4ADTA

Crystal structure of plasmodial plp synthase
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
278
structure length
273
Chain Sequence
b'DNDSILLKHGWCEMLKGGVIMDVKNVEQAKIAEKAGAIGVMILENIPTDGVARSVDPLKIEEIRKCISINVLAKVRIGHFVEAQILEELKVDMLDESEVLTMADEYNHINKHKFKTPFVCGCTNLGEALRRISEGASMIRTKGEAGTGNIIEAIKHIRTVNNEIKYLCSLDESEVYNFAKKLRAPIDLILLTRKLKRLPVVNFAAGGIATPADAAMCMQLGMDGVFVGSGIFESENPQKMASSIVMAVSNFNNPKILLNVSLGLGKAMHGNTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PYRIDOXINE BIOSYNTHETIC ENZYME PDX1 HOMOLOGUE, PUTATIVE
publication title Assembly of the Eukaryotic Plp-Synthase Complex from Plasmodium and Activation of the Pdx1 Enzyme.
pubmed doi rcsb
source organism Plasmodium berghei
molecule tags Transferase
total genus 96
structure length 273
sequence length 278
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4adtA00
2W6RA 3ATZA 4QM1A 2GUUA 1TPC1 3T7VA 2QCFA 1OX6A 2NX3A 2ZRUA 3QPZA 4IMEA 3HGRA 1GT8A 2A7RA 4CCDA 3LHWA 3DBPA 3O06A 2C13A 1SW3A 4UFKA 2ZA2A 4JTKA 3TSBA 2FB3A 1G6CA 3DFNA 1BTMA 3RMJA 1H7XA 5LSMA 4LRSA 3OVPA 2NXGA 3P61A 4JD4A 3VCRA 1I2NA 2H6RA 3W7RA 1VLIA 5HMSA 1YXDA 1HO4A 4DELA 1XXXA 5CKSA 4O12A 1ZFJA 1B3OA 3CPRA 5D33A 3L21A 4IMCA 1MZHA 2QJHA 1M7PA 1RQBA 1VHCA 1JUEA 3FLUA 2GPTA 3NPVA 1VYRA 3NR0A 4FXRA 4I7WA 3NQ2A 4UFMA 2CLOA 5CZ0A 4HSOA 1A5SA 3B0VC 2DZPA 4OV4A 4K38A 5HR6A 1AK5A 1SR9A 1FCQA 3GK0A 2E77A 3W75A 1IXNA 3WJXA 1VYPX 4IQLA 2ZZ2A 1H7PA 1LRQA 1JULA 1H62A 1A5CA 2B4GA 1L9WA 3WJWA 2GOUA 5AYXA 2V81A 1K8XA 4FX8A 5T26A 5AC8A 4FEZA 1IXOA 4HNTA 1F7BA 1KFKA 3LTSA 3PS7A 2RH9A 4OQVA 4UTMA 3VI2A 3ABRA 4C1LA 4O13A 3CHVA 1WBJA 3BLIA 3STCA 1LZOA 4JS3A 3D0CA 1HL2A 1PS9A 2QDHA 1KM3A 1O94A 7TIMA 3AJXA 1Q3NA 3W7MA 4DF2A 2B7NA 1IXPA 2B7QA 4POCA 1YDVA 4Z1DA 3USBA 3W7QA 4S2CA 3ANYA 4O1CA 2QKFA 1S3HA 1VZWA 3QF0A 2YDAA 5TBOA 2V2CA 3S5OA 3B8DA 1QNVA 2C16A 3H55A 4P61A 4ZZ9A 4MY9A 2CZEA 1AL7A 2EGZA 4C1KA 3LHVA 3G1FA 1G4SA 4AHPA 3NG3A 3TE9A 4CNNA 3RF9A 3EB2A 2ZZ6A 2C15A 1G4TA 2PURA 2YW4A 3W23A 1YDNA 3SECA 2R94A 3VNDA 2QCEA 3PB2A 2E6FA 2Y7DA 3TMQA 3CC1A 2QUVA 4GUGA 3UNDA 1QMLA 3BG5A 3DFTA 1S5WA 4DF1A 1ME7A 3H53A 1P1XA 1SSDA 4YLWA 4E2BA 1PHWA 4M19A 5F4SA 1A50A 3TROA 5FEXA 3OBKA 1TO3A 2YFNA 2G96A 4HNVA 3IIVA 5G1YA 2X1SA 3N9SA 2A4AA 3THQA 5LGXA 3NQ7A 3TFCA 2I9EA 4IPJA 3HGSA 3G1AA 4K7VA 4O52A 4XBSA 4DF0A 1FDZA 1DBTA 4OGZA 1QO2A 4UTHA 5LNSA 3LCLA 2GJNA 1GVRA 4PA8A 3GB6A 3NAVA 2E5BA 4S2BA 3DGRA 4N02A 4MFDA 5DN1A 1TQXA 4OV9A 3GIYA 3PSWA 1X6UA 1ZAIA 4H4IA 4UTWC 3PVFA 4XQ6A 3P80A 1GYNA 1MEHA 2A1YA 2ISWA 4X2RA 3S1XA 1TV8A 3FA5A 1SFLA 5TQLA 1P5BA 5GVJA 1EP3A 4HT3A 2OMAA 4AB4A 1SUXA 1ZNNA 3LXCA 1T99A 4IUOA 4WQ6A 1KA9F 4UFLA 1F74A 1I2QA 4IGHA 3C2FA 4FB7A 4LS0A 1GVQA 2GQAA 3CM4A 2J27A 1T0OA 1SZEA 2A85A 4HPXA 5A5WA 4DO6A 1QPOA 4UTIA 3Q94A 3LCIA 1GOXA 2Y7GA 3SY5A 1QAPA 2WKJA 1AL8A 1S5TA 3DH7A 4FO4A 4LC6A 4NVTA 1H50A 3NQEA 3P82A 2NXHA 4WOQA 3MYOA 3A21A 2Q8LA 2E1DA 3NZ1A 4MY1A 4QSHA 4MYXA 3NQ6A 5TIMA 1KM2A 1YADA 4K6AA 4JEQA 3W7CA 2QF7A 1ADOA 6TIMA 2VFGA 3I7SA 4LU0A 4A3UA 5K9CA 1UUMA 3EWBX 3PBUA 2G95A 3HQ1A 3STEA 3TR2A 2V5BA 4AHOA 1KFLA 4QQ3A 3IIPA 3QJAA 1VJIA 2A2IA 1ZY9A 4O14A 2NXIA 1W5OA 1GVSA 3HG3A 4RXFA 1WAUA 2WJZA 2NX1A 4N9DA 4UMBA 3C52A 3BW3A 4GUJA 3GZ3A 3P8JA 3T78A 1ZALA 1FCUA 4KFOA 1ME9A 1H61A 3KRZA 5AHIA 2CZ5A 3SZ8A 4AWUA 4JIPA 4W9TA 1MEIA 5FF0A 3HG2A 2FDSA 1OFAA 3TNOA 3P5YA 1EP1A 3FIGA 1VH7A 4K39A 3DI1A 1YDOA 3N14A 3M6YA 2C6QA 1T96A 3SFKA 1OK6A 3HJZA 4Q33A 3P7YA 3MP3A 1IIHA 4FNUA 1GQNA 3L65A 4HKPA 3ELFA 3GYEA 3UWQA 2VC6A 4O18A 3FKRA 5K3VA 1U5JA 2P10A 3IV3A 3CTLA 3PG8A 3NQDA 5D2XA 1SSGA 3UWZA 4R34A 3NL3A 5FESA 4LUJA 3G3MA 3O8AA 2YW3A 3KVJA 2CW6A 2TPSA 2RDUA 1VHNA 3BLFA 4MKNA 4LW7A 2HSAA 5AHLA 2CFFA 4ZQOA 3IGXA 2O7QA 5G4EA 5HR7A 3G0SA 3O15A 3R5EA 3DENA 4ZMGA 2R8WA 3W85A 6ALDA 1XL9A 4FXSA 4B5NA 3FEMA 3KRSA 3C56A 3NM3A 3LM7A 4M6VA 5EKYA 1DKWA 5CPNA 3A23A 1DHPA 3M44A 2ISSA 4MY8A 5E0KA 1G7UA 1DV7A 5HJLA 1Q45A 3PWAA 3DFPA 4DEFA 2VEKA 3HF3A 1OFPA 5SWUA 2AGKA 3M5XA 1FUYA 1H7OA 5LHEA 1IIGA 3L5LA 3Q37A 1I4NA 2FTPA 2GVJA 3IVUA 4RK8A 4AEOA 5LGZA 1VCGA 1HFBA 3GDKA 4NZFA 1O60A 2VEPA 1QFEA 4ZQNA 5K9DA 3UPBA 3GKAA 5D2TA 4UC5A 1X8FA 2XN1A 3NPXA 2QCGA 1E51A 1XCFA 3B4UA 3DHFA 2QCNA 4ML9A 3C4UA 1W5QA 2AQWA 3TA6A 4LVGA 4K36A 1JCJA 4NXKA 3W74A 2YX0A 4PTNA 3L66A 4M7TA 5DCEA 5DLCA 3EXSA 3G22A 3W88A 4HN4A 4IPIA 3PUDA 3DFSA 3MI6A 3QFEA 5J5RA 2CLLA 3OA3A 1F76A 1TPWA 2Y7FA 3M5VA 1ZJIA 3CIXA 3LERA 3W1MA 1AG1O 5G4WA 2BTMA 3EX2A 4Q4KA 1TPEA 3L0NA 4NX5A 3ZS4A 1W5NA 1LOQA 4YXGA 3W2KA 1H1ZA 3CIWA 1QCWA 4UTWA 4N6EA 2C14A 3QMSA 3R89A 5MHBA 1XI3A 3P67A 1BWLA 3A9IA 4N6FA 2E68A 4AWSA 5AOUA 2B0MA 4QJ1A 4GC4A 3EX6A 3M43A 2ISVA 5AHNA 4Z1CA 1RQHA 4JTUA 3W87A 3WJZA 3L67A 5D37A 2C1HA 2Z6JA 1RZMA 3CT7A 3LGEA 2YFOA 4TR9A 3JR2A 4FX6M 4X22A 1OABA 3GDLA 3Q58A 1P0NA 3MI2A 4XUGA 1N8FA 3M1ZA 5BW6A 2HMCA 1GJPA 2CLKA 4ZQCA 1YPIA 3QW3A 2I14A 5D2YA 2VKZG 4JN6A 5C55A 3GLCA 1P0KA 1Q6RA 3GAKA 5K9XA 4O57A 3S5YA 4NQ1A 3P84A 3C2OA 4XKYB 5F4XA 2NX9A 4O50A 3ZR4A 2FLIA 1SO6A 3DKJA 1WXJA 4KFPA 4O4VA 3KHJA 5DXYA 2Q3OA 4JR5A 1TYGA 1D3GA 1EB3A 3NQCA 1K7EA 4O8RA 3TDFA 3C0JA 3FYPA 4WY0A 1I2RA 2ZRZA 1Z42A 1A5BA 1W31A 4IMFA 2I1OA 3E96A 2ZRXA 3RFAA 4Z0SA 4Y6GA 3L0GA 2RDWA 3WFAA 2X16A 1LBLA 1H7WA 1XDLA 2F84A 3EWZA 3A22A 2G97A 3OG3A 4NJKA 4LVDA 1TIMA 2OT0A 4I7UA 2J9XA 2VFEA 4WXZA 2FFCA 1VCVA 4UTLA 3S8HA 4DBDA 4O54A 1H1YA 1TMHA 4RCXA 3GNDA 2X2GA 1C8VA 4AMAA 1SU5A 4LVBA 1L2UA 3CEPA 4DO5A 2NUWA 3W84A 1LCOA 3C8FA 3LBMA 5LNVA 1EWEA 2WNNA 5AYZA 2DZTA 3HGOA 1TTIA 3N3MA 3LCXA 1F6PA 5HWJA 1NSJA 1SZGA 2JKPA 2CZFA 4GXMA 3MP4A 2QJGA 3LCGA 2RDTA 2RKXA 4RXGA 3B06A 4Z1AA 3DFOA 1W54A 5AFDA 3UWVA 3TUUA 1UASA 3W3OA 3QMRA 1U83A 3NQMA 3HOJA 1K03A 4HPJA 1FDYA 3W1QA 5IBXC 3W73A 1FCVA 3LTPA 1BWKA 1VYSX 5EY5A 3PY2A 3W1AA 3R12A 1ZCOA 3R2GA 4LY8A 3G8EA 2H3BA 4U4MA 1GG0A 3YPIA 2JK2A 1FWTA 5FF4A 3U8GA 5C54A 3W1LA 4A2RA 2OZ0A 4XTDA 3S1UA 5C5YA 2A7NA 4KKXA 1AMKA 4I7VA 4UR8A 3O07A 3FJ6A 3P62A 1FBAA 3TAOA 1LBMA 5D03A 3MYPA 1NF0A 1HO1A 5E1QA 3STFA 3NPWA 1ZAJA 1IF2A 5AN7A 4K7YA 4MIMA 1J4EA 2ZTJA 1XC4A 4N9BA 4NNBA 3C2RA 1JRBA 5BMXA 4XWUA 5KMYA 5AHEA 4MLRA 5DELA 3SGUA 2OJPA 3FS2A 3G24A 2VENA 2PE4A 3TC7A 1ICQA 2YGYA 2Y62A 3THAA 1K7FA 1OX4A 5FF7A 3W2JA 3STGA 3T40A 5KZDA 4J9JA 3W6YA 3LTYA 3B0UX 1VLWA 1UJPA 1OFOA 3PUEA 4KWVA 4O0ZA 4HNNA 2GVGA 3W1RA 1ZENA 1W5PA 3MUXA 3LB0A 1OYCA 3MO7A 4WX2A 4NUWA 5BRBA 4HNUA 4ZQRA 1TPVA 3OVQA 3G0XA 3EWYA 3EKZA 1QDSA 4CNOA 2CLIA 3FKKA 1WYIA 3INPA 3CWOX 2JGQA 2V30A 1TREA 4YCPA 3N34A 3G1VA 5D32A 2EKCA 3W2LA 4AHQA 1YYAA 3PSVA 2WNQA 4RLIA 4TX9A 4FNSA 3BO9A 3P60A 2ZDRA 4IWWA 2ZZ4A 4JIQA 3W2UA 5BOOA 3NGJA 2EF9A 1ICSA 5EA9A 1L6WA 2ZRYA 3ATYA 4NU7A 3KVLA 2ALDA 1IXQA 3HO8A 1R46A 3V1PA 3B03A 3VKJA 1NF7A 4ORMA 3B04A 3O6CA 4IOTA 2NLIA 4IX2A 4N2YA 2ZCGA 3WK0A 3N2MA 1TPB1 1YXCA 2W0UA 2PRMA 4D2JA 1W56A 3UD6A 2PCQA 1NVMA 1K7XA 2H3DA 3GXTA 1SO4A 5LHFA 3QRHA 2P0OA 1DQWA 3O1NA 5I3FA 2C18A 1TQJA 4UTTC 5D2VA 3EEGA 3PC0A 3W7DA 1I45A 1EEPA 1Z48A 3MW7A 3JRKA 1OFEA 2VELA 4NJIA 4HIBA 2ZA3A 4AF0A 3NO5A 4TMCA 3G1HA 4O15A 4UIOA 2Y89A 4GFSA 4H3DA 5FF2A 3PG9A 3W1PA 1W3TA 3L68A 3MWAA 4UTJA 5I3JA 3LHYA 3KXQA 5F4WA 2YYTA 4PCFA 4LV4A 2A21A 3TCEA 4BK9A 3GDTA 4HSNA 4NXSA 4BR1A 3IIOA 1XUZA 1EX5A 4BWLC 3C2VA 1D3HA 1K3UA 3QM3A 2VFHA 5U7SA 2WSYA 4JTGA 3M16A 5CSSA 3HPXA 2LLEA 4QNEA 4JTSA 3UXDA 1QOPA 2HS6A 2QJIA 3NXFA 2V82A 3GR7A 3DI0A 4FNQA 5HWMA 3HG5A 4ADSA 4BI5A 4K37A 1XFBA 2PC4A 3G1SA 4UFIA 5KINA 4XTIA 4K8HA 4KFNA 2BXVA 1WOAA 1QPRA 2V9DA 3TW7A 2ZQ0A 4QAIA 1FWWA 3OVRA 3CU2A 2X1TA 2A6LA 1OF6A 4RV8A 4WY0B 1AW1A 5F2GA 1H7RA 4EVZA 3HIJA 4BI6A 4O4WA 2ZTKA 1KFCA 2FPVA 2DORA 3KFTA 3M9YA 4RKAA 1X1OA 2TYSA 5HUPA 1R30A 5F2MA 2OCZA 3S0CA 5ABTA 3NL5A 1SZNA 3L0KA 2EPHA 5G5IA 3E49A 2WPBA 3W86A 1F2JA 5LKYA 4X3ZA 1PIIA 2Y70A 3S9YA 3MBDA 4CCEA 4AH7A 5AB3A 5I3HA 4R53A 4O10A 3W7IA 1RPXA 1KV8A 4MYAA 4DBEA 4GNJA 4ONVA 5G2HA 1TTQA 5EYWA 4NJGA 3TFXA 3QEZA 3EWXA 1DJQA 4GUIA 1LYXA 3I65A 4LRTA 3TXVA 2DZXA 1PHQA 2QCDA 3DU0A 1QR7A 5IBXA 1I2OA 3G1DA 1KTNA 1H5YA 2J88A 3QSTA 2JBMA 3S6DA 1LBFA 5DY3A 2GJLA 2QCCA 3UWWA 2WSQA 3GAYA 2Q8ZA 2A7PA 4JTEA 1SPQA 3DXIA 1Y0EA 4PEKA 1WA3A 3LLDA 1KBJA 1G7VA 2ABBA 2Y7EA 3HB9A 1J5TA 1DORA 2Z2UA 4UCGA 2TSYA 1W0MA 4XZ9A 2A6NA 3W1TA 1BEUA 3BW2A 3KVKA 4JYDA 1M5WA 2PRLA 5HNRA 4IXHA 1EWDA 4N9EA 4BFAA 2X30A 3QPYA 3ABQA 3CB8A 3SI9A 1TV7A 5BMWA 3NOEA 2V2DA 3CWNA 2YYUA 1WOBA 2WNZA 3E02A 3L9CA 3MI3A 4JX4A 4GJ1A 4Y90A 2AAMA 2NZLA 2YSWA 3T4CA 4OBTA 2E09A 5AC6A 1OFDA 2Q3RA 3Q2DA 5DCBA 1VS1A 2Z6IA 1H51A 1DQXA 5K4XA 4OE7A 4FHAA 2QCMA 1SW0A 5IM51 1TPFA 5HUOA 1TTJA 1HTIA 4WOZA 1YLVA 2R91A 3HMJG 3G3DA 2JKEA 4MUZA 5D38A 1AW5A 1OX4B 3P5ZA 3VE9A 5DCDA 3PF3A 5L6UA 4P2VA 2H90A 1GG1A 1YTKA 5FEPA 3LXBA 4M6PA 1VRDA 3FFSA 1W1ZA 1VQTA 1WX0A 4LS1A 4DQWA 1O5XA 3K30A 3W7LA 1GVFA 1G4EA 4CNPA 1HG3A 4AXKA 1FWNA 4E38A 4Z1BA 1TCDA 3LXAA 4YL2A 4MOZA 1TRDA 1TPUA 3LV6A 3W7JA 4OT7A 1NAL1 1DL3A 3W1UA 3EXRA 1M7OA 1X1ZA 2Y63A 2JGYA 3E12A 3KVMA 5KZMA 4NX0A 3GNNA 4UTUA 3MMTA 4ZL1A 4ADTA 5CPOA 1JQVA 3NQAA 4HHPA 1GTHA 4JY8A 3VE7A 1P4CA 5AHFA 2YR1A 4UTTA 3F1QA 1WQ5A 1FXPA 5F1VA 1PE1A 4H6KA 3LCHA 3TXZA 1YTDA 3OIXA 1IGSA 4QNWA 4OWGA 4YMZA 4UMAA 4JTTA 1H7NA 1JVNA 1LTDA 4JDYA 1JCMP 1KV5A 3WK2A 2C0AA 3GX9A 2BWGA 1LP6A 3NQFA 4IMDA 2VFFA 3L5AA 4NNCA 2E5DA 4M7SA 2BLEA 2HS8A 1VGAA 3LHZA 1TJPA 1W8SA 1LOLA 3S1VA 1F5ZA 1NFBA 1QPNA 1OJXA 1LLWA 4PL1A 1RD5A 2GQ8A 3NM1A 5F1UA 1OYAA 3CLMA 4AF0B 4JDBA 5KTLA 4BWLA 1JUKA 1QWGA 3RK8A 2V2HA 3IVTA 1KW1A 1FWSA 3LLFA 5I3IA 3HPSA 1LRNA 3M0ZA 4AVFA 3W7PA 3LI1A 2DU2A 3E0IA 3LI0A 2FJKA 4E2DA 2DZWA 3NDOA 3NYZA 3DFQA 4LVFA 2IQTA 3M5YA 3W07A 5AHMA 4MJZA 3PAJA 3EX3A 2CLMA 3MBFA 2E5CA 4WUIA 4PH6A 3PBYA 4MFEA 2WO5A 1W5MA 1T8XA 3TMLA 1MXSA 1W3NA 4EOUA 4I9AA 1TSIA 3ZFHA 4RJEA 4MVAA 1GZGA 4Q32A 3G1YA 3L5MA 5G2WA 4FX7A 2BX7A 3TQKA 3TIMA 2B7PA 1PV8A 4O1AA 5FEZA 3GDMA 4AWTA 3MHFA 1G4PA 1AW2A 1A5AA 3IEBA 3PB0A 1I8JA 4ALDA 3BGGA 4LV9A 4N4QA 1B4KA 5HINA 4RZ5A 2P1FA 5I3GA 1XKYA 4A22A 3LRKA 3IGUA 3PBWA 4A29A 2YZRA 3N19B 4O11A 5FF3A 2Z0IA 2QR6A 1R2SA 1YXYA 1TRIA 1MEWA 1RVGA 4QITA 4CQAA 3UZJA 1G67A 2NUYA 3EX4A 2ZZ1A 4QIUA 1JRCA 3W1XA 3N9RA 4LUIA 4Z0JA 3QW4B 3NL6A 1ONRA 3FYOA 3C3NA 2FQIA 2J9ZA 3BLEA 1JUBA 3UQNA 2YCEA 2WV8A 1DJNA 2QCDB 3BARA 1FX6A 3U2OA 1GPWA 4YCOA 3T55A 4R33A 4DPPA 1N55A 2H8ZA 4JX6A 4CQ8A 2WSRA 1V7YA 5D09A 1UCWA 3IRDA 5DY2A 1ZHAA 3LOTA 2CZDA 3EWWA 3GR8A 1TB3A 3BW4A 2VFDA 1KLYA 4PC8A 3R13A 3BV4A 1Z41A 1EPXA 3C61A 1SZFA 3TU9A 3TQVA 3C2EA 5CPLA 2OX1A 4TMBA 4PL2A 1XBXA 4GRSA 3UPWA 1R47A 2VXNA 1XBZA 2YPIA 3IGSA 4FF7A 1JCNA 4Y8FA 3W70A 4JNMA 1KFJA 1N7KA 3LBCA 4ADUA 2DZSA 3W7EA 3BK0A 4RZ6A 3W71A 5CG7A 4O1BA 3NVTA 1L6SA 4MZ1A 2JKAA 3R8RA 5D05A 4NJJA 3AO0A 1FQ0A 4JYEA 2ZRWA 1KBIA 2BZNA 5G2IA 4YWIA 1TJRA 4WJEA 3M7WA 1XBVA 4O1DA 3GXNA 2Z1BA 3W83A 5DBTA 4EF8A 2QUUA 4NT0A 3DHDA 2G5WA 5D04C 5AYYA 3FJLA 3M5ZA 3UYCA 5K4ZA 3KOFA 3QC3A 1W37A 1EUAA 1ME8A 5KITA 3BVJA 3G1XA 3JS3A 3MHGA 3U6WA 4O0KA 1RV8A 3I6RA 3V75A 3G0UA 4KWWA 4WD0A 4MZ8A 1C29A 2O7SA 1VPXA 1KFEA 2BSLA 5EL1A 3TC6A 3BPWA 2OT1A 5H2ZA 2CWNA 4OU1A 1KFBA 1CX9A 2DZUA 4TU1A 1XBYA 3LHUA 1LDCA 2E6DA 3OHIA 3RLUA 2FPTA 4RX0A 3I7QA 1VCFA 2HTMA 4QISA 3PR2A 1SO3A 3ABSA 1VR6A 4RZ4A 4G1KA 4XBKA 5FI8A 5KSWA 4M6QA 1BKSA 2ZRVA 2DJLA 3DZ1A 4IXXA 2E6YA 4ZVJA 4GUHA 2YXGA 1KLZA 2DP3A 4LS2A 4CQ9A 1OG0A 1UB3A 3SSJA 3LCWA 1I2PA 3S42A 4RR4A 1FY6A 4UNKA 5CPMA 4O17A 1OF8A 4JY9A 4AAJA 4NZJA 4LVAA 1QOQA 1DOSA 4O19A 1PL9A 4E0CA 2RHGA 1LRTA 3TW6A 3I68A 2F7FA 3PM6A 3NQ8A 3P81A 1UUOA 2ATMA 2ZZ5A 2ABAA 1JJKA 3NL2A 4O53A 1K8ZA 4UUIA 4IJBA 1YTEA 1OFBA 5U4NA 3LRLA 3TX9A 5CZJA 3WJYA 3W1NA 2QAFA 3OEXA 4UNLA 2V5LA 2J6XA 3QMTA 3UWYA 1B4EA 3O16A 3TAKA 2W79A 3KRUA 3G18A 1GWJA 3G8RA 1B9BA 3QH2A 4FIRA 3WK3A 2PRHA 2VOMA 4XKYA 3MP5A 1JQXA 4MJMA 1OK4A 3KAOA 3P8IA 2ZZ7A 4MPQA 4GE8A 3NNTA 3NQGA 1L6YA 1H63A 2XN2A 3B05A 4JTLA 4LT9A 1C9DA 4UXDA 4O28A 3O6YX 1WV2A 1JCXA 1W3IA 3BGJA 5LNUA 2WOQA 2XN0A 1LM1A 3W76A 2KZHA 3H54A 3BG9A 2ZBTA 3QYQA 4MZYA 3FOKA 3A24A 1G69A 1H60A 3HPZA 4JGDA 5DXXA 3HGJA 4JYFA 1KM4A 1M6JA 5C6MA 4IMGA 3LDVA 3IIZA 2D73A 1HUVA 4BI7A 4FNRA 3S1WA 4UFJA 2A0NA 4R7JA 3F03K 3DAQA 3SJ3A 5AC7A 5G1TA 3PUOA 1EP2A 4S1FA 5DBUA 3LCFA 3O63A 3UWUA 3GKFA 3WJSA 2WQPA 4OHQA 2V0TA 3UXAA 2XFWA 1XDMA 2EHHA 3W7NA 2NUXA 3SIZA 4N9CA 4WY0F 3UZ5A 1MSSA 1GYLA 3L2IA 5C2XA 3O6DA 4PFMA 4ICNA 1GEQA 5LNRA 4CLMA 4LWWA 3HBLA 1LORA 4UFHA 3EWUA 1EIXA 3LX9A 1RQEA 3IIXA 4Z08A 3CQ0A 1SO5A 1OYBA 2H8XA 2NWRA 4EIVA 5L9FA 3RLVA 3GDRA 1Z44A 5J5DA 5CSRA 1F05A 1CW2A 1KM0A 1GTEA 2VFIA 1TTPA 5A8GA 4ZQMA 4WZHA 1F6KA 5BNKA 1JCYA 3NA8A 1SFJA 3S5NA 4TIMA 4FNPA 4NJHA 3TJLA 3W72A 1VC4A 8TIMA 1KTBA 2DJXA 4LOCA 1J2WA 1S5VA 5HULA 4NNAA 1NEYA 3ZWSA 3W7HA 3SGZA 1EUNA 2ZZ3A 3IVSA 4GUFA 4N4PA 2Y6ZA 1TPDA 3N73A 4K8EA 3ZWTA 1PCKA 4JXCA 3W7KA 2CU0A 5CZTA 2QEZA 4U28A 4O16A 4EWND 1OFRA 5KZEA 3W22A 1FCBA 4WXYA 3N2XA 3RU6A 2QUTA 2E6AA 2FPYA 1O4UA 1JR1A 3QQ0A 2FIQA 2QCLA 2GVLA 1LOSA 2NWSA 1GVOA 2C19A 1K02A 1PCWA 2A5HA 2R14A 4DXVA 1ML1A 3UY8A 2ZFAA 3UY7A 5FEWA 3A5FA 3TK7A 4IX0A 1XM3A 4MLJA 5HWNA 1K8YA 4DO4A 4FIQA 4LNYA 2Y85A 3W7OA 4JTJA 1X7FA 3TSMA 1KM6A 3GXPA 2V8ZA 4A21A 3TKFA 4JX5A 1OX5A 1WDWA 4L4LA 3RNDA 3F4NA 4M5PA 1D9EA 3F4WA 2QCHA 3T44A 3MJYA 1FWRA 3C6CA 1TPH1 2ZA1A 5E93A 2ATSA 1Q6QA 3EX1A 3M41A 1OFQA 1FXQA 3W9ZA 2TRSA 3WK1A 4TO8A 2B7OA 1ICPA 3LV5A 4JTIA 4A2SA 5D2WA 4JTFA 1KM1A 2CLHA 2QAPA 3SW6A 1DVJA 3PBVA 5H91A 3TSDA 2Y61A 5EBUA 4GWEA 1LLZA 5D02A 5LZLA 4PODA 4UMCA 3DKLA 3W7GA 1CI1A 1PVNA 3EXTA 3P74A 3TH6A 3TJXA 4UTKA 5CZSA 5F2LA 2GQ9A 3NEVA 5EMUA 1XUUA 3EKLA 1WBHA 3W2NA 5HQEA 3LHTA 3HG4A 1B57A 2DZVA 3LRMA 4X9SA 3M47A 1MO0A 2J24A 5I3KA 1RR2A 3KX6A 3S5ZA 3B0PA 3VFLA 1ALDA 1EA0A 2TMDA 1THFD 1QO5A 4L4MA 4JICA 5K7JA 2X1UA 1Q6OA 2CLEA 1TV5A 3NPUA 5D30A 4FNTA 3I7RA 3A5VA 1UBSA 2QDGA 3TV8A 2UV8G 4DPQA 2VEMA 4JTHA 1Q6LA 2Y88A 4LC8A 3MHUA 1QPQA 1KM5A 4Y9AA 1V5XA 1FDJA 1KTCA 4Y96A 3NZRA 1OVDA 4EF9A 1LROA 3QZEA 3NQVA 2X1RA 2RFGA 1JCLA 3E9AA 3TQ0A 1OHLA 2NV2A 3GVGA 1R2RA 3W2MA 2J9YA 3BG3A 5EPDA 3O05A 4CCCA 1R2TA 1SQ7A 5K2ZA 2ZYFA 3ABOA 1YPFA 4ZQPA 3CEUA 4BF9A 1ZAHA 1A53A 5LNWA 2CLFA 2EAWA 1SW7A 2VEIA 3PULA 4GBUA 3QSRA 3SR7A 4ORIA 4LTSA 1O5KA 1O95A 2C3ZA 2FB2A 4UR7A 5F2IA 3QQ1A 1F73A 2NV1A 5CGQA
chains in the Genus database with same CATH superfamily
2F6KA 1XYCA 2W6RA 3W82A 4H8VA 1TPC1 5CZKA 4KCTA 4GGHA 1QNOA 3FYYA 3QPZA 3CV6A 4CCDA 3DBPA 4O8AA 4UFKA 2ZX9A 1NQ6A 1G6CA 1PYFA 1Y65A 3CZEA 3DFNA 3XIMA 3KOXA 4HSHA 2NQJA 1US3A 3VD9A 2V63A 2H6RA 2PA6A 1ELSA 3AMDA 2YXOA 5HMSA 2REQB 1YXDA 4ZO7A 3AAMA 1XXXA 5CKSA 1Z89A 3CK5A 4O12A 2FDMA 2VL4A 2WZEA 1B3OA 3CPRA 3L21A 2TODA 3RIKA 2QJHA 1M7PA 1VHCA 3ALGA 2OO0A 5LIKX 3NPVA 4FXRA 3WIJA 5I24A 4JIRA 3EB3A 2CLOA 4FOKA 1XP3A 4PUWA 3B0VC 3WDHA 2QIWA 1UKPA 4DZIA 1YNQA 2GLKA 3BOLA 2Z2AA 1ZSXA 5CSUA 3W75A 3WJXA 4IQLA 1H62A 1KCKA 4WSKA 3WQDA 3CZ8A 2B4GA 1L9WA 5A69A 2OLSA 5AYXA 2V81A 2X0YA 4FEZA 2DY3A 2ZVRA 3LTSA 3PS7A 5LIYX 4FOUA 3WD4A 3ABRA 5HDRA 2XFRA 3MA8A 1XWYA 4LX4A 2PWDA 2ISFA 4DX3A 3TNBA 3D0CA 4RPQA 2QDHA 1O94A 1Q3NA 2B7NA 1IXPA 5CLTA 1YDVA 5I79A 4GH3A 4GVGA 1GK8A 3WNOA 3CUJA 1FRBA 3QF0A 2V2CA 3S5OA 1Q4NX 4L56A 4ZZ9A 4MY9A 2WVTA 3DG6A 3PZMA 4R85A 4AHPA 1U22A 3U57A 3TE9A 1OC7A 3H24A 3GTNA 1G4TA 2VX5A 1GNXA 2YW4A 1BPLB 2MANA 3SECA 3N4FA 1XDJA 4YNGA 2QUVA 3BG5A 1XLJA 2OQLA 3DFTA 4DF1A 3S9ZA 2FHFA 4C6JA 3LGGA 4F0LA 4NZCA 4E2BA 2R6OA 1PHWA 4M19A 5FEXA 3OBKA 2YFNA 1GOWA 4HNVA 3Q67A 2W66A 1A4MA 3WENA 3G77A 2JEQA 2Z7KA 3U5UA 1FWJC 3HGSA 4K7VA 3SO7A 4DF0A 3DC0A 1DJIA 4GZJA 5LNSA 2GJNA 3EAUA 3SCQA 3MV11 2VUNA 3W25A 4S2BA 1EJ7L 5DN1A 6PTDA 4NAFA 6XIAA 1WPCA 4OV9A 4Y9NA 5CPSA 1CCWB 1ZAIA 3P80A 1MEHA 1EZ2A 2ISWA 4X2RA 1TV8A 4PMJA 5TQLA 2FMOA 4AB4A 1UWRA 4LBUA 4AISA 2VD8A 3KOZA 5AY7A 3LXCA 4W8LA 4WQ6A 2VX4A 2HWGA 2FH6A 3MMWA 1SYTA 2J7DA 2GQAA 2J27A 1SZEA 2NT0A 1F07A 4QFUA 4UTIA 3LCIA 4QEHA 1GOXA 3UETA 3VMNA 3DH7A 4NVTA 1C91A 3NQEA 3VIPA 1HP4A 1ESWA 3QV7A 3NQ6A 5TIMA 2JE8A 4L6HA 1YADA 1S3TC 3ZR5A 4XX6A 4B9ZA 4MSSA 1J18A 9XIAA 2ZE3A 4H7ZA 4S3FA 4AY7A 6A3HA 1SJCA 3I7SA 4LU0A 4A3UA 1UUMA 3F2BA 2A3EA 3LEPA 2G95A 2V5BA 4AHOA 4QQ3A 3VIJA 1VJIA 4B16A 2A2IA 1NWTA 4HPNA 1W9UA 2HCVA 1ZY9A 4O14A 4TV5A 5XINA 1HQTA 3W6MA 3C52A 4GUJA 3T78A 4JQAA 4K2SA 4S3BA 4EWJA 1VBUA 4AWUA 1M7XA 1ISWA 4W9TA 3N9KA 3GVRA 4BJHA 3P5YA 1EP1A 1AH0A 1PIGA 2BXZA 1ISXA 1YDOA 1XYAA 3FHAA 4LF2A 2YDRA 1RJPA 3SFKA 2GSHA 2AL2A 5REQB 3MP3A 3ABXA 3L65A 4S3KA 1ZRQA 3G6MA 3E1F1 3KOYA 3GSMA 4IIBA 5CJNA 2P10A 3T6CA 3CTLA 5D2XA 2QJMA 5FESA 3K8KA 3ARYA 3G3MA 3O8AA 1R85A 2YW3A 3H12A 4PRWA 2TPSA 4D6EA 4P7NA 1DP0A 1QU4A 1S2UA 1UMLA 4LEQA 2Y5JA 1E3XA 2VTFA 1US0A 3AIUA 4B5VA 3B8TA 1M9HA 2VNCA 4ZQOA 3IGXA 2O7QA 3AALA 4GQRA 5G4EA 4GPNA 4L4OA 4AZCB 1PZ2A 3G0SA 5CSYA 3WQFA 1EOMA 3JZUA 3W85A 3KRSA 2WM1A 3C56A 3SADA 3NM3A 4M6VA 1REQA 5EKYA 3CGTA 4MY8A 2HPIA 1V6TA 5SWUA 4U3AA 4IG2A 3M5XA 3JW7A 1FUYA 3DFHA 3PZNA 4WJ8A 2PODA 1I4NA 1VFHA 2FTPA 3T9PA 1PKMA 1CLXA 2FFIA 2GVJA 1BAGA 1VCGA 3POHA 2WKLA 1HFBA 2J66A 2JALA 3UA4A 1TJ0A 3UPBA 2XIJA 3EPOA 1X8FA 2ODOA 4J3TA 1XCFA 2WVSA 3WF1A 4XBJA 3UCDA 3KL3A 2QCNA 4ML9A 4K8GA 1EJSC 3SBFA 4K36A 2I16A 4F0RA 1H11A 3W74A 3CJPA 2PCEA 4PTNA 3KCJA 2BHZA 3QFWA 3OLDA 4JTQA 3VX1A 5JU6A 1VPYA 3MI6A 5J5RA 3F2DA 4FALA 3OA3A 4PULA 3CIXA 3SEPA 3L0NA 1PYMA 3ZS4A 4NHVA 3M64A 2IMRA 1D8WA 4YXGA 3W2KA 1GKRA 4W5UA 1H1ZA 1QCWA 1ISVA 1X6NA 2F9RA 2F38A 3QMSA 2J8TA 1XI3A 4N6FA 5AOUA 1OD0A 4HQVA 1LWJA 3VD4A 4JTUA 4OOZA 3JU2A 5D37A 3FA3A 4TX6A 2ON3A 3UG8A 4DJED 1VBHA 1IHIA 2YFOA 4TR9A 2PDMA 4FX6M 3GDLA 2PDHA 2XJ7A 4M82A 3MI2A 3TTQA 3M1ZA 1GJPA 5D2YA 4GQGA 2G4FA 1P0KA 1JL8A 5K9XA 4NQ1A 1XW8A 2VURA 3IK4A 3SN4A 3M0HA 4KBXA 4XKYB 1J96A 2NX9A 3BICA 1XH1A 2FLIA 4UNIA 2CPUA 1WXJA 5BCAA 2G3JA 1EQCA 1RK5A 3I10A 2XH7A 4KEVA 4U2ZA 2Q3OA 5AYBA 5FJJA 3VIFA 2WXDM 3IV8A 4KPLA 3WMBA 1O68A 4GI4A 2O4QA 1W31A 3E96A 3VDCA 2RDWA 3CYVA 1B3XA 1H7WA 1LBLA 4GC3A 3A22A 3N6HA 4ES4A 1RHCA 3TW9A 3URBA 4YTQA 3EBVA 3SIMA 2J9XA 3WMCA 1HJXA 2E4TA 4UTLA 4DBDA 4P8XA 2V3DA 5T9CE 4AMAA 3KBSA 4KEMA 3B40A 1PX4A 2WNWA 4NKCA 1QNQA 1L2UA 3CL6A 5BXPA 2V5JA 4LUSB 5H6HA 3UXLA 4JFTA 3UJ2A 2NUWA 4DAFA 4PTXA 3W84A 1LCOA 3ZJKA 1UHVA 3LBMA 5LNVA 2WNNA 4CN4A 5CPTA 3TLLA 3VILA 2CZFA 1OEPA 5C9ZA 2CKSA 3HV9A 4CN1A 4RXGA 2RKXA 3B06A 1TV2A 4PCTA 4I5XA 4XG1A 4RE4A 3VK5A 4HYWA 4NF7A 5IBXC 3Q4DA 3II1A 3W73A 4Q4MA 1FCVA 4Q8OA 4MDOA 3GXMA 3PY2A 5EU9A 3R12A 3VPLA 1ZCOA 3BZGA 3G8EA 1AJZA 2VEFA 5DMMA 2JK2A 1NOFA 1FWTA 5C54A 4GLEA 3IJLA 1XD0A 3AICA 2OZ0A 2WZHA 3S1UA 2FYMA 3N4AA 4JFUA 1AMKA 3O07A 4E4PA 1NFPA 3P62A 1F8IA 4FS9A 4JQ3A 1C9WA 4WIWA 3W38A 1NF0A 3STFA 4AW7A 1ZAJA 3BGAA 3SUSA 2VGBA 1F3EA 1FTXA 1J79A 4BY3A 2OJPA 3G24A 4ZO9A 3TC7A 3MZ2A 3GHUA 4NAEA 1WUFA 4HMDA 1GHSA 3W2JA 3M0JA 1OC6A 2INFA 4QCFA 1UJPA 2E28A 1VEOA 3MZNA 3MO7A 4HNUA 4ZQRA 3BJSA 3OVQA 2P8CA 1E1CA 1QDSA 4CNOA 2RGMA 4JKKA 3INPA 2JGQA 1W91A 3THUA 4YCPA 3GHSA 1S2WA 2Y0FA 3P14A 4L6DA 1FWFC 3PSVA 4IFKB 2WNQA 3BO9A 4RPPA 1Y8BA 5ABFA 2ZDRA 4IWWA 2ZZ4A 1JXJA 3W2UA 5EA9A 1XYMA 1Q7ZA 1DQUA 1PDYA 4NU7A 3NURA 3LUTA 1SZRA 3V1PA 5A8OA 1OT1A 4ORMA 3WK0A 1YXCA 2W0UA 1BD0A 1W9BM 3CUGA 4BQ4A 4UZUA 1VEPA 5DEZA 1DQWA 3FSUA 4LYKA 2P3EA 4EP8C 2GOKA 3DX5A 4QLJA 5EMKA 3AMKA 1GOOA 3U0HA 4AF0A 3NO5A 1MQRA 4TMCA 3G1HA 4O15A 3VIGA 4LCQA 2Y89A 1Q2SA 3W1PA 5GQBA 1TZZA 4JTCA 1YX1A 4IUGA 4L65A 4UTJA 3KXQA 3R1ZA 4AUBA 2BMBA 4DN1A 3TCEA 2YXXA 4MPKA 1F3WA 2QGYA 1K3UA 3QM3A 2VFHA 3WZ0E 2INEA 4HK6A 1GHRA 2FGZA 3UXDA 3R0UA 4QDMA 1QOPA 1FVPA 2HS6A 1VBJA 3GR7A 2HV5A 4EXAA 5TD4A 2ZX5A 3HG5A 4ADSA 1WZKA 1Y5VA 4B4HA 1HL8A 1LG2A 3HURA 2BXVA 3PANA 3QR3A 1TJ2A 4QAIA 3OVRA 2GSEA 1R9XA 1OF6A 3M07A 3EDFA 3VM5A 2OZ8A 4RV8A 4AD5A 2J78A 4UQBA 5F2GA 2OWXA 3S9IA 2PD5A 3M9YA 3N13A 4RKAA 4DZAA 4IIGA 5HUPA 2DT1A 3NL5A 1K4GA 1YKWA 4R9OA 5G5IA 4GJJA 4XO6A 4XB3A 4KS0A 1FH8A 2PDJA 2QZRA 2Y70A 3S9YA 4AH7A 2BY2A 3R0KA 4ONVA 1UD5A 5BXRA 4ZBCA 2XVLA 3W00A 3EWXA 1E0WA 1DJQA 1V8EA 3QR1A 4GUIA 3BZJA 2DZXA 2VZUA 4L5ZA 1QR7A 5IBXA 1I2OA 1MRAA 1KTNA 1H5YA 1WCGA 2J88A 3MUZ1 3IJQA 3S6DA 5DY3A 2GJLA 4LYPA 2WSQA 3T0BA 4Z2IA 2X41A 1SPQA 3DXIA 1K4HA 1WA3A 1G7VA 3H7VA 1LL7A 1J5TA 2TSYA 3APTA 1W0MA 4XZ9A 1BEUA 1BQCA 4O1EA 4ROPA 1CPUA 5T9BG 3H2EA 3ISIX 5HNRA 1EWDA 4N9EA 3UZZA 1BG4A 3ABQA 3LLXA 4DAIA 3SI9A 4D71A 3CWNA 3LQGA 3FCPA 2HK1A 1A0DA 4QJ5B 3L9CA 4L6OA 3KLKA 1TZ7A 4PEEA 5AC6A 3CQKA 2I17A 1FWDC 5JMUA 4OE7A 3V0TA 4KWUA 3ITTA 1H2JA 1G9HA 4W7VA 2WMFA 1HTIA 2R91A 4H6RA 2JKEA 1GQJA 5D38A 4D8AA 1V6YA 1AW5A 1OX4B 4GMEA 4MM1A 1XLDA 1NDVA 5L6UA 3CASA 2H90A 4JN7A 3IRSA 2XUCA 1EKOA 1EF2A 2QUNA 3W7LA 4H2CA 3WD2A 1GVFA 1HG3A 1AQHA 4E38A 4JL1A 4NG3A 4MOZA 1TRDA 4JOMA 2V69A 1KNWA 1DJZA 2JGYA 2XFYA 5KZMA 4W5ZA 3MMTA 4ADTA 4XIAA 5C9UA 3NQAA 4HHPA 1ZLPA 4JY8A 3VE7A 4C6DA 1WQ5A 3QY7A 1JZ6A 4H6KA 3LCHA 3CUIA 2C7FA 1O1HA 3HQPA 8XIMA 4IQDA 4JCMA 3M46A 4V2XA 4OWGA 4LUTA 3ITXA 1JVNA 4TUFA 2C0AA 3PBMA 3UG4A 1DWAM 4L1WA 3AXIA 3H4WA 1I9CB 1WXYA 1LOLA 1E6PA 1RCOB 4C1NB 1J11A 1QPNA 4RE2A 4JHOA 1PUDA 4PCSA 1RD5A 4PL1A 2GQ8A 5HQLA 1UIOA 4I3GA 1EEXA 4JDBA 3PWIA 3F5JA 5KTLA 2VR2A 3ZR6A 3OZPA 3FJNA 3RK8A 4LAZA 1FWSA 4W89A 1E6ZA 1W1YA 3M0ZA 5CH9A 1JCTA 3LI1A 6XIMA 3G5EA 4E2DA 2VR5A 2XGZA 3BXWA 4GZ7A 1K77A 3NDOA 1HGWA 3DFQA 2WVVA 3KWSA 4GYPC 5AHMA 4MJZA 4E3TA 1J8VA 4QG9A 4DHGA 3NO1A 4K68A 2E5CA 4PH6A 2WO5A 3REQB 5M2FX 1BYCA 1DE5A 1T8XA 3CNYA 1W3NA 4I9AA 4C6PA 1V0MA 3UF9A 4EACA 2WJDA 4MVAA 3WEOA 3EMCA 3G1YA 1MI3A 3IAQA 4ACYA 1NOWA 1XJBA 4XUYA 3PTKA 3SCSA 3TIMA 5JBDA 4AWTA 1G4PA 4G9PA 3IEBA 3U7BA 2IPJA 1EHNA 4LV9A 4RZ5A 1DIOA 3QBUA 5I3GA 3LRKA 3IGUA 1SJBA 2YZRA 1KWKA 4O11A 5FF3A 2YBUA 4EAMA 1R2SA 2EQDA 1YXYA 1TRIA 1MEWA 1RVGA 1GUVA 3WFLA 1LQ0A 2BY0A 3GTFA 3HQOA 4XD3A 4V15A 2EO7A 4QIUA 3B0XA 3QW4B 3NL6A 4W87A 3C3NA 2ZOXA 1A49A 3BLEA 5AVHA 3VOIA 1LWHA 5GJPA 4B5WA 3S4TA 3BARA 1FX6A 1VFOA 2QT3A 5E0CA 5HJYA 1N55A 3IUIA 3IGHX 1GPFA 4JX6A 3MDUA 2WSRA 2ZX6A 2PGWA 3CHEA 2PMQA 1FWHC 1EXBA 3MANA 3CIVA 3GR8A 4CU7A 1Q85A 1KLYA 5C7VA 3ZLGA 1B0IA 3AIRA 3SUVA 1JAEA 3GG1A 5A6JA 1WE5A 3GFZA 1KXHA 2POZA 2Q8XA 1RP8A 2V3GA 2VXNA 1XBZA 4GQBA 1VB9A 1ONEA 3WD0A 2CXEA 4FF7A 3L2MA 1KFJA 2PWHA 2PTZA 3L4VA 2HPMA 1V6XA 3ZT5A 4WK9A 4AZBA 2G3MA 2J62A 4GY1A 2VHLA 3AWOA 3PJUA 2OSYA 3GFYA 3TCSA 2JKAA 1F3TA 3VINA 3R8RA 5ABEA 5AZ1A 1FQ0A 4YWIA 1N8IA 3VIIA 1RA5A 3AISA 1XBVA 3M7WA 2VMFA 3WLPA 5AYIA 5FAJA 5JBEA 2G5WA 1AVAA 2DH3A 5AYYA 2C0HA 3SRHA 1G1YA 3FJLA 1NIUA 3KOFA 2CEQA 5IDIA 1EUAA 4J4KA 3PPCA 4GABA 5FJOA 3MHGA 3SB0A 4GVIA 3G0UA 3N1AA 3GU2A 1WKDA 4WD0A 1C29A 2O7SA 1KFEA 2BSLA 2GZXA 5EL1A 4XAPA 1E4MM 4ROQA 1KFBA 3VD5A 1JDAA 1UH2A 4L61A 3POCA 4TU1A 1XBYA 4FSAA 3OZYA 1XH2A 2QIIA 3WMLA 3KWXA 4B2DD 1JPHA 2FPTA 3CMFA 4QJ3B 1IWPA 4RX0A 3I7QA 4Q22A 1SO3A 3F2CA 4PMUA 4J28A 4Q8UA 2GJRA 1P0EA 2ZRVA 1XRFA 3EDKA 1QI5A 4LS2A 3OQEA 4HYRA 2PWFA 1J93A 2JFEX 4J3WA 4MDPA 4O17A 1OF8A 2XWEA 1QOQA 2RHGA 1LRTA 2WC4A 3I68A 3I3DA 2F7FA 2PP1A 4HA4A 4GYPA 1HKVA 3P81A 3FW6A 5FAGA 1GW9A 1JJKA 1K8ZA 4UUIA 3U2CA 5FOOA 4B90A 5JH2A 4EPEC 3WJYA 3IS4A 4UNLA 2V5LA 2ZICA 3O16A 2W79A 1GQIA 2VOTA 3G8RA 1GWJA 4FIRA 2PRHA 1S46A 2WC3A 2VOMA 1J0JA 4XKYA 1JD7A 1ZPTA 4AX7A 5I3DA 1W1B1 2AMXA 3NQGA 1PKYA 4J35A 4JTLA 4H7CA 3E6EA 4O28A 5FJRA 3TYCA 3L4UA 3NSMA 1JCXA 3FEQA 2VC7A 4RE0A 4PBFA 1P48A 4RW3A 4Z42C 2F2HA 3A24A 2CZVA 2WJFA 4GD0A 5DXXA 1C92A 1X6LA 5C6MA 2O9PA 2J7EA 4BI7A 4XK2A 3EYPA 3MTWA 1NOUA 2A0NA 3RLGA 3PUOA 1VFMA 4S1FA 2FVLA 5DBUA 3K4DA 4C6CA 3CAKA 1KQZA 1VIWA 3BAJA 4O1FA 5H8PA 7XIMA 3UWUA 3WJSA 2WQPA 3V5FA 1BGGA 2FZNA 2EHHA 3RCMA 3C3UA 4D72A 4YYFA 2J7FA 3T09A 3ARTA 3O6DA 2QVHA 1GEQA 4CLMA 2PTWA 3VKCA 4UFHA 1QATA 3EWUA 5I2UA 3IIXA 5L9FA 1X98A 3GDRA 4IM4A 1KM0A 3T0CA 1GTEA 3R11A 3NA8A 1O7AA 3OBAA 4ZODA 3VDAA 3PJTA 4FNPA 3TJLA 1VC4A 4MF4A 1KTBA 2DJXA 2PLJA 4NNAA 4GYKA 3IUDA 1HKWA 4ZOAA 1XIDA 1EUNA 3T05A 2ZZ3A 4GUFA 4MNJA 4I8DA 4LAUA 1POJA 4U33A 4NI8A 4CU6A 4O16A 1OFRA 5LA1A 3OO2A 3RU6A 3ZJ7A 5A6BA 2X42A 1XC6A 1LOSA 2NWSA 1GVOA 1K02A 1C8YA 4DXVA 3QV6A 3AIBA 1LF1A 3ITVA 5C8BB 3UY7A 1RJQA 1W1IE 2XH4A 3TK7A 2QV5A 4MLJA 2X7VA 4DO4A 2Y85A 3OVGA 4YVPA 4C60A 3TSMA 5MKGA 1KM6A 2Z27A 2DSVA 4A21A 2DT2A 4HCLA 4JX5A 1K8CA 3QHMA 4L4LA 5M1TA 3RNDA 1WDRA 4M5PA 3R4IA 2PWEA 3UYIA 1FWRA 4KERA 3C6CA 1TPH1 2ZA1A 5E93A 1FH7A 3GC4A 3EX1A 3M41A 3RCYA 2OODA 4YIWA 1HJSA 1C8QA 3GDBA 2DIKA 1HKKA 2UY3A 2PBOA 1AODA 4A2SA 5D2WA 3H23A 3TYDA 1P7TA 4JTFA 3TVAA 3SW6A 2Z25A 1UC5A 3TSDA 2Y61A 5EBUA 4GWEA 1LLZA 5LZLA 2RUSA 1UW9A 1X38A 2PTDA 4JQ1A 4F4RA 2CHRA 2QV4A 3B9NA 4FOJA 4QHRA 1U5HA 1XUUA 3SSZA 3W2NA 1YPXA 4GYFA 3WF4A 2IXVA 3RG6A 3RX3A 4GK8A 2DZVA 2J24A 4AQLA 1ZP3A 3S5SA 2NT1A 1Q8JA 4J3SA 1CWYA 2G8ZA 1EA0A 1W17A 1B3ZA 2EBNA 4JICA 5K7JA 2X1UA 2CLEA 5FJPA 5LXXA 3A5VA 7ODCA 1MW3A 4GNVA 2QDGA 2XG9A 3OJGA 3MCNA 4A3RA 3WG6A 4JTHA 3MHUA 1E3ZA 1KM5A 2DSKA 3GG8A 3AMLA 3RDKA 1LJYA 4Y96A 1RAKA 4P7LA 3EMZA 3QZEA 3NQVA 3U7VA 3H2OA 1R2RA 3W2MA 2J9YA 3O05A 4MAVA 4CCCA 2ZYFA 2XIIA 1CB2A 4CKQA 3WH5A 1SW7A 2VEIA 3ALFA 3QSRA 3VAVA 1C93A 1WAWA 3PZQA 4LTSA 2VQUA 3GH7A 4QROA 2V6AA 3QQ1A 4IL2A 2Y5SA 4PTDA 4EPBC 3ATZA 2W27A 3T7VA 2QCFA 2NX3A 2ZRUA 2A7RA 3LHWA 4WGHA 2ZA2A 4NI3A 2EJAA 3W4RA 5LSMA 1XFCA 4GVHA 3OVPA 2NXGA 1QI2A 5A6KA 3VCRA 2WZTA 1QBAA 3PZ9A 1I2NA 2DV0A 3NTYA 3VGDA 2INZA 4ICMA 1VLIA 4FI4A 1W1TA 1HP5A 4J2PA 1ZFJA 2IPGA 1MZHA 4ATDA 1X96A 3CHDA 1OCQA 5BXTA 3MCMA 3NR0A 4I7WA 1TVPA 3UERA 8XIAA 4QR6A 3DYPA 4Q8MA 5CZ0A 1A5SA 3KS6A 2XIBA 4ASTA 5HR6A 3SRFA 1FCQA 2E77A 3SQLA 1VYPX 2ZZ2A 1BSLA 2VVNA 4KH2A 3E2SA 3MKKA 1A5CA 1WZAA 1B5TA 2PDFA 4JCLA 4FX8A 4D6GA 5AC8A 3F4VA 4Q6JA 1IXOA 5ABHA 1F7BA 2RH9A 4M29A 1TE6A 2XIMA 3VIOA 3PTMA 3CHVA 2OKOA 1LZOA 4ZFMA 3TJ4A 4DLFA 2GK1A 4GO8A 5IHRA 1W2VA 2BVTA 4DF2A 2D2OA 5M3WA 1XIJA 4Z1DA 2D2GA 1RP9A 3QTGA 3OBEA 4S2CA 4TOQA 4F0HA 2GDUA 3S2LA 1S3HA 5TBOA 3EKGA 3I6TA 1BVZA 1BG9A 3LHVA 4IF2A 3SY8A 5CGTA 2QF8A 2ZZ6A 4PTWA 2ACSA 3KTCA 3W23A 3WD1A 3C0SA 1M41A 4DYEA 2QCEA 1Y5WA 3PB2A 3BLKA 2Y7DA 3OYXA 3CC1A 4GUGA 1CLKA 1QMLA 1A0CA 1D3CA 1I0BA 1P1XA 1SSDA 4YLWA 3QHOA 4XVEA 5F4SA 2PWGA 2BHUA 2CNCA 1TO3A 4FPSA 3DHUA 2A79A 3C8NA 3UPMA 3B9AA 2ISDA 2PGFA 2A4AA 4H1ZA 3TFCA 2I9UA 4IPJA 3G1AA 1DBTA 4OGZA 3NEHA 3LCLA 1WP6A 4EANA 1GVRA 2ZC1A 3U4AA 5BROA 4HNCA 3ONCA 4M6UA 1TQXA 2CESA 2CIPA 3GIYA 4YVVA 4ZCWA 1X6UA 4QX4A 2QMJA 4UTWC 1GYNA 1XIBA 2VRJA 2PDKA 5GVJA 4HT3A 2GFTA 2OMAA 4N7QA 1K6AA 3SFWA 1T99A 3CT2A 3N04A 1I2QA 2WB5A 3C2FA 5DANA 4ERAA 1GVQA 3CM4A 4FK9A 2OGYA 3RU8X 3VMOA 2E67A 4HPXA 2V68A 3Q94A 2PUZA 3SY5A 1QAPA 2QXWA 4IPNB 1H50A 4LYRA 4IP4A 4GO9A 3P82A 3PUGA 2V3FA 3VX0A 2Y8KA 3AS1A 3AHZA 4MYXA 4J2MA 2O56A 3V16A 1MFUA 2QF7A 1MNSA 3RILA 6TIMA 1ITUA 3KBVA 3QGVA 1UD4A 1EOKA 3EWBX 2HDJA 3PBUA 5CC5A 2E9LA 3IIPA 3QJAA 4ZO6A 2C91A 3IJ8A 1TWSA 4JNZA 4WDUA 3RMEA 4L9ZA 1W5OA 3HG3A 3U48A 2WJZA 4JTRA 1POKA 2XDFA 1UUQA 3P8JA 4MGGA 2OKTA 2YCIX 2HE8A 1ME9A 1H61A 3KRZA 3VNKA 3CHFA 4JIPA 3N3TA 3TYAA 1MEIA 5FF0A 3HG2A 2FDSA 4LBSA 3FIGA 4AD1A 4HPHA 3O2LA 2PDLA 2PDWA 3P2VA 1K6WA 4Q33A 2O9OA 4FNUA 2DUXA 3ELFA 3GFXA 4HCHA 1OG6A 1KKOA 2RDXA 5KEZA 1LWIA 5K3VA 1XINA 3A4JA 3PG8A 3NQDA 1TFVA 1HJVA 3VKKA 3NL3A 4XAFA 4LUJA 5E9XA 4K1WA 3BOXA 5A2BA 1IR1A 2X7WA 3HFTA 4YU1A 4KMQA 3BLFA 2WZMA 2HVOA 1IT0A 1B30A 3IK2A 1TCMA 4J3UA 1EL3A 3UJFA 5HR7A 3O15A 3R7MA 3DENA 3VC5A 2R8WA 5ECUA 6ALDA 3D5HA 4FXSA 4B5NA 1R6WA 3B9EA 1I1XA 3GU1A 4NRRA 4MNLA 1DKWA 1DHPA 3E38A 4D6CA 1G7UA 3S6TA 1DV7A 4XD4A 3UG5A 1E6SM 1Q45A 3PWAA 1UZHA 2VEKA 1G94A 1OFPA 3H7UA 4HK7A 3GW0A 5F7UA 5LHEA 1IIGA 1A80A 3Q37A 3AHTA 1Z7AA 4OFCA 2CETA 3VKAA 2XSXA 1G5AA 4YTTA 4IJRA 5LIXX 3GDKA 4NZFA 4XVDA 1V93A 3UXKA 4DXXA 4B9YA 4ZQNA 3GKAA 5D2TA 1KGUA 3L4WA 1I60A 4Y9MA 1D7KA 1E51A 5DT5A 2ZX7A 5FA5A 1NWSA 3KZPA 3S2JA 3VABA 2OSWA 5BWAA 2YX0A 2PU0A 1KCZA 3EXSA 3G22A 1HX0A 4HN4A 4B5SA 2GWGA 5FL1A 1A5MC 3PUDA 2H9AB 4ATLA 3QFEA 1F76A 1TPWA 4TVCA 3M5VA 4AIBA 4HZ7A 3AS3A 2NQLA 1WZMA 3W1MA 3WQ8A 4DI9A 3EX2A 4Q4KA 2W92A 2OZ3A 4Q7IA 1W5NA 1DJYA 1LOQA 1JGMA 2UBPC 4IGNA 3CIWA 2J47A 4UTWA 4N6EA 4L1XA 3R89A 4S3CA 3A9IA 1JFHA 3WMSA 3NFUA 1PZ0A 1M65A 3EX6A 4IT1A 2ISVA 4Z1CA 4NAFB 3W87A 5BOFA 5A6AA 3SJNA 3L4XA 3W0KA 1ZQ5A 1E5JA 1RJRA 2Z6JA 1XSIA 3CT7A 4FF5A 2YL8A 3LGEA 3JR2A 4X22A 4DZ5A 1OABA 1V7AA 2XPKA 1P0NA 1N8FA 2HMCA 1E0VA 3ZVHA 4ZQCA 3N2CA 2O9TA 2PLCA 3VGFA 1XX1A 3P6LA 5C55A 3GLCA 5A94A 4WEVX 1QI0A 2DUAA 5J8LA 3S5YA 3HMCA 1H3GA 2GYIA 4ZE4A 4HNOA 1GEHA 4B91A 7PTDA 4DBUA 2R24A 4DO7A 5BWFA 3KUMA 3GBDA 3DKJA 4IFRA 4GJIA 3BCFA 1WNOA 1EB3A 3NQCA 4RDVA 4PGLA 2XIOA 4WY0A 1A5BA 4LBRA 2O55A 2CITA 2I1OA 1XCXA 3VU2A 3WBAA 1H09A 4Y6GA 2X16A 5DMYA 2BVDA 1XDLA 2F84A 3NWRA 3OG3A 4NJKA 1V3LA 3IACA 1TIMA 3BDKA 4P8UA 4HMCA 3CXOA 4WXZA 2WCGA 3MSDA 3UR2A 1C8VA 1SU5A 3CMJA 4ZTXA 1C90A 3OODA 4A3HA 4JBRA 5IXEA 4QS6A 1EPVA 3BV7A 3C8FA 1ITCA 2RGLA 4C91A 1OGBA 5AYZA 3N3MA 1NU5A 3LCXA 1F6PA 5HWJA 3ZZ1A 2JKPA 2AL2B 2CC0A 3NDYA 3MP4A 1EJTC 1W54A 5AFDA 3UWVA 4CD4A 3VZXA 3QMRA 4HD5A 3NQMA 4PMQA 1UD8A 3QLDA 3HOJA 2V3EA 1FDYA 4ZB0A 3LTPA 3PJWA 1BWKA 1CLVA 3R2GA 4ATWA 4W8AA 1M3UA 1J0IA 1VJZA 2MNRA 4H41A 1XYLA 4D6JA 3AFBA 1P0BA 1BXBA 5C5YA 2A7NA 3SDOA 1KXVA 3WLTA 3GH4A 4C6QA 1TKKA 5D03A 3MYPA 2BFGA 2YB4A 5D9MA 1HO1A 5E1QA 1VBGA 3OG2A 2B81A 1EIBA 4K7YA 4MIMA 1REQB 2ZTJA 4RDYA 1KXQA 3T0AA 4XWUA 1B90A 1V77A 3SGUA 1J0KA 1Y5XA 5G4HC 3TOYA 3FS2A 3WH9A 1PEZA 2YGYA 4BZYA 1DWJM 4HNLA 1KKRA 4IG2B 2V5DA 3Q45A 3W6YA 4CNTA 3LTYA 3GXDA 4D8LA 3CPUA 3PUEA 3JUGA 4F0MA 2GVGA 1RY8A 3W81A 4H8UA 4LQ1A 3KDOA 1HVXA 4AVNA 4I6VA 4B92A 2VZTA 4C6KA 3S6OA 3EKZA 4OTKA 3RO8A 2CWXA 2CLIA 3ZSTA 1WYIA 4GBDA 1X1NA 3CWOX 2ZUNA 1WKEA 1LQ2A 3N34A 3GIQA 4R88A 3BMVA 4AHQA 2VGGA 4Q4SA 4FNSA 1AQMA 2IW0A 1W1VA 1GOMA 2QLYA 3LQLA 4UZSA 2ZRYA 4LB4A 1H41A 5BYWA 1R46A 2FVKA 4Q3MA 3B03A 3VKJA 2HRWA 4F9JA 1NF7A 3B04A 4IX2A 4BCEA 3SGGA 4AZ7A 2P76A 1TX0A 3THCA 1YHTA 4KIEA 3N2MA 2WLYA 2I57A 1IYXA 2QDDA 4JTDA 3CV1A 4D2JA 4HZ8A 1NVMA 1LG1A 1SO4A 3QRHA 4HU0A 5A2AA 1M03A 4KCUA 3W7DA 3R79A 1I45A 3NYDA 3MW7A 3N12A 4AZGA 4NJIA 2WMKA 4HIBA 4QGCA 2VUYA 1R5YA 4P5UA 2QJJA 5FF2A 2ZE0A 4QS5A 1FWIC 2VC9A 4DY1A 1W3TA 4A4AA 3MWAA 3LHYA 2XZ7A 1VFLA 2A21A 4Y8EA 1CGUA 3BL3A 4BK9A 3VMPA 4S3GA 4NXSA 3IIOA 3NSNA 4PB5A 4UOQA 1QHZA 3WDIA 4F8XA 3PTQA 1U33A 2YLAA 1D3HA 1GQLA 1NP0A 1NM9A 4KGLA 1OT2A 2ZUWA 2DSWA 4BQ5A 1QNPA 3LS9A 2LLEA 2P50A 4YTSA 2NSOA 3NXFA 2V82A 2PFHA 3TYBA 4Q8WA 4H19A 3GW3A 3QY6A 1XFBA 1F3XA 2PC4A 4UFIA 4XTIA 4D9PA 2X09A 4I8YA 2AMGA 4KWSA 4QCEA 4REQB 1BQGA 2A6LA 3HV8A 3DYOA 1XLAA 3LPGA 4B3ZA 1H7RA 3BOFA 4BI6A 4NILA 2ZTKA 3WQ6A 3B9OA 5JVLA 3KFTA 3I4EA 3B8IA 2TYSA 1CXLA 1CXIA 1FHDA 3QQWA 3WSUA 3HN3A 5ABTA 3OHMB 4CNUA 4B5TA 4W88A 3TTSA 3E49A 2WPBA 5EMJA 2J79A 4X3ZA 1PIIA 4DXKA 4N0RA 3BE7A 4MWAC 1BXNA 3MBDA 5AB3A 1WKYA 3FJ4A 3FGCB 3TWBA 1XIHA 4O10A 4WDTA 4MYAA 4KETA 4MB4A 2OWCA 4NJGA 3TFXA 2EPLX 1VAHA 4XSLA 4HA1A 2QCDA 3G1DA 2DVXA 3AZSA 2OYMA 3QSTA 2JBMA 4GINA 3U3HA 4DBWA 5CAHA 3KLLA 3GAYA 2A7PA 2NVAA 4D6HA 2ABBA 2Y7EA 1ADSA 1DORA 2Z2UA 3MKVA 3QVQA 1Z6KA 1UG6A 3ITYA 3W1TA 4JYDA 3RUBL 3URNA 2C1IA 1GVEA 4IXHA 3GTIA 2PDQA 3GNPA 3HU7A 3QPYA 4QE5A 4IISA 2PC8A 4Q4PA 3CB8A 1JZ2A 1UR1A 1TV7A 4W7WA 2BXYA 3NOEA 2V2DA 5BMWA 2YYUA 1WOBA 2WNZA 2EG8A 5FJIA 3CL8A 3MI3A 4OBSA 4JX4A 4GJ1A 2NZLA 4M3PA 4GKTA 1OFDA 3Q2DA 1ZJAA 5DCBA 1ISYA 2GVEA 2Z6IA 1H51A 5K4XA 1XLFA 1A3XA 4M51A 4XZIA 2QCMA 2NLYA 3KP0A 3WNNA 3BSMA 5IM51 3ZLFA 5HUOA 1JZ3A 2YOCA 3CHCA 5A8PA 1E72M 3HMJG 3G3DA 1DTUA 4NAEB 4UOJA 5HNNA 3JZEA 1DXEA 3VE9A 1UR4A 3TEVA 4PMYA 3M0YA 3PF3A 3EOEA 4AG0A 2QGHA 2Z1KA 2RAGA 1GG1A 1UA7A 4M6PA 3FFSA 1W1ZA 3GYCA 4GQ0A 4Z17A 4LS1A 1O5XA 4L4PA 3AXMA 1G4EA 1E1CB 3RJXA 4YL2A 1JPMA 5E6YA 4OT7A 1NAL1 1U1HA 3EXRA 1IT8A 3HPFA 2I5IA 2WHMA 4S38A 5ABFB 4UTUA 1UKTA 1HZYA 5CBBA 1AZ2A 1GTHA 2OU4A 3T81A 2YR1A 1RCQA 3TXZA 1YTDA 4GA8A 4RDZA 1IGSA 1SMAA 4C6FA 4JTTA 4LUYA 1U5VA 1JCMP 2VDIA 4I9TA 3WK2A 1UWIA 3NQFA 4C5YA 5GPRA 1Z3NA 3A3HA 4IMDA 2VFFA 4NNCA 4DLMA 1VGAA 4PUNA 3DHPA 1TJPA 3WQPA 1F5ZA 4DJFC 1LLWA 3KCLA 4AF0B 3AHVA 2TAAA 3AS0A 4HHLA 1QWGA 4D8ZA 1E43A 3IVTA 1KW1A 2P3ZA 3HPSA 1T5AA 4AVFA 4PTVA 2FJKA 8RUCA 5CJ5A 2IQTA 4AC7C 3M5YA 1CGWA 1W3JA 3N15A 2Y8UA 1M53A 4JQ4A 1LL6A 1E4IA 2VEGA 3PBYA 1OIFA 3TMLA 1MXSA 1CDGA 4MJ2A 3ZFHA 4RJEA 4HZMA 4YTRA 2OYKA 3VNIA 1B3WA 1Y7VA 2G3IA 1R7AA 3VFCA 5FEZA 3TTOA 1AW2A 1A5AA 3WY1A 2EPOA 3FK4A 4ALDA 3K5XA 4MWAA 1QNSA 1HN1A 4N4QA 1TV3A 1XKYA 2WC7A 2FZ8A 1A3WA 1ENUA 3N19B 3WLRA 4HK5A 2HBXA 1DXFA 1JNEA 3OLEA 1UZ4A 4WVXA 4QITA 5E70A 3UU0A 3JVAA 1G67A 3MC5A 4QBXA 3GVQA 4HOWA 1PDZA 2FQIA 1ZJHA 1JUBA 4EAYA 3UQNA 4DVOA 5JQ9A 1DJNA 4AZHA 4KF1A 1QW8A 4CD5A 1VEMA 2G50A 4R33A 1DWIM 4KRTA 2Y5EA 4GIRA 1V7YA 2XWDA 5BRPA 1OBAA 1UCWA 3IRDA 3WLLA 3VDGA 3LOTA 2POTA 3EWWA 1TB3A 3CUXA 3R13A 1GKQA 5CPQA 4AVOA 3TU9A 4PTMA 3HZ3A 4L1GA 1E0TA 3NXLA 4Z1YA 5CPLA 2OX1A 3H2MA 1W3HA 4TMBA 2WJEA 4GRSA 5A1AA 1R47A 4WKHA 3KTXA 5IOBA 3FY1A 5B7YA 4J7RA 3NVDA 5HK4A 4Y8FA 1UWAA 2QS8A 4JNMA 1N7KA 2EXOA 3PHAA 5JXQA 4A3QA 3XINA 4ZOCA 2DZSA 2Z2BA 3OW1A 3RRXA 3OP2A 1L6SA 4R7OA 1OGGA 1OWQA 5D05A 1J10A 1V6WA 1XR2A 5G2IA 1V0NA 1VPQA 3C0LA 1TJRA 5EMLA 3UR7A 3W83A 4EF8A 2DZBA 4NT0A 4HMEA 3E3HA 4DWSC 3WNKA 1VP5A 3LPOA 3D47A 3U6WA 3U4FA 3S2CA 4RE3A 2J7GA 4US5D 3VZZA 4H2HA 4JTAA 1LT8A 1NDZA 3BPWA 3V3WA 2OT1A 3CO4A 4W86A 3A9BA 4GH1A 2H9AA 1EYEA 2WQDA 2XYLA 4S3EA 5TF0A 1S2VA 4C7FA 3VC6A 1SMDA 4G2DA 2E6DA 1NFGA 3RLUA 4ZO8A 4F9DA 1Q8AA 1VCFA 2A3AA 4DBSA 3PR2A 4DJFA 4H9YA 1I75A 3ABSA 2VCAA 5J04A 1CXFA 4XBKA 3WUFA 4LUTB 1UIPA 2WCSA 3DZ1A 2ZUMA 4XAGA 1AD1A 4B4FA 4ZVJA 3TTYA 1XSJA 2YXGA 1KLZA 3S2NA 2DP3A 1BKHA 1OG0A 3SSJA 3LCWA 3S42A 4J3VA 4XISA 1V6UA 4E0CA 1DE6A 3TW6A 2XTKA 5EFFA 1XCWA 2V5CA 1VFFA 2ABAA 2PF8A 4KEZA 2E25A 1YTEA 1OFBA 3N29A 2BY1A 3VUSA 3OEXA 4DJDD 2J6XA 3QMTA 3KRUA 2IPFA 4R9XA 1L0PA 4GI6A 2WVVB 3MP5A 4FLQA 1JQXA 4MJMA 1OK4A 2XIQA 3LG3A 3NNTA 3TN3A 2DH2A 3D46A 1C9DA 1IZKA 2BBFA 4JHMA 1WV2A 3BGJA 4AY8A 5LNUA 1TWDA 2XN0A 1LM1A 3W76A 2CXGA 1PB0A 2ZADA 3BG9A 2QNEA 1XLHA 1RALA 4HPGA 3HGJA 5FIPA 3W02A 1QUMA 3OLIA 4IMGA 2ZWZA 3IIZA 4YTUA 1JFXA 2PZ0A 4UR9A 3VD7A 1G01A 2P5NA 4JFVA 1XIEA 1N82A 4AC1X 1V79A 4MNMA 5IFPA 3SM0A 1QJWA 1C7SA 4FP1A 4EXQA 2XVKA 1BSIA 1F6YA 3LCFA 3T8LA 4C5ZA 2VCBA 2BB0A 4F66A 4LAKA 3DC8A 1JZ7A 1QBBA 2BV9A 1IEXA 4U31A 3SIZA 4N9CA 3QYSA 1UKSA 5I7GA 4CQDA 4XKMA 3UZ5A 1GYLA 4GCAA 3RR4A 3N2TA 4S23A 5AVNA 5LNRA 3CS2A 4Q8NA 5JUVA 3PPHA 1EIXA 3LX9A 1OGSA 3AOFA 1YIXA 3CQ0A 1SO5A 2NWRA 4EIVA 4JNYA 1IR2A 2I5QA 2ZKMX 1Z44A 5J5DA 4J3ZA 2J13A 1CW2A 3AC0A 4S3JA 2VFIA 2PPGA 3I3BA 5BNKA 3ARUA 1EGMA 4TIMA 3W72A 2PGEA 3EOOA 1PXGA 1NEYA 4FMVA 2E7FA 4G7FA 3O7UA 3SGZA 1B9ZA 3URAA 4K8EA 1CB7B 4JXCA 3VNYA 3ITLA 5LYRA 4NP7A 2QEZA 3BAIA 1FCBA 4WXYA 2E6AA 2FPYA 2E8YA 7ENLA 1O4UA 3QQ0A 3UEQA 2BVYA 3HM7A 1QK0A 2A5HA 4H00A 4P7RA 4DWSA 3UY8A 4RNFA 3A5FA 5HNTA 4IX0A 5DMNA 2YA0A 2O0TA 3WQOA 3P93A 1K8YA 4H9VA 4FIQA 3ITCA 4XO7A 4UCFA 1X7FA 3TKFA 3H4XA 3IWPA 4ILSA 5RUBA 1OX5A 2QHAA 1WDWA 3F4NA 5FD0A 4JIEA 1KWGA 5M5DA 2ATSA 1RXOB 3WUEA 1JXKA 3SCRA 3FV9A 4KIRA 5TNVA 2WHLA 3EOUA 3QXBA 4GI8A 2B7OA 3NOYA 3AXXA 5BU6A 3LV5A 3O0FA 3LPPA 4JTIA 3BJFA 1WB0A 1KO0A 1KM1A 3RCNA 1EC7A 1GQKA 5D02A 4QG8A 2ACUA 1EDGA 1CI1A 4UTFA 3P74A 3TJXA 5CZSA 5F2LA 3NEVA 3EKLA 1WDDA 9CGTA 1X39A 5HQEA 3LHTA 3HG4A 4KRUA 3LRMA 2ZIDA 1RBOB 1VENA 3AYVA 3W28A 3S5ZA 4L9XA 1Q2RA 3VCNA 4ZENA 3A47A 1UOKA 1PWLA 1ALDA 4QE1A 4PMOA 2TMDA 4U5KA 1RSCA 3NPUA 1JF6A 4LCSA 2ASHA 5HAOA 1K1DA 3UESA 2NQZA 2HE5A 2Y88A 3S83A 3BJTA 4Y9AA 2X8RA 1KTCA 3NZRA 1DPMA 4DUWA 4EF9A 1J9YA 4MTVA 2X1RA 2RFGA 1JCLA 4V1XA 3TQ0A 1OHLA 3WLSA 3E0VA 2NV2A 1MVYA 1OCNA 2PSNA 1SQ7A 2OFJA 3EB4A 1YPFA 1A53A 5LNWA 1UQYA 4R7WA 8A3HA 4AEEA 3PULA 4REQA 3AQUA 3A12A 2W5FA 2GVYA 4URIA 2C3ZA 2FB2A 4TV6A 3SCNA 3GM8A 1KB3A 3FDKA 4M0XA 1VIZA 2NV1A 1AJ2A 1PKNA 4NASA 4QM1A 2GUUA 3ABZA 3VKBA 1OX6A 3AI0A 1CEOA 4KEUA 2Q02A 2YBTA 1E4NA 2WMHA 1SW3A 3PPFA 4JTKA 4US6A 2FB3A 1OCJA 4LRSA 1UR2A 2FJUB 4A05A 4JD4A 4NRSA 3EOSA 2PD9A 5A8MA 3FGCA 4CEXC 4QE4A 4DM2A 4XAZA 1HO4A 2E1WA 2FZDA 4DELA 3ZQ9A 1BYDA 3URQA 4ECLA 2OG9A 4EX4A 1JZ4A 3R8HA 1FHLA 3NZGA 1DJWA 4X2PA 1ONWA 2XSAA 2IKHA 3NQ2A 1V3MA 4UFMA 2XM2A 2DT3A 1VFSA 4PR4A 4HSOA 3AUOA 4K38A 2C8NA 1F4AA 1J6PA 4IP7A 1EJXC 1A5UA 1GKPA 1O66A 1IXNA 1TIWA 3GRIA 2PDXA 3RPTA 1H7PA 4PMRA 3RJYA 4IPPA 1JULA 4YHGA 3SUUA 1XPYA 3AU6A 2OR2A 3WJWA 2DUZA 5C9XA 1M04A 1K8XA 5T26A 4OVXA 2CYGA 4AFYA 4CD7A 1KFKA 2VWTA 4OQVA 3VOHA 2HXUA 4UTMA 2D0GA 3VI2A 2FH8A 4GOAA 3WLOA 3DG3A 4C1LA 4JKLA 4O13A 2OWWA 2YB1A 3BLIA 2BG5A 4HA3A 3WLNA 2J8FA 3GG0A 3MS8A 3DN5A 1CXKA 3CBWA 3UG3A 2B7QA 3L4TA 4POCA 3WX7A 4XZWA 3B8DA 1W9DM 4PSPA 4CQCA 2C16A 3SY1A 7TAAA 2G41A 3ENLA 1AL7A 4C1KA 3G1FA 4Y2WA 1G4SA 3NG3A 2X2YA 3VNZA 3RF9A 2FMNA 3EB2A 1UH4A 1DIEA 2R94A 3VNDA 5MKGB 2JIWA 4X9YA 5A6LA 1Q6DA 1F4HA 2WCAA 2WSPA 1I0DA 3H70A 2X1IA 1XPGA 3OOQA 2GJXA 4ZGYA 4HGXA 1ME7A 2GJPA 4XAYA 4TVDA 2Z1SA 3LK6A 1B3VA 2F61A 3I4KA 3T2OA 3CQIA 1WDPA 4BKNA 5JH1A 2G96A 3IIVA 5I09A 2UZ9A 5G1YA 2BASA 2X1SA 3N9SA 1EQPA 3LMYA 3KE0A 3THQA 5LGXA 2IKGA 2FZ9A 2I9EA 4CEUC 4O52A 2AQOA 3WCZA 4XZNX 3V5CA 4E6MA 1QO2A 4UTHA 2D0FA 1P7TB 4PA8A 3GB6A 2DQXA 3MSGA 3DGRA 4N02A 3OU8A 2PF0A 4MFDA 3T1GA 1ZJBA 1QK2A 3PSWA 1LLOA 3PVFA 1XGDA 3MSYA 2YZ5A 2A1YA 1ZBWA 3S1XA 3FA5A 4S3AA 4TTGA 1EP3A 4DJEC 1SUXA 1J0HA 1ZNNA 2WMIA 3T0DA 4UFLA 1F74A 4FB7A 5XIMA 3KBWA 3RM4A 2JEPA 1T0OA 4L7ZA 2A85A 2A3LA 3R6IA 1FWBC 3MY9A 1QRQA 5A5WA 4DO6A 4NZ1A 4GQQA 1S5TA 2OO6A 4FO4A 4LC6A 3AWNA 3E2VA 4WOQA 3MYOA 3A21A 2Q8LA 2BDQA 1YE6A 3H2FA 1KM2A 4KQNA 3EA3A 3SCOA 2VCCA 4YN5A 4K6AA 1RUSA 3F5LA 4JEQA 2DIJA 5M17A 3DFYA 5AECA 3TLQA 3V4BA 2UY2A 1ADDA 4WKAA 1JGIA 3STEA 3TR2A 1TA3A 2R9RA 4MJ4A 1E40A 1W3KA 4HTYA 4RXFA 1WAUA 2VRQA 2NX1A 4N9DA 4UMBA 4HHHA 3BW3A 4AU0A 4KFOA 3H7RA 3RN6A 5AHIA 3WQWA 4A8RA 4HYVA 4G5DA 3TNOA 3MUIA 1VH7A 4K39A 3DI1A 2VT0A 4LGXA 2VJXA 3QY8A 4LJ3A 3L4YA 3P7YA 1HW6A 2ACRA 4P8VA 1UR9A 2VC6A 4KESA 2PTXA 1M68A 3FKRA 1HGYA 4PYSA 1UA3A 2D0HA 1M01A 1MW1A 1HKJA 4HB7A 3GXFA 2NQHA 3MUCA 2CW6A 2XINA 2RDUA 4F3HA 1VHNA 2W4XA 4MKNA 4LW7A 2YBVA 3WQGA 1E9IA 5B7ZA 2WK2A 3C2YA 4U2YA 3T42A 5FJTA 3R5EA 4ZMGA 4XSMA 3L2LA 3OPSA 1UPPA 4KWOA 3W26A 4S39A 3A23A 3M44A 4O0QA 1E55A 5E0KA 3WLHA 3AMGA 4GIEA 4A6GA 4F0SA 5HJLA 1WKFA 4PMXA 3DFPA 4DEFA 3HF3A 2PP0A 1H7OA 3L5LA 3VZYA 2GK1B 3GVVA 2A3BA 5LGZA 3IVUA 4RK8A 9RUBA 3OB8A 4JIHA 4FAMA 2DEPA 4GKLA 3GHTA 4JPGA 4QXIA 1QFEA 3EMQA 2OX4A 1BRLA 1TX2A 4UC5A 3KOWA 1E56A 2PDBA 3B4UA 4Q7NA 3DHFA 4YS1A 4BQ2A 3ARVA 4BHYA 3C4UA 1W5QA 1XLBA 2NSXA 3GS6A 4A8LA 4NXKA 3UNTA 4J27A 5FKYA 2QVNA 3L66A 3ARSA 5DCEA 2Z00A 5DLCA 1M7JA 5C71A 2EG7A 2YL5A 2VYOA 3EDJA 1V6VA 1F61A 4XD6A 1O6IA 4IPIA 1E1FA 2J7BA 3DFSA 3DBNA 4OIFA 1OZQA 2CLLA 2FGLA 2Y7FA 1B2YA 1K9DA 3SCPA 1AG1O 3SQSA 4DUVA 2BTMA 4HHMA 4NX5A 7CGTA 3BCJA 3AHXA 4I9JA 1Q13A 1Q4WA 1DIDA 2C14A 5E6ZA 3ZVIA 5MHBA 3CZLA 5EBAA 4HA0A 3P67A 1BWLA 3T2QA 4C6EA 1RCXB 2E68A 4AWSA 2O92A 3HA1A 4DJEA 3D6NA 2B0MA 4QJ1A 4ZA0A 3M43A 4RW5A 4Q4QA 1CZ1A 3M0VA 2Y24A 3IJIA 5DRIA 3ECQA 1L8NA 1RZMA 3E5PA 3FVDA 3WO8A 3AYSA 1UKQA 4WDWA 3WD3A 3QZ6A 3T0TA 5A8QA 2OTDA 2QPUA 2VRKA 4XUGA 2CLKA 4PCNA 1BVNP 3QW3A 1SJDA 2I14A 3KZSA 5MF5A 3LYEA 4JN6A 1FHVA 1Q6RA 2B31A 4PUDA 3P84A 3C2OA 3MSRA 2UY5A 5F4XA 3ZR4A 1F9CA 1H5VA 1Q63A 1SO6A 2ONEA 2R1LA 1KRMA 1GYMA 4PUEA 4JR5A 4IIFA 3BLOA 3LSCA 5ABGA 4A8IA 1K7EA 4O8RA 3EZ4A 3TDFA 3C0JA 2E8ZA 3UWEA 2MUCA 4MNKA 1I2RA 2ZRZA 3GXIA 3RFAA 3V36A 4ACZA 4GVFA 3TONA 4WDXA 2FVMA 5BZAA 3S1GA 3EWCA 3EWZA 1VFTA 4H83A 1ZCCA 2J8GA 3UJEA 3BTNA 3M0IA 3ARWA 1P6WA 2VFEA 1XS2A 2W9MA 1VCVA 3PAOA 3BSHA 1H1YA 1TMHA 2X2GA 4LVBA 2WM0A 3MPGA 4DO5A 6REQA 1FH9A 4A35A 3GIPA 2VVSA 1EWEA 1TELA 2DZTA 4H8NA 3HGOA 1TTIA 1XGZA 4YJ5A 4WRHA 3LPFA 3KEHA 3P0XA 4X0NA 1MQPA 3KHDA 2DPEA 1QWKA 2QJGA 2RDTA 3LCGA 5CJMA 3DFOA 3APGA 2D20A 2Z24A 1UASA 3W3OA 4FLOA 3T4WA 1U83A 4INFA 1LL4A 1K03A 4HPJA 2XGIA 4MKVA 3TA9A 2JF6A 1QXLA 1X7IA 5EY5A 3W1AA 4UQ9A 3VDBA 3NJ3A 3AYRA 2H3BA 4U4MA 5D8ZA 1JDCA 3GG7A 3NQBA 3PFRA 1EC8A 5FF4A 5FJUA 4ZOBA 3R58A 1HXJA 1E70M 3TN5A 1LQAA 1MZRA 1JNDA 4I9MA 3FJ6A 3TAOA 1DWFM 1FBAA 1LBMA 2ACQA 3NPWA 2IXUA 2QQ6A 1J4EA 3HFYA 1W9PA 1XC4A 4N9BA 1MUCA 3C2RA 1JRBA 5BMXA 3VVGA 5KMYA 5AHEA 3TOPA 4V27A 1KBLA 2PE4A 1ICQA 2Y62A 1XLCA 4B5XA 1IEVA 3K4AA 1K7FA 1GJWA 5FF7A 3STGA 4J9JA 3QKZA 4EPKA 4XZHA 5GNXA 3B0UX 3W24A 3VA8A 4KWVA 4HNNA 3WLJA 1CGVA 3BMWA 4WX2A 5BRBA 4E3VA 1TPVA 4Q4RA 4D6FA 3G0XA 3GNOA 3EWYA 3FKKA 2W91A 4PE8A 3VOCA 4IMAA 2V30A 1TREA 2EKCA 1H4PA 1YYAA 4JZ5A 4RNIA 4TX8A 4JIQA 2Y4SA 3NGJA 4RV3A 1MUWA 3WLQA 2ALDA 3GHRA 2FTWA 3VD3A 1IXQA 4BQ3A 2OEKA 4JAWA 5FACA 1MDRA 4DUOA 3O6CA 2NLIA 1XIGA 4N2YA 3AXKA 1P1MA 1TPB1 4CGTA 1XICA 2PDYA 2XGBA 2PRMA 1ZB5A 3CLWA 1W56A 2PCQA 3GXTA 1K7XA 2P0OA 4H9UA 5I3FA 2YL6A 2C18A 1TQJA 2Q71A 1PKLA 5D2VA 3EEGA 1EEPA 1UWSA 1Z48A 2BGSA 1OFEA 3AJ7A 3R8GA 1RBAA 2F2KA 3S46A 2DT0A 1BXCA 3U9IA 1ODZA 4UIOA 3QV9A 4H3DA 4OUEA 2PP3A 4J1OA 4WKFA 3L68A 3ONBA 5F4WA 2BVWA 2YYTA 2Z4GA 4LV4A 4PCFA 2VGIA 4HSNA 4CVUA 1BLIA 5CLWA 3ZVHB 4JIIX 3NCOA 3BUVA 4BWLC