A;  2FO7 A;  4JL0 A;  3P2B A;  1H6K A;  2OVF A;  4JEU A;  5FT9 A;  4GYY A;  2XPY A;  3S7F A;  4DLQ A;  5D0Q D;  4JA9 A;  3CVQ A;  3MZL B;  2WVI A;  4Q94 A;  2NXP A;  3PE4 A;  3FTU A;  3UX4 A;  3VLF A;  4E85 A;  2LSU A;  4I2Z A;  3VTX A;  4MLP A;  2FBN A;  3ZHE A;  3Q49 B;  4AVX A;  4OYS A;  3OAW A;  3CVY A;  5G04 C;  2E0I A;  3OTN A;  1INZ A;  3S2A A;  4YND A;  1E96 B;  3FU6 A;  2X6K A;  2L0I A;  3FTW A;  1H0A A;  5FQ4 A;  4AP2 A;  2KCL A;  1IYG A;  4I1O B;  4ANU A;  3QC1 A;  4L23 A;  5A23 A;  4M3O A;  2WXJ A;  2GGF A;  1N52 A;  3BG0 B;  3QK0 A;  4WNE A;  3T5X A;  3TAX A;  2XHE A;  2Y4U A;  3SBS A;  4HOR A;  3CST A;  2KM4 A;  1HE8 A;  2FI7 A;  4Q96 A;  2J4B A;  4YVO A;  4N3B A;  5G04 J;  4UI9 J;  4Y6C A;  1OWO A;  3CVV A;  4WWO A;  4BWR A;  4P29 A;  1U3D A;  2IOS A;  3FP3 A;  4URK A;  1QNF A;  3GZ2 A;  2R5S A;  3U64 A;  5HI7 A;  4BT9 A;  1XGW A;  2IJG X;  3CVP A;  3JQ1 A;  3LVR E;  3NZU A;  3PNT B;  2A4Z A;  3MEK A;  1JPL A;  3ESK A;  4XKC A;  5A7D B;  4LCT A;  1WAO 1;  2WXK A;  3TXN A;  3ZYM A;  4EZL A;  3FUD A;  1OWN A;  3FWV A;  3OXG A;  4L2Y A;  2WXM A;  3MA5 A;  1LF8 A;  3ULQ A;  2OV8 A;  5ANL A;  3FTV A;  1H2V C;  3FTY A;  3Q5M A;  4GA2 A;  2C2L A;  3B7R L;  2WXQ A;  2QY7 A;  1W3B A;  5BUZ A;  1Z3X A;  2GRM A;  2DBA A;  3PUJ A;  4D10 C;  4HLE A;  5KJL A;  1E8Y A;  4ANV A;  4IRU A;  4A55 A;  3ZYQ A;  2LAH A;  4JW1 A;  3LJ3 A;  4CDN A;  5LCW C;  3FEY A;  1UW4 B;  3RRM B;  3E4B A;  3CK8 A;  3GYZ A;  4FP7 A;  3U4T A;  4N2Q A;  1PC2 A;  2MHK A;  5ARG A;  4GAA A;  2YIN A;  2ILR A;  3D9J A;  4FLH A;  2XCB A;  4GCO A;  3ZPJ A;  3FTS A;  4RG6 A;  4LEU A;  5CHE E;  3SBT B;  5AEN A;  3R7Q A;  4AV7 A;  4FA6 A;  3JQ0 A;  3D9P A;  3S7B A;  3D3M A;  4MKT A;  5JJT A;  2LO6 A;  3LKU A;  1A17 A;  2J49 A;  3PE3 A;  3FHE A;  1E7V A;  2KCK A;  4N5C A;  4FLB A;  4WWP A;  3GZS A;  4XZ4 A;  1EYH A;  4NUR A;  5JJ6 A;  2MOW A;  4EBA A;  3D9O A;  4GB9 A;  2VSY A;  2I6H A;  3WXX A;  3FTX A;  3ONK A;  4DI4 A;  3TG4 A;  3MV2 B;  2IU1 A;  2R59 A;  3ZIM A;  5FQ8 A;  3FTZ A;  5CCM A;  4XKB A;  4U07 A;  4BTB A;  4KZC A;  4TV3 A;  4XI9 A;  3FU3 A;  4I9E A;  2GRL A;  3CHP A;  2XGO A;  4ACK A;  1UJJ A;  5BV0 A;  1QQE A;  2X6I A;  3CKB A;  4MS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...