4ADZA

Crystal structure of the apo form of a copper-sensitive operon regulator (csor) protein from streptomyces lividans
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
90
structure length
90
Chain Sequence
b'YHKQKAEHLKRLRRIEGQIRGLQRMVDEDVYCIDILTQVSASTKALQSFALQLLEEHLRHCVADAALKGGTEIDAKVEEATKAIGRLLRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CSOR
publication title The Response to Copper Stress in Streptomyces Lividans Extends Beyond Genes Under the Direct Control of a Copper Sensitive Operon Repressor Protein (Csor)
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Transcription
total genus 40
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02583 Trns_repr_metal Metal-sensitive transcriptional repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1000 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4adzA00
5LCYA 3AAIA 4M1PA 5LBMA 4UIGA 4ADZA 2HH7A 5FMNA
chains in the Genus database with same CATH superfamily
2WBLA 1U4QA 4C90A 4ZOLE 3LK2B 3LG7A 2C5KT 3LDQB 3PUSA 2IUBA 3HKBE 2VVSA 2W2UA 3T8OA 4XBFB 4QH4A 4YLHA 3PUXF 1MMNA 2WP9A 3P8CD 3M3ZB 2FJBA 2LJLA 5KDMC 2X9WA 2CCQA 2VASA 2VWAA 3PV0F 1YD8G 3HKCE 4IDQA 2CLYB 2ZM8A 4PFOA 4L5GA 4TNWA 4PJMA 4HEAA 4I4TE 1VOMA 2E9XB 3LJCA 5JRCB 4DV4T 1D0ZA 2XAFB 2LEHA 5AQVB 2V7LA 5JR9C 3HKDE 3MA9A 3MZKB 1N36T 2H7OA 2CBJA 1J1JA 2C0SA 3AAAB 2V6YB 5FY0A 1MNDA 2OV9A 2LRKA 3HR0A 4U7YA 2DCFA 5AQIB 5FXVA 1WYCA 3KFWX 5EZYE 4KHZF 2AXDS 2H89A 3N5LA 1OWAA 3HL6A 3F2EA 4CN1A 4ISSA 1J5WA 5JDMA 3ZT7A 3ONLC 5FVLA 4QXHB 2JPFA 1VCSA 2V7KA 3PUVF 5BR8T 4DR1T 4OX9T 5C3JA 1E2AA 2E5LT 3IEEA 5JDQA 2X9XA 5KX5E 4BAYB 2CHNA 4IDPA 2XAHB 2PG8A 2V6XA 1BR1A 4QHOA 1BR0A 3LBXA 2YDRA 2UUCT 2BDEA 2BS3A 1DU2A 4AKRB 3SOLA 4CZZB 4LFCT 4HWFA 3DJBA 3P4WA 4ANJA 3P4QA 4IE6A 2WQYA 2LOPA 5JR9A 4MBQA 3UU8A 4MHCA 3GWHA 3FXEB 4DNDA 4JBWF 3JAFA 2CM0A 3K3OA 2JMHA 2ZLYA 2W62A 3AE9A 3RQUA 3IF8B 3AE4A 3N2KE 2Z6EA 3IHRA 5LYJE 2OLTA 4QX8B 3VHLA 3EABA 1YQ4A 2XUEA 3AE1A 4NIQA 3C64A 4HWDA 2X51A 3NZQA 5LXTE 2WMOA 4DO0A 2VB6A 2EHOB 2CXFA 2WDVA 1SA0E 5AQSB 4EV6A 4AKGA 3NVOA 4IE7A 3RGLA 3OKQA 4COFA 4P0BA 3CMLA 3MJXA 1SHZC 2C5IT 2CWYA 4NUVA 5FXZA 4HTEA 4LF9T 3ZPOA 4ZI3C 2H3RA 3P4SA 5FYMA 2X9YA 2FBWA 2DWKA 1WYBA 4BJNA 1T98A 3CQCB 2UXBT 4YXDA 3N9NA 5HEGA 5H6RB 3ZLIA 4I43B 3V5SA 2IAKA 2CE7A 2A72A 3ZJ1A 4HFVA 3H3AA 3LFMA 2IHR1 1XMQT 3ZJ2A 4I0UA 2W61A 2VKDA 2JQ9A 4O4HE 5EK4A 3ZT5A 1M62A 1NEKA 4YTPA 3TLTA 1T72A 3JAEA 2LM9A 2X0HA 1XNQT 5HCMA 2G0UA 3B5MA 3JC6D 3H37A 4YT0A 3AVRA 3RKOA 3ZEFB 5J2TE 2ZM2A 4UIGA 5HEOA 2HH7A 2UXDT 4DBQA 4WBNE 5L3EB 3CQGB 2LSKA 3N2GE 4TZ4C 4AQFC 4CI1B 4TV8E 3ZYKA 2X66A 4IDZA 3RLFF 5LGNB 3ZMTB 3B57A 2A2FX 2JQKA 2WM9A 4L9IA 4P0AA 3HKEE 3PUQA 5LBQB 4DMWA 3PUAA 2DNXA 2V7MA 3FBZA 5JQGE 3UTKA 1Z8UA 4X1YE 3ZC1A 5F3JA 4OYJA 2BBHA 2BVMA 2B76A 4IL4A 2PFVA 4KBMB 2CHOA 3TLUA 4X62T 3I9YA 4DR6T 3P4PA 1O3XA 5EK2A 2NR4A 5JDNA 2X0YA 3ANWB 4XAXB 4AKLA 4E7ZA 3IA3A 2VQFT 5JREA 3KV4A 5L3CB 5CJ5A 2QVAA 2XQ7A 4OHFA 2JQHA 3ZCJA 4UVBB 1M7KA 5AQPB 2ODUA 5F8PA 3QUJA 3I0OA 2AE9A 4I55E 1L0VA 3N9QA 4P09A 4CXWA 3A8YC 3TLVA 3RC3A 2BG9E 4ASKA 4YTNA 4EEBA 3ZSSA 2KSRA 3Q9DA 1W9RA 2ACXA 3AE3A 3ONJA 4IHJE 2XQ9A 3VR8A 3UU5A 2L8KA 2IIUA 4PNIA 2D0UA 3OTOT 1UUSA 2XJ7A 3UQ4A 3N9PA 4P1NA 5LMNT 5M4YA 2KNDA 2Y8DA 4B3TT 4UVCB 4ZI2C 4ZEYA 4NXNT 3RKGA 3ZN1B 2N9DA 3MXZA 1LRZA 2XQ3A 1D0XA 1W0BA 2BZBA 4IIJE 3DTOA 2YOEA 4JI7T 2YU2A 2WSSV 2DWGA 3Q5XA 3AAIA 1UK5A 3C4XA 5LBMA 4A5XA 4UF0B 2KLQA 4ZHQE 3QNUA 4LMKA 3AE8A 2V7JA 3K8PC 3NRYA 3T1YT 3PUWF 2IW5B 5LG4A 3WAKA 4B3ST 4JUYA 3GN5A 5FY1A 1MMAA 1Y01A 4EXTA 3O1JA 2R6GF 2DHRA 3E0ZA 2XQ6A 4DV5T 3ZT6A 1HNZT 2IC9A 4B6XA 1OEDE 4O2BE 4HWHA 2MYSA 4ILUA 1WLXA 2JRKA 5A1LA 3N9MA 2CRBA 1N33T 3MKDA 4DV6T 4GOUA 3PE0A 3NWIA 3OPCA 4QXCB 3GMIA 2XSBA 1Y64B 2K48A 3RQWA 2VVNA 3AA1B 3BQIA 2W67A 3AEBA 5ETWA 5LG3A 2H7VC 2A3DA 1HX8A 4TNVA 4OFZA 5FY7A 3K3NA 4JYAT 4UEMA 4J2CA 2BS2A 4H9SE 3ZN0B 5LB7B 5FXWA 1FEWA 2K5BB 5IYZE 5JDHA 2XAJB 4H9QC 3TLSA 2MBGA 4U3CA 2YINA 5LNKA 2V6YA 5KMGP 2LRLA 4EZ4A 4JI3T 1KNZA 4JI6T 2ZM0A 2E8IA 4C91A 4YHJA 4X65T 1IAPA 1WFDA 2XTLA 1S94A 4X66T 1Z0PA 3AE7A 1X79A 5LGTB 3RI5A 1XWMA 2RA1A 5DABA 4GYSA 3C4ZA 3EHZA 4TUYE 4ZZCA 4X64T 5AQHB 3O9XA 3FZMB 3NRXA 3SFEA 3J9X1 4YSXA 2M6IA 2VKOA 3MACA 1KFYA 3Q5DA 5HAXA 4DV7T 4PAGA 4PJNA 4YFSA 1MNEA 5LHIB 5IUXA 4TV9E 1SE7A 5AQGB 5AQRB 1YKEB 2C5JA 1KNPA 3WI3A 2D2SA 3LBXB 2MPKA 3CX8B 5FKYA 3AAEB 5AQKB 2X9HA 5AFUL 2VL8A 1D1AA 4HGAA 1EZ3A 4U72A 3RRWA 4U7IA 5HEJA 3W15B 5ADXL 3CVRA 5JDLA 4AI6A 2WB5A 3UU3A 5JR9B 3G06A 3A7MA 5AQFB 4ZXLA 2ZM6T 5TAOA 4G63A 5L4HA 5HXHA 2XAGB 4U2YA 4X1KE 2ACZA 2LLYA 1NWMX 2V7IA 2QRXA 4LF7T 2N2NA 2V5CA 3ZKRA 1WR6A 2FUPA 5IHYA 4O2AE 3ZSTA 4B3MT 4Q25A 2UU9T 4KI0F 4E7SA 2I59A 1HNXT 2CXLA 2QYWA 4GIWA 2CA5A 2LM2A 1LKXA 3Q5EA 4TWFA 1CUNA 4JEHB 4MLKA 2UXXB 2NW8A 3RF1A 3LK42 4DR7T 2BKOA 4NPPA 3C98B 4HFCA 4TN7B 3F57A 4DV3T 1IBLT 3VU7H 1HS7A 3OJAA 2W63A 5ABGA 5JDGA 3PUZF 2VL0A 1N34T 4ZI2D 3Q5WA 4AKHA 2CPTA 1ZV4X 3AEFA 4M1PA 5F5WA 2K24A 2L9QA 3PU8A 3LK3B 5LOVE 3UULA 4GKJT 2UUAT 3NBXX 4JI0T 4JI2T 1ZOYA 2LE8A 3AXJA 3AA0B 4GK0E 4K0UA 1UCUA 2XHEB 4HFBA 1WRDA 4PK5A 3ZYMA 5ABFB 2BG9C 4DMVA 4ADZA 2DI4A 2XASB 3ETUA 4ERRA 2W0GA 5L2LA 4QKNA 3ZYLA 1KF6A 4O4IE 5LP6E 3FZFB 1T7SA 4NUUA 4PFPA 2SPCA 5CFBA 2IMLA 4IT4A 3U3IA 4Z91A 3AVSA 2P9BA 2Q9QC 3P4RA 2VKJA 3WAJA 2HHHT 3B13A 4IE5A 5FNVE 1NAFA 3R84B 1XDOA 3I0QA 3ZCIA 4EGWA 1WR0A 1FMVA 1KEYA 2NWBA 4YHHT 4DIDB 5KXJA 5JVDE 2W66A 2ZMAA 3AEEA 3VRAA 3OVUA 3P7IA 4FI5A 3AEGA 2Y48B 1US7B 4U33A 3ANWA 2PBIA 3PUYF 3RYHE 4UV8B 2BG9A 3RHWA 3O1HA 1HG5A 4BJMA 2LSYA 5AQTB 3RIUC 2IDOB 1HNWT 2XAQB 3OYZA 4EIWA 2I0MA 3TKLB 2OA5A 4H63V 4DR3T 4CN6A 1HF8A 1OEDC 4IE4A 5ABHA 2Q9QA 2YU1A 1D1CA 4ILAA 4YTMA 3UT5E 4AISA 4DUYT 3KVAA 4JI5T 3K1SA 2HN2A 2LHNA 1IZNB 5GONE 4ZS2A 5J1GA 3FB2A 4BA9A 3AE6A 1XDPA 5IWAT 4AQGA 4AQYT 5LJMA 4WW0A 1BR4A 2XY8B 3CPZA 3PURA 4KX6A 5AQNB 1E1HB 2MAWA 2XM2A 3ZMVB 2YN6A 4JEUB 3SFDA 1X9BA 3ZC0A 1HCIA 3HI2A 1UGOA 3V5UA 5HCJA 1SUMB 4YSZA 3L39A 4QH1A 4JI8T 1YQ3A 4ZS3A 3RIUA 2CLYC 5L47A 1W0AA 5LJNA 3NKZA 5JH7E 2M6BA 4EB6E 2CWOA 3AB3B 3RC8A 2HPJA 5FP3A 2E9XC 2WDRA 3S4UA 1LVKA 2WAUA 5CB4E 1OEDA 1IJ5A 1FIOA 2JMKA 2DL1A 4IL9A 2RP4A 1UX4A 5DQVA 5J0ZA 5LHGB 3VR9A 2KINB 3ETVA 3P50A 2BVLA 2VQET 2KT9A 3ONXA 3RYFE 3EUHA 1T8BA 4EOZB 2HPLA 5LMUT 1W09A 1E7PA 4K0KT 3BQKA 1UURA 2KZ7B 3RX6A 5HXSA 2WZHA 4YSYA 2XQ5A 2W4XA 5HXEA 5C8YE 2WMNA 1ZHCA 1XMOT 2YDQA 3CKDA 1JNZA 4ZI3D 2UXCT 4DR2T 1HTJF 3OBVE 3VKHA 2E9XA 2XPKA 4WYVA 4AKIA 3RYCE 5JRCA 2J47A 4A97A 1I6ZA 3KVBA 4MFRA 5BMVE 3GA8A 3ABVA 3AE5A 3SRZA 2XQ8A 3ZMZB 4F8HA 2J62A 4FJOA 4ILCA 4Z90A 4EAHA 2J1DG 3UUNA 4DV1T 3SS1A 1HFAA 4HWIB 5AQMB 1CHUA 4QH5A 3UUBA 2B1EA 4JV5T 1R8IA 4TWDA 3HA4A 4KUMB 1IBKT 2XQYA 3RRCA 4A98A 2ES0A 2X0LB 3M65A 3SWHA 2V5DA 4NXMT 2JQQA 2CBIA 4EYYR 2BKPA 4IE0A 1IBMT 2Q9QD 1XNRT 3UQ7A 4YJ2E 2EHOC 3UUXB 4JI4T 5HWYA 2WWUA 1LVFA 3MK7C 3FZLB 3X1DA 2KWHA 2JJ9A 4CI3B 3EVYA 2D0TA 3IBPA 2XZEA 3JADA 3FZHB 3J7Yq 4PJJA 2I6HA 2LHRA 4LF5T 3FBLA 2FJEA 2QGSA 4DVDA 4LMLA 4PW8A 4IREA 5HXRA 1MIVA 4LF6T 4KHPT 3E22E 2K9AA 5CGMA 4TWHA 3QB5K 3NZPA 2MTQA 2BBJA 2NW9A 2NTXA 2MOZA 3KV6A 2VK9A 4I50E 3O4XE 4KMCA 2XQAA 3KDSE 2NW7A 1ZP0A 4CN4A 1OXZA 5HEUA 2QA7A 4DBRA 4CXYA 2EHOA 2IC6A 3PTRB 2KMFA 3ZMSB 3AECA 1JNRA 5FMNA 3FHNA 3EDVA 4WZXA 4PK4A 4H9RC 1GQEA 3N9OA 4X5TA 3RIFA 3C50A 5AQJB 3PUGA 2LSJA 5LCYA 4AXPA 1IJ6A 2XSAA 1N32T 3A5XA 4B3RT 3PDYA 2UXNB 2FJAA 4HWCA 4UV9B 3CX7B 4IDNA 3RH3A 2LSIA 3U78A 2NOXA 4UXNB 5L3FB 4UVAB 2GK9A 1V9DA 3EDUA 4UELA 3UUMA 1HR0T 4A56A 5L3BB 1U5PA 3UFGA 1QUUA 3C51A 4U74A 5HXCA 4YY3T 4GKKT 3D0TA 2WU2A 5L3DB 2M67A 3FXDB 4QXBB 3AXJB 2LKHA 3K3QC 2E9XD 5HYAA 5FL1A 3QB5A 2D5UA 3AA7B 4IGUA 5ABFA 4LF8T 3UU6A 3R6NA 4LF4T 2Y6XA 3AA6B 5AQQB 5AQUB 4O4LE 3N9LA 2BS4A 2WS3A 2WWVA 4HFIA 1YKHB 2UUBT 5LA6E 1HG2A 4H9PC 2LSGA 3KV9A 4F6RC 3EAMA 5LHHB 3KV5A 5DJQC 4CXXA 4YJ3E 2E5VA 2YKSA 4GYRA 5L4EA 4CQIA 5CA1E 3QOFA 4KP3C 1YXRA 3KBTA 2D9DA 4LMJA 3QK6A 4EYUA 4QX7B 1VCTA 2ODVA 4CI2B 1I94T 3QC9A 3CK6A 4Z8XA 5J2UE 3KBUA 5H6QB 2XM1A 2DLRA 2YEVC 4AIUA 2YK0A 2BKNA 1B7TA 4HFEA 4IDOA 4DR5T 4L0RA 2L3LA 1WCRA 1YW0A 3I9WA 3O1IA 3PU3A 4O4JE 2V1DB 1G8XA 5LGUB 3F31A 5FXXA 1KNRA 2LT3A 4MALA 5FVKA 3OYXA 2WY2A 2E2AA 2HN1A 4HN9A 3FZKB 4UR9A 4LFBT 4H9NC 3CQXC 1ZKEA 5FL0A 2BG9B 1BR2A 3UU4A 2RPAA 1KK7A 1MIYA 2N1GA 4ZI7E 4WBOA 1UX5A 2LKGA 2W00A 4HE8A 3BQLA 1D0YA 3AEAA 4ILBA 4HKAA 3L09A 2XQ4A 1XZYA 2CEAA 3T1HT 4EZHA 5EK3A 4HFHA 3RYIE 2H88A 3PJAJ 1AJ3A 1QLBA 5JTGA 4TX5A 2CMRA 3PJAA 2A9UA 3H3MA 3EI0A 2Q9QB 4AQFA 4H9OC 4O8SA 3ZMUB 1G73A 4V1Av 3RPUA 5AQLB 4QWNB 5HWXA 2X68A 2NP9A 3CWZB 1H7CA 4H63H 3BK9A 5DQWA 2WCAA 2WDQA 4N78D 4ISTA 3ESLA 3JCFA 3I1AA 1MMDA 2CXDA 4U31A 1S35A 1VRBA 4DV2T 5CA0E 3CX6B 3RIAA 1FMWA 2FJDA 2EHOD 2KWIB 3TLWA 3C4WA 2V8SV 5E0OA 2WZIA 2NTYA 4EEDA 4OK0A 4JLEA 4UF0A 1D1BA 3Q2MA 2F4VT 2X67A 3L8RA 2K3WA 2J4GA 4XZCA 2V26A 5JDFA 4LFAT 1ZEEA 3KINB 4PK6A 5AQOB 1QSDA 4U2ZA 1HX1B 4DUZT 3UFEA 2VKHA 4JI1T 5HEHA 4X1IE 3VKGA 3LSVA 4DR4T 4OYKA 3GN5B 4X20E 1MMGA 1NENA 4PJLA 4ZZBA 2VURA 3JC6C 1OEDB 2PJQA 3DP7A 4DV0T 1MIWA 4G2AA 2JIWA 1FJGT 2KXPB 3VRBA 1J5ET 5L3GB 4HFDA 3AEDA 3CIRA 2PTFA 5ABEA 3AE2A 2YDSA 3N2OA 5C2TA 4GK5E 2WU5A 2LOSA 3L3PA 3E08A 4WNKA
chains in the Genus database with same CATH topology
2WBLA 3N9QA 1U4QA 4P09A 4CXWA 3NBXX 4C90A 3J7Yq 4PJJA 2LE8A 3LK2B 4ZOLE 3LG7A 3AA0B 2LHRA 2C5KT 3FBLA 3RC3A 4GK0E 4K0UA 4ASKA 3PUSA 1UCUA 3HKBE 2XHEB 3T8OA 1WRDA 4PK5A 4XBFB 2QGSA 3ZYMA 4DVDA 4YLHA 4PW8A 3Q9DA 1MMNA 4DMVA 2ACXA 4ADZA 2DI4A 2XASB 3ETUA 4IHJE 5HXRA 1MIVA 4ERRA 3P8CD 2L8KA 2W0GA 5L2LA 4QKNA 3ZYLA 2LJLA 4PNIA 2D0UA 4O4IE 3E22E 5KDMC 2X9WA 2K9AA 2CCQA 2VASA 2VWAA 5LP6E 3N9PA 4NUUA 4PFPA 1YD8G 2KNDA 3HKCE 2Y8DA 5M4YA 2SPCA 3NZPA 2CLYB 2ZM8A 4UVCB 2MTQA 4ZI2C 4PFOA 4L5GA 4PJMA 4HEAA 4I4TE 1VOMA 2E9XB 3U3IA 3AVSA 2NW9A 3ZN1B 2N9DA 3MXZA 2NTXA 1LRZA 3LJCA 2MOZA 2Q9QC 2P9BA 3KV6A 1D0XA 5JRCB 2VK9A 2VKJA 2BZBA 4I50E 4IIJE 3WAJA 1D0ZA 3B13A 3DTOA 3O4XE 2YU2A 4IE5A 5FNVE 2WSSV 2XAFB 4KMCA 2DWGA 3Q5XA 1NAFA 3AAIA 3R84B 3C4XA 2LEHA 5LBMA 3KDSE 3I0QA 3ZCIA 2NW7A 4UF0B 2KLQA 2V7LA 1OXZA 1FMVA 3HKDE 4ZHQE 5JR9C 3MA9A 3MZKB 2QA7A 4DBRA 2NWBA 2H7OA 4CXYA 2EHOA 2V7JA 2IC6A 2C0SA 3AAAB 3K8PC 3NRYA 5FY0A 1MNDA 3PTRB 2IW5B 3HR0A 5LG4A 2KMFA 5JVDE 3WAKA 2ZMAA 3ZMSB 2DCFA 5FXVA 1WYCA 5FMNA 3FHNA 3EDVA 3P7IA 4FI5A 3KFWX 4PK4A 4H9RC 5EZYE 4JUYA 3GN5A 3N9OA 5FY1A 2Y48B 1MMAA 3N5LA 1OWAA 1US7B 3HL6A 4EXTA 3ANWA 3F2EA 2PBIA 3O1JA 4ISSA 3C50A 3PUGA 5JDMA 2LSJA 4QXHB 2JPFA 5LCYA 2DHRA 3RYHE 4AXPA 4UV8B 1IJ6A 2V7KA 3A5XA 3PDYA 3O1HA 1HG5A 4BJMA 2UXNB 3E0ZA 3IEEA 2LSYA 5JDQA 2X9XA 5KX5E 4BAYB 4UV9B 3CX7B 3RH3A 2XAHB 2LSIA 2XAQB 2IC9A 3OYZA 3U78A 2NOXA 4EIWA 4B6XA 4UXNB 5L3FB 4UVAB 2GK9A 4O2BE 2PG8A 3TKLB 2MYSA 1V9DA 4ILUA 3EDUA 4UELA 1WLXA 2JRKA 5A1LA 3UUMA 3N9MA 1BR1A 2OA5A 4A56A 1U5PA 3MKDA 4QHOA 5L3BB 1QUUA 3C51A 4H63V 4U74A 4GOUA 3LBXA 5HXCA 1BR0A 3PE0A 1HF8A 2BDEA 3D0TA 4IE4A 2Q9QA 4AKRB 5L3DB 2M67A 3FXDB 4QXBB 4QXCB 3SOLA 2YU1A 3GMIA 3K3QC 2E9XD 5HYAA 1D1CA 4CZZB 1Y64B 3DJBA 2D5UA 3AA7B 4IGUA 4ANJA 2K48A 4IE6A 3UT5E 3KVAA 3R6NA 3AA1B 2Y6XA 2LHNA 2LOPA 1IZNB 5GONE 3BQIA 4ZS2A 5JR9A 3AA6B 4MBQA 5J1GA 5ETWA 3FB2A 4BA9A 4AQGA 4O4LE 2H7VC 4MHCA 3GWHA 3FXEB 3N9LA 5LJMA 4DNDA 2A3DA 4WW0A 1HX8A 1YKHB 1BR4A 2CM0A 3K3OA 3CPZA 1HG2A 3PURA 4OFZA 5FY7A 5LA6E 2JMHA 2ZLYA 1E1HB 2W62A 4H9PC 3ZMVB 2LSGA 3KV9A 3IF8B 4JEUB 3K3NA 4F6RC 4UEMA 3N2KE 5LHHB 2Z6EA 3KV5A 3IHRA 4J2CA 5DJQC 4H9SE 5LYJE 3ZC0A 1HCIA 3ZN0B 4CXXA 4QX8B 4YJ3E 3HI2A 3VHLA 4GYRA 1FEWA 5FXWA 2K5BB 2XUEA 4CQIA 5CA1E 5IYZE 3V5UA 5JDHA 2XAJB 4H9QC 4KP3C 3KBTA 3QK6A 4EYUA 3C64A 4QX7B 2MBGA 2X51A 2ODVA 2YINA 3NZQA 4CI2B 2WMOA 5LNKA 5LXTE 3QC9A 4ZS3A 4DO0A 5KMGP 4Z8XA 2CLYC 5LJNA 4EZ4A 1KNZA 2VB6A 5J2UE 3KBUA 2EHOB 2ZM0A 2CXFA 2E8IA 5H6QB 2DLRA 5JH7E 4C91A 1SA0E 4YHJA 4EB6E 2CWOA 3AB3B 3RC8A 2HPJA 5FP3A 2YEVC 2E9XC 4AKGA 1IAPA 3S4UA 2YK0A 2XTLA 1B7TA 1LVKA 1S94A 4IE7A 1Z0PA 5LGTB 1X79A 4L0RA 2L3LA 2WAUA 3OKQA 5CB4E 1YW0A 4P0BA 3I9WA 3CMLA 3O1IA 1IJ5A 3MJXA 1SHZC 3PU3A 2C5IT 4O4JE 1FIOA 2CWYA 2JMKA 4NUVA 2V1DB 1G8XA 5LGUB 5FXZA 4HTEA 3F31A 5FXXA 3ZPOA 2RA1A 5DABA 4ZI3C 4GYSA 2H3RA 2LT3A 3C4ZA 4MALA 3OYXA 2RP4A 4TUYE 5FYMA 2X9YA 1UX4A 2DWKA 4HN9A 1WYBA 4BJNA 3O9XA 5DQVA 3NRXA 4H9NC 3J9X1 1T98A 3CQCB 3CQXC 1ZKEA 5LHGB 2VKOA 1BR2A 3N9NA 2KINB 5H6RB 3ETVA 3MACA 3ZLIA 1KK7A 2BVLA 1MIYA 2N1GA 5HAXA 4ZI7E 4WBOA 4I43B 1UX5A 3V5SA 2IAKA 2W00A 4HE8A 2CE7A 2KT9A 2A72A 3ZJ1A 4PAGA 3BQLA 4PJNA 1D0YA 4HFVA 3ONXA 3H3AA 1MNEA 3L09A 3LFMA 4HKAA 4YFSA 5LHIB 3RYFE 2CEAA 4TV9E 3EUHA 3ZJ2A 4EOZB 4EZHA 2HPLA 5EK3A 2W61A 1YKEB 2C5JA 3RYIE 3WI3A 2VKDA 1AJ3A 4TX5A 2D2SA 3BQKA 4O4HE 3LBXB 2CMRA 5EK4A 3CX8B 3AAEB 2X9HA 2KZ7B 5AFUL 2Q9QB 3RX6A 2VL8A 4AQFA 1D1AA 5HXSA 4H9OC 4O8SA 4HGAA 5HXEA 5C8YE 3ZMUB 1G73A 4V1Av 1EZ3A 2LM9A 4U72A 3RRWA 2WMNA 1ZHCA 3RPUA 4QWNB 5HWXA 2X68A 2G0UA 2NP9A 1H7CA 3CKDA 3CWZB 3W15B 4ZI3D 5ADXL 4H63H 3BK9A 3JC6D 5DQWA 3CVRA 5JDLA 3H37A 4AI6A 3AVRA 4N78D 5JR9B 4ISTA 3ESLA 3RKOA 3ZEFB 5J2TE 3I1AA 1HTJF 1MMDA 2ZM2A 4UIGA 5TAOA 2HH7A 3OBVE 4G63A 2CXDA 3VKHA 4DBQA 1S35A 1VRBA 4WBNE 5HXHA 2E9XA 2XAGB 5CA0E 5L3EB 3CX6B 4X1KE 4AKIA 1FMWA 3CQGB 2LSKA 2EHOD 3RYCE 5JRCA 3N2GE 1NWMX 2V7IA 4TZ4C 3KVBA 2KWIB 4MFRA 5BMVE 3GA8A 2N2NA 4AQFC 3C4WA 1WR6A 4CI1B 5IHYA 4O2AE 4TV8E 3SRZA 3ZYKA 5E0OA 2X66A 4IDZA 2NTYA 5LGNB 3ZMTB 4OK0A 4JLEA 4E7SA 3B57A 4UF0A 1D1BA 2A2FX 3Q2MA 2X67A 3ZMZB 2I59A 4FJOA 2WM9A 4L9IA 4XZCA 4P0AA 4EAHA 2CXLA 2V26A 2J1DG 4GIWA 2CA5A 1LKXA 3HKEE 3PUQA 3UUNA 5JDFA 5LBQB 4DMWA 3PUAA 2DNXA 1ZEEA 3KINB 4PK6A 3SS1A 1QSDA 1HFAA 1CUNA 2V7MA 3FBZA 5JQGE 4JEHB 4MLKA 3UTKA 3UFEA 4X1YE 3ZC1A 2VKHA 2UXXB 4OYJA 5F3JA 2NW8A 2B1EA 2BVMA 2PFVA 3LK42 4X1IE 4KBMB 3VKGA 3I9YA 3C98B 1O3XA 3HA4A 4TN7B 5EK2A 4KUMB 3F57A 3GN5B 4OYKA 4X20E 2XQYA 1MMGA 5JDNA 4PJLA 3RRCA 3VU7H 1HS7A 3ANWB 3OJAA 3JC6C 2W63A 4XAXB 5JDGA 4AKLA 4E7ZA 2PJQA 3DP7A 2ES0A 1MIWA 2X0LB 4G2AA 3M65A 3SWHA 4ZI2D 3Q5WA 5JREA 2KXPB 3KV4A 2JQQA 4EYYR 4AKHA 5L3CB 5L3GB 1ZV4X 4IE0A 2Q9QD 4M1PA 4YJ2E 2EHOC 3UUXB 2K24A 3N2OA 2L9QA 2WWUA 5HWYA 1LVFA 4GK5E 4OHFA 3MK7C 3PU8A 3ZCJA 3LK3B 4UVBB 2KWHA 2JJ9A 2LOSA 3L3PA 2ODUA 5LOVE 4CI3B 3E08A 3UULA 3EVYA 2D0TA 5F8PA 4WNKA 3QUJA 3IBPA 3I0OA 4I55E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LCY A;  3AAI A;  4M1P A;  5LBM A;  4UIG A;  4ADZ A;  2HH7 A;  5FMN A; 
#chains in the Genus database with same CATH topology
 2WBL A;  1U4Q A;  4C90 A;  4ZOL E;  3LK2 B;  3LG7 A;  2C5K T;  3LDQ B;  3PUS A;  2IUB A;  3HKB E;  2VVS A;  2W2U A;  3T8O A;  4XBF B;  4QH4 A;  4YLH A;  3PUX F;  1MMN A;  2WP9 A;  3P8C D;  3M3Z B;  2FJB A;  2LJL A;  5KDM C;  2X9W A;  2CCQ A;  2VAS A;  2VWA A;  3PV0 F;  1YD8 G;  3HKC E;  4IDQ A;  2CLY B;  2ZM8 A;  4PFO A;  4L5G A;  4TNW A;  4PJM A;  4HEA A;  4I4T E;  1VOM A;  2E9X B;  3LJC A;  5JRC B;  4DV4 T;  1D0Z A;  2XAF B;  2LEH A;  5AQV B;  2V7L A;  5JR9 C;  3HKD E;  3MA9 A;  3MZK B;  1N36 T;  2H7O A;  2CBJ A;  1J1J A;  2C0S A;  3AAA B;  2V6Y B;  5FY0 A;  1MND A;  2OV9 A;  2LRK A;  3HR0 A;  4U7Y A;  2DCF A;  5AQI B;  5FXV A;  1WYC A;  3KFW X;  5EZY E;  4KHZ F;  2AXD S;  2H89 A;  3N5L A;  1OWA A;  3HL6 A;  3F2E A;  4CN1 A;  4ISS A;  1J5W A;  5JDM A;  3ZT7 A;  3ONL C;  5FVL A;  4QXH B;  2JPF A;  1VCS A;  2V7K A;  3PUV F;  5BR8 T;  4DR1 T;  4OX9 T;  5C3J A;  1E2A A;  2E5L T;  3IEE A;  5JDQ A;  2X9X A;  5KX5 E;  4BAY B;  2CHN A;  4IDP A;  2XAH B;  2PG8 A;  2V6X A;  1BR1 A;  4QHO A;  1BR0 A;  3LBX A;  2YDR A;  2UUC T;  2BDE A;  2BS3 A;  1DU2 A;  4AKR B;  3SOL A;  4CZZ B;  4LFC T;  4HWF A;  3DJB A;  3P4W A;  4ANJ A;  3P4Q A;  4IE6 A;  2WQY A;  2LOP A;  5JR9 A;  4MBQ A;  3UU8 A;  4MHC A;  3GWH A;  3FXE B;  4DND A;  4JBW F;  3JAF A;  2CM0 A;  3K3O A;  2JMH A;  2ZLY A;  2W62 A;  3AE9 A;  3RQU A;  3IF8 B;  3AE4 A;  3N2K E;  2Z6E A;  3IHR A;  5LYJ E;  2OLT A;  4QX8 B;  3VHL A;  3EAB A;  1YQ4 A;  2XUE A;  3AE1 A;  4NIQ A;  3C64 A;  4HWD A;  2X51 A;  3NZQ A;  5LXT E;  2WMO A;  4DO0 A;  2VB6 A;  2EHO B;  2CXF A;  2WDV A;  1SA0 E;  5AQS B;  4EV6 A;  4AKG A;  3NVO A;  4IE7 A;  3RGL A;  3OKQ A;  4COF A;  4P0B A;  3CML A;  3MJX A;  1SHZ C;  2C5I T;  2CWY A;  4NUV A;  5FXZ A;  4HTE A;  4LF9 T;  3ZPO A;  4ZI3 C;  2H3R A;  3P4S A;  5FYM A;  2X9Y A;  2FBW A;  2DWK A;  1WYB A;  4BJN A;  1T98 A;  3CQC B;  2UXB T;  4YXD A;  3N9N A;  5HEG A;  5H6R B;  3ZLI A;  4I43 B;  3V5S A;  2IAK A;  2CE7 A;  2A72 A;  3ZJ1 A;  4HFV A;  3H3A A;  3LFM A;  2IHR 1;  1XMQ T;  3ZJ2 A;  4I0U A;  2W61 A;  2VKD A;  2JQ9 A;  4O4H E;  5EK4 A;  3ZT5 A;  1M62 A;  1NEK A;  4YTP A;  3TLT A;  1T72 A;  3JAE A;  2LM9 A;  2X0H A;  1XNQ T;  5HCM A;  2G0U A;  3B5M A;  3JC6 D;  3H37 A;  4YT0 A;  3AVR A;  3RKO A;  3ZEF B;  5J2T E;  2ZM2 A;  4UIG A;  5HEO A;  2HH7 A;  2UXD T;  4DBQ A;  4WBN E;  5L3E B;  3CQG B;  2LSK A;  3N2G E;  4TZ4 C;  4AQF C;  4CI1 B;  4TV8 E;  3ZYK A;  2X66 A;  4IDZ A;  3RLF F;  5LGN B;  3ZMT B;  3B57 A;  2A2F X;  2JQK A;  2WM9 A;  4L9I A;  4P0A A;  3HKE E;  3PUQ A;  5LBQ B;  4DMW A;  3PUA A;  2DNX A;  2V7M A;  3FBZ A;  5JQG E;  3UTK A;  1Z8U A;  4X1Y E;  3ZC1 A;  5F3J A;  4OYJ A;  2BBH A;  2BVM A;  2B76 A;  4IL4 A;  2PFV A;  4KBM B;  2CHO A;  3TLU A;  4X62 T;  3I9Y A;  4DR6 T;  3P4P A;  1O3X A;  5EK2 A;  2NR4 A;  5JDN A;  2X0Y A;  3ANW B;  4XAX B;  4AKL A;  4E7Z A;  3IA3 A;  2VQF T;  5JRE A;  3KV4 A;  5L3C B;  5CJ5 A;  2QVA A;  2XQ7 A;  4OHF A;  2JQH A;  3ZCJ A;  4UVB B;  1M7K A;  5AQP B;  2ODU A;  5F8P A;  3QUJ A;  3I0O A;  2AE9 A;  4I55 E;  1L0V A;  3N9Q A;  4P09 A;  4CXW A;  3A8Y C;  3TLV A;  3RC3 A;  2BG9 E;  4ASK A;  4YTN A;  4EEB A;  3ZSS A;  2KSR A;  3Q9D A;  1W9R A;  2ACX A;  3AE3 A;  3ONJ A;  4IHJ E;  2XQ9 A;  3VR8 A;  3UU5 A;  2L8K A;  2IIU A;  4PNI A;  2D0U A;  3OTO T;  1UUS A;  2XJ7 A;  3UQ4 A;  3N9P A;  4P1N A;  5LMN T;  5M4Y A;  2KND A;  2Y8D A;  4B3T T;  4UVC B;  4ZI2 C;  4ZEY A;  4NXN T;  3RKG A;  3ZN1 B;  2N9D A;  3MXZ A;  1LRZ A;  2XQ3 A;  1D0X A;  1W0B A;  2BZB A;  4IIJ E;  3DTO A;  2YOE A;  4JI7 T;  2YU2 A;  2WSS V;  2DWG A;  3Q5X A;  3AAI A;  1UK5 A;  3C4X A;  5LBM A;  4A5X A;  4UF0 B;  2KLQ A;  4ZHQ E;  3QNU A;  4LMK A;  3AE8 A;  2V7J A;  3K8P C;  3NRY A;  3T1Y T;  3PUW F;  2IW5 B;  5LG4 A;  3WAK A;  4B3S T;  4JUY A;  3GN5 A;  5FY1 A;  1MMA A;  1Y01 A;  4EXT A;  3O1J A;  2R6G F;  2DHR A;  3E0Z A;  2XQ6 A;  4DV5 T;  3ZT6 A;  1HNZ T;  2IC9 A;  4B6X A;  1OED E;  4O2B E;  4HWH A;  2MYS A;  4ILU A;  1WLX A;  2JRK A;  5A1L A;  3N9M A;  2CRB A;  1N33 T;  3MKD A;  4DV6 T;  4GOU A;  3PE0 A;  3NWI A;  3OPC A;  4QXC B;  3GMI A;  2XSB A;  1Y64 B;  2K48 A;  3RQW A;  2VVN A;  3AA1 B;  3BQI A;  2W67 A;  3AEB A;  5ETW A;  5LG3 A;  2H7V C;  2A3D A;  1HX8 A;  4TNV A;  4OFZ A;  5FY7 A;  3K3N A;  4JYA T;  4UEM A;  4J2C A;  2BS2 A;  4H9S E;  3ZN0 B;  5LB7 B;  5FXW A;  1FEW A;  2K5B B;  5IYZ E;  5JDH A;  2XAJ B;  4H9Q C;  3TLS A;  2MBG A;  4U3C A;  2YIN A;  5LNK A;  2V6Y A;  5KMG P;  2LRL A;  4EZ4 A;  4JI3 T;  1KNZ A;  4JI6 T;  2ZM0 A;  2E8I A;  4C91 A;  4YHJ A;  4X65 T;  1IAP A;  1WFD A;  2XTL A;  1S94 A;  4X66 T;  1Z0P A;  3AE7 A;  1X79 A;  5LGT B;  3RI5 A;  1XWM A;  2RA1 A;  5DAB A;  4GYS A;  3C4Z A;  3EHZ A;  4TUY E;  4ZZC A;  4X64 T;  5AQH B;  3O9X A;  3FZM B;  3NRX A;  3SFE A;  3J9X 1;  4YSX A;  2M6I A;  2VKO A;  3MAC A;  1KFY A;  3Q5D A;  5HAX A;  4DV7 T;  4PAG A;  4PJN A;  4YFS A;  1MNE A;  5LHI B;  5IUX A;  4TV9 E;  1SE7 A;  5AQG B;  5AQR B;  1YKE B;  2C5J A;  1KNP A;  3WI3 A;  2D2S A;  3LBX B;  2MPK A;  3CX8 B;  5FKY A;  3AAE B;  5AQK B;  2X9H A;  5AFU L;  2VL8 A;  1D1A A;  4HGA A;  1EZ3 A;  4U72 A;  3RRW A;  4U7I A;  5HEJ A;  3W15 B;  5ADX L;  3CVR A;  5JDL A;  4AI6 A;  2WB5 A;  3UU3 A;  5JR9 B;  3G06 A;  3A7M A;  5AQF B;  4ZXL A;  2ZM6 T;  5TAO A;  4G63 A;  5L4H A;  5HXH A;  2XAG B;  4U2Y A;  4X1K E;  2ACZ A;  2LLY A;  1NWM X;  2V7I A;  2QRX A;  4LF7 T;  2N2N A;  2V5C A;  3ZKR A;  1WR6 A;  2FUP A;  5IHY A;  4O2A E;  3ZST A;  4B3M T;  4Q25 A;  2UU9 T;  4KI0 F;  4E7S A;  2I59 A;  1HNX T;  2CXL A;  2QYW A;  4GIW A;  2CA5 A;  2LM2 A;  1LKX A;  3Q5E A;  4TWF A;  1CUN A;  4JEH B;  4MLK A;  2UXX B;  2NW8 A;  3RF1 A;  3LK4 2;  4DR7 T;  2BKO A;  4NPP A;  3C98 B;  4HFC A;  4TN7 B;  3F57 A;  4DV3 T;  1IBL T;  3VU7 H;  1HS7 A;  3OJA A;  2W63 A;  5ABG A;  5JDG A;  3PUZ F;  2VL0 A;  1N34 T;  4ZI2 D;  3Q5W A;  4AKH A;  2CPT A;  1ZV4 X;  3AEF A;  4M1P A;  5F5W A;  2K24 A;  2L9Q A;  3PU8 A;  3LK3 B;  5LOV E;  3UUL A;  4GKJ T;  2UUA T;  3NBX X;  4JI0 T;  4JI2 T;  1ZOY A;  2LE8 A;  3AXJ A;  3AA0 B;  4GK0 E;  4K0U A;  1UCU A;  2XHE B;  4HFB A;  1WRD A;  4PK5 A;  3ZYM A;  5ABF B;  2BG9 C;  4DMV A;  4ADZ A;  2DI4 A;  2XAS B;  3ETU A;  4ERR A;  2W0G A;  5L2L A;  4QKN A;  3ZYL A;  1KF6 A;  4O4I E;  5LP6 E;  3FZF B;  1T7S A;  4NUU A;  4PFP A;  2SPC A;  5CFB A;  2IML A;  4IT4 A;  3U3I A;  4Z91 A;  3AVS A;  2P9B A;  2Q9Q C;  3P4R A;  2VKJ A;  3WAJ A;  2HHH T;  3B13 A;  4IE5 A;  5FNV E;  1NAF A;  3R84 B;  1XDO A;  3I0Q A;  3ZCI A;  4EGW A;  1WR0 A;  1FMV A;  1KEY A;  2NWB A;  4YHH T;  4DID B;  5KXJ A;  5JVD E;  2W66 A;  2ZMA A;  3AEE A;  3VRA A;  3OVU A;  3P7I A;  4FI5 A;  3AEG A;  2Y48 B;  1US7 B;  4U33 A;  3ANW A;  2PBI A;  3PUY F;  3RYH E;  4UV8 B;  2BG9 A;  3RHW A;  3O1H A;  1HG5 A;  4BJM A;  2LSY A;  5AQT B;  3RIU C;  2IDO B;  1HNW T;  2XAQ B;  3OYZ A;  4EIW A;  2I0M A;  3TKL B;  2OA5 A;  4H63 V;  4DR3 T;  4CN6 A;  1HF8 A;  1OED C;  4IE4 A;  5ABH A;  2Q9Q A;  2YU1 A;  1D1C A;  4ILA A;  4YTM A;  3UT5 E;  4AIS A;  4DUY T;  3KVA A;  4JI5 T;  3K1S A;  2HN2 A;  2LHN A;  1IZN B;  5GON E;  4ZS2 A;  5J1G A;  3FB2 A;  4BA9 A;  3AE6 A;  1XDP A;  5IWA T;  4AQG A;  4AQY T;  5LJM A;  4WW0 A;  1BR4 A;  2XY8 B;  3CPZ A;  3PUR A;  4KX6 A;  5AQN B;  1E1H B;  2MAW A;  2XM2 A;  3ZMV B;  2YN6 A;  4JEU B;  3SFD A;  1X9B A;  3ZC0 A;  1HCI A;  3HI2 A;  1UGO A;  3V5U A;  5HCJ A;  1SUM B;  4YSZ A;  3L39 A;  4QH1 A;  4JI8 T;  1YQ3 A;  4ZS3 A;  3RIU A;  2CLY C;  5L47 A;  1W0A A;  5LJN A;  3NKZ A;  5JH7 E;  2M6B A;  4EB6 E;  2CWO A;  3AB3 B;  3RC8 A;  2HPJ A;  5FP3 A;  2E9X C;  2WDR A;  3S4U A;  1LVK A;  2WAU A;  5CB4 E;  1OED A;  1IJ5 A;  1FIO A;  2JMK A;  2DL1 A;  4IL9 A;  2RP4 A;  1UX4 A;  5DQV A;  5J0Z A;  5LHG B;  3VR9 A;  2KIN B;  3ETV A;  3P50 A;  2BVL A;  2VQE T;  2KT9 A;  3ONX A;  3RYF E;  3EUH A;  1T8B A;  4EOZ B;  2HPL A;  5LMU T;  1W09 A;  1E7P A;  4K0K T;  3BQK A;  1UUR A;  2KZ7 B;  3RX6 A;  5HXS A;  2WZH A;  4YSY A;  2XQ5 A;  2W4X A;  5HXE A;  5C8Y E;  2WMN A;  1ZHC A;  1XMO T;  2YDQ A;  3CKD A;  1JNZ A;  4ZI3 D;  2UXC T;  4DR2 T;  1HTJ F;  3OBV E;  3VKH A;  2E9X A;  2XPK A;  4WYV A;  4AKI A;  3RYC E;  5JRC A;  2J47 A;  4A97 A;  1I6Z A;  3KVB A;  4MFR A;  5BMV E;  3GA8 A;  3ABV A;  3AE5 A;  3SRZ A;  2XQ8 A;  3ZMZ B;  4F8H A;  2J62 A;  4FJO A;  4ILC A;  4Z90 A;  4EAH A;  2J1D G;  3UUN A;  4DV1 T;  3SS1 A;  1HFA A;  4HWI B;  5AQM B;  1CHU A;  4QH5 A;  3UUB A;  2B1E A;  4JV5 T;  1R8I A;  4TWD A;  3HA4 A;  4KUM B;  1IBK T;  2XQY A;  3RRC A;  4A98 A;  2ES0 A;  2X0L B;  3M65 A;  3SWH A;  2V5D A;  4NXM T;  2JQQ A;  2CBI A;  4EYY R;  2BKP A;  4IE0 A;  1IBM T;  2Q9Q D;  1XNR T;  3UQ7 A;  4YJ2 E;  2EHO C;  3UUX B;  4JI4 T;  5HWY A;  2WWU A;  1LVF A;  3MK7 C;  3FZL B;  3X1D A;  2KWH A;  2JJ9 A;  4CI3 B;  3EVY A;  2D0T A;  3IBP A;  2XZE A;  3JAD A;  3FZH B;  3J7Y q;  4PJJ A;  2I6H A;  2LHR A;  4LF5 T;  3FBL A;  2FJE A;  2QGS A;  4DVD A;  4LML A;  4PW8 A;  4IRE A;  5HXR A;  1MIV A;  4LF6 T;  4KHP T;  3E22 E;  2K9A A;  5CGM A;  4TWH A;  3QB5 K;  3NZP A;  2MTQ A;  2BBJ A;  2NW9 A;  2NTX A;  2MOZ A;  3KV6 A;  2VK9 A;  4I50 E;  3O4X E;  4KMC A;  2XQA A;  3KDS E;  2NW7 A;  1ZP0 A;  4CN4 A;  1OXZ A;  5HEU A;  2QA7 A;  4DBR A;  4CXY A;  2EHO A;  2IC6 A;  3PTR B;  2KMF A;  3ZMS B;  3AEC A;  1JNR A;  5FMN A;  3FHN A;  3EDV A;  4WZX A;  4PK4 A;  4H9R C;  1GQE A;  3N9O A;  4X5T A;  3RIF A;  3C50 A;  5AQJ B;  3PUG A;  2LSJ A;  5LCY A;  4AXP A;  1IJ6 A;  2XSA A;  1N32 T;  3A5X A;  4B3R T;  3PDY A;  2UXN B;  2FJA A;  4HWC A;  4UV9 B;  3CX7 B;  4IDN A;  3RH3 A;  2LSI A;  3U78 A;  2NOX A;  4UXN B;  5L3F B;  4UVA B;  2GK9 A;  1V9D A;  3EDU A;  4UEL A;  3UUM A;  1HR0 T;  4A56 A;  5L3B B;  1U5P A;  3UFG A;  1QUU A;  3C51 A;  4U74 A;  5HXC A;  4YY3 T;  4GKK T;  3D0T A;  2WU2 A;  5L3D B;  2M67 A;  3FXD B;  4QXB B;  3AXJ B;  2LKH A;  3K3Q C;  2E9X D;  5HYA A;  5FL1 A;  3QB5 A;  2D5U A;  3AA7 B;  4IGU A;  5ABF A;  4LF8 T;  3UU6 A;  3R6N A;  4LF4 T;  2Y6X A;  3AA6 B;  5AQQ B;  5AQU B;  4O4L E;  3N9L A;  2BS4 A;  2WS3 A;  2WWV A;  4HFI A;  1YKH B;  2UUB T;  5LA6 E;  1HG2 A;  4H9P C;  2LSG A;  3KV9 A;  4F6R C;  3EAM A;  5LHH B;  3KV5 A;  5DJQ C;  4CXX A;  4YJ3 E;  2E5V A;  2YKS A;  4GYR A;  5L4E A;  4CQI A;  5CA1 E;  3QOF A;  4KP3 C;  1YXR A;  3KBT A;  2D9D A;  4LMJ A;  3QK6 A;  4EYU A;  4QX7 B;  1VCT A;  2ODV A;  4CI2 B;  1I94 T;  3QC9 A;  3CK6 A;  4Z8X A;  5J2U E;  3KBU A;  5H6Q B;  2XM1 A;  2DLR A;  2YEV C;  4AIU A;  2YK0 A;  2BKN A;  1B7T A;  4HFE A;  4IDO A;  4DR5 T;  4L0R A;  2L3L A;  1WCR A;  1YW0 A;  3I9W A;  3O1I A;  3PU3 A;  4O4J E;  2V1D B;  1G8X A;  5LGU B;  3F31 A;  5FXX A;  1KNR A;  2LT3 A;  4MAL A;  5FVK A;  3OYX A;  2WY2 A;  2E2A A;  2HN1 A;  4HN9 A;  3FZK B;  4UR9 A;  4LFB T;  4H9N C;  3CQX C;  1ZKE A;  5FL0 A;  2BG9 B;  1BR2 A;  3UU4 A;  2RPA A;  1KK7 A;  1MIY A;  2N1G A;  4ZI7 E;  4WBO A;  1UX5 A;  2LKG A;  2W00 A;  4HE8 A;  3BQL A;  1D0Y A;  3AEA A;  4ILB A;  4HKA A;  3L09 A;  2XQ4 A;  1XZY A;  2CEA A;  3T1H T;  4EZH A;  5EK3 A;  4HFH A;  3RYI E;  2H88 A;  3PJA J;  1AJ3 A;  1QLB A;  5JTG A;  4TX5 A;  2CMR A;  3PJA A;  2A9U A;  3H3M A;  3EI0 A;  2Q9Q B;  4AQF A;  4H9O C;  4O8S A;  3ZMU B;  1G73 A;  4V1A v;  3RPU A;  5AQL B;  4QWN B;  5HWX A;  2X68 A;  2NP9 A;  3CWZ B;  1H7C A;  4H63 H;  3BK9 A;  5DQW A;  2WCA A;  2WDQ A;  4N78 D;  4IST A;  3ESL A;  3JCF A;  3I1A A;  1MMD A;  2CXD A;  4U31 A;  1S35 A;  1VRB A;  4DV2 T;  5CA0 E;  3CX6 B;  3RIA A;  1FMW A;  2FJD A;  2EHO D;  2KWI B;  3TLW A;  3C4W A;  2V8S V;  5E0O A;  2WZI A;  2NTY A;  4EED A;  4OK0 A;  4JLE A;  4UF0 A;  1D1B A;  3Q2M A;  2F4V T;  2X67 A;  3L8R A;  2K3W A;  2J4G A;  4XZC A;  2V26 A;  5JDF A;  4LFA T;  1ZEE A;  3KIN B;  4PK6 A;  5AQO B;  1QSD A;  4U2Z A;  1HX1 B;  4DUZ T;  3UFE A;  2VKH A;  4JI1 T;  5HEH A;  4X1I E;  3VKG A;  3LSV A;  4DR4 T;  4OYK A;  3GN5 B;  4X20 E;  1MMG A;  1NEN A;  4PJL A;  4ZZB A;  2VUR A;  3JC6 C;  1OED B;  2PJQ A;  3DP7 A;  4DV0 T;  1MIW A;  4G2A A;  2JIW A;  1FJG T;  2KXP B;  3VRB A;  1J5E T;  5L3G B;  4HFD A;  3AED A;  3CIR A;  2PTF A;  5ABE A;  3AE2 A;  2YDS A;  3N2O A;  5C2T A;  4GK5 E;  2WU5 A;  2LOS A;  3L3P A;  3E08 A;  4WNK A; 
#chains in the Genus database with same CATH homology
 2WBL A;  3N9Q A;  1U4Q A;  4P09 A;  4CXW A;  3NBX X;  4C90 A;  3J7Y q;  4PJJ A;  2LE8 A;  3LK2 B;  4ZOL E;  3LG7 A;  3AA0 B;  2LHR A;  2C5K T;  3FBL A;  3RC3 A;  4GK0 E;  4K0U A;  4ASK A;  3PUS A;  1UCU A;  3HKB E;  2XHE B;  3T8O A;  1WRD A;  4PK5 A;  4XBF B;  2QGS A;  3ZYM A;  4DVD A;  4YLH A;  4PW8 A;  3Q9D A;  1MMN A;  4DMV A;  2ACX A;  4ADZ A;  2DI4 A;  2XAS B;  3ETU A;  4IHJ E;  5HXR A;  1MIV A;  4ERR A;  3P8C D;  2L8K A;  2W0G A;  5L2L A;  4QKN A;  3ZYL A;  2LJL A;  4PNI A;  2D0U A;  4O4I E;  3E22 E;  5KDM C;  2X9W A;  2K9A A;  2CCQ A;  2VAS A;  2VWA A;  5LP6 E;  3N9P A;  4NUU A;  4PFP A;  1YD8 G;  2KND A;  3HKC E;  2Y8D A;  5M4Y A;  2SPC A;  3NZP A;  2CLY B;  2ZM8 A;  4UVC B;  2MTQ A;  4ZI2 C;  4PFO A;  4L5G A;  4PJM A;  4HEA A;  4I4T E;  1VOM A;  2E9X B;  3U3I A;  3AVS A;  2NW9 A;  3ZN1 B;  2N9D A;  3MXZ A;  2NTX A;  1LRZ A;  3LJC A;  2MOZ A;  2Q9Q C;  2P9B A;  3KV6 A;  1D0X A;  5JRC B;  2VK9 A;  2VKJ A;  2BZB A;  4I50 E;  4IIJ E;  3WAJ A;  1D0Z A;  3B13 A;  3DTO A;  3O4X E;  2YU2 A;  4IE5 A;  5FNV E;  2WSS V;  2XAF B;  4KMC A;  2DWG A;  3Q5X A;  1NAF A;  3AAI A;  3R84 B;  3C4X A;  2LEH A;  5LBM A;  3KDS E;  3I0Q A;  3ZCI A;  2NW7 A;  4UF0 B;  2KLQ A;  2V7L A;  1OXZ A;  1FMV A;  3HKD E;  4ZHQ E;  5JR9 C;  3MA9 A;  3MZK B;  2QA7 A;  4DBR A;  2NWB A;  2H7O A;  4CXY A;  2EHO A;  2V7J A;  2IC6 A;  2C0S A;  3AAA B;  3K8P C;  3NRY A;  5FY0 A;  1MND A;  3PTR B;  2IW5 B;  3HR0 A;  5LG4 A;  2KMF A;  5JVD E;  3WAK A;  2ZMA A;  3ZMS B;  2DCF A;  5FXV A;  1WYC A;  5FMN A;  3FHN A;  3EDV A;  3P7I A;  4FI5 A;  3KFW X;  4PK4 A;  4H9R C;  5EZY E;  4JUY A;  3GN5 A;  3N9O A;  5FY1 A;  2Y48 B;  1MMA A;  3N5L A;  1OWA A;  1US7 B;  3HL6 A;  4EXT A;  3ANW A;  3F2E A;  2PBI A;  3O1J A;  4ISS A;  3C50 A;  3PUG A;  5JDM A;  2LSJ A;  4QXH B;  2JPF A;  5LCY A;  2DHR A;  3RYH E;  4AXP A;  4UV8 B;  1IJ6 A;  2V7K A;  3A5X A;  3PDY A;  3O1H A;  1HG5 A;  4BJM A;  2UXN B;  3E0Z A;  3IEE A;  2LSY A;  5JDQ A;  2X9X A;  5KX5 E;  4BAY B;  4UV9 B;  3CX7 B;  3RH3 A;  2XAH B;  2LSI A;  2XAQ B;  2IC9 A;  3OYZ A;  3U78 A;  2NOX A;  4EIW A;  4B6X A;  4UXN B;  5L3F B;  4UVA B;  2GK9 A;  4O2B E;  2PG8 A;  3TKL B;  2MYS A;  1V9D A;  4ILU A;  3EDU A;  4UEL A;  1WLX A;  2JRK A;  5A1L A;  3UUM A;  3N9M A;  1BR1 A;  2OA5 A;  4A56 A;  1U5P A;  3MKD A;  4QHO A;  5L3B B;  1QUU A;  3C51 A;  4H63 V;  4U74 A;  4GOU A;  3LBX A;  5HXC A;  1BR0 A;  3PE0 A;  1HF8 A;  2BDE A;  3D0T A;  4IE4 A;  2Q9Q A;  4AKR B;  5L3D B;  2M67 A;  3FXD B;  4QXB B;  4QXC B;  3SOL A;  2YU1 A;  3GMI A;  3K3Q C;  2E9X D;  5HYA A;  1D1C A;  4CZZ B;  1Y64 B;  3DJB A;  2D5U A;  3AA7 B;  4IGU A;  4ANJ A;  2K48 A;  4IE6 A;  3UT5 E;  3KVA A;  3R6N A;  3AA1 B;  2Y6X A;  2LHN A;  2LOP A;  1IZN B;  5GON E;  3BQI A;  4ZS2 A;  5JR9 A;  3AA6 B;  4MBQ A;  5J1G A;  5ETW A;  3FB2 A;  4BA9 A;  4AQG A;  4O4L E;  2H7V C;  4MHC A;  3GWH A;  3FXE B;  3N9L A;  5LJM A;  4DND A;  2A3D A;  4WW0 A;  1HX8 A;  1YKH B;  1BR4 A;  2CM0 A;  3K3O A;  3CPZ A;  1HG2 A;  3PUR A;  4OFZ A;  5FY7 A;  5LA6 E;  2JMH A;  2ZLY A;  1E1H B;  2W62 A;  4H9P C;  3ZMV B;  2LSG A;  3KV9 A;  3IF8 B;  4JEU B;  3K3N A;  4F6R C;  4UEM A;  3N2K E;  5LHH B;  2Z6E A;  3KV5 A;  3IHR A;  4J2C A;  5DJQ C;  4H9S E;  5LYJ E;  3ZC0 A;  1HCI A;  3ZN0 B;  4CXX A;  4QX8 B;  4YJ3 E;  3HI2 A;  3VHL A;  4GYR A;  1FEW A;  5FXW A;  2K5B B;  2XUE A;  4CQI A;  5CA1 E;  5IYZ E;  3V5U A;  5JDH A;  2XAJ B;  4H9Q C;  4KP3 C;  3KBT A;  3QK6 A;  4EYU A;  3C64 A;  4QX7 B;  2MBG A;  2X51 A;  2ODV A;  2YIN A;  3NZQ A;  4CI2 B;  2WMO A;  5LNK A;  5LXT E;  3QC9 A;  4ZS3 A;  4DO0 A;  5KMG P;  4Z8X A;  2CLY C;  5LJN A;  4EZ4 A;  1KNZ A;  2VB6 A;  5J2U E;  3KBU A;  2EHO B;  2ZM0 A;  2CXF A;  2E8I A;  5H6Q B;  2DLR A;  5JH7 E;  4C91 A;  1SA0 E;  4YHJ A;  4EB6 E;  2CWO A;  3AB3 B;  3RC8 A;  2HPJ A;  5FP3 A;  2YEV C;  2E9X C;  4AKG A;  1IAP A;  3S4U A;  2YK0 A;  2XTL A;  1B7T A;  1LVK A;  1S94 A;  4IE7 A;  1Z0P A;  5LGT B;  1X79 A;  4L0R A;  2L3L A;  2WAU A;  3OKQ A;  5CB4 E;  1YW0 A;  4P0B A;  3I9W A;  3CML A;  3O1I A;  1IJ5 A;  3MJX A;  1SHZ C;  3PU3 A;  2C5I T;  4O4J E;  1FIO A;  2CWY A;  2JMK A;  4NUV A;  2V1D B;  1G8X A;  5LGU B;  5FXZ A;  4HTE A;  3F31 A;  5FXX A;  3ZPO A;  2RA1 A;  5DAB A;  4ZI3 C;  4GYS A;  2H3R A;  2LT3 A;  3C4Z A;  4MAL A;  3OYX A;  2RP4 A;  4TUY E;  5FYM A;  2X9Y A;  1UX4 A;  2DWK A;  4HN9 A;  1WYB A;  4BJN A;  3O9X A;  5DQV A;  3NRX A;  4H9N C;  3J9X 1;  1T98 A;  3CQC B;  3CQX C;  1ZKE A;  5LHG B;  2VKO A;  1BR2 A;  3N9N A;  2KIN B;  5H6R B;  3ETV A;  3MAC A;  3ZLI A;  1KK7 A;  2BVL A;  1MIY A;  2N1G A;  5HAX A;  4ZI7 E;  4WBO A;  4I43 B;  1UX5 A;  3V5S A;  2IAK A;  2W00 A;  4HE8 A;  2CE7 A;  2KT9 A;  2A72 A;  3ZJ1 A;  4PAG A;  3BQL A;  4PJN A;  1D0Y A;  4HFV A;  3ONX A;  3H3A A;  1MNE A;  3L09 A;  3LFM A;  4HKA A;  4YFS A;  5LHI B;  3RYF E;  2CEA A;  4TV9 E;  3EUH A;  3ZJ2 A;  4EOZ B;  4EZH A;  2HPL A;  5EK3 A;  2W61 A;  1YKE B;  2C5J A;  3RYI E;  3WI3 A;  2VKD A;  1AJ3 A;  4TX5 A;  2D2S A;  3BQK A;  4O4H E;  3LBX B;  2CMR A;  5EK4 A;  3CX8 B;  3AAE B;  2X9H A;  2KZ7 B;  5AFU L;  2Q9Q B;  3RX6 A;  2VL8 A;  4AQF A;  1D1A A;  5HXS A;  4H9O C;  4O8S A;  4HGA A;  5HXE A;  5C8Y E;  3ZMU B;  1G73 A;  4V1A v;  1EZ3 A;  2LM9 A;  4U72 A;  3RRW A;  2WMN A;  1ZHC A;  3RPU A;  4QWN B;  5HWX A;  2X68 A;  2G0U A;  2NP9 A;  1H7C A;  3CKD A;  3CWZ B;  3W15 B;  4ZI3 D;  5ADX L;  4H63 H;  3BK9 A;  3JC6 D;  5DQW A;  3CVR A;  5JDL A;  3H37 A;  4AI6 A;  3AVR A;  4N78 D;  5JR9 B;  4IST A;  3ESL A;  3RKO A;  3ZEF B;  5J2T E;  3I1A A;  1HTJ F;  1MMD A;  2ZM2 A;  4UIG A;  5TAO A;  2HH7 A;  3OBV E;  4G63 A;  2CXD A;  3VKH A;  4DBQ A;  1S35 A;  1VRB A;  4WBN E;  5HXH A;  2E9X A;  2XAG B;  5CA0 E;  5L3E B;  3CX6 B;  4X1K E;  4AKI A;  1FMW A;  3CQG B;  2LSK A;  2EHO D;  3RYC E;  5JRC A;  3N2G E;  1NWM X;  2V7I A;  4TZ4 C;  3KVB A;  2KWI B;  4MFR A;  5BMV E;  3GA8 A;  2N2N A;  4AQF C;  3C4W A;  1WR6 A;  4CI1 B;  5IHY A;  4O2A E;  4TV8 E;  3SRZ A;  3ZYK A;  5E0O A;  2X66 A;  4IDZ A;  2NTY A;  5LGN B;  3ZMT B;  4OK0 A;  4JLE A;  4E7S A;  3B57 A;  4UF0 A;  1D1B A;  2A2F X;  3Q2M A;  2X67 A;  3ZMZ B;  2I59 A;  4FJO A;  2WM9 A;  4L9I A;  4XZC A;  4P0A A;  4EAH A;  2CXL A;  2V26 A;  2J1D G;  4GIW A;  2CA5 A;  1LKX A;  3HKE E;  3PUQ A;  3UUN A;  5JDF A;  5LBQ B;  4DMW A;  3PUA A;  2DNX A;  1ZEE A;  3KIN B;  4PK6 A;  3SS1 A;  1QSD A;  1HFA A;  1CUN A;  2V7M A;  3FBZ A;  5JQG E;  4JEH B;  4MLK A;  3UTK A;  3UFE A;  4X1Y E;  3ZC1 A;  2VKH A;  2UXX B;  4OYJ A;  5F3J A;  2NW8 A;  2B1E A;  2BVM A;  2PFV A;  3LK4 2;  4X1I E;  4KBM B;  3VKG A;  3I9Y A;  3C98 B;  1O3X A;  3HA4 A;  4TN7 B;  5EK2 A;  4KUM B;  3F57 A;  3GN5 B;  4OYK A;  4X20 E;  2XQY A;  1MMG A;  5JDN A;  4PJL A;  3RRC A;  3VU7 H;  1HS7 A;  3ANW B;  3OJA A;  3JC6 C;  2W63 A;  4XAX B;  5JDG A;  4AKL A;  4E7Z A;  2PJQ A;  3DP7 A;  2ES0 A;  1MIW A;  2X0L B;  4G2A A;  3M65 A;  3SWH A;  4ZI2 D;  3Q5W A;  5JRE A;  2KXP B;  3KV4 A;  2JQQ A;  4EYY R;  4AKH A;  5L3C B;  5L3G B;  1ZV4 X;  4IE0 A;  2Q9Q D;  4M1P A;  4YJ2 E;  2EHO C;  3UUX B;  2K24 A;  3N2O A;  2L9Q A;  2WWU A;  5HWY A;  1LVF A;  4GK5 E;  4OHF A;  3MK7 C;  3PU8 A;  3ZCJ A;  3LK3 B;  4UVB B;  2KWH A;  2JJ9 A;  2LOS A;  3L3P A;  2ODU A;  5LOV E;  4CI3 B;  3E08 A;  3UUL A;  3EVY A;  2D0T A;  5F8P A;  4WNK A;  3QUJ A;  3IBP A;  3I0O A;  4I55 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...