4ACZA

Structure of the gh99 endo-alpha-mannosidase from bacteroides thetaiotaomicron
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
341
structure length
341
Chain Sequence
TLDDHTISFYYNWYGNPSVDGEMKHWMHPIALAPGHSGDVGAISGLNDDIACNFYPELGTYSSNDPEIIRKHIRMHIKANVGVLSVTWWGESDYGNQSVSLLLDEAAKVGAKVCFHIEPFNGRSPQTVRENIQYIVDTYGDHPAFYRTHGKPLFFIYDSYLIKPAEWAKLFAAGGEISVRNTKYDGLFIGLTLKESELPDIETACMDGFYTYFAATGFTNASTPANWKSMQQWAKAHNKLFIPSVGPGYIDTRIRPWNGSTTRDRENGKYYDDMYKAAIESGASYISITSFNEWHEGTQIEPAVSKKCDAFEYLDYKPLADDYYLIRTAYWVDEFRKARSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Insight Into N-Glycan Processing by Endo-Alpha-Mannosidase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords ENDO-ALPHA-MANNOSIDASE
total genus 126
structure length 341
sequence length 341
ec nomenclature ec 3.2.1.130: Glycoprotein endo-alpha-1,2-mannosidase.
pdb deposition date 2011-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4aczA00
4P7LA 3AIVA 4AZIA 4Z2LA 3N1AA 4WSKA 4JKKA 4D6JA 1EHNA 3VIOA 2W92A 1VEMA 1JZ3A 3II1A 4P7NA 1I1WA 2A3HA 2WLZA 4ZE4A 1GJWA 3QOMA 3RM9A 1UWTA 1GOWA 4MDPA 4WLCA 2DH3A 5CZKA 3VU2A 1EDQA 1CXEA 1VFFA 3ALFA 2V3EA 3FW6A 2WAGA 2VX5A 1C8QA 1HJUA 1GJUA 4GXPA 1W1VA 3LPFA 4M80A 1CZ1A 4GO8A 2WMKA 4FLOA 3S2CA 1ISWA 2EJ1A 1JYVA 2V5CA 1W9PA 1UWIA 1H3GA 1C7TA 4F66A 1E40A 3AHXA 1D2KA 2D24A 2WCSA 3WDJA 5C71A 3MUZ1 6TAAA 4LYQA 1V6VA 4AISA 2GJRA 2WZHA 2VR4A 3VTRA 4IPNB 2FDMA 1XSJA 3MS8A 4P8VA 3SCQA 1PEZA 3WUGA 2G3JA 2ZX7A 2G8ZA 1WDQA 3B9DA 3CO4A 1NARA 3TONA 3MANA 3T09A 2DT1A 1H09A 2X1IA 2J25A 2VCAA 2VC9A 4C7GA 5CSUA 3ARRA 3VMOA 4JFVA 4NRRA 4P7QA 1UH4A 3WF2A 3FXYA 3WN6A 5JBEA 4YHEA 5FKYA 4P7OA 1WZMA 4BQ2A 1V08A 1CENA 2ZOXA 2WVVB 2XYLA 2ZXDA 2W66A 1BGGA 4UFKA 1Q6GA 3ZR5A 1UZ4A 4NRSA 2CEQA 3WQ8A 1HJXA 1MXGA 2CCRA 3M7SA 4LXFA 1EH9A 2Y8VA 2FH8A 3SURA 4A3YA 1W2VA 3DC0A 3CZJA 1W1TA 4BS0A 3TTYA 3CPUA 4HOZA 5AYIA 3SCSA 2C7FA 5A2AA 4MAVA 2WBGA 4OKDA 2E9LA 3NDYA 1GOMA 1UR8A 3ARVA 1UQZA 5ABFB 1NWTA 1DWAM 4AD5A 4UR9A 4AY1A 1BTCA 2GK1A 1A3HA 4QLLA 3ZJ6A 4MNLA 1KGWA 1V6UA 4ATWA 1BSIA 1EIBA 4W93A 3WEZA 4ZXOA 1M01A 2VT0A 1JIBA 1CGTA 4PRWA 1HX0A 3SCVA 3QHNA 4PUEA 1L8NA 1KR0A 1E15A 3WEMA 1L0PA 3ZJKA 1ZBWA 5JIPA 2E8YA 3WFZA 3MUY1 4UFLA 1CPUA 2J47A 3VIJA 3MMWA 4LYRA 4WKHA 4EANA 4UQDA 1LG2A 5BXSA 1CXKA 1WCGA 3EDKA 1M03A 1TG7A 5AY7A 9CGTA 3UG4A 3AXXA 5D8ZA 3BSGA 1R7AA 3WY1A 2PI6A 3SCOA 4NZCA 3T0DA 2Y8KA 5D9PA 1B3WA 3MUIA 4J3SA 3GNPA 2ZXAA 1V6WA 1K9EA 2C0HA 2XSAA 2PF0A 1NOFA 3AJ7A 3W82A 2OYLA 1CLXA 3VDHA 2EO7A 1XYFA 1GQLA 1HXJA 4GI8A 5HNNA 3IJ8A 1SR0A 4Q22A 3GNRA 4GKLA 2YL9A 1KXHA 1B3YA 2O9PA 2ZE0A 1XHGA 5EB8A 1JZ7A 4AD2A 4WF7A 2VQTA 2DIEA 5IHRA 4IISA 4MADA 3IANA 3OGSA 4KGJA 4OJYA 1OIMA 4JZ5A 1Y7VA 4H04A 2GUYA 5I0DA 3VIFA 1HVQA 1E3XA 3AICA 1BQCA 3TTQA 3QGVA 2E40A 3L4XA 1ECEA 5FL0A 2V38A 1PJ9A 1CNVA 5CPTA 4QP0A 4AIUA 1FFRA 2BVDA 2WBKA 4JL1A 3W26A 5FCZA 5LA0A 3W38A 2B31A 2FH6A 5JIWA 3A47A 3RIKA 3WENA 4AZ7A 1G1YA 2ZUSA 2DT2A 4U5KA 4DUVA 1WAWA 4YPJA 2E8ZA 1EXPA 4LYPA 1E5NA 1JXKA 3BAYA 3EDJA 4JHOA 2XGBA 5DT5A 2V3DA 2EPNA 2W91A 2ZUNA 3KZSA 4PTMA 1J0YA 3WDIA 4D1JA 4Q7NA 5BRQA 3CHDA 5BXPA 5BXTA 1RH9A 3RM4A 1QI0A 2Y24A 4Z2HA 3BAKA 1U33A 4UOZA 5IXEA 4RE4A 2BS9A 1KCKA 2XVKA 2XM2A 1WDSA 1XYZA 1JI2A 4PEEA 3OZOA 4CD7A 2XIBA 2VR5A 3CIVA 1RPKA 4PMOA 4IM4A 4CN4A 5A6BD 3VX0A 3PHAA 4CGTA 2XM1A 1BYBA 4AZCA 1GVYA 2E4TA 4W88A 5D9MA 3M07A 3DECA 1G9HA 2NSXA 3AIEA 2YKKA 4B3KA 3NYDA 3L4TA 4U2ZA 1JD9A 2WVSA 3QHMA 4TVCA 3RO8A 2QPUA 5IHSA 1JFXA 3SUVA 1UYQA 3WMCA 1VRXA 1QNOA 1ISYA 3M46A 4Y7EA 4W85A 3F4VA 1W3JA 5JBDA 3QR3A 2WSPA 4PCSA 5I24A 3VNZA 4PMZA 4V2XA 2WANA 4JFWA 4HOWA 1B31A 3PTMA 2WMHA 5I78A 2OYMA 5ABFA 2UY5A 5KZ6A 4RE3A 1Q6CA 2ZUWA 2WVVA 1UOKA 3F5LA 1GOQA 3MMDA 1QI5A 2O9TA 1LL7A 2YBTA 1UKPA 3THCA 3JUGA 4S3KA 1FP9A 4KWUA 6CGTA 4P8XA 1E70M 3PZOA 3W25A 3KE0A 2J7HA 4AD3A 4PMXA 1K9FA 3N12A 3VX1A 1FP8A 1C3FA 2D3NA 1FA2A 1XH1A 3AIQA 2WYSA 5ECUA 5TD4A 1K6AA 5CLWA 4CD8A 2J8FA 4ZXLA 2CBJA 4ZEPA 4MPKA 5A6LA 3PN8A 3OA5A 3CLWA 2DSKA 5CPSA 2E3ZA 1UG6A 3FHAA 3NJ3A 4MTVA 2X8RA 4U2YA 3WUEA 2X09A 4NI3A 1QI2A 4FLRA 1WKYA 4TXEA 1OGGA 2YL8A 1W9XA 3WEOA 3W27A 1UD5A 2FHFA 2VNCA 5HDRA 1OGBA 3WDQA 2JE8A 4AZ5A 1CXHA 1XSKA 3ZJ7A 3WUFA 1TA3B 2J7GA 2PWEA 1E71M 3GZAA 3KL5A 1V0LA 1Q6EA 2J7EA 3OIHA 2X0YA 1CLVA 1E6ZA 1JDDA 3UETA 4AEEA 4PMVA 1WDRA 2BFGA 2G3IA 2BY3A 2VOTA 4B16A 1G94A 3CH9A 1FH8A 5A2CA 4D71A 3G6MA 2ZX8A 4AW7A 4NSBA 1UR2A 2GVYA 1O6IA 4JCLA 1V6YA 1EGZA 1PIGA 1E0VA 4GO9A 3OLEA 4HPHA 2XPKA 4U3CA 4BZYA 3I3BA 2IUZA 3W6LA 3BGAA 1Z32X 4HTYA 3SCTA 2DEPA 4ATLA 2VURA 1W9VA 3GM8A 1UD6A 4DWSC 3IJ7A 1QW8A 3GTNA 3BXWA 1QBAA 7A3HA 4JFTA 5CJ5A 1OD0A 1EHAA 2GDVA 4W5ZA 4TVDA 5CPQA 4CVUA 2WHMA 5CQ1A 1H1NA 4ACZB 1HVXA 4AZBA 3VOCA 1TVPA 3VGGA 3VIPA 3EMQA 2BXYA 1ISVA 3HN3A 3VINA 1DWJM 4QAWA 4RL3A 1UH3A 2V5DA 4MB3A 2OWCA 1UWQA 4H7VA 3T2QA 1E0WA 3WDPP 3DHUA 2JEQA 1J12A 4EKJA 4MDOA 5D8WA 3WQ4A 2CKRA 3MKKA 1H0IA 2NW0A 3WD4A 3WNNA 5LA1A 1ZU8A 2VVNA 1RD6A 2V3GA 2ZUUA 1H41A 5GNXA 3WNOA 2ZWZA 1C90A 2QMKA 3WH8A 3TTOA 1KXTA 2XJ7A 1W3KA 3SUSA 3SUUA 4CD4A 3WD2A 3NSNA 1FHDA 4D6DA 2MANA 1J9YA 1FH9A 5A8NA 2W63A 1KXQA 5A69A 3AOFA 1OT1A 2J62A 2CBVA 3UR7A 2EBNA 4JKLA 2CHOA 3OLGA 1OINA 1ZS2A 2A3EA 1ODZA 3WSUA 3A4XA 5DF0A 3UCQA 3ARSA 3I3DA 3UG3A 4TTUA 3BCFA 3W0KA 4MB4A 2ZUVA 3POCA 4GQRA 1BYDA 2VO5A 5A3HA 3ZJ8A 1HP4A 1EO7A 1PX4A 2JIEA 2A3BA 1I1XA 1UKOA 2QPSA 3VIHA 3WF1A 3ZSTA 2YA1A 4PMRA 4B9ZA 1JNDA 3WDHA 2IXUA 2WVTA 2VZUA 3KL0A 3WMSA 5A8OA 1BF2A 1UR4A 2AOSA 4JL2A 7TAAA 3WL0A 3D3AA 5HPCA 1UR1A 2QF8A 4OUEA 2UY4A 4MNJA 5A1AA 1GONA 1KBBA 5CGTA 5ABHA 1E1EA 1KBKA 2G3NA 2XTKA 3ARUA 4H2CA 6A3HA 2OLHA 4D6GA 2WM0A 1HP5A 2F61A 4BA0A 5F7UA 1UKQA 1V3KA 4KRTA 3AHVA 4UZSA 1E6QM 1H11A 3AS1A 4MB1A 1IZKA 1MFVA 4GZIA 1XD1A 4XV0A 4AZHA 5M17A 3UERA 4FF5A 2G3MA 4CCDA 1OT2A 2OSXA 1TMQA 3PZGA 4W87A 1KR1A 3B8SA 3BCDA 2WPGA 2D0HA 2VZOA 1F4AA 4M29A 5CG0A 1ZBCA 1B0IA 1UQYA 1JZ8A 1E1FA 3N04A 5D9NA 4UQAA 2WXDM 1GQJA 4EK7A 1MXDA 1WE5A 4ML4A 1HIZA 3ZO9A 1JD7A 1CXFA 2OYKA 2EPLX 2WLYA 1JYWA 1NWRA 2XIIA 1CWYA 4W8LA 3CZEA 1GOKA 3HJEA 4UTFA 3K4DA 4C7FA 4YN5A 1VEPA 4OOZA 4AWEA 3L4WA 2ZX6A 1HKJA 1G0CA 5IFTA 3QHOA 1UHVA 1UWUA 2Y5EA 4AMCA 3SCPA 2F8QA 4CN6A 1BGAA 3UEQA 2FHBA 3ARQA 1RP8A 3FAWA 4WSJA 4OIFA 3AIUA 1HKKA 1UA7A 1MQQA 1GUVA 3PBGA 1JAKA 1LJYA 3AS3A 3CUIA 1BG9A 1R87A 5A8PA 1K9DA 1GOOA 1CGVA 3AIWA 3VGBA 1M04A 5CLTA 1XSIA 2BV9A 1JZ5A 5KEZA 2WWCA 4JCMA 1QPKA 1H5VA 3VDBA 1E4NA 1OB0A 2J77A 1JDAA 3KWXA 3UESA 2PWGA 1J10A 2DSVA 2BY0A 4JFUA 2TAAA 3SCWA 2VI0A 4HA1A 2DGAA 4MAZA 4GQQA 1V0NA 4E8CA 4ZE5A 4NF7A 1GOIA 4HU0A 2XFFA 2WMIB 1ITXA 1E6RA 3LMYA 3AROA 2J74A 1E5JA 1KXVA 4Z2GA 3CUJA 5M03A 3NUKA 2BXZA 1JAEA 4HOXA 1JFHA 1MVYA 4PMUA 2UY2A 3KEHA 3D5HA 3U57A 2PBOA 5BROA 1X1NA 3OLIA 3AHZA 1JI1A 2IXVA 1TFVA 3A4AA 3VNYA 4W5UA 2DT0A 2HVMA 5E6YA 3A3HA 4GI6A 4XZBA 3TP4A 3WNPA 1SMAA 1HF6A 1B90A 3IAPA 1JF5A 1AMYA 2UWFA 1HKMA 4OOUA 3PZQA 4QCFA 5I6SA 2O9OA 4KGLA 2CESA 4UZUA 4UQBA 1V3HA 3VVGA 1F4HA 5A6MA 4CD5A 4AZGA 1LF1A 1IV8A 2BHZA 4W7VA 5A6AA 2GFTA 1VJZA 3T2OA 3TTSA 4F8XA 3CZKA 1KQZA 3ZIZA 2ZXQA 2VZSA 1PZ2A 4CCEA 4UFJA 1QHZA 1DHKA 4U3AA 2DSZA 1BYCA 3CZ8A 1B3XA 1V3IA 4R27A 2VVSA 2CIPA 4WJXA 3EDDA 2DT3A 2YDSA 1MQPA 3SCRA 1W3LA 1P6WA 3WUBA 3ECQA 2X0HA 5HXMA 3OZPA 1Q6FA 3WKZA 3VMPA 2W5FA 4MB5A 5FOOA 3VIIA 1LLOA 2RGMA 1C91A 2FGZA 5GQBA 4B9YA 2CPUA 1J0HA 3BAJA 3SCNA 1HJVA 1WO2A 3AHTA 1XRVA 2J78A 5A8QA 1DWIM 4AXNA 1GORA 3VD5A 3GBEA 3L4UA 1FHLA 1UZ1A 1AVAA 5AYBA 4W7WA 4P8UA 1VJSA 3WF4A 3WD3A 5HPOA 1MW2A 1CXIA 3LPPA 2E0PA 3ZSSA 4PMQA 1QHOA 4TX6A 1UA3A 3OGVA 1ZBVA 3LPGA 1QW9A 1WPCA 3VD7A 4BQ3A 3LPOA 4R5EA 2WWDA 5A6SA 2J7DA 1J0KA 3A6OA 2BVYA 4CD6A 1W9UA 1VB9A 1TR1A 3U5YA 1ZB5A 1QOXA 3J7HA 1E4MM 2QLYA 2EQDA 3EBVA 5E09A 2YL5A 1DWHM 1HL8A 3RCNA 1SMDA 4PSRA 4CU6A 2EPOA 3BAWA 3N9KA 3SIMA 1BLIA 2J7FA 1NM9A 2WZEA 1QVBA 4IUGA 3AQUA 2YBUA 4DWSA 2A3CA 4CCCA 2CBUA 1BG4A 4K68A 3AXIA 5FIPA 4TOQA 3PZ9A 3N18A 3ARPA 4TTGA 4GPNA 4F79A 1NH6A 3S6TA 1UUQA 3PZUA 1MQRA 4D6FA 4Z2KA 2WMFA 1GPFA 5I2UA 2XWDA 3U5UA 5DO8A 1EOKA 5CGMA 4UFMA 3FAXA 1KCLA 1EQPA 1VFMA 1US3A 2XG9A 2CITA 2VUYA 3WQVA 2J4GA 2XHYA 3VIMA 1KWKA 3WNMA 4LX4A 4UFIA 2UY3A 2VZTA 2DPEA 3BH4A 1QNPA 1MYRA 4YHGA 3L2MA 1JYNA 4DWSB 3SEPA 3FN9A 3WF3A 1CTNA 1OSEA 3ARYA 4OBRA 3EDFA 3WNKA 1FH7A 1GZJA 2JALA 2XWEA 3MMUA 3F5KA 1B3ZA 2ZICA 3TOPA 3CUFA 3CTTA 1M53A 1CGWA 4UOQA 3THDA 1XD0A 1E56A 3CGTA 5LA2A 1BFNA 3K46A 4PUDA 3ZOAA 3IK2A 2WC3A 3MSDA 5EFFA 1E72M 4F9JA 4GZEA 4V28A 2YOCA 3K4AA 5GNYA 1J18A 4EE9A 4ACZA 4J28A 2XVGA 2VCBA 4HU8A 1C7SA 3WMBA 2VL4A 3VD9A 3NSXA 2CHNA 4GZJA 1EA9C 2ZWYA 1ZBKA 2J7CA 5D9OA 2QHAA 1AQHA 3VKKA 4KMQA 3VDAA 1EO5A 5BRPA 1CXLA 1C8XA 1JL8A 5ABGA 1ISXA 2WB5A 3VIGA 2VRJA 3FNDA 1MWOA 2Y4SA 1IT0A 2VMFA 3CHEA 4LGXA 1XV8A 3KL3A 1J0IA 1CIUA 2D22A 1R86A 2PWDA 3GH7A 2YIHA 1BYAA 4DUWA 2WK2A 1PX3A 3W24A 2ZUTA 2V3FA 3WL1A 2GJXB 1E4IA 4GINA 1E73M 1BVNP 2WCAA 2ZIDA 2YLLA 4JHZA 4V27A 3VM7A 2FHCA 1W2PA 1W32A 4PSPA 2XVPA 4FK9A 3PZTA 3PZNA 1HN1A 5IFPA 1C93A 3PZVA 3VIKA 1EOMA 1ZJBA 1H49A 3GXFA 3WBEA 1E3ZA 1BPLB 1UD4A 2RGLA 2W61A 3VD3A 2VCCA 1TCMA 1W9DM 1G01A 4UQEA 4UNIA 4M81A 2WZIA 1DP0A 5JBFA 3GH4A 2J7BA 3AIBA 4U33A 2CBIA 2ZX5A 4D72A 1US2A 3WQWA 4FMVA 1V0KA 1MW3A 1EDTA 1LQ0A 2OSWA 4PTXA 3WF0A 3WNLA 1B1YA 1PX8A 3IAQA 3ZT6A 3HU7A 1ZL1A 1NWSA 4H41A 3W81A 1QNSA 3ARTA 2VRKA 5M3WA 3W53A 1CECA 3WFLA 4PMNA 4D6EA 4LQ1A 3AXHA 3QOKA 4FLSA 4UQCA 4M8UA 4GI9A 1YQ2A 2E9BA 4HA4A 5FD0A 7CGTA 3BLPX 4WIWA 3VDCA 1OD8A 3WQ6A 4OZOA 4ACYA 1UD2A 2BHUA 3WIJA 2D3LA 3N13A 3OLDA 1W3HA 3RILA 2WKGA 2VTFA 2WHLA 3VUPA 2FGLA 3CMGA 3GNOA 2O92A 4PCTA 4AD0A 4AZCB 3BLKA 4QCEA 1TUXA 3ZQ9A 5M5DA 2EPKX 1VENA 1X6LA 1XH2A 3DYPA 2BY2A 5HOSA 3WD0A 5E0FA 1QNQA 5E70A 1WP6A 4L4OA 4HMDA 3ZM8A 3NDZA 3BAIA 3ZT5A 5E6ZA 1JG9A 3AI0A 2J75A 1V0MA 4QDMA 3HMCA 2CNCA 1TVNA 5DT7A 2G4FA 4P7RA 4E2OA 5D4YA 5E0CA 5A2BA 3MSGA 3W29A 4MNMA 1E9LA 3B9AA 2WCGA 3N15A 4W89A 4ZENA 3WELA 2OSYA 2C8NA 3GH5A 3K8KA 4ATDA 1JF6A 3NCOA 4AZ6A 1CDGA 3IJ9A 2W67A 1WZLA 5HBFA 4WKAA 1FFQA 3MUAA 1PAMA 1JYXA 4URIA 1JXJA 3WD1A 1J11A 2WC4A 3VILA 5DFAA 3POHA 4J3XA 5BYWA 2W62A 1H2JA 4PTVA 3ZMRA 4S3JA 3L2LA 1HJWA 1UKTA 4D6HA 5JUVA 3ZT7A 2VX4A 1JZ4A 3PTQA 5BCAA 3OG2A 4X0NA 2GJPA 3APGA 4DUXA 3O9NA 3PZIA 1IZJA 2JIWA 4CKQA 1HNYA 1J0JA 4XX6A 3W28A 2JF6A 3N11A 3WDRA 3RMEA 1V03A 2XGIA 2D20A 1HKIA 4TX8A 1VAHA 4Z2JA 5I3DA 3U7VA 5I5RA 1DWGM 3L4VA 2WVUA 4HP5A 4C7DA 1V3MA 1KFWA 3GXMA 1V3JA 3PTKA 3MU7A 1V6XA 1NQ6A 4MJ2A 4WKFA 3EMZA 4BQ5A 1Q6DA 1XC6A 4QLJA 3ARWA 3M6DA 3T2PA 5BXRA 5EFDA 4JKMA 1S46A 5BWFA 4XB3A 3SUTA 2VZVA 3WBAA 3BAXA 4XZWA 1NWUA 2WHJA 1ZJAA 2BVTA 3AYRA 3W4RA 2XVNA 3OGRA 4AEFA 1GHSA 1C8YA 4KRUA 2X05A 1D3CA 4W84A 2D0GA 5AC5A 3WH5A 1N82A 1OWQA 2WC7A 2DIJA 3CZLA 1ITCA 1W91A 4H8VA 3GBDA 1MW1A 4CN1A 3T0AA 3U7BA 2BNJA 4Z2IA 1KGXA 3MV01 1UH2A 1HL9A 1VFUA 2CKSA 2GDUA 1JZ6A 2D23A 4CUCA 1AQ0A 4P8WA 2VQUA 2ESCA 3VPLA 1CEOA 1HJQA 4D6CA 1E4LA 1E43A 1ESWA 4EAMA 4PN2A 1PBGA 1U2YA 1E6SM 2OWWA 3L4YA 8A3HA 4TUFA 3AYSA 4HMCA 2WKLA 5C70A 1BVZA 1DWFM 4RE2A 1E6PA 4M82A 1R8LA 1Q4NX 2CXGA 3RPMA 1SFSA 1CYGA 1QI3A 3SUWA 2D2OA 4KH2A 1XCXA 1UD8A 1DTUA 3FHQA 3FY1A 4AD4A 2PB1A 2YA2A 5A6JA 1TA3A 3CMJA 3AHYA 2WMIA 1HT6A 2PC8A 2Y2WA 3DHPA 3CZGA 4W86A 3GXDA 4CVWA 4AIOA 2NT1A 4PMYA 5A95A 4AIEA 3BMVA 3T08A 3EDEA 2WMGA 3UG5A 4BCEA 3K1DA 1OCQA 1NP0A 1X6NA 3O6AA 4H8UA 4UQ9A 4J3UA 3AISA 1GQKA 3F5JA 2YL6A 2BHYA 2DSWA 2EXOA 5DMYA 4U5IA 1MFUA 2WSKA 3K8MA 4DM2A 3WH9A 1ISZA 2VX7A 1B2YA 3RJXA 1LL4A 2F2HA 5LYRA 4E4PA 4B15A 1VF8A 1E55A 2HISA 1K9TA 1GHRA 2JFEX 5C8BB 2PWHA 3VGHA 2DSUA 3UR8A 2JF7A 4HA3A 1C92A 2D1ZA 1JGIA 4AYSA 1XGZA 2VRQA 5GPRA 1EQCA 1CGUA 1V3LA 1D7FA 1OGSA 4QLKA 2GJXA 5ABEA 4MJ4A 4J3TA 4B3LA 1WZKA 3N17A 1GNXA 2YDQA 4MNKA 8CGTA 2DH2A 5IDIA 1GQIA 4TVUA 2XFRA 3A4WA 2YDRA 2X2YA 5EBAA 4J3WA 2QV4A 3W37A 4E8DA 5A6KA 1J0ZA 2VJXA 2QMJA 3MV11 1QBBA 5E9AA 2W4XA 1MW0A 4HPGA 2BY1A 1ODUA 3DYMA 2NT0A 3RJYA 2ZX9A 1DEDA 1V02A 3AMGA 1KWGA 2AAAA 1NOWA 3ARZA 1WB0A 1RP9A 1VBUA 3T0BA 4IPLA 4BF7A 3DYOA 2WHKA 1YHTA 1KGUA 1LWJA 3NSMA 1JNEA 1OBAA 2JEPA 1WNOA 1OM0A 4D6IA 4LPCA 1WDPA 4BQ4A 2WNWA 4PTWA 1U30A 5I77A 4H8HA 5CXPA 1H4PA 1GW1A 3ZR6A 4HMEA 1UWSA 4AC1X 3VM5A 2XSBA 4PYSA 1GCYA 1BAGA 3AS0A 2YA0A 1B9ZA 3EMCA 4A3HA 1R7OA 3G6LA 5DEZA 3E1F1 4PBGA 4JIEA 4UOJA 1VIWA 4HZ7A 1W1PA 2XFYA 3I3EA 4UCFA 4J3VA 3BSHA 2O9RA 1VFOA 3PZMA 2Q8XA 2WMJA 2EEXA 1CGXA 5I79A 2AMGA 4CU7A 2Z1SA 3AMKA 2J79A 2XVLA 4QFUA 4W7UA 4CU8A 4W8BA 4M24A 1LG1A 4J7RA 4GIAA 1JDCA 5A94A 2J8GA 3AMLA 3AZTA 1QI4A 1EDGA 2Z1KA 1G5AA 3B9EA 1SYTA 2PBGA 3TA9A 1E0XA 3L4ZA 1QNRA 1A47A 3EYPA 4N42A 5FL1A 3GYCA 3SCUA 3VGEA 1WZAA 4JFSA 2CERA 1W1YA 3CHFA 3CHCA 5EMYA 4WK9A 2DDXA 2YJQA 3AZSA 3WQ5A 1V02E 4D1IA 1JZ2A 1UD3A 4HZ6A 1LWHA 1HJSA 1H0GA 1R85A 3AIRA 2A3AA 1FOBA 2GK1B 1I75A 3CBWA 5A8MA 4XUYA 3AS2A 5I23A 2D0FA 1UWRA 2ZUMA 3VMNA 4M56A 1KB3A 1J01A 3AFBA 4A4AA 3AZRA 5A6BA 3CUHA 3ARXA 2OWXA 4J27A 1KQYA 1TZ7A 4DWSD 1E6NA 4JAWA 1LL6A 3GDBA 3NIYA 2EPMX 1PZ3A 3ALGA 3OB8A 3VO0A 2XUCA 2G41A 3WH7A 1B3VA 3AMDA 1E6XM 4L4PA 1VEOA 4W8AA 2CYGA 4ZFMA 3VD4A 1QHPA 1AQMA 4DM1A 1GVIA 2GSJA 1VBRA 1PPIA 4X0VA 3CUGA 1W9BM 3AMCA 3BC9A 5AC4A 1NOUA 1CGYA 3MO4A 3RDKA 3RM8A 2WW5A 1XCWA 4HZ8A 4U31A 3O2LA 4PMDA 2CETA 4FLQA 2DQXA 3OBAA 2VX6A 3K8LA 1TE1A 1UR9A 1M7XA 4F9DA 4UFHA 1OIFA 4X9YA 3WH6A 1B30A 2YLAA 5CSYA 1UR0A 1XH0A 2E9MA 1PIFA 4M1RA 1O7AA 3VGFA 2PWFA 1UKSA 1NP2A 1BHGA 4OBSA 3W6MA 5GNZA 3GXIA 1CBGA 3VGDA 4N0RA 4AD1A 2ZXBA 3BMWA
chains in the Genus database with same CATH superfamily
3C8FA 1OC6A 1AH3A 5K7JA 4P7LA 3BK0A 2ZRZA 4JIQA 1JEZA 3IEBA 2W9MA 2XH7A 1QU4A 5DY3A 1JCLA 1XRFA 4PH6A 3VIOA 3QV7A 1I1WA 4ZE4A 1QK2A 1GJWA 4DX3A 2QVHA 3I10A 2QDHA 1GOWA 4RDYA 2ONEA 4MDPA 2J9ZA 3TQPA 4OT7A 2DH3A 1DTNA 1SW7A 2Y7DA 1OFDA 4HNUA 2E09A 4IGHA 4GZ7A 1VC4A 4XBJA 3T4WA 2H3BA 3FW6A 4C6JA 2WAGA 2IKIA 1M7PA 2E6YA 3RG6A 4NVTA 3EEZA 1W1VA 2I17A 1AQFA 1ZQ5A 3QM3A 4M80A 1CZ1A 2UV8G 3GUWA 2XIQA 4KCTA 4OV4A 1UWIA 4C6LA 1E40A 2WCSA 3IGXA 2Y0FA 2GJRA 2WZHA 3FA5A 1TPB1 5CBIA 3MS8A 3SRHA 2G8ZA 1WDQA 4K39A 3CO4A 3MANA 3SQMA 3T09A 2R9RA 4IFOA 3LXAA 4V1XA 2BGSA 4JFVA 1XIDA 3PPHA 3CQKA 3G1SA 3GD6A 3FXYA 4YHEA 1V6TA 5FKYA 4QJ4B 1BXNA 3UXIA 4ROQA 5DMNA 2J27A 4UFKA 4C6OA 1Q6GA 2VFGA 5D04C 1TQXA 1XL9A 2R14A 4UTUA 3N14A 3BICA 3B0YA 1FWWA 3SURA 4A3YA 1XISA 3CZJA 3TTYA 3CPUA 1OX6A 1SZGA 3SCSA 4JY9A 3KLLA 1A0EA 1Q45A 1SW0A 5D2TA 4Z17A 4WCJA 4AD5A 6XIMA 3LHYA 2QDEA 1VIZA 4AY1A 1LBFA 3G0XA 3DHFA 3L66A 1OZMA 1A3HA 3S0CA 1KGWA 3LCLA 1BF6A 1JIBA 1MRAA 3QZ6A 3M0YA 1O94A 4GJ1A 3NQDA 4PRWA 3SCVA 2EKCA 2QUUA 1XFCA 1E1CA 5JIPA 1ZBWA 5AHFA 3CWNA 3W1MA 4M6PA 2J47A 1UC5A 4UQDA 2L5HA 5F2GA 1CXKA 3E49A 1WCGA 4XVDA 4GX9A 1M03A 3Q94A 9CGTA 3GW0A 3AXXA 1Y0EA 2PPGA 2PI6A 4MLRA 1RJPA 3MKCA 4O14A 3RRXA 2OT0A 3T0DA 3QMSA 3MUIA 4J3SA 1Q6QA 3G8EA 1GWJA 4DBSA 3E12A 2F7FA 1K9EA 1IXNA 2XSAA 3EX3A 3DIPA 3R5EA 1NOFA 3VDHA 1LUCA 1XYFA 3S5YA 4ZO6A 4Q4KA 1H1ZA 1TVLA 1SR0A 2P88A 4GKLA 4FR1A 3MUXA 4QG9A 1AZ2A 1RPXA 1KTNA 2YCJA 3AWNA 3KXQA 5LHEA 3G0SA 2O9PA 1UP0A 2JGQA 1CW2A 2VC7A 4O1BA 1ITQA 4AD2A 4WF7A 1KM2A 2DIEA 4K3ZA 1YNPA 4ENLA 4A21A 4OJYA 2OU4A 2V68A 3RNDA 3W1XA 3VIFA 3AICA 1BQCA 2FTPA 4J3ZA 3SO7A 3VFLA 5KZDA 2V38A 4HN4A 1DVJA 3H21A 1AA1B 2QCCA 1PCKA 3W38A 2XH0A 3S5NA 2ZUSA 4QJ5B 4U5KA 3TFXA 1WAWA 4YPJA 4LYPA 4NILA 4ERGA 1S3TC 3GU2A 1VBJA 4MYXA 1NF0A 2ZC8A 3NXFA 3UZWA 2FZMA 3CV2A 1L6FA 2DUXA 2INEA 4JHOA 3GTXA 4Q8WA 1G67A 2XGBA 3V18A 1BXBA 3KZSA 2PMQA 3CNYA 5T26A 2OODA 4KBXA 4LEQA 1F05A 2R1MA 2VWSA 3B05A 2XM2A 3E0LA 1XYZA 4FXRA 1JI2A 2FB2A 2DZTA 3P93A 5HULA 1TWDA 1V51A 1RPKA 5F4XA 2A21A 3IJLA 4AZCA 3NQFA 1R2SA 2FVLA 2WZMA 2E4TA 5D9MA 3M07A 3ISIX 2NSXA 3AIEA 2YKKA 2R94A 3NYDA 1SZFA 3QHMA 3RO8A 3QY7A 1QT1A 4JD4A 4JPGA 3IGUA 2UBPC 3CIXA 2QNEA 1PSCA 3ZVIA 1QNOA 1ISYA 3QKEA 2PURA 3F4VA 3DERA 2PA6A 4PCSA 5I24A 1XIFA 4PMZA 4IP7A 4JFWA 4HOWA 1EC8A 4AHQA 4W4QA 5CPNA 3MBFA 2WJFA 5D38A 5I78A 3QY8A 3APYA 7REQA 2J6VA 3GXNA 3NR0A 2QIWA 4QISA 1FDYA 4S3EA 2Z1BA 1SFJA 1KTCA 2O9TA 4J1OA 1UKPA 3TKFA 3OVRA 4JTFA 4Y8FA 3W25A 2TYSA 2J7HA 5DLCA 4Z1CA 1K03A 5FF7A 1DQWA 4WEVX 3AIQA 4LOCA 5TD4A 5CLWA 4I3GA 2CBJA 1BWLA 1QPRA 4ZEPA 4MPKA 3OA5A 1NEYA 3CLWA 4GBDA 4ORIA 5CPSA 4MTVA 3HOJA 3WUEA 2X8RA 3E2RA 1LP6A 2P0OA 3BOLA 1QI2A 4TXEA 4QQ3A 1UD5A 2F6UA 2FHFA 1ZENA 2JE8A 2A1YA 3WUFA 4Q3MA 3OO2A 5DRIA 3WK1A 1TELA 1V0LA 1Q6EA 1RK5A 3OIHA 1UJPA 1CLVA 1E6ZA 1OG0A 5HJLA 3UETA 2OEMA 3N4AA 3ZR4A 1AH0A 4LUTA 1IYXA 3GVVA 3PF3A 1XFBA 1Y5WA 4NSBA 2X1RA 3JZUA 3MHFA 4Y96A 1PIGA 3WQPA 3WLHA 3OLEA 3PBYA 4OFCA 2OG9A 1HZYA 4DO7A 5BNKA 1AJ0A 1XBVA 2IUZA 3I3BA 3P6LA 3EKGA 4DY1A 4DHGA 1YRRA 4ATLA 3E0IA 2NVDA 1UD6A 2QDGA 4DWSC 3IJ7A 1QW8A 5H8MA 3BXWA 1QBAA 1XQLA 2J13A 3O6YX 3IGHX 4RW5A 2Z0IA 2AL2B 4W5ZA 3VOCA 3GO2A 4UMAA 1SVDA 2Y5SA 1IEVA 2E68A 4XTIA 4GUJA 2PODA 4KWOA 2JEQA 2VWTA 3T7VA 2CKRA 2GWNA 3MKKA 2GSHA 3S5SA 1ZU8A 2ZUUA 1BTMA 2QZRA 3QMRA 4N4PA 3PUOA 1KXTA 4B5WA 3SUUA 4CD4A 3CL7A 1TV4A 3GNXA 2C71A 4BJHA 2P3EA 2YXOA 1FH9A 4KERA 5C6MA 3R0KA 1NDZA 1TPH1 4NXKA 4B92A 1FWFC 1JCJA 1S2UA 3CU2A 4E5TA 2CZEA 1ZS2A 4UTTC 5CZTA 3IJQA 3WSUA 1Q65A 3DFSA 3A4XA 1SGJA 2WKJA 5REQA 2NVAA 3ARSA 5K2ZA 5JU6A 4YU1A 2R91A 4GVIA 2PTYA 2ZUVA 3ZVHB 1BYDA 3LA4A 3IJ6A 3RU6A 3ZJ8A 3E0FA 1EO7A 1PX4A 2GGGA 3BURA 1I1XA 2YA1A 3ENLA 1VRDA 4C6CA 2AOSA 3HG5A 4RNFA 1KCXA 3KHDA 3OHIA 3WL0A 4D9PA 2W0UA 4J5NA 5HPCA 3TYUA 1EJWC 4LBSA 2CFFA 1KBKA 3G18A 3ITLA 3TN3A 5IOBA 2G3NA 2DP3A 2OLHA 5HK4A 3DAQA 5F7UA 4BA0A 2AQOA 4KRTA 3C3UA 1H11A 1PIIA 2WZTA 4LCSA 1DJZA 1XD1A 2QJJA 4JQAA 3FDKA 5M17A 4YLWA 2NQJA 3HBLA 1TWZA 1VYRA 1Q3NA 2DUZA 4N7QA 3QTPA 3W87A 3B8SA 3OP2A 3PBVA 2WPGA 1PB0A 1DJIA 4O54A 5HINA 1JZ8A 1E1FA 3TN4A 4KWVA 1KFBA 4C1KA 4EK7A 4F0KA 3F2CA 1WE5A 3QQWA 4K7VA 4UTMA 3I4EA 4JX4A 4BK9A 2EPLX 2YX0A 4A05A 4IZGA 3CZEA 3CQ0A 4Z1BA 3HJEA 4Q8MA 2Z4GA 4UTFA 3K4DA 3THQA 4C7FA 3FDGA 4ORMA 1VS1A 2ZX6A 4I8DA 1YDNA 1FWRA 4AMCA 3W75A 3SCPA 4HA0A 2BOGX 3OZYA 1BGAA 3UEQA 5LNWA 4WSJA 1U22A 3T55A 4MIMA 4XVEA 1GW9A 3LNMA 1LJYA 1OYAA 4BI6A 1NQKA 1BG9A 3HURA 5A8PA 1M04A 4DJED 3MSRA 2PRHA 3P62A 3BG9A 3R6IA 4JCMA 1QPKA 1RD5A 5LSMA 3DESA 3QV6A 4LUYA 1YDVA 1MDLA 3H26A 3KWXA 3UESA 4AF0A 2PWGA 2BY0A 3FCPA 3U6WA 3TJXA 4G9PA 5AC6A 3SCWA 1NFGA 5I3GA 2OQLA 4JTQA 1V0NA 3GG1A 4TQTA 4C90A 2Y85A 3HPFA 2D2JA 1N8FA 2C91A 2OO0A 2DU2A 3LCHA 1JAEA 4HOXA 1XLDA 4YTUA 4Y8EA 1IXPA 3CH0A 1JRBA 3OLIA 2IXVA 4RZ6A 2BP1A 3NEVA 4LT9A 2HVMA 5DMMA 3TJ4A 3BW2A 3LHUA 1HF6A 2XGZA 2UWFA 1F3EA 4IGNA 3I4KA 4EF8A 3PZQA 3BLDA 4QCFA 4IXXA 5REQB 5I6SA 4QRNA 2EG8A 5CH9A 4LS0A 4AZGA 1LF1A 5A6AA 3CAVA 3VXGA 3T2OA 3TTSA 4F8XA 1KQZA 1ME8A 1QHZA 4C6QA 4PMJA 1OCBA 1BYCA 3WJSA 3CZ8A 3HGSA 1DIDA 2VVSA 2VGIA 4NL1A 1TO3A 3NPUA 4IFRA 4X2RA 5FACA 2BVWA 2OEJA 4LNCA 2W5FA 1I4NA 4NUWA 4NZ4A 1V5XA 4QE5A 3SW6A 1P7TA 4PL1A 5HJYA 4MM1A 2NXGA 4O1CA 5L6UA 2J78A 1R47A 4AXNA 5HJXA 2GWGA 3LM3A 1TPFA 3NYZA 2PDQA 4V1YA 4EXBA 4O1EA 4W7WA 4A8NA 4P8UA 4O1FA 2DZAA 4H6EA 3W7PA 1S39A 1UA3A 3OGVA 3B0PA 3SFKA 1ZBVA 1QW9A 3CWHA 2O55A 8XIMA 5PTDA 1E9IA 5A6SA 1BKSA 3A6OA 4AXKA 1EZWA 2H9AA 4O19A 2BVYA 1VB9A 3H4XA 4HK5A 3C2OA 1PUDA 1TR1A 4GVFA 3EWDA 4R7OA 2NLYA 3PULA 4HHHA 2YXXA 4OQVA 2QLYA 4AVNA 3Q37A 4M6QA 2WQDA 4A3QA 4DQWA 1X96A 1Z42A 3QTGA 3V1HA 3OVPA 3BAWA 1FWEC 3H8AA 1NM9A 4PRTA 4JYEA 2YBUA 1I0BA 4CCCA 2CBUA 3KVKA 1X6UA 1UP2A 2NQ9A 4K68A 3AXIA 4TOQA 3R25A 5H8PA 4TTGA 2FTWA 4GPNA 2BGNE 3ZWTA 1NH6A 3S6TA 3B97A 4Z2KA 2OOFA 2WMFA 5AHIA 1GPFA 4HNVA 4S39A 1FWIC 3C61A 3EB3A 1EOKA 3WLKX 4XUGA 1MNSA 1M7JA 1KRMA 2NWSA 3WLOA 4DNMA 3S46A 4O18A 2QJGA 3T9PA 1US3A 1F07A 4AX7A 2XG9A 4DZIA 2VUYA 4LVBA 3WNMA 4LX4A 2GZXA 3FVMA 4DEFA 4ZQOA 1KNWA 1LROA 5CSRA 1JYNA 3PTDA 1XM3A 3L9CA 1CTNA 3ABZA 3L0KA 1I9CB 3DHDA 4RKAA 2X0SA 2XWEA 2C79A 3GHUA 3LCIA 1XD0A 1RSCA 4HNTA 5HMSA 1KFCA 2VEMA 3MP5A 1FKWA 3ZOAA 2CU0A 4WJ8A 5EFFA 4UTJA 4J2MA 1W5QA 3GDLA 4V28A 4PULA 3K4AA 5GNYA 4EE9A 5LIXX 3NG3A 1YE6A 4ROPA 3M5VA 4ZGYA 1OFPA 2VCBA 1C7SA 3SIZA 3T0CA 3VD9A 2YCLB 3NSXA 2QCHA 1R3TA 3A3WA 2ZWYA 3G1YA 3BARA 4HTBA 2J7CA 2QHAA 1AQHA 3VKKA 3PR2A 4KMQA 1CXLA 1C8XA 1JL8A 1AG1O 3FNDA 4NXSA 2B7QA 3NL3A 1IT0A 3KL3A 1J0IA 1CIUA 5KMYA 1BYAA 1ZRQA 4FZIA 2QQ6A 4JEQA 2WJZA 4O13A 5K9XA 2JKEA 4XKYB 5D05A 1TV3A 3VKJA 4RX0A 1ZZMA 4GINA 4EWND 2WCAA 3VC5A 3G1HA 4V27A 1W32A 1M6JA 1P0BA 5IFPA 5E1QA 3E0WA 3O0KA 3PAOA 4US5D 1H49A 3SN0A 2RGLA 1BPLB 2W61A 3W3OA 4R85A 4Q4QA 4Q4MA 5FF2A 1GZGA 1XIHA 4UQEA 2GVLA 1DP0A 2CLEA 3Q2DA 3TZNA 4U33A 5KSWA 3IVUA 3PC0A 1LQ0A 6PTDA 1NDYA 3FYOA 3IAQA 3TROA 4O1DA 4FNSA 4K8GA 4LU0A 5M3WA 1GG0A 4I6KA 3AXHA 3QOKA 1P4CA 4FLSA 2Y63A 1DQUA 4GC3A 5FD0A 7CGTA 2A6NA 3ATZA 4PE8A 1VFLA 4GUFA 1UD2A 3CEPA 4GBUA 1S5TA 4XAZA 1YDOA 2QCDB 2D3LA 3I7QA 3TXVA 5TAOA 1LRNA 3RILA 2WKGA 1F6PA 2VTFA 2WHLA 3GAYA 3VUPA 1R3QA 3N2MA 3PWGA 4GISA 3VKAA 3LZ5A 3MI2A 4ZOBA 1PHQA 1RAKA 1TPEA 1X6LA 1W1ZA 2PDUA 3WD0A 1Z89A 5E0FA 1QNQA 4KS0A 5E70A 1OFAA 3JVAA 4L4OA 3NDZA 3ZT5A 2QVNA 5E6ZA 1JG9A 2GDQA 2J75A 1FX6A 1V0MA 5I3HA 2CNCA 2TRSA 3GG0A 1XICA 5E0CA 5EBUA 2RJHA 1TJ0A 1RVGA 2A79A 4IMAA 4LVFA 4DUOA 4W89A 1YXCA 7XIMA 1EC9A 1Q85A 3GH5A 3S9IA 3NCOA 2ZE3A 4AZ6A 1CDGA 4N6FA 5FF0A 1TTJA 3QH2A 4HYWA 3BLOA 1VH7A 3A9BA 1FCUA 3CJPA 3V5OA 3MUAA 3Q67A 1EYWA 1PAMA 4NNAA 3UVAA 2OJPA 1I0DA 2VD9A 1DORA 1FWDC 1VLWA 3WD1A 1J11A 3L2IA 4J2PA 3MWAA 4L4LA 4J3XA 5EMMA 4US5A 2XU2A 4PTVA 1K8YA 1HJWA 4IP5A 2E5BA 5C7HA 4D6HA 2ZKMX 3LHZA 3NNTA 4JTJA 3ZT7A 2VX4A 1JZ4A 1DJNA 1G7UA 3RRAA 5BCAA 4GIRA 4OHQA 4UNKA 2ABAA 2D73A 2I14A 2GJPA 4F0SA 2YCEA 1A5MC 2OGYA 4M19A 3CL6A 1J0JA 3FSTA 3W28A 3THUA 3N11A 3CL8A 1TREA 1FDZA 4H83A 3GE7A 5I3DA 3U7VA 2WVUA 2WNQA 3H55A 3PTKA 1RALA 4QITA 4DBUA 1V6XA 1T8XA 4FIQA 4ZR8A 1XIIA 3TCEA 4EOUA 1GVOA 3N2CA 3HZ3A 4MJ2A 4WKFA 1X7FA 3EMZA 3K1GA 2V82A 3ARWA 5CC3A 5BWFA 1F73A 1KM4A 2VZVA 3IACA 3NQ2A 3CPGA 1DXIA 2XVNA 3OGRA 2ANUA 4Z0SA 4IP4A 2X05A 2KAUC 2D0GA 4NJHA 3RR4A 3GBDA 3QV9A 3P8IA 3T0AA 1KGXA 1UH2A 2D23A 1AQ0A 1JULA 1PWMA 3LX9A 3UW6A 1V7AA 4EAMA 1GZ1A 1TUFA 1ZAJA 1BKHA 1E6SM 2OWWA 1TV5A 3W2NA 2CHRA 1A53A 3PM6A 2Q02A 4QGCA 1R8LA 2CXGA 3RPMA 1XC4A 1QI3A 1MUMA 1XCXA 1UD8A 5BOOA 1DTUA 3W7GA 3FGCA 5IBXA 2PC8A 1Z7AA 4W86A 2NT1A 4X9SA 3KW3A 3TJIA 4AIEA 3TYDA 3BMXA 4IFKA 4WSHA 3RITA 3WO8A 3O6AA 2CWXA 1IT7A 4BKNA 4UQ9A 4J3UA 2PDIA 4JNZA 1UW9A 4U5IA 1EYEA 4XD4A 3WH9A 3F7JA 4AH7A 3TLQA 3W23A 3RJXA 3HMJG 1DJGA 4JS3A 5FESA 2VHLA 2PTZA 4B15A 1JRCA 2P8CA 4MZ1A 3FKRA 1K9TA 4ZQMA 5EY5A 2Q8ZA 2A5HA 1GHRA 3SECA 2JFEX 4QQUA 3VGHA 1J93A 1JGIA 2D1ZA 4P5UA 4AYSA 3M0LA 4IMGA 1W1B1 1CGUA 1V3LA 1TKKA 4YTQA 2PF8A 4S2CA 3C52A 1RY0A 2GJXA 3ABOA 2DZUA 4U4MA 2XZ7A 2FJKA 1GNXA 3M5ZA 3URNA 8CGTA 2ALRA 3LCFA 4XKMA 4DELA 1ONEA 4ZO8A 4ZODA 1OG6A 1XBZA 5EBAA 4QS6A 2X2YA 4J3WA 3UJFA 1SO6A 4MY9A 3WMLA 4E8DA 3LCXA 5A6KA 4X63A 4RNJA 2F6KA 2QMJA 1QBBA 2Y7GA 3A5VA 2W4XA 3D47A 3NAVA 4HPGA 1ODUA 1V02A 3W7CA 4IPLA 4G8TA 3BWWA 2WHKA 4S3FA 3VAVA 1DYSA 1OBAA 4NYYA 5AHNA 4LPCA 1X8FA 2WNWA 3GFXA 4OU1A 4O0QA 2ZC1A 1O5XA 3GNNA 3R10A 1WUEA 4HMEA 4H6RA 2PS2A 3DDMA 3VM5A 4I8YA 4GNKB 3WX7A 4MYAA 4OGZA 1DE5A 2VDHA 3W7HA 4A3HA 1H51A 5MHBA 3LG3A 3EKZA 1CX9A 3WLNA 1S2WA 4K1GA 1TE6A 2XFYA 2Z25A 3PK7A 1VFOA 3PZMA 2PCQA 4QE1A 4M5PA 4CU7A 2AMGA 2OEKA 4DVOA 2Z1SA 2PP1A 3UBPC 4S3BA 4QFUA 3HQNA 4M6UA 1EJTC 5BU6A 5U7SA 4CU8A 4W8BA 1KRCC 4M24A 1LG1A 4GIAA 5A94A 2J8GA 3AMLA 2Z1KA 3TNBA 3ITCA 4FOUA 5F4WA 3LTSA 1UROA 4BFAA 3H12A 2HTMA 3SCUA 3VGEA 1WZAA 1GVQA 1RK6A 2OLAA 4LF2A 2DDXA 3BG3A 5AC7A 4PFMA 1LBLA 4EPDC 3EA1A 1LWHA 1FOBA 2GLKA 1I75A 3WLPA 1G4TA 4XUYA 3AS2A 2RAGA 2C14A 3N2OA 1Q6OA 1ADSA 3O8AA 1R2RA 3AFBA 4A4AA 5E5CA 1T0OA 3GB6A 4B4HA 3PG8A 3NZQA 4IF2A 2E5DA 3ALGA 3VO0A 3HIJA 4DZAA 3BE7A 3WH7A 1B3VA 3DZ1A 3M5YA 3BCJA 4CQ8A 3T42A 4UNLA 4ZFMA 1WXYA 2QIIA 3BQ5A 1AQMA 3H23A 1VBRA 3WLQA 4KEVA 2OZTA 4IPJA 3MO4A 3ANUA 3RM8A 1XCWA 4FLQA 2REQB 4KEMA 1ZHAA 1N2VA 2DQXA 3L12A 2VX6A 3OBAA 1UR9A 4JTEA 4ICNA 1OY0A 2HK0A 4RNIA 5AN7A 4E38A 4R9OA 3G1FA 1PIFA 1O7AA 3VGFA 4R9XA 3EX6A 1NP2A 2HV5A 3W6MA 3GXIA 1CBGA 4AD1A 2E7FA 3W84A 2FPVA 4JIRA 3AIVA 3SRDA 5KTLA 1KV8A 5XINA 3GR4A 4CNSA 3SGGA 2FZ8A 4LYKA 1AMKA 2VEPA 3DOPA 2B7NA 4JGDA 5LGXA 1JZ3A 4C65A 1MUWA 3RM9A 1QATA 3ITGA 3W83A 1A0DA 3KOXA 5G1TA 4N9BA 2V3EA 4L1WA 1JCNA 2VX5A 4GQBA 4L56A 1V79A 4GXPA 3LPFA 2C15A 2WMKA 1XDJA 4FLOA 3S2CA 1TZZA 4O53A 1WDDA 1JYVA 2V5CA 6REQA 4EPBC 1XKJA 2D24A 5CG7A 4E2DA 6TAAA 4KEZA 1QWKA 3LQLA 4AISA 3G5EA 3QZAA 3VTRA 4IPNB 2FDMA 1D8WA 1A49A 1XSJA 1PEZA 3P2VA 3WUGA 2NSOA 2G3JA 4ZOAA 1XIMA 3ITTA 1GOXA 5D32A 1A5LC 3TONA 4JTRA 2DT1A 2J25A 3HQOA 2VC9A 2PTDA 5BU9A 4PUJA 3BSMA 3VMOA 1I6NA 3DFNA 3PBMA 1P43A 1DBTA 2F6XA 3S4TA 2AL2A 1BGGA 2RDWA 1W31A 3MDUA 3ZR5A 2CEQA 1FUYA 3WQ8A 4Z0JA 1FHVA 3VCNA 1HJXA 4IH3A 1MXGA 3V7PA 3SSJA 1FRBA 2VC5A 4LAOA 2CCRA 3APTA 3GWQA 3M7SA 4LXFA 4RDZA 1O12A 2H8XA 4IIDA 2X30A 2Z27A 4HOZA 2Z6JA 5AYIA 3LBCA 3NEHA 4OKDA 2E9LA 3NDYA 3W86A 1UR8A 4J35A 2PDKA 3LMZA 2QYGA 1XKYA 1UQZA 1F3WA 1K4GA 2QCDA 3AAMA 2QCFA 4QLLA 4MNLA 1V6UA 4ATWA 3QLDA 1EIBA 3WEZA 1J6OA 3CT7A 1F74A 3LTYA 3NZRA 1XLLA 4TO8A 4EWJA 4FNPA 4UTWC 4HB7A 1EKOA 1XLCA 4C6DA 5XIMA 4R53A 4QG6A 3P74A 1E15A 2QDDA 3VI2A 1L0PA 3ZJKA 2E8YA 5FF3A 1EF2A 1W37A 3ZVHA 3MMWA 4EANA 2B7OA 1LG2A 5D2XA 5BXSA 2VEKA 1NF7A 2OZ3A 5AY7A 3M9YA 4S1FA 4UTLA 3BSGA 4R88A 1R7AA 4XBKA 6REQB 3WY1A 2VGBA 3NDOA 1TTPA 4NZCA 2Y8KA 3M5XA 3KBVA 3W00A 2DJXA 4X60A 2FVKA 2C0HA 2PF0A 4G7FA 3LU2A 4HCHA 5FEWA 2EO7A 3A23A 5KZMA 1GQLA 1HXJA 3OHMB 5HNNA 5DBTA 3R58A 3GNRA 3OOQA 4CQAA 1KXHA 1K02A 3R0UA 1YMYA 1I2QA 2ZE0A 3ZXWA 3WK3A 5G4EA 2VQTA 3LOTA 5FJPA 4IISA 4MADA 5FA5A 4KGJA 3N4EA 1OIMA 4H04A 5I0DA 3B06A 1HVQA 1E3XA 3VFCA 3QGVA 1ECEA 5FL0A 1P48A 1CNVA 5CPTA 5LA0A 4AIUA 1FFRA 3A47A 1UBPC 1XIGA 1G1YA 1IEQA 2DT2A 4Y2WA 4DUVA 2E8ZA 2PE4A 4AVOA 4IIFA 3PP7A 4RDVA 3NURA 1E5NA 2F38A 5DCDA 4Q4RA 1W8SA 1MI3A 4JIIX 1TPDA 4B5SA 5L9FA 2GGEA 1QJWA 2P1FA 1SJCA 2V3DA 2W91A 4Y9OA 2ZUNA 5TNVA 4PTMA 1J0YA 3CHDA 3RM4A 1QUMA 3BAKA 4UOZA 3O07A 3S9ZA 4IIHA 2GGHA 1WDSA 1JPKA 4DN1A 3OZOA 3CIVA 1NELA 2CZVA 3CMFA 3TMQA 5FEZA 4PMOA 2INZA 2XN1A 3G0UA 4OTKA 2HPIA 3GVRA 1RXOB 3SRFA 3DECA 1WKDA 3L4TA 4U2ZA 1JD9A 3V36A 4O12A 2GUBA 2E5CA 4NJKA 5LKYA 1O66A 5AKQA 3WMCA 4Y7EA 4FNQA 4W85A 5JBDA 4JEJA 2IMRA 1L2UA 2WSPA 1K8ZA 3DKLA 3SB0A 3QVQA 2WANA 2ASHA 5CC6A 3PTMA 5KZ6A 4RE3A 1Q6CA 1ALDA 1SU5A 1KD0A 3B8DA 3F5LA 1GOQA 2PFHA 1QI5A 3UXAA 1VFSA 1MEWA 4KWUA 4P8XA 4A3UA 1E70M 4S2BA 4LFYA 3PZOA 3CO8A 4AD3A 4PMXA 3N12A 1FP8A 2D3NA 2E1WA 5ECUA 4CD8A 4JTHA 3WQOA 4KQNA 3JRKA 4OBTA 4LBUA 1HG3A 2E3ZA 3M47A 3NZGA 2X09A 2ZZ7A 3F03K 3MZNA 4NI3A 3O6DA 2ZTJA 1OGGA 2YL8A 1W9XA 3GHSA 5HDRA 2Z1WA 3BW3A 2C19A 3RLVA 4AZ5A 1XSKA 3D3FA 4A3RA 2GPTA 2HROA 3WLIA 4F3HA 3GZAA 1HTIA 2OMAA 3B4YA 3E5BA 1W17A 3T4CA 3CTLA 1XPGA 4FS9A 4AEEA 2G3IA 1G94A 3CH9A 2PDBA 2SFPA 5A2CA 4D71A 3G6MA 4AW7A 2E6DA 2QPXA 5CC5A 2CLPA 1UR2A 2ISFA 3MTWA 3RPTA 1I2PA 4JQ2A 4IMDA 4AWUA 4XG1A 3TSMA 1PKYA 1E0VA 5I06A 4DBWA 3I6RA 3MP4A 4FEZA 4HPHA 4NZ1A 5DN1A 2IW0A 3EWBX 4YL2A 2ABBA 3SCTA 3OZMA 2VENA 3FXGA 1W9VA 2BZNA 4M3PA 5LXEA 2V8ZA 7A3HA 4RLIA 3M6YA 2Y1HA 2PLKA 1VR6A 2GDVA 4TVDA 2WHMA 4ACZB 1TVPA 1KO0A 2ZDRA 3CUZA 3NPXA 3I6TA 5HNRA 1ISVA 1DWJM 1RCOB 4RL3A 1UH3A 3NL5A 4MB3A 3DG3A 4R7WA 2OWCA 4H7VA 2XSXA 3TAOA 1A5NC 3DHUA 1J12A 4C60A 5BMWA 2VVNA 2V3GA 3EPNA 1JPDX 4LJ3A 2ZWZA 2QMKA 3WH8A 1W3KA 3NSNA 4BEUA 1W5MA 4D6DA 3QJAA 1J9YA 1Z41A 5A8NA 3EZ4A 4YTTA 5A69A 1N8IA 3AOFA 1ZALA 3NM3A 2J62A 4JKLA 3QQ0A 4GXMA 1M1BA 1ODZA 5CBJA 3THAA 3C0LA 2OZ8A 3OBEA 1UWAA 3W0KA 1H61A 3POCA 1OVDA 2IPFA 3C4UA 4GQRA 3V0SA 1MRQA 3MZ2A 4DJFC 1F8IA 4X61A 4TR9A 3S2NA 2A3BA 2R8WA 4DF0A 1ADDA 2QPSA 2WOQA 4LS1A 4B9ZA 3WDHA 2IXUA 3VDGA 5A8OA 1BF2A 1UR4A 1WBHA 4MY1A 1YADA 5FSDC 4MNJA 1GONA 1KBBA 5ABHA 1E1EA 2O0TA 2XTKA 3ARUA 3KTCA 3P7YA 1PXGA 3MI6A 3TXZA 1N8WA 1HP5A 5HQLA 2F61A 1V3KA 4WXYA 4QTGA 2V6AA 3VZYA 3K2GA 1MFVA 4XV0A 5A8GA 4QSFA 4BI7A 4FF5A 4M0XA 1OT2A 2FYMA 2Z28A 1TMQA 3QZEA 3NOEA 2DZVA 4YYFA 3USZA 3W7NA 2KX9A 2YZ5A 3TTEA 4M29A 1XG3A 1XLJA 1B0IA 4C5ZA 1UQYA 2OQYA 3N04A 5D9NA 4DXXA 4HCDA 3GSMA 2WXDM 1S2TA 3T8LA 1OZQA 2O4QA 3LLXA 4G2DA 1CXFA 2OYKA 3TYBA 2XIIA 1CWYA 1R2TA 1FCBA 3P0WA 4RDWA 4A22A 1VEPA 2EGZA 2CZDA 4OOZA 4GRSA 4XSLA 1HKJA 1G0CA 4BHYA 5IFTA 3QHOA 5LZLA 1DXEA 4IHCA 3PSWA 4CN6A 3PB2A 4L1GA 3UP8A 4E6MA 3MWCA 4YYCA 2YCKX 4FOJA 1HKKA 2ON3A 2JQXA 1UA7A 2PRMA 1MQQA 4U10A 4US6A 3CUIA 4WR3A 1K9DA 1GOOA 1KFJA 4E4FA 3OTRA 4K36A 1XJBA 1XSIA 1OF8A 1HQTA 1G4EA 2R24A 1H5VA 3DI0A 3NM1A 3GVGA 3U4AA 4YXGA 6TIMA 5LHFA 1GYNA 3DG7A 4JFUA 2JKAA 2TAAA 4PB5A 2VI0A 1SSDA 1I2OA 4GCAA 2YB1A 2REQA 3L0GA 3VOFA 4NF7A 4ICMA 1GOIA 2XFFA 3OU8A 2WMIB 3ZS4A 3AROA 2J74A 3TSDA 4Z2GA 5M03A 3CUJA 2VFIA 3NUKA 2BXZA 3M4HA 1V7YA 3COTA 3SN4A 2ZFAA 1WV2A 1TWWA 1QRQA 3D5HA 3U57A 2FVMA 1AJ2A 3UXKA 1SPQA 1OABA 4V33A 4FR6A 4IQJA 1IHIA 3A3HA 2OVLA 3B8VA 4Q8OA 3EPMA 3WJYA 4H9UA 3IAPA 1AMYA 1S5WA 1HKMA 4OOUA 2I9UA 2XN2A 5BW6A 2QULA 5HATA 3W1LA 2FMOA 2O9OA 2LLEA 3LCGA 1WYIA 4UQBA 1V3HA 1YPIA 4W7VA 3C2FA 3SJ3A 2I57A 4ASTA 4B91A 2GFTA 4U28A 1VJZA 3CZKA 3RUBL 3ZIZA 3ZFHA 1TMLA 1U1JA 4UFJA 4BI5A 3U48A 1EUNA 4U3AA 3CQHA 3M16A 5G2IA 1B3XA 4H4IA 4R27A 2YFNA 3BOXA 1MQPA 1W3LA 3ECQA 2PDNA 1DXFA 2X0HA 2ALDA 3DXIA 4ZMGA 1Q6FA 5JVLA 3FK4A 3WKZA 3VMPA 4I90A 5FOOA 1OCNA 4LUJA 2RGMA 2J9XA 3HFYA 3SCNA 1HJVA 2NWRA 1Q63A 4JX6A 2BDQA 2ADAA 2G97A 4PR4A 1OX5A 1FHLA 4GUHA 4UIOA 1AVAA 4HHLA 2DZXA 4L1XA 4XIAA 1KCZA 1EJVC 1S1PA 3LPPA 2E0PA 3IIOA 2RDUA 4PMQA 3ZSSA 1QHOA 3QY6A 1B54A 3LPOA 4JNYA 3LYEA 1L2QA 4DNHA 1JCTA 4R5EA 2J7DA 1R3SA 4KWWA 1LLZA 3LLDA 5CJMA 4AUBA 4AC7C 3K4WA 2FZDA 2Y62A 2P3ZA 4JTIA 3EXSA 1ZB5A 1E4MM 3H4WA 5E09A 3LGDA 3QV8A 1DL3A 3M0VA 4PGLA 2Z00A 4B5TA 1J2BA 1SZNA 4GHRA 2EPOA 3EWYA 3N9KA 2VXNA 1ONWA 4DWSA 2QCLA 2A3CA 3OPSA 1BG4A 2OELA 5LNRA 3AUJA 4H7ZA 2Y5JA 3W7LA 3O0FA 3N18A 3ARPA 1D3GA 3FV9A 3M0JA 1MQRA 4HPXA 1YX1A 3C5QA 5DCBA 3FAXA 1SZRA 1VFMA 4ZCWA 3KTSA 4C91A 2RFGA 2DZPA 2XHYA 4REQA 2ISDA 4UFIA 3GRIA 2DPEA 2I5GA 3BH4A 1YIXA 3XISA 1EC7A 3CIWA 3AJXA 1XWYA 4CCZA 3WJWA 2GQAA 3WNKA 3A9IA 5AYYA 1KA9F 4HD5A 3MMUA 4H6QA 3QEZA 2ZICA 3M44A 2FTYA 3TOPA 4IJRA 5CPLA 5G4HC 1CGWA 4HT3A 2O7QA 4Z1DA 2Y70A 1RJRA 1W3TA 1ADOA 3ES8A 3P5YA 3CGTA 7REQB 4OUIA 5J04A 1W1IE 3IK2A 4Q8PA 3T07A 4NAFB 4F9JA 2JK2A 4GZEA 4K1WA 2AQVA 4JTSA 2YOCA 1J18A 4RCXA 2XVGA 4LWWA 5AOUA 2VL4A 2C3ZA 4GZJA 1EA9C 1WXJA 4L6OA 3WBXA 1VCFA 4I9AA 5D9OA 3LSBA 1Q4WA 1QPNA 5ABGA 1QDSA 4BWLA 1XDLA 2VRJA 3W7KA 4MKVA 1MWOA 5EU9A 1EP1A 2V5BA 1XV8A 3C3NA 1XW8A 1R86A 3GH7A 1EJ7L 1OJXA 2R1LA 1EGVA 3V35A 4LNYA 1QMLA 3NTYA 1TQJA 1IEXA 4Q8NA 1XLHA 5FAJA 2V3FA 3OODA 2HBVA 3REQB 3WL1A 2GJXB 1E73M 1ICPA 5D2WA 5CBBA 3PZTA 3PZNA 3JW7A 3QBUA 1VZWA 2DORA 9XIAA 3GXFA 4Z08A 4NZ3A 1E3ZA 4DBDA 2V81A 3VD3A 2QUTA 1TCMA 1W9DM 3DFOA 5EMKA 4PFHA 3RF9A 4M81A 3CPRA 1G4PA 1AD1A 2QJHA 3GH4A 2ISSA 2CBIA 1US2A 3WQWA 4FMVA 1XINA 1ZAIA 4JQ1A 1M5WA 4MY8A 2C1HA 4HBKA 3ZYZA 1V93A 4H41A 4AHPA 4Q7IA 2FKPA 4AY8A 3ARTA 4QS5A 3W53A 1CECA 3B03A 4D6EA 3PJWA 3NQCA 3GY1A 5D2YA 1L6WA 4GI9A 1SZEA 1YTEA 4GOAA 2E9BA 4HA4A 3CQIA 2P0IA 1J5SA 1KLYA 2F9RA 6XIAA 5ECVA 1GVEA 5TQLA 3CK5A 4OZOA 3MO7A 2YB4A 1F2JA 3DENA 3VKBA 2X1TA 3N13A 3FOKA 2X7VA 9XIMA 4JTCA 3CMGA 2XH2A 4AD0A 1RA5A 3BLKA 1SJDA 1BXCA 2XIOA 1TUXA 3LI1A 5M5DA 3RLGA 1HO4A 5LNSA 5HOSA 4XO7A 3MPGA 1FY6A 4CQDA 1YE4A 4QDMA 1JQVA 3ZZ1A 5DT7A 2G4FA 4P7RA 5D4YA 3V0UA 2ZZ6A 1NVMA 1Z6KA 1TJRA 1KFEA 2VD8A 3KAOA 4NAEA 1FTXA 1CCWB 5BWAA 2WJDA 3GDTA 4YMZA 4NIRA 4QDWA 4MNMA 1H7XA 3WK2A 1E9LA 2ZCGA 1LM1A 2O56A 3ZWSA 1T40A 2OSYA 2PDJA 2C8NA 1KM3A 2PLCA 1SO5A 1JF6A 4DBEA 4NYUA 4MKSA 3HJZA 2OQHA 3EWUA 1RCQA 4CNNA 3CT2A 1TJ2A 5EL1A 3TWBA 3POHA 4F2BA 3G1RA 2W62A 1H2JA 3ZMRA 3HPZA 3B8TA 4H3DA 1OK6A 1RV8A 1T41A 1UKTA 1DJHA 2Y7FA 4IG2A 4UR7A 5C9UA 2FGBA 2DVUA 3OG2A 3SI9A 2PP3A 4O11A 4YCOA 4DUXA 5EMLA 3MB9A 1AUSL 4PB3A 2JIWA 4CKQA 4LV9A 2GQ8A 1HNYA 2P5NA 1Q7MA 1VCGA 3KS6A 4H7CA 5CZJA 2VEIA 4TX8A 1VAHA 1R3WA 4Z2JA 4B2DD 5CPMA 4JYFA 5HMDA 1C9WA 3B4UA 3LRMA 4HP5A 3PPGA 3GXMA 4WRHA 2W3ZA 1K7EA 4DLFA 1Q6DA 3T2PA 5EFDA 3EX1A 3W1NA 2NXHA 3SUTA 4HYVA 1S3HA 4OE7A 4XZWA 1ZGDA 1ZFJA 1JR1A 1IT8A 2VYOA 5AZ0A 4JTLA 1GHSA 3ABRA 2OR2A 1D3CA 4LALA 2DZSA 4Y9PA 1XGEA 3WH5A 2WC7A 1WA3A 3NQ8A 1ITCA 1VP5A 2BNJA 4Z2IA 3MV01 4L9YA 1VFUA 2X7WA 3RHGA 2GDUA 4DI9A 3G2GA 3MBDA 3WCZA 3ATYA 1T5AA 4D6CA 1E43A 1ESWA 5LIKX 3W2KA 4MWAD 1PBGA 4ZO7A 3CWOX 4F0HA 4DF1A 3CV7A 3TYCA 4HMCA 5C70A 1BVZA 4GH1A 4RE2A 4XZNX 1E6PA 1VKFA 1SFSA 3PJTA 3SUWA 4ALDA 3P82A 3FY1A 3B9OA 3QC0A 4RE0A 4F4RA 5A6JA 1TWIA 3AHYA 2H6RA 3DHPA 5K4ZA 3KRBA 4PMYA 1TCDA 1OC5A 3T08A 3EDEA 2WMGA 3BVJA 1KTBA 3UG5A 1GTHA 4GE8A 1BSLA 3KUMA 3VE9A 4UBPC 2B81A 3RLHA 1CI1A 2PTXA 3KVMA 4LF1A 3W7RA 3KOZA 4NZ5A 2AL1A 1YPFA 4EXQA 1DOSA 3P81A 3GKAA 5E0KA 1ISZA 4D2JA 3B04A 1P6CA 4DJEA 1HL2A 4TV6A 4HK7A 3B3DA 1QXLA 3TYZA 4KPLA 3HPXA 1XG4A 4MVAA 4DPPA 3HG2A 4O8RA 3C8NA 3P5ZA 5ABTA 2JF7A 4HA3A 5ENLA 4BR1A 3LV5A 2VRQA 3VA8A 3WJXA 4FNUA 2VFDA 1OGSA 3R79A 5C9XA 3E3HA 4RXGA 1TV7A 3DN5A 3MUCA 3GG7A 4Q8VA 1WZKA 1ZCOA 4MNKA 3EOSA 1XYLA 2CLFA 1P0DA 4WVXA 5MKGB 5I07A 4LH8A 2Z2BA 5I00A 1FWJC 6ENLA 1S5VA 4XWUA 3DBPA 3H2NA 1J0ZA 3GR7A 5E9AA 1MW0A 3W2JA 2Z6IA 1U83A 3B0XA 1WKFA 2ZX9A 3AMGA 4GK8A 2ACRA 2ZADA 1NOWA 4IPPA 5DBUA 3PUGA 2VOMA 1R3YA 2IPGA 1VBUA 3T0BA 4H9XA 3G1DA 3GVWA 3KOYA 1S2CA 4RZ5A 1KGUA 3NSMA 2J9YA 2XN0A 1JNEA 3N2TA 4L9XA 2JEPA 4GJIA 4XZMX 4D6IA 1DJQA 3H7VA 4B5UA 4BQ4A 3GLCA 4PTWA 1U30A 5I77A 4H8HA 5CXPA 2FDSA 4FX8A 4MG4A 2AKMA 3T6CA 1RBAA 3SRKA 1GW1A 3GTHA 3PAJA 4WQ6A 3ZR6A 3TOYA 2IKHA 4AC1X 1IZCA 4LAZA 3R13A 2XSBA 4O8AA 1BAGA 4LSBA 5G2HA 3NVDA 1B9ZA 1X39A 3EMCA 4A2RA 2MNRA 1R7OA 3ONBA 2HNHA 5DEZA 4PBGA 4JIEA 4UOJA 1VIWA 3O05A 1EIXA 1QPOA 3QXBA 1RR2A 4GVHA 1YEYA 3I3EA 4J3VA 2D2HA 3INPA 1SJAA 2EEXA 1CGXA 5I79A 2QUNA 2DIKA 3GXPA 2J79A 1YBQB 4WOQA 4W7UA 2WV8A 1VBGA 3EB2A 4L6DA 5T9BG 1YYAA 3LY0A 3GDKA 3TMLA 3ERPA 3O6CA 3AZTA 1LOSA 1QI4A 4JIPA 1XP3A 3B9EA 3C0SA 3QF0A 3L4ZA 1QNRA 1M65A 1F6YA 1QO2A 5A5WA 3G24A 3PVFA 3GYCA 5CPOA 3CHFA 3U3HA 4DAIA 1JDFA 1KFKA 3W88A 2HXTA 3GX9A 4WDTA 1K6WA 3H2OA 4AIBA 5HUPA 2Z2UA 1JZ2A 1UD3A 3WJZA 3CS2A 3UNDA 3BLIA 1HJSA 1H0GA 3NXLA 4GY1A 3W70A 1MO0A 2GK1B 3FJ6A 4I5UA 4BEQA 2AGTA 5E9XA 3M0MA 7TIMA 1MDRA 4CQBA 5J5RA 2HXUA 1UWRA 1VFHA 1ICSA 5EKYA 2PDWA 1J01A 3KWSA 4H19A 5EYWA 5A6BA 3G1VA 1KQYA 3GYEA 3TCSA 5FSEC 1XLIA 1LL6A 1UIOA 2G41A 4PCPA 3H6OA 3UGVA 2EF9A 1U1HA 2YSWA 1RQBA 2QF7A 1E6XM 1GYLA 2V2DA 3VE7A 1VEOA 1S2AA 5SWUA 3KOFA 4DM1A 1GVIA 4QROA 3AMCA 5AC4A 1XLKA 3RDKA 3TN6A 2AKZA 2WW5A 2IQDA 4HZ8A 1VJIA 2PUZA 1U5HA 3O2LA 3UF9A 2A3LA 3NO1A 1D3HA 3RN6A 1YDYA 4XQ6A 1XYMA 1OIFA 3TC6A 5CAKA 3WH6A 4XD6A 4GG9A 1UR0A 3UJ2A 2G50A 4MWAC 3W7EA 3VCCA 2PDFA 5C2XA 1POKA 3Q45A 2GVGA 4OBSA 5GNZA 4S3DA 4N0RA 1FWAC 3MSYA 4AZIA 3N1AA 4LCRA 1ZTVA 4UMCA 3F4NA 5G5IA 4JKKA 4D6JA 1EHNA 4LUSB 2W92A 1HGWA 1BEUA 3KBSA 3CLMA 2RDXA 3QOMA 4KIEA 2QAFA 4WLCA 4S3AA 4FHAA 2ISVA 1AZ1A 1CXEA 2ZZ5A 1JPHA 3ALFA 3MP3A 1UOZA 4G56A 4KCVA 5HNTA 4FXFA 5D2VA 1HJUA 2GVEA 1GJUA 4GO8A 2ZQ0A 4NX0A 1EJSC 3TWAA 2EJ1A 3VC6A 3TA6A 4JDYA 1GPWA 1UUOA 1W9PA 4PB4A 3AHXA 4RZ4A 4H9MA 4UC5A 1I60A 1L9WA 3FFSA 1DIKA 1JCYA 3WDJA 5C71A 3MUZ1 3ANVA 4LYQA 4HJWA 2RH9A 3L21A 1F5ZA 1S5MA 5HANA 1KM0A 3GC4A 1TX2A 2OFJA 3SCQA 2WNZA 1C8VA 2ZX7A 3M0HA 3RCYA 5EGRA 2E25A 3B9DA 3SBFA 1NARA 1Z8AA 4QEHA 4C7GA 3ITYA 3CV1A 1LQ2A 3R7MA 2MUCA 3WF2A 4LY4A 2IS7A 4MF4A 3WN6A 1PS9A 3RXZA 2E67A 4YWIA 1WZMA 4BQ2A 1V08A 2ZOXA 3EX4A 4AWSA 4IGSA 2XYLA 4I9MA 2ZXDA 2W66A 2RUSA 3EKLA 5DQPA 1QOQA 4NRSA 3BJTA 3MVTA 4DJDD 4ICCX 5CZ0A 3IIPA 2CZ5A 1YBQA 2Y8VA 2FH8A 2NVCA 1W2VA 4IQDA 3DC0A 1W1TA 4BS0A 3DEQA 4JTUA 4FPSA 2C7FA 5A2AA 2WBGA 4LC6A 4JN7A 2POTA 4DAFA 5K9CA 3BZGA 4AAJA 1IEIA 1OQFA 1DWAM 5TF0A 2V0TA 1BTCA 1UPMB 3HQPA 3IS4A 3EAUA 1BSIA 4IGMA 4W93A 3H2CA 4ZXOA 2VT0A 1CGTA 2BGQA 2PU0A 1IGSA 2JGYA 1HX0A 4PUEA 1L8NA 1KR0A 1MUCA 5KZEA 3WEMA 3N25A 1AD4A 1EXBA 3MUY1 2OO6A 2AMXA 4UFLA 3MC5A 3XIMA 1CPUA 2GGIA 4E3TA 4CQ9A 3DG6A 4LYRA 2WQPA 4A35A 4LVDA 1LYXA 1W1A1 5MF5A 2F2KA 4RNHA 3BJSA 1NAL1 3MVIA 5D8ZA 3UG8A 3ME3A 1Z3NA 4UTKA 3S6OA 5H91A 1L6YA 3P8JA 4L65A 5D9PA 3E2SA 1B3WA 4ZQCA 3GNPA 1VYSX 2V5JA 4AY7A 1BRLB 2B4GA 1V6WA 4YCPA 3RPDA 3W82A 1CLXA 3RLUA 1VPYA 4GI8A 1O1ZA 1XLMA 3TC7A 1ZSXA 4KW2A 3NQ7A 3BJFA 4GFIA 3E6EA 1W56A 1XHGA 3LN3A 5EB8A 1JZ7A 4UWMA 3P0XA 1L6SA 2QW5A 3G8RA 3OJGA 1VYPX 1H5YA 1Y7VA 1WQ5A 2X2GA 2IPJA 3L4XA 1UPPA 2NQLA 4Q4SA 5FCZA 2BVDA 2WBKA 4JL1A 3W26A 4CQCA 5JIWA 3RIKA 4AZ7A 4ZOCA 3R8RA 3UZXA 3VNDA 4LANA 3W1TA 4HMNA 4Y9NA 3TIMA 5CC7A 1EXPA 1DJWA 3BL3A 3TSBA 5DELA 2BBFA 4GYJA 4UR8A 3KP1A 5I03A 3BAYA 4KETA 2VDIA 4XSMA 3EA3A 2IPWA 1R9ZA 4JBRA 1A5BA 3WDIA 4D1JA 4Q7NA 4GGHA 5BXPA 1RH9A 1QI0A 4Z2HA 3WZ0E 5IXEA 1TV8A 4RE4A 2BS9A 1PKMA 3RK8A 1KCKA 3SY5A 3DI1A 3S2JA 4PEEA 2XIBA 2VR5A 1NTHA 5A6BD 4CN4A 1AL8A 3PHAA 4CGTA 2XM1A 2X16A 3LS9A 2TMDA 2X41A 1P0EA 4W88A 5GJPA 4K37A 3EOLA 3G1AA 1XBYA 1G9HA 4FNTA 1ELSA 4B3KA 1A5OC 2WVSA 4O4VA 4TVCA 1YKWA 2QPUA 2AQWA 1RLDA 3SUVA 1VRXA 4XZIA 4EX4A 1H63A 1OEPA 4V2XA 1KFLA 2WMHA 4YTSA 1AW5A 4FSAA 3BV4A 4RW3A 3IGSA 4L9ZA 3V5CA 1OFQA 3PWAA 3MMDA 2QCMA 2YCLA 2B7PA 3VNLA 1VQTA 3L23A 1LL7A 2YBTA 3THCA 4ZVJA 3JUGA 4S3KA 6CGTA 1BD0A 2GSEA 2YGYA 1EBGA 3QMTA 3G3DA 4I6VA 3PFRA 4C6NA 3M7WA 3MCNA 2ZBTA 1FA2A 3M0IA 3A4JA 4FXJA 1QFEA 2WYSA 1K6AA 3ELFA 4ZXLA 3UR2A 3ZLGA 3RR1A 2PD5A 3VKCA 1UG6A 3FHAA 3NJ3A 4U2YA 3S9YA 1R3RA 4FLRA 1WKYA 2Q09A 4IG2B 4GI4A 3WEOA 3W27A 2VNCA 1OGBA 1PWLA 4UTHA 3WDQA 2Y61A 1CXHA 1JJKA 3ZJ7A 2DV0A 3W22A 2J7GA 4MMWA 1QNVA 4C6MA 2PWEA 1J5TA 3M0ZA 1E71M 2ZVIA 3L67A 3CUXA 2DY3A 4H9VA 2X0YA 4WY0A 4I9TA 4ZA0A 4PMVA 2J24A 2VOTA 4B16A 4TMCA 3FJLA 2WSQA 3Q65A 1A5KC 1FH8A 1XYBA 4X2PA 4NZJA 4QSHA 4WXZA 3E2VA 3GFZA 1V6YA 4AHOA 1KW1A 3HGOA 4XZ9A 4GYFA 4KF1A 4GO9A 5HNUA 3W76A 1I45A 4BZYA 1P1MA 3UXLA 3BGAA 3CAWA 1Z32X 2NLIA 3OVGA 4HTYA 3W7DA 2PRLA 2VURA 3GM8A 4NAFA 3RCMA 1A3WA 3NO5A 4QR6A 4FO4A 4JFTA 1OD0A 4RR4A 1XYCA 5DXYA 3MYOA 4Z1YA 5CPQA 1H1NA 1LDCA 2FFIA 1HVXA 2Z7GA 4RV8A 3VGGA 4Q4PA 2ATSA 2YCIX 3EMQA 2BXYA 3PG9A 3VINA 1NY1A 4JOMA 1Z48A 5D33A 2V5DA 2DUAA 5CGQA 1TZ9A 1VPQA 3T2QA 3WDPP 4UMBA 4MDOA 3WQ4A 3GKFA 3WD4A 4WJEA 4DYEA 2Y89A 3WNNA 1RD6A 2NXIA 1H41A 3WNOA 5C54A 1C90A 2XIMA 1LT8A 2XJ7A 3SUSA 1IXQA 2VP8A 3SDOA 4GGBA 3LQGA 1A5UA 3GS6A 4ES4A 1QW7A 1KXQA 4IWWA 4PEKA 2NV9A 3BLEA 2EBNA 1C29A 4WY0F 2CHOA 3OLGA 4ZB2A 4C6EA 1U5VA 3TW9A 4A8IA 3K5XA 3T0TA 5DF0A 1J2WA 4NI8A 3PJUA 3I3DA 5AECA 1XIBA 1K8XA 1H7WA 1XUUA 3BCFA 1H7RA 4MB4A 2NUWA 1WBJA 3SGUA 5GJMA 5A3HA 1C9DA 7PTDA 1HP4A 3GK0A 3F2BA 3VABA 1VGAA 3SN1A 1ZUAX 1X8CA 1JGMA 3TDFA 1WX0A 1JNDA 2NX3A 4EAYA 2WVTA 4GQGA 2VZUA 3KL0A 3STEA 3V16A 2ACUA 4WDWA 7TAAA 4WGXA 1SQ7A 4E4UA 1UR1A 2QF8A 2EAWA 3JZEA 4OUEA 1A4MA 2UY4A 4TMBA 6A3HA 3STCA 1E9ZB 3WLMA 2EKGA 2A2IA 2W79A 3PPCA 1UKQA 3AHVA 1E6QM 3TJLA 2BB0A 3AS1A 4MB1A 1IZKA 4LB3A 3N3TA 3DFHA 4JQ3A 1A50A 4DO4A 3DGBA 1EPXA 1X97A 2YXGA 2OSXA 3IRDA 4UXDA 4W87A 1KR1A 2Q8LA 2Z7KA 3W2UA 4IJCA 5FI8A 2D0HA 2VZOA 1F4AA 5CG0A 3E0VA 1ZBCA 4NU7A 2ATMA 4UQAA 1GQJA 3T05A 1UBSA 1MXDA 1XLFA 4ML4A 1SSGA 1GG1A 3ZO9A 3BDKA 3LZ3A 5I7GA 1SW3A 1YTDA 2WLYA 3SFWA 1JYWA 1NWRA 3W73A 4LY8A 3BV7A 4DO6A 4ECLA 1GOKA 3QPZA 1AFSA 1A80A 2HBXA 2EJAA 1NU5A 4LAUA 1UHVA 2PLJA 1KBIA 4JXCA 4ZBCA 5AFDA 3HO8A 1VHCA 3BLFA 3H2AA 3QPEA 2O7SA 2YFOA 3KCJA 4JQ4A 1LOLA 2FQIA 1GUVA 2BWGA 1XLAA 3H7RA 1E9YB 3E02A 1CGVA 1EA0A 4WZHA 5C9ZA 3I68A 2BV9A 2CXEA 1JZ5A 1YXDA 3NGFA 1G69A 1E4NA 1GT8A 1UASA 5E93A 3GQYA 3TW7A 1JDAA 4KEUA 1J10A 1FBAA 1H60A 3EB4A 3TYEA 4GWEA 4HA1A 4NZFA 2DGAA 5AB3A 3BO9A 1A5AA 3LK6A 4FIRA 2GOUA 4ZE5A 3O06A 3IV8A 3PBUA 1E6RA 1W5PA 1E5JA 3BGGA 4E3VA 1JFHA 1MVYA 2HE5A 3NPVA 4PMUA 3O7UA 2UY2A 2PBOA 4XISA 4N9EA 2HJPA 1HKVA 1H50A 2G95A 4GI6A 4N02A 2G96A 1DE6A 3WNPA 4FI4A 3O15A 3IPWA 1SMAA 4FP1A 1JF5A 3H2MA 4XD5A 3KRZA 5RUBA 3B8WA 3MYPA 4MJMA 4FOKA 5HQMA 3SQLA 3VNJA 3K13A 4KGLA 1GYMA 3VVGA 4J9JA 4CD5A 1TX0A 1W5OA 1IV8A 2BHZA 1SFLA 4Q8QA 2ZXQA 4AMAA 4DJDC 1FWCC 4CCEA 2PDGA 3W7MA 3C2EA 1JCXA 1L6GA 2NX9A 3V5FA 1V3IA 2OCZA 4WJXA 3EDDA 2DT3A 2YDSA 3GG8A 3R1ZA 3SCRA 4Z42C 3WUBA 3W1PA 1LWIA 4MB5A 4ZFCA 1LLOA 3IV3A 2FPTA 4XIMA 4ERIA 2FGZA 5HMEA 2CPUA 1J0HA 3BAJA 1O5RA 2PWVA 1XRVA 5A8QA 3L65A 1GORA 1LZOA 3VD5A 3GBEA 1OX4A 4DLMA 3L4UA 1UZ1A 5AYBA 3CAKA 4HPNA 2XIJA 5IBXC 3GC5A 4LCQA 1MW2A 2Y8UA 3H24A 4DJFA 4BQ3A 1DQXA 2E77A 1H7NA 2WWDA 3N29A 3TVAA 4CD6A 1W9UA 4MPQA 4QJ3B 1QPQA 1GQNA 2J6XA 2ZTKA 2EQDA 5DXXA 1LCOA 3GAKA 1PZ0A 2YL5A 1SMDA 2VFHA 1TPUA 1IWPA 1Y65A 1F6KA 2J7FA 4KIRA 5HUOA 5JQ9A 4WX2A 4IUGA 4XAPA 1E51A 4OWGA 3IRSA 4UB9A 3HB9A 1EPVA 1O1HA 4AEOA 4WD0A 4QNEA 2ZDSA 3E96A 3WBYA 4YS1A 2C13A 4F79A 1XX1A 3F4CA 3PZUA 4D6FA 3QN3A 8XIAA 2XWDA 5LIWX 3U5UA 1JCMP 5DO8A 1TIWA 3L5AA 3T40A 4UFMA 1TMHA 1KCLA 1EQPA 2NUYA 4H9TA 3BLLA 2CITA 3CAQA 2ZRUA 3UYIA 1PTGA 1I2NA 2J4GA 3VIMA 1KWKA 4RUBA 3RYSA 2UY3A 2VZTA 3MI3A 4IXHA 2HS6A 4B5NA 1MYRA 3SEPA 1SUXA 3FN9A 3P60A 3WF3A 3UCDA 1VFTA 1OSEA 4K2SA 1O68A 3TNOA 4L80A 3VUSA 1FH7A 1GZJA 2JALA 4FX6M 5AC8A 1PZ1A 3F5KA 4G5DA