4ADZA

Crystal structure of the apo form of a copper-sensitive operon regulator (csor) protein from streptomyces lividans
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
90
structure length
90
Chain Sequence
YHKQKAEHLKRLRRIEGQIRGLQRMVDEDVYCIDILTQVSASTKALQSFALQLLEEHLRHCVADAALKGGTEIDAKVEEATKAIGRLLRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CSOR
publication title The Response to Copper Stress in Streptomyces Lividans Extends Beyond Genes Under the Direct Control of a Copper Sensitive Operon Repressor Protein (Csor)
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Transcription
total genus 40
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02583 Trns_repr_metal Metal-sensitive transcriptional repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1000 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4adzA00
2HH7A 5FMNA 5LCYA 3AAIA 4M1PA 4ADZA 4UIGA 5LBMA
chains in the Genus database with same CATH superfamily
3MZKB 1VCTA 2Z6EA 3GN5B 4JUYA 4ZI2D 3C51A 2A2FX 1UK5A 2CXLA 4ZEYA 2UXNB 5H6QB 3P4RA 3AE9A 2V8SV 1D0ZA 2KNDA 3C64A 3GWHA 4B6XA 1T98A 3N9MA 4TZ4C 4LMLA 1SE7A 2K48A 2DWKA 5FL0A 2B1EA 5LXTE 2HPJA 3P8CD 3NZQA 2LSYA 5GONE 1MMNA 5LA6E 5FVKA 4IDQA 4MFRA 3VR9A 4PFOA 4I4TE 3RYCE 3I0QA 2FUPA 2L9QA 4EEDA 4X65T 4IIJE 4ZHQE 3P7IA 3RC8A 1HX8A 2QYWA 5C2TA 1HNZT 4WZXA 3HA4A 1BR0A 3UTKA 2CHOA 1H7CA 4K0KT 4AKIA 5CGMA 3PUWF 4GK0E 4EEBA 5JVDE 5JRCA 1KNZA 3M3ZB 4DR2T 2A9UA 3AB3B 4AKHA 5DABA 2LSKA 2CM0A 2BG9B 3ZPOA 4H9NC 3N2GE 2BKPA 2LKHA 2XQ3A 3JC6C 2XQ8A 3I0OA 5LOVE 1IBMT 2XHEB 3P4PA 2UUBT 2K3WA 4YXDA 3EABA 2MOZA 4A97A 3F2EA 1DU2A 1HNXT 4H9QC 2W0GA 2QGSA 1J1JA 2HPLA 2YN6A 3ETVA 4UR9A 2XAQB 1YXRA 3HL6A 3BQKA 3KFWX 5LGNB 4XBFB 2VQFT 3JC6D 5FY7A 2DNXA 2BZBA 1N36T 2DL1A 4EYUA 5HEJA 2HN1A 1XDOA 2ACXA 3N2KE 4LMJA 2ZM2A 4PK6A 2ZM0A 3Q5XA 1GQEA 5IHYA 4PJNA 1LKXA 2XSBA 4ZZBA 5AQPB 5L4HA 3VKHA 3NZPA 4UF0B 1W9RA 3TLTA 3ZCIA 2V5CA 2Y8DA 2ZMAA 3ZMSB 3KINB 2B76A 2JQHA 5JDLA 1XNQT 1ZOYA 1M7KA 2Q9QB 3RX6A 4ADZA 3PUQA 3IHRA 4Z8XA 1B7TA 1G73A 3PUAA 1O3XA 2HHHT 3UUXB 3AEEA 4EB6E 2KMFA 4P0BA 1E1HB 3FZHB 5DQVA 3GA8A 2WU5A 4ZS2A 3RI5A 4NXMT 4DR1T 1WRDA 2IC6A 4HKAA 3K3NA 4QKNA 5HEOA 2W2UA 3OJAA 4PK5A 2CLYC 4JI6T 4LF8T 5EK3A 2MYSA 4TWHA 1IJ5A 3WAJA 3N2OA 5AQQB 2JPFA 3ZC1A 2WS3A 1XDPA 5J1GA 4ISTA 1D0YA 3OKQA 3OYZA 4DV2T 1ZEEA 2UUCT 2NWBA 3PUYF 4BAYB 4KHPT 4ZI7E 4B3MT 3PUGA 1ZKEA 4MBQA 4CQIA 2E9XB 1NAFA 3FHNA 4DV5T 4U7IA 4BJNA 2CEAA 3JCFA 2V5DA 4BJMA 5L4EA 4A56A 2QVAA 3VHLA 2LHNA 4ANJA 4COFA 3AEGA 2DCFA 2GK9A 5FY0A 3I9WA 4N78D 2V6YB 2YK0A 3AE3A 2V7LA 1NEKA 3R6NA 5J2UE 2C5KT 4YSXA 3NKZA 2XY8B 3VRAA 2XAJB 2WM9A 5IWAT 1SUMB 5TAOA 1I94T 3ZT6A 5FY1A 4B3ST 5JH7E 5ABFA 3EDUA 2WU2A 2NW8A 1WFDA 4X5TA 4AXPA 4L0RA 4G2AA 2XQ5A 5LGUB 5DJQC 2NOXA 1FIOA 3GN5A 3O4XE 4HFDA 4X1YE 3HI2A 3ZEFB 3HKBE 1FMWA 1XZYA 3CX8B 4BA9A 2E8IA 4ZOLE 3MXZA 3EDVA 5JR9B 3A5XA 3FB2A 2ACZA 3PTRB 3AE5A 4KP3C 2PTFA 5ETWA 4UV9B 1W0AA 2E2AA 4KMCA 4IDZA 3ZJ1A 1YKEB 2JIWA 3MKDA 3IBPA 1VRBA 4WBOA 3RQUA 3ZMZB 3U78A 1OEDA 3W15B 4EZHA 3UQ7A 5AQMB 3AE8A 3KV9A 5FXWA 3CX7B 4DNDA 2J47A 5FYMA 4MLKA 3ETUA 1HFAA 3ESLA 3V5UA 3PUZF 1FJGT 2DLRA 2H7OA 4WYVA 4JI2T 4YJ2E 2FBWA 1BR2A 2E5LT 4IE7A 3Q5DA 4I43B 3UU4A 3PUXF 4LF7T 3DP7A 1D0XA 3FXEB 3E0ZA 5BMVE 3FZMB 3BQIA 4DBRA 3LDQB 4O4HE 1JNRA 3FZKB 2LRLA 2BG9A 4IL9A 3RH3A 3ZMVB 3F57A 4O4JE 5CA1E 3ZYKA 5KXJA 1XMQT 3VU7H 4NIQA 2YU1A 2X0HA 4HWCA 2BS4A 3Q2MA 2WAUA 1KFYA 5LHGB 2FJEA 5LBMA 2KT9A 4X62T 2YDRA 3UUMA 3AE6A 4X66T 3BQLA 4IGUA 3LFMA 1E2AA 5LMNT 4H9SE 2D5UA 3QUJA 3MACA 1ZV4X 2CWYA 2VL0A 3KVAA 4UEMA 1OEDE 5JDNA 2XQ4A 1D1BA 5JDMA 4JI7T 3NVOA 3V5SA 2OLTA 4DMWA 4HFBA 5HYAA 2NW7A 2CBIA 3N9LA 3QOFA 5KX5E 2G0UA 3ANWB 3K3QC 5LHIB 2BS2A 3IA3A 1N34T 1S94A 2W4XA 2JRKA 4UF0A 2EHOD 1KNPA 1M62A 2ZLYA 2K24A 4P09A 2IW5B 1N33T 2WZHA 4IE0A 3SOLA 2J62A 2Q9QA 2ZM8A 3CK6A 3TLSA 4A98A 4U2ZA 5C3JA 2BG9E 3UULA 4GYSA 2X9XA 3RRCA 2IDOB 1KNRA 4YSYA 3FXDB 5LCYA 2D2SA 4DV3T 2WMNA 3VRBA 3JAFA 2IMLA 1EZ3A 4QH5A 4AIUA 5AQNB 4X20E 2BDEA 4JI3T 2WDVA 3U3IA 4LFBT 2N9DA 1OEDC 4OYJA 1LRZA 2KWIB 3O9XA 3AE1A 4AKGA 2WCAA 5HXRA 3AE7A 3ZCJA 4KX6A 5HCMA 5JDFA 2CE7A 3FZLB 3QC9A 5HEUA 4IDOA 2X68A 3JAEA 3LBXA 5AQIB 5LGTB 5BR8T 4OYKA 1HF8A 3UQ4A 2E9XA 2M6IA 1HR0T 2XQ7A 5HCJA 2FJAA 3EVYA 2BVMA 2BBHA 2CRBA 4Z90A 3H37A 2BG9C 2WSSV 1ZP0A 3AEDA 2CXFA 1E7PA 3MA9A 2V6YA 4ZXLA 3UU8A 2YEVC 4EIWA 3OYXA 4HFCA 2XASB 2BS3A 2BKNA 3Q5EA 4H63H 4TX5A 2XAGB 5FNVE 5L3FB 4H9OC 5LJMA 4DV4T 5CFBA 1YKHB 5LHHB 1MNEA 5J0ZA 3ZN0B 1HTJF 4G63A 4UIGA 2WB5A 2W61A 3ZN1B 4DO0A 2VKJA 3C50A 3LSVA 2XAFB 2H7VC 3QB5K 1KF6A 5J2TE 3ZYLA 3KBTA 2XM1A 2C0SA 3CIRA 2KXPB 2V7MA 4IHJE 3ONXA 3Q9DA 4QHOA 3ZKRA 4YHHT 3RGLA 4LFCT 2Y6XA 1XNRT 4I50E 2V1DB 3ONLC 2W67A 2LJLA 2VVNA 4E7ZA 1L0VA 5LBQB 1IZNB 4AI6A 4CI1B 3MJXA 2JMKA 5L2LA 3HR0A 1HCIA 4IT4A 3FBZA 3SWHA 2PJQA 1WYCA 2N2NA 4WW0A 2Q9QC 4NUUA 3QB5A 4GK5E 3PDYA 2X0YA 2N1GA 3RRWA 4NUVA 2X66A 3WI3A 4IE5A 3SS1A 1X79A 3MK7C 2QA7A 1HX1B 2YDSA 4C90A 4PJJA 2BKOA 2UU9T 4EYYR 3ZMUB 3ZLIA 1UURA 2IAKA 5L3CB 5AFUL 4DR3T 2CHNA 4ISSA 1T7SA 2JQQA 4YTNA 4IDNA 2QRXA 5ABGA 5ADXL 3EI0A 3WAKA 3O1JA 4DBQA 3EAMA 2NP9A 1KK7A 4YFSA 3BK9A 3AE2A 3O1HA 3PU8A 4ZI3C 2YOEA 2J4GA 4IL4A 1HG5A 3L09A 2E9XC 4TN7B 4OK0A 1YW0A 3KDSE 3N9OA 3RPUA 2H89A 2R6GF 5AQTB 3LK2B 2X9HA 3DTOA 4ILUA 2VKHA 1IAPA 2WDQA 4EAHA 1LVKA 4LF6T 2KWHA 5E0OA 1U4QA 3NWIA 2VKDA 4JEUB 4PNIA 4ZI3D 2VVSA 3J7Yq 1SHZC 2ODVA 4TUYE 4CXXA 2ZM6T 3OTOT 5CB4E 2YDQA 3C98B 2DWGA 2X9YA 3ANWA 4DIDB 1IJ6A 4JV5T 5LG4A 2H3RA 2K9AA 1AJ3A 3TLWA 2CCQA 4UVBB 4U2YA 5JDGA 2LHRA 3AA6B 3FZFB 4ILBA 2WWVA 4UXNB 4CI3B 3UU6A 5HWYA 5JDQA 3PE0A 4HWIB 4DV6T 3TLVA 2JQ9A 2LM2A 2NTXA 2IUBA 4OFZA 1WR6A 3M65A 2L8KA 1MMGA 4QH1A 1MNDA 3QK6A 3L39A 4U33A 5AQOB 1Y01A 4YJ3E 2W63A 1Z0PA 4WBNE 4O4IE 3K3OA 4TWDA 2KSRA 3RIUA 2C5IT 2E5VA 2XM2A 3RIAA 5C8YE 4GOUA 4ERRA 1CUNA 2AXDS 5JQGE 3QNUA 2JMHA 3B57A 4YTPA 4HWFA 4KI0F 4JYAT 5LNKA 4YT0A 2W62A 4C91A 2VQET 2BBJA 3AAIA 3K1SA 4UVAB 1MMDA 1UX5A 2XQ9A 1SA0E 4HN9A 3CQGB 2L3LA 2MBGA 3CX6B 2CWOA 3SFDA 3KVBA 1D1CA 4ILAA 3TLUA 1FMVA 5JDHA 4HE8A 4XAXB 1BR1A 2Y48B 5AQGB 3RHWA 3C4XA 3NRYA 2WDRA 2JQKA 4PK4A 2VB6A 3KBUA 4HFHA 4DR7T 3P4WA 2V26A 1UGOA 5HEHA 2UXBT 2EHOB 4K0UA 4KHZF 5H6RB 1IBLT 4EV6A 5FKYA 4O2AE 4CZZB 2CXDA 5L3BB 4IE6A 3ZSSA 2X51A 1MIVA 1LVFA 4ZI2C 4O8SA 4DV0T 3ZSTA 3UFEA 2LLYA 2XUEA 2V7KA 4EOZB 4AQGA 2P9BA 3HKDE 4UVCB 2XPKA 4JI0T 4DUZT 2YKSA 1JNZA 2CBJA 5EK2A 3H3AA 4X1KE 2XAHB 3FBLA 3AXJB 1MMAA 4WNKA 3RIFA 4JLEA 4A5XA 5L3DB 5CJ5A 2XQAA 4HFEA 5L47A 3RYFE 4AQYT 1T72A 5AQSB 5FMNA 2XQ6A 4B3RT 3AEFA 5LB7B 3O1IA 3PU3A 3N9PA 5FVLA 4TNVA 3P4QA 3AA7B 1Z8UA 4AKLA 5ABEA 1WCRA 3NRXA 1OEDB 4YLHA 5JTGA 2ODUA 4XZCA 1ZHCA 1YQ3A 3AVRA 4TV8E 4TV9E 4AQFA 4EXTA 5AQVB 1YQ4A 2MPKA 2DHRA 4DUYT 4M1PA 3EHZA 2XQYA 3F31A 2LEHA 2X0LB 1HG2A 4J2CA 5EZYE 1XMOT 4IDPA 3PJAA 2AE9A 4JEHB 3RIUC 4AKRB 5LG3A 2RPAA 2LSGA 3K8PC 1XWMA 2NW9A 3EUHA 5LYJE 5LMUT 1OXZA 3PURA 4IREA 4EGWA 3CQXC 2D0TA 3SFEA 3R84B 2X9WA 1UCUA 1U5PA 4O2BE 3OVUA 2JJ9A 1G8XA 2WBLA 1WYBA 2FJBA 2OV9A 3SRZA 5HXSA 3DJBA 4ILCA 3IEEA 5HAXA 2VWAA 3LK42 3OBVE 5CA0E 4LF9T 5FXXA 4F8HA 4KUMB 4IE4A 4HWHA 4I0UA 2SPCA 2WQYA 5L3EB 3P50A 3P4SA 4DR6T 3IF8B 1IBKT 4QWNB 3PUSA 3CQCB 3C4ZA 2UUAT 1QSDA 5ABHA 2M67A 2WZIA 1NENA 4FI5A 3UU3A 2VL8A 3CKDA 4EZ4A 5JR9A 2PFVA 3D0TA 2VURA 4UELA 4X1IE 4GKKT 2ES0A 2W66A 4AISA 1R8IA 2I6HA 4TWFA 5FXZA 1CHUA 4B3TT 4QXHB 2V7IA 2I59A 5HXCA 1BR4A 3ZT7A 5HWXA 3B5MA 4ZS3A 2F4VT 1X9BA 3E08A 3ZT5A 2C5JA 2PBIA 3HKEE 1WLXA 2VKOA 3CVRA 3E22E 3PV0F 5KDMC 3L8RA 1J5WA 4U31A 2LOSA 4CN6A 5IUXA 4JI8T 4PW8A 4FJOA 2YU2A 3ZMTB 2BVLA 2LKGA 3LG7A 2LSJA 1MIWA 2CLYB 5AQLB 2FJDA 3UFGA 3N9QA 3TKLB 3A8YC 2XSAA 4CXYA 4U72A 3AE4A 2Q9QD 2LSIA 2HN2A 4HFIA 2NR4A 4GKJT 2XTLA 3J9X1 4DV7T 3RKGA 2MTQA 4QX7B 3PJAJ 4TNWA 4AQFC 4PFPA 5JREA 1I6ZA 1Y64B 1US7B 3AAAB 4I55E 3RF1A 3T1YT 5JRCB 3LK3B 2UXCT 2VK9A 3AAEB 4X64T 4DR5T 3T1HT 1N32T 2RP4A 3HKCE 2UXDT 3LBXB 3KV5A 1W0BA 1YD8G 4CN4A 3JADA 5AQKB 3T8OA 2CMRA 3VKGA 4QH4A 1MIYA 1WR0A 2IHR1 4E7SA 2EHOA 3I9YA 2LOPA 4HGAA 5AQJB 5FL1A 4P1NA 1V9DA 4NPPA 4PJMA 3NBXX 1HS7A 1NWMX 1J5ET 2K5BB 3CPZA 3B13A 5HXEA 5HXHA 2X67A 4QXBB 4F6RC 4ZZCA 3CWZB 3AA0B 4HTEA 2WP9A 2E9XD 3PUVF 4YTMA 5LJNA 1T8BA 3VR8A 2LE8A 2KLQA 5KMGP 2MAWA 5AQHB 2HH7A 4QX8B 3ZJ2A 5AQRB 4GYRA 3AXJA 3A7MA 3AVSA 4KBMB 4UV8B 3H3MA 4PAGA 2LM9A 5M4YA 3S4UA 1VCSA 3AA1B 5IYZE 2I0MA 3G06A 3RYHE 1S35A 4PJLA 2V6XA 5FP3A 5AQFB 5JR9C 3N9NA 2NTYA 4YHJA 1W09A 2D0UA 2D9DA 4H9RC 1UUSA 4U7YA 3ZYMA 4DV1T 4NXNT 2W00A 5F8PA 4MHCA 3I1AA 2LT3A 3Q5WA 5F3JA 4LF4T 4H9PC 5EK4A 3AEAA 4DMVA 2OA5A 4MALA 3UU5A 5FXVA 4ASKA 2V7JA 2J1DG 2IIUA 4JI4T 3LJCA 4QXCB 4OHFA 4DR4T 2KINB 3KV4A 4LFAT 2PG8A 3RQWA 4YY3T 3AECA 4HEAA 1QLBA 4H63V 3ONJA 2DI4A 4V1Av 4CI2B 4OX9T 1UX4A 1QUUA 4LF5T 3X1DA 2CPTA 3KV6A 5L3GB 2WWUA 2WY2A 2M6BA 3RKOA 2KZ7B 2A3DA 3GMIA 1OWAA 2YINA 2LRKA 3UT5E 3AEBA 4JBWF 4JI5T 3C4WA 3N5LA 1D1AA 2A72A 4Z91A 4HFVA 5LP6E 5F5WA 3RYIE 5A1LA 5DQWA 4DVDA 5AQUB 3ABVA 3RLFF 4HWDA 4P0AA 4YSZA 3UUBA 4CN1A 2UXXB 2XJ7A 1KEYA 2IC9A 2CA5A 4U3CA 2WMOA 2XZEA 4Q25A 4O4LE 3ZC0A 2EHOC 1FEWA 4L9IA 5HEGA 4JI1T 1HNWT 4GIWA 3UUNA 2RA1A 3L3PA 3RC3A 3OPCA 4LMKA 2H88A 5ABFB 4L5GA 4U74A 3CMLA 4CXWA 1VOMA 2VASA
chains in the Genus database with same CATH topology
3MZKB 4IE4A 4ISSA 2Z6EA 3KV9A 3GN5B 5FXWA 2SPCA 3CX7B 4JUYA 4DNDA 2JQQA 4ZI2D 3C51A 5L3EB 2A2FX 5FYMA 4MLKA 5ADXL 3ETUA 1HFAA 3ESLA 3V5UA 3WAKA 3O1JA 2CXLA 4DBQA 2DLRA 2H7OA 2NP9A 2UXNB 3IF8B 5H6QB 1KK7A 4YJ2E 4YFSA 4QWNB 1D0ZA 2KNDA 3BK9A 1BR2A 3C64A 3CQCB 3GWHA 1T98A 3C4ZA 3PUSA 4B6XA 3O1HA 3N9MA 1QSDA 2M67A 3PU8A 4IE7A 4TZ4C 2K48A 4ZI3C 4I43B 4FI5A 2DWKA 3DP7A 2B1EA 5LXTE 2HPJA 3P8CD 1HG5A 1D0XA 2VL8A 3L09A 3CKDA 3NZQA 2LSYA 3E0ZA 3FXEB 1MMNA 5GONE 4EZ4A 5JR9A 2E9XC 2PFVA 5BMVE 4TN7B 4OK0A 3BQIA 3D0TA 4DBRA 1YW0A 3KDSE 3N9OA 3RPUA 4O4HE 4UELA 5LA6E 4X1IE 2ES0A 3LK2B 2X9HA 3DTOA 4ILUA 4MFRA 2VKHA 3RH3A 1IAPA 3ZMVB 4PFOA 3F57A 4O4JE 4I4TE 5CA1E 5FXZA 3RYCE 4EAHA 3ZYKA 3I0QA 1LVKA 2L9QA 2KWHA 4QXHB 1U4QA 5E0OA 2V7IA 2VKDA 2I59A 4IIJE 5HXCA 3VU7H 4JEUB 4ZHQE 2YU1A 1BR4A 4PNIA 3P7IA 4ZI3D 3RC8A 5HWXA 3J7Yq 1SHZC 1HX8A 2ODVA 4TUYE 4CXXA 5CB4E 3C98B 2DWGA 3HA4A 2X9YA 3ANWA 2WAUA 3Q2MA 1BR0A 3UTKA 4ZS3A 5LHGB 1IJ6A 1H7CA 5LBMA 5LG4A 2H3RA 2KT9A 4AKIA 2K9AA 1AJ3A 3E08A 2C5JA 3UUMA 2PBIA 4GK0E 3HKEE 5JVDE 1WLXA 3BQLA 2VKOA 3CVRA 4IGUA 3E22E 5JRCA 3LFMA 2CCQA 5KDMC 4UVBB 5JDGA 4H9SE 2LOSA 1KNZA 4PW8A 4FJOA 2D5UA 2YU2A 3AB3B 2LHRA 2BVLA 3ZMTB 4AKHA 3QUJA 3MACA 5DABA 3AA6B 1ZV4X 2LSKA 2CM0A 3ZPOA 2CWYA 3LG7A 2LSJA 4UXNB 1MIWA 4CI3B 2CLYB 4H9NC 5HWYA 3KVAA 3N2GE 5JDQA 4UEMA 3PE0A 5JDNA 3N9QA 3TKLB 1D1BA 5JDMA 3V5SA 4CXYA 3JC6C 4U72A 3I0OA 4DMWA 2NTXA 5HYAA 2NW7A 2Q9QD 3N9LA 4OFZA 2LSIA 1WR6A 5LOVE 5KX5E 2XHEB 3M65A 2L8KA 1MMGA 2XTLA 1MNDA 2G0UA 3ANWB 3QK6A 3K3QC 5LHIB 3J9X1 2MOZA 3F2EA 2MTQA 4YJ3E 2W63A 1Z0PA 4QX7B 4WBNE 1S94A 4O4IE 3K3OA 2JRKA 4H9QC 4AQFC 4UF0A 2W0GA 2QGSA 4PFPA 5JREA 2HPLA 2EHOD 3ETVA 1Y64B 1US7B 2XAQB 3AAAB 4I55E 2ZLYA 5JRCB 2K24A 4P09A 2IW5B 3HL6A 3LK3B 2C5IT 2VK9A 3AAEB 3BQKA 4IE0A 3KFWX 3SOLA 5LGNB 4XBFB 3JC6D 5C8YE 4GOUA 2RP4A 5FY7A 4ERRA 3HKCE 1CUNA 2DNXA 2Q9QA 2BZBA 5JQGE 2ZM8A 3LBXB 4EYUA 3KV5A 1YD8G 2JMHA 3B57A 3UULA 2ACXA 4GYSA 3N2KE 2X9XA 2ZM2A 4PK6A 3T8OA 2CMRA 2ZM0A 3RRCA 3VKGA 3Q5XA 1MIYA 3FXDB 5LCYA 4E7SA 2EHOA 3I9YA 5LNKA 2D2SA 2LOPA 4HGAA 5IHYA 2W62A 4C91A 4PJNA 2WMNA 3AAIA 4UVAB 1LKXA 1V9DA 4PJMA 3NBXX 1HS7A 1NWMX 1MMDA 1UX5A 1SA0E 2K5BB 3VKHA 1EZ3A 3NZPA 3CPZA 4HN9A 3B13A 3CQGB 2L3LA 4UF0B 2MBGA 5HXEA 5HXHA 3CX6B 2CWOA 2X67A 4X20E 2BDEA 4QXBB 3ZCIA 4F6RC 2Y8DA 2ZMAA 3KVBA 1D1CA 3CWZB 3AA0B 4HTEA 3U3IA 3KINB 3ZMSB 1FMVA 2N9DA 2E9XD 5JDHA 5LJNA 4OYJA 4HE8A 1LRZA 4XAXB 1BR1A 5JDLA 2KWIB 3O9XA 2Y48B 2Q9QB 3C4XA 4AKGA 2LE8A 2KLQA 5KMGP 3NRYA 5HXRA 3RX6A 3ZCJA 4PK4A 4ADZA 3PUQA 3IHRA 4Z8XA 1B7TA 1G73A 2HH7A 2CE7A 2VB6A 3KBUA 4QX8B 5JDFA 3PUAA 3ZJ2A 1O3XA 4GYRA 3QC9A 3AVSA 2V26A 4KBMB 4UV8B 2X68A 4PAGA 2LM9A 3UUXB 3S4UA 2KMFA 3LBXA 1E1HB 2EHOB 4P0BA 4K0UA 4EB6E 5M4YA 3AA1B 5DQVA 3GA8A 5H6RB 5IYZE 5LGTB 4OYKA 4O2AE 1HF8A 2E9XA 4CZZB 4ZS2A 2CXDA 3RYHE 1S35A 4PJLA 5L3BB 4IE6A 5FP3A 3EVYA 2BVMA 5JR9C 3N9NA 1WRDA 2NTYA 2IC6A 4YHJA 2X51A 1MIVA 1LVFA 2D0UA 4ZI2C 4HKAA 3K3NA 4QKNA 4O8SA 3H37A 2WSSV 4H9RC 3OJAA 4PK5A 3UFEA 3ZYMA 2CLYC 2XUEA 2CXFA 2V7KA 4EOZB 4AQGA 3MA9A 5EK3A 2MYSA 2P9BA 3HKDE 4UVCB 1IJ5A 2YEVC 4EIWA 3OYXA 2XASB 2W00A 5F8PA 4MHCA 5EK2A 3H3AA 3I1AA 3WAJA 3N2OA 4H63H 4TX5A 2XAGB 2JPFA 4X1KE 3ZC1A 2LT3A 3Q5WA 2XAHB 5FNVE 5J1GA 4ISTA 3FBLA 5L3FB 1D0YA 3OKQA 4H9OC 3OYZA 5F3JA 1ZEEA 2NWBA 4H9PC 1MMAA 4WNKA 5EK4A 5LJMA 4BAYB 4DMVA 1YKHB 4ZI7E 5LHHB 2OA5A 1MNEA 4MALA 4JLEA 3ZN0B 5L3DB 1HTJF 5FXVA 4ASKA 3PUGA 1ZKEA 4MBQA 2V7JA 2J1DG 4CQIA 4G63A 4UIGA 2E9XB 3LJCA 1NAFA 3FHNA 4QXCB 3RYFE 4OHFA 2W61A 4BJNA 3ZN1B 4DO0A 2CEAA 2KINB 2VKJA 3C50A 3KV4A 4BJMA 4A56A 5FMNA 2XAFB 2H7VC 2PG8A 3VHLA 5J2TE 2LHNA 4ANJA 3ZYLA 3O1IA 3KBTA 3PU3A 2DCFA 2GK9A 3N9PA 5FY0A 3I9WA 4N78D 2YK0A 4HEAA 2C0SA 2V7LA 3R6NA 2KXPB 3AA7B 4H63V 5J2UE 2V7MA 4AKLA 2DI4A 2C5KT 3ONXA 4IHJE 4V1Av 3Q9DA 4QHOA 4CI2B 3NRXA 4YLHA 2XAJB 1UX4A 2Y6XA 2WM9A 1QUUA 2ODUA 2V1DB 4I50E 3KV6A 4XZCA 2LJLA 1ZHCA 5TAOA 5FY1A 2WWUA 3AVRA 4TV8E 4E7ZA 4TV9E 5LBQB 4AQFA 5JH7E 1IZNB 5L3GB 4EXTA 3RKOA 2KZ7B 4AI6A 2DHRA 4M1PA 2A3DA 3EDUA 2XQYA 3F31A 2LEHA 3MJXA 3GMIA 4CI1B 2X0LB 1HG2A 4J2CA 1OWAA 2JMKA 2YINA 5EZYE 3UT5E 5L2LA 3HR0A 1HCIA 2NW8A 3C4WA 4JEHB 3FBZA 3N5LA 4L0RA 1D1AA 4AXPA 4G2AA 3SWHA 2A72A 2PJQA 5DJQC 4AKRB 5LGUB 4HFVA 2NOXA 1FIOA 3GN5A 3O4XE 4X1YE 1WYCA 2N2NA 3HI2A 5LP6E 3ZEFB 3RYIE 3HKBE 5A1LA 1FMWA 5DQWA 4WW0A 2LSGA 2Q9QC 4DVDA 3K8PC 3CX8B 4BA9A 4NUUA 2E8IA 2NW9A 4ZOLE 3MXZA 4P0AA 3EDVA 3EUHA 5LYJE 1OXZA 3PURA 4GK5E 2UXXB 3CQXC 2D0TA 3PDYA 5JR9B 3R84B 3A5XA 2IC9A 2N1GA 2CA5A 2X9WA 3FB2A 1UCUA 1U5PA 2WMOA 3RRWA 3PTRB 4KP3C 4O2BE 2JJ9A 4NUVA 2X66A 4O4LE 5ETWA 4UV9B 1G8XA 3ZC0A 3WI3A 4IE5A 2EHOC 1FEWA 2WBLA 4L9IA 3SS1A 1X79A 4KMCA 1WYBA 3MK7C 3SRZA 5HXSA 2QA7A 4GIWA 4C90A 3DJBA 3UUNA 4PJJA 2RA1A 3IEEA 3L3PA 3ZMUB 4EYYR 5HAXA 3RC3A 4IDZA 3ZJ1A 1YKEB 2VWAA 3LK42 3OBVE 3ZLIA 3MKDA 3IBPA 4L5GA 1VRBA 4WBOA 5CA0E 3ZMZB 2IAKA 4U74A 5FXXA 3U78A 5AFUL 5L3CB 3CMLA 4CXWA 3W15B 4KUMB 1VOMA 2VASA 4EZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HH7 A;  5FMN A;  5LCY A;  3AAI A;  4M1P A;  4ADZ A;  4UIG A;  5LBM A; 
#chains in the Genus database with same CATH topology
 3MZK B;  1VCT A;  2Z6E A;  3GN5 B;  4JUY A;  4ZI2 D;  3C51 A;  2A2F X;  1UK5 A;  2CXL A;  4ZEY A;  2UXN B;  5H6Q B;  3P4R A;  3AE9 A;  2V8S V;  1D0Z A;  2KND A;  3C64 A;  3GWH A;  4B6X A;  1T98 A;  3N9M A;  4TZ4 C;  4LML A;  1SE7 A;  2K48 A;  2DWK A;  5FL0 A;  2B1E A;  5LXT E;  2HPJ A;  3P8C D;  3NZQ A;  2LSY A;  5GON E;  1MMN A;  5LA6 E;  5FVK A;  4IDQ A;  4MFR A;  3VR9 A;  4PFO A;  4I4T E;  3RYC E;  3I0Q A;  2FUP A;  2L9Q A;  4EED A;  4X65 T;  4IIJ E;  4ZHQ E;  3P7I A;  3RC8 A;  1HX8 A;  2QYW A;  5C2T A;  1HNZ T;  4WZX A;  3HA4 A;  1BR0 A;  3UTK A;  2CHO A;  1H7C A;  4K0K T;  4AKI A;  5CGM A;  3PUW F;  4GK0 E;  4EEB A;  5JVD E;  5JRC A;  1KNZ A;  3M3Z B;  4DR2 T;  2A9U A;  3AB3 B;  4AKH A;  5DAB A;  2LSK A;  2CM0 A;  2BG9 B;  3ZPO A;  4H9N C;  3N2G E;  2BKP A;  2LKH A;  2XQ3 A;  3JC6 C;  2XQ8 A;  3I0O A;  5LOV E;  1IBM T;  2XHE B;  3P4P A;  2UUB T;  2K3W A;  4YXD A;  3EAB A;  2MOZ A;  4A97 A;  3F2E A;  1DU2 A;  1HNX T;  4H9Q C;  2W0G A;  2QGS A;  1J1J A;  2HPL A;  2YN6 A;  3ETV A;  4UR9 A;  2XAQ B;  1YXR A;  3HL6 A;  3BQK A;  3KFW X;  5LGN B;  4XBF B;  2VQF T;  3JC6 D;  5FY7 A;  2DNX A;  2BZB A;  1N36 T;  2DL1 A;  4EYU A;  5HEJ A;  2HN1 A;  1XDO A;  2ACX A;  3N2K E;  4LMJ A;  2ZM2 A;  4PK6 A;  2ZM0 A;  3Q5X A;  1GQE A;  5IHY A;  4PJN A;  1LKX A;  2XSB A;  4ZZB A;  5AQP B;  5L4H A;  3VKH A;  3NZP A;  4UF0 B;  1W9R A;  3TLT A;  3ZCI A;  2V5C A;  2Y8D A;  2ZMA A;  3ZMS B;  3KIN B;  2B76 A;  2JQH A;  5JDL A;  1XNQ T;  1ZOY A;  1M7K A;  2Q9Q B;  3RX6 A;  4ADZ A;  3PUQ A;  3IHR A;  4Z8X A;  1B7T A;  1G73 A;  3PUA A;  1O3X A;  2HHH T;  3UUX B;  3AEE A;  4EB6 E;  2KMF A;  4P0B A;  1E1H B;  3FZH B;  5DQV A;  3GA8 A;  2WU5 A;  4ZS2 A;  3RI5 A;  4NXM T;  4DR1 T;  1WRD A;  2IC6 A;  4HKA A;  3K3N A;  4QKN A;  5HEO A;  2W2U A;  3OJA A;  4PK5 A;  2CLY C;  4JI6 T;  4LF8 T;  5EK3 A;  2MYS A;  4TWH A;  1IJ5 A;  3WAJ A;  3N2O A;  5AQQ B;  2JPF A;  3ZC1 A;  2WS3 A;  1XDP A;  5J1G A;  4IST A;  1D0Y A;  3OKQ A;  3OYZ A;  4DV2 T;  1ZEE A;  2UUC T;  2NWB A;  3PUY F;  4BAY B;  4KHP T;  4ZI7 E;  4B3M T;  3PUG A;  1ZKE A;  4MBQ A;  4CQI A;  2E9X B;  1NAF A;  3FHN A;  4DV5 T;  4U7I A;  4BJN A;  2CEA A;  3JCF A;  2V5D A;  4BJM A;  5L4E A;  4A56 A;  2QVA A;  3VHL A;  2LHN A;  4ANJ A;  4COF A;  3AEG A;  2DCF A;  2GK9 A;  5FY0 A;  3I9W A;  4N78 D;  2V6Y B;  2YK0 A;  3AE3 A;  2V7L A;  1NEK A;  3R6N A;  5J2U E;  2C5K T;  4YSX A;  3NKZ A;  2XY8 B;  3VRA A;  2XAJ B;  2WM9 A;  5IWA T;  1SUM B;  5TAO A;  1I94 T;  3ZT6 A;  5FY1 A;  4B3S T;  5JH7 E;  5ABF A;  3EDU A;  2WU2 A;  2NW8 A;  1WFD A;  4X5T A;  4AXP A;  4L0R A;  4G2A A;  2XQ5 A;  5LGU B;  5DJQ C;  2NOX A;  1FIO A;  3GN5 A;  3O4X E;  4HFD A;  4X1Y E;  3HI2 A;  3ZEF B;  3HKB E;  1FMW A;  1XZY A;  3CX8 B;  4BA9 A;  2E8I A;  4ZOL E;  3MXZ A;  3EDV A;  5JR9 B;  3A5X A;  3FB2 A;  2ACZ A;  3PTR B;  3AE5 A;  4KP3 C;  2PTF A;  5ETW A;  4UV9 B;  1W0A A;  2E2A A;  4KMC A;  4IDZ A;  3ZJ1 A;  1YKE B;  2JIW A;  3MKD A;  3IBP A;  1VRB A;  4WBO A;  3RQU A;  3ZMZ B;  3U78 A;  1OED A;  3W15 B;  4EZH A;  3UQ7 A;  5AQM B;  3AE8 A;  3KV9 A;  5FXW A;  3CX7 B;  4DND A;  2J47 A;  5FYM A;  4MLK A;  3ETU A;  1HFA A;  3ESL A;  3V5U A;  3PUZ F;  1FJG T;  2DLR A;  2H7O A;  4WYV A;  4JI2 T;  4YJ2 E;  2FBW A;  1BR2 A;  2E5L T;  4IE7 A;  3Q5D A;  4I43 B;  3UU4 A;  3PUX F;  4LF7 T;  3DP7 A;  1D0X A;  3FXE B;  3E0Z A;  5BMV E;  3FZM B;  3BQI A;  4DBR A;  3LDQ B;  4O4H E;  1JNR A;  3FZK B;  2LRL A;  2BG9 A;  4IL9 A;  3RH3 A;  3ZMV B;  3F57 A;  4O4J E;  5CA1 E;  3ZYK A;  5KXJ A;  1XMQ T;  3VU7 H;  4NIQ A;  2YU1 A;  2X0H A;  4HWC A;  2BS4 A;  3Q2M A;  2WAU A;  1KFY A;  5LHG B;  2FJE A;  5LBM A;  2KT9 A;  4X62 T;  2YDR A;  3UUM A;  3AE6 A;  4X66 T;  3BQL A;  4IGU A;  3LFM A;  1E2A A;  5LMN T;  4H9S E;  2D5U A;  3QUJ A;  3MAC A;  1ZV4 X;  2CWY A;  2VL0 A;  3KVA A;  4UEM A;  1OED E;  5JDN A;  2XQ4 A;  1D1B A;  5JDM A;  4JI7 T;  3NVO A;  3V5S A;  2OLT A;  4DMW A;  4HFB A;  5HYA A;  2NW7 A;  2CBI A;  3N9L A;  3QOF A;  5KX5 E;  2G0U A;  3ANW B;  3K3Q C;  5LHI B;  2BS2 A;  3IA3 A;  1N34 T;  1S94 A;  2W4X A;  2JRK A;  4UF0 A;  2EHO D;  1KNP A;  1M62 A;  2ZLY A;  2K24 A;  4P09 A;  2IW5 B;  1N33 T;  2WZH A;  4IE0 A;  3SOL A;  2J62 A;  2Q9Q A;  2ZM8 A;  3CK6 A;  3TLS A;  4A98 A;  4U2Z A;  5C3J A;  2BG9 E;  3UUL A;  4GYS A;  2X9X A;  3RRC A;  2IDO B;  1KNR A;  4YSY A;  3FXD B;  5LCY A;  2D2S A;  4DV3 T;  2WMN A;  3VRB A;  3JAF A;  2IML A;  1EZ3 A;  4QH5 A;  4AIU A;  5AQN B;  4X20 E;  2BDE A;  4JI3 T;  2WDV A;  3U3I A;  4LFB T;  2N9D A;  1OED C;  4OYJ A;  1LRZ A;  2KWI B;  3O9X A;  3AE1 A;  4AKG A;  2WCA A;  5HXR A;  3AE7 A;  3ZCJ A;  4KX6 A;  5HCM A;  5JDF A;  2CE7 A;  3FZL B;  3QC9 A;  5HEU A;  4IDO A;  2X68 A;  3JAE A;  3LBX A;  5AQI B;  5LGT B;  5BR8 T;  4OYK A;  1HF8 A;  3UQ4 A;  2E9X A;  2M6I A;  1HR0 T;  2XQ7 A;  5HCJ A;  2FJA A;  3EVY A;  2BVM A;  2BBH A;  2CRB A;  4Z90 A;  3H37 A;  2BG9 C;  2WSS V;  1ZP0 A;  3AED A;  2CXF A;  1E7P A;  3MA9 A;  2V6Y A;  4ZXL A;  3UU8 A;  2YEV C;  4EIW A;  3OYX A;  4HFC A;  2XAS B;  2BS3 A;  2BKN A;  3Q5E A;  4H63 H;  4TX5 A;  2XAG B;  5FNV E;  5L3F B;  4H9O C;  5LJM A;  4DV4 T;  5CFB A;  1YKH B;  5LHH B;  1MNE A;  5J0Z A;  3ZN0 B;  1HTJ F;  4G63 A;  4UIG A;  2WB5 A;  2W61 A;  3ZN1 B;  4DO0 A;  2VKJ A;  3C50 A;  3LSV A;  2XAF B;  2H7V C;  3QB5 K;  1KF6 A;  5J2T E;  3ZYL A;  3KBT A;  2XM1 A;  2C0S A;  3CIR A;  2KXP B;  2V7M A;  4IHJ E;  3ONX A;  3Q9D A;  4QHO A;  3ZKR A;  4YHH T;  3RGL A;  4LFC T;  2Y6X A;  1XNR T;  4I50 E;  2V1D B;  3ONL C;  2W67 A;  2LJL A;  2VVN A;  4E7Z A;  1L0V A;  5LBQ B;  1IZN B;  4AI6 A;  4CI1 B;  3MJX A;  2JMK A;  5L2L A;  3HR0 A;  1HCI A;  4IT4 A;  3FBZ A;  3SWH A;  2PJQ A;  1WYC A;  2N2N A;  4WW0 A;  2Q9Q C;  4NUU A;  3QB5 A;  4GK5 E;  3PDY A;  2X0Y A;  2N1G A;  3RRW A;  4NUV A;  2X66 A;  3WI3 A;  4IE5 A;  3SS1 A;  1X79 A;  3MK7 C;  2QA7 A;  1HX1 B;  2YDS A;  4C90 A;  4PJJ A;  2BKO A;  2UU9 T;  4EYY R;  3ZMU B;  3ZLI A;  1UUR A;  2IAK A;  5L3C B;  5AFU L;  4DR3 T;  2CHN A;  4ISS A;  1T7S A;  2JQQ A;  4YTN A;  4IDN A;  2QRX A;  5ABG A;  5ADX L;  3EI0 A;  3WAK A;  3O1J A;  4DBQ A;  3EAM A;  2NP9 A;  1KK7 A;  4YFS A;  3BK9 A;  3AE2 A;  3O1H A;  3PU8 A;  4ZI3 C;  2YOE A;  2J4G A;  4IL4 A;  1HG5 A;  3L09 A;  2E9X C;  4TN7 B;  4OK0 A;  1YW0 A;  3KDS E;  3N9O A;  3RPU A;  2H89 A;  2R6G F;  5AQT B;  3LK2 B;  2X9H A;  3DTO A;  4ILU A;  2VKH A;  1IAP A;  2WDQ A;  4EAH A;  1LVK A;  4LF6 T;  2KWH A;  5E0O A;  1U4Q A;  3NWI A;  2VKD A;  4JEU B;  4PNI A;  4ZI3 D;  2VVS A;  3J7Y q;  1SHZ C;  2ODV A;  4TUY E;  4CXX A;  2ZM6 T;  3OTO T;  5CB4 E;  2YDQ A;  3C98 B;  2DWG A;  2X9Y A;  3ANW A;  4DID B;  1IJ6 A;  4JV5 T;  5LG4 A;  2H3R A;  2K9A A;  1AJ3 A;  3TLW A;  2CCQ A;  4UVB B;  4U2Y A;  5JDG A;  2LHR A;  3AA6 B;  3FZF B;  4ILB A;  2WWV A;  4UXN B;  4CI3 B;  3UU6 A;  5HWY A;  5JDQ A;  3PE0 A;  4HWI B;  4DV6 T;  3TLV A;  2JQ9 A;  2LM2 A;  2NTX A;  2IUB A;  4OFZ A;  1WR6 A;  3M65 A;  2L8K A;  1MMG A;  4QH1 A;  1MND A;  3QK6 A;  3L39 A;  4U33 A;  5AQO B;  1Y01 A;  4YJ3 E;  2W63 A;  1Z0P A;  4WBN E;  4O4I E;  3K3O A;  4TWD A;  2KSR A;  3RIU A;  2C5I T;  2E5V A;  2XM2 A;  3RIA A;  5C8Y E;  4GOU A;  4ERR A;  1CUN A;  2AXD S;  5JQG E;  3QNU A;  2JMH A;  3B57 A;  4YTP A;  4HWF A;  4KI0 F;  4JYA T;  5LNK A;  4YT0 A;  2W62 A;  4C91 A;  2VQE T;  2BBJ A;  3AAI A;  3K1S A;  4UVA B;  1MMD A;  1UX5 A;  2XQ9 A;  1SA0 E;  4HN9 A;  3CQG B;  2L3L A;  2MBG A;  3CX6 B;  2CWO A;  3SFD A;  3KVB A;  1D1C A;  4ILA A;  3TLU A;  1FMV A;  5JDH A;  4HE8 A;  4XAX B;  1BR1 A;  2Y48 B;  5AQG B;  3RHW A;  3C4X A;  3NRY A;  2WDR A;  2JQK A;  4PK4 A;  2VB6 A;  3KBU A;  4HFH A;  4DR7 T;  3P4W A;  2V26 A;  1UGO A;  5HEH A;  2UXB T;  2EHO B;  4K0U A;  4KHZ F;  5H6R B;  1IBL T;  4EV6 A;  5FKY A;  4O2A E;  4CZZ B;  2CXD A;  5L3B B;  4IE6 A;  3ZSS A;  2X51 A;  1MIV A;  1LVF A;  4ZI2 C;  4O8S A;  4DV0 T;  3ZST A;  3UFE A;  2LLY A;  2XUE A;  2V7K A;  4EOZ B;  4AQG A;  2P9B A;  3HKD E;  4UVC B;  2XPK A;  4JI0 T;  4DUZ T;  2YKS A;  1JNZ A;  2CBJ A;  5EK2 A;  3H3A A;  4X1K E;  2XAH B;  3FBL A;  3AXJ B;  1MMA A;  4WNK A;  3RIF A;  4JLE A;  4A5X A;  5L3D B;  5CJ5 A;  2XQA A;  4HFE A;  5L47 A;  3RYF E;  4AQY T;  1T72 A;  5AQS B;  5FMN A;  2XQ6 A;  4B3R T;  3AEF A;  5LB7 B;  3O1I A;  3PU3 A;  3N9P A;  5FVL A;  4TNV A;  3P4Q A;  3AA7 B;  1Z8U A;  4AKL A;  5ABE A;  1WCR A;  3NRX A;  1OED B;  4YLH A;  5JTG A;  2ODU A;  4XZC A;  1ZHC A;  1YQ3 A;  3AVR A;  4TV8 E;  4TV9 E;  4AQF A;  4EXT A;  5AQV B;  1YQ4 A;  2MPK A;  2DHR A;  4DUY T;  4M1P A;  3EHZ A;  2XQY A;  3F31 A;  2LEH A;  2X0L B;  1HG2 A;  4J2C A;  5EZY E;  1XMO T;  4IDP A;  3PJA A;  2AE9 A;  4JEH B;  3RIU C;  4AKR B;  5LG3 A;  2RPA A;  2LSG A;  3K8P C;  1XWM A;  2NW9 A;  3EUH A;  5LYJ E;  5LMU T;  1OXZ A;  3PUR A;  4IRE A;  4EGW A;  3CQX C;  2D0T A;  3SFE A;  3R84 B;  2X9W A;  1UCU A;  1U5P A;  4O2B E;  3OVU A;  2JJ9 A;  1G8X A;  2WBL A;  1WYB A;  2FJB A;  2OV9 A;  3SRZ A;  5HXS A;  3DJB A;  4ILC A;  3IEE A;  5HAX A;  2VWA A;  3LK4 2;  3OBV E;  5CA0 E;  4LF9 T;  5FXX A;  4F8H A;  4KUM B;  4IE4 A;  4HWH A;  4I0U A;  2SPC A;  2WQY A;  5L3E B;  3P50 A;  3P4S A;  4DR6 T;  3IF8 B;  1IBK T;  4QWN B;  3PUS A;  3CQC B;  3C4Z A;  2UUA T;  1QSD A;  5ABH A;  2M67 A;  2WZI A;  1NEN A;  4FI5 A;  3UU3 A;  2VL8 A;  3CKD A;  4EZ4 A;  5JR9 A;  2PFV A;  3D0T A;  2VUR A;  4UEL A;  4X1I E;  4GKK T;  2ES0 A;  2W66 A;  4AIS A;  1R8I A;  2I6H A;  4TWF A;  5FXZ A;  1CHU A;  4B3T T;  4QXH B;  2V7I A;  2I59 A;  5HXC A;  1BR4 A;  3ZT7 A;  5HWX A;  3B5M A;  4ZS3 A;  2F4V T;  1X9B A;  3E08 A;  3ZT5 A;  2C5J A;  2PBI A;  3HKE E;  1WLX A;  2VKO A;  3CVR A;  3E22 E;  3PV0 F;  5KDM C;  3L8R A;  1J5W A;  4U31 A;  2LOS A;  4CN6 A;  5IUX A;  4JI8 T;  4PW8 A;  4FJO A;  2YU2 A;  3ZMT B;  2BVL A;  2LKG A;  3LG7 A;  2LSJ A;  1MIW A;  2CLY B;  5AQL B;  2FJD A;  3UFG A;  3N9Q A;  3TKL B;  3A8Y C;  2XSA A;  4CXY A;  4U72 A;  3AE4 A;  2Q9Q D;  2LSI A;  2HN2 A;  4HFI A;  2NR4 A;  4GKJ T;  2XTL A;  3J9X 1;  4DV7 T;  3RKG A;  2MTQ A;  4QX7 B;  3PJA J;  4TNW A;  4AQF C;  4PFP A;  5JRE A;  1I6Z A;  1Y64 B;  1US7 B;  3AAA B;  4I55 E;  3RF1 A;  3T1Y T;  5JRC B;  3LK3 B;  2UXC T;  2VK9 A;  3AAE B;  4X64 T;  4DR5 T;  3T1H T;  1N32 T;  2RP4 A;  3HKC E;  2UXD T;  3LBX B;  3KV5 A;  1W0B A;  1YD8 G;  4CN4 A;  3JAD A;  5AQK B;  3T8O A;  2CMR A;  3VKG A;  4QH4 A;  1MIY A;  1WR0 A;  2IHR 1;  4E7S A;  2EHO A;  3I9Y A;  2LOP A;  4HGA A;  5AQJ B;  5FL1 A;  4P1N A;  1V9D A;  4NPP A;  4PJM A;  3NBX X;  1HS7 A;  1NWM X;  1J5E T;  2K5B B;  3CPZ A;  3B13 A;  5HXE A;  5HXH A;  2X67 A;  4QXB B;  4F6R C;  4ZZC A;  3CWZ B;  3AA0 B;  4HTE A;  2WP9 A;  2E9X D;  3PUV F;  4YTM A;  5LJN A;  1T8B A;  3VR8 A;  2LE8 A;  2KLQ A;  5KMG P;  2MAW A;  5AQH B;  2HH7 A;  4QX8 B;  3ZJ2 A;  5AQR B;  4GYR A;  3AXJ A;  3A7M A;  3AVS A;  4KBM B;  4UV8 B;  3H3M A;  4PAG A;  2LM9 A;  5M4Y A;  3S4U A;  1VCS A;  3AA1 B;  5IYZ E;  2I0M A;  3G06 A;  3RYH E;  1S35 A;  4PJL A;  2V6X A;  5FP3 A;  5AQF B;  5JR9 C;  3N9N A;  2NTY A;  4YHJ A;  1W09 A;  2D0U A;  2D9D A;  4H9R C;  1UUS A;  4U7Y A;  3ZYM A;  4DV1 T;  4NXN T;  2W00 A;  5F8P A;  4MHC A;  3I1A A;  2LT3 A;  3Q5W A;  5F3J A;  4LF4 T;  4H9P C;  5EK4 A;  3AEA A;  4DMV A;  2OA5 A;  4MAL A;  3UU5 A;  5FXV A;  4ASK A;  2V7J A;  2J1D G;  2IIU A;  4JI4 T;  3LJC A;  4QXC B;  4OHF A;  4DR4 T;  2KIN B;  3KV4 A;  4LFA T;  2PG8 A;  3RQW A;  4YY3 T;  3AEC A;  4HEA A;  1QLB A;  4H63 V;  3ONJ A;  2DI4 A;  4V1A v;  4CI2 B;  4OX9 T;  1UX4 A;  1QUU A;  4LF5 T;  3X1D A;  2CPT A;  3KV6 A;  5L3G B;  2WWU A;  2WY2 A;  2M6B A;  3RKO A;  2KZ7 B;  2A3D A;  3GMI A;  1OWA A;  2YIN A;  2LRK A;  3UT5 E;  3AEB A;  4JBW F;  4JI5 T;  3C4W A;  3N5L A;  1D1A A;  2A72 A;  4Z91 A;  4HFV A;  5LP6 E;  5F5W A;  3RYI E;  5A1L A;  5DQW A;  4DVD A;  5AQU B;  3ABV A;  3RLF F;  4HWD A;  4P0A A;  4YSZ A;  3UUB A;  4CN1 A;  2UXX B;  2XJ7 A;  1KEY A;  2IC9 A;  2CA5 A;  4U3C A;  2WMO A;  2XZE A;  4Q25 A;  4O4L E;  3ZC0 A;  2EHO C;  1FEW A;  4L9I A;  5HEG A;  4JI1 T;  1HNW T;  4GIW A;  3UUN A;  2RA1 A;  3L3P A;  3RC3 A;  3OPC A;  4LMK A;  2H88 A;  5ABF B;  4L5G A;  4U74 A;  3CML A;  4CXW A;  1VOM A;  2VAS A; 
#chains in the Genus database with same CATH homology
 3MZK B;  4IE4 A;  4ISS A;  2Z6E A;  3KV9 A;  3GN5 B;  5FXW A;  2SPC A;  3CX7 B;  4JUY A;  4DND A;  2JQQ A;  4ZI2 D;  3C51 A;  5L3E B;  2A2F X;  5FYM A;  4MLK A;  5ADX L;  3ETU A;  1HFA A;  3ESL A;  3V5U A;  3WAK A;  3O1J A;  2CXL A;  4DBQ A;  2DLR A;  2H7O A;  2NP9 A;  2UXN B;  3IF8 B;  5H6Q B;  1KK7 A;  4YJ2 E;  4YFS A;  4QWN B;  1D0Z A;  2KND A;  3BK9 A;  1BR2 A;  3C64 A;  3CQC B;  3GWH A;  1T98 A;  3C4Z A;  3PUS A;  4B6X A;  3O1H A;  3N9M A;  1QSD A;  2M67 A;  3PU8 A;  4IE7 A;  4TZ4 C;  2K48 A;  4ZI3 C;  4I43 B;  4FI5 A;  2DWK A;  3DP7 A;  2B1E A;  5LXT E;  2HPJ A;  3P8C D;  1HG5 A;  1D0X A;  2VL8 A;  3L09 A;  3CKD A;  3NZQ A;  2LSY A;  3E0Z A;  3FXE B;  1MMN A;  5GON E;  4EZ4 A;  5JR9 A;  2E9X C;  2PFV A;  5BMV E;  4TN7 B;  4OK0 A;  3BQI A;  3D0T A;  4DBR A;  1YW0 A;  3KDS E;  3N9O A;  3RPU A;  4O4H E;  4UEL A;  5LA6 E;  4X1I E;  2ES0 A;  3LK2 B;  2X9H A;  3DTO A;  4ILU A;  4MFR A;  2VKH A;  3RH3 A;  1IAP A;  3ZMV B;  4PFO A;  3F57 A;  4O4J E;  4I4T E;  5CA1 E;  5FXZ A;  3RYC E;  4EAH A;  3ZYK A;  3I0Q A;  1LVK A;  2L9Q A;  2KWH A;  4QXH B;  1U4Q A;  5E0O A;  2V7I A;  2VKD A;  2I59 A;  4IIJ E;  5HXC A;  3VU7 H;  4JEU B;  4ZHQ E;  2YU1 A;  1BR4 A;  4PNI A;  3P7I A;  4ZI3 D;  3RC8 A;  5HWX A;  3J7Y q;  1SHZ C;  1HX8 A;  2ODV A;  4TUY E;  4CXX A;  5CB4 E;  3C98 B;  2DWG A;  3HA4 A;  2X9Y A;  3ANW A;  2WAU A;  3Q2M A;  1BR0 A;  3UTK A;  4ZS3 A;  5LHG B;  1IJ6 A;  1H7C A;  5LBM A;  5LG4 A;  2H3R A;  2KT9 A;  4AKI A;  2K9A A;  1AJ3 A;  3E08 A;  2C5J A;  3UUM A;  2PBI A;  4GK0 E;  3HKE E;  5JVD E;  1WLX A;  3BQL A;  2VKO A;  3CVR A;  4IGU A;  3E22 E;  5JRC A;  3LFM A;  2CCQ A;  5KDM C;  4UVB B;  5JDG A;  4H9S E;  2LOS A;  1KNZ A;  4PW8 A;  4FJO A;  2D5U A;  2YU2 A;  3AB3 B;  2LHR A;  2BVL A;  3ZMT B;  4AKH A;  3QUJ A;  3MAC A;  5DAB A;  3AA6 B;  1ZV4 X;  2LSK A;  2CM0 A;  3ZPO A;  2CWY A;  3LG7 A;  2LSJ A;  4UXN B;  1MIW A;  4CI3 B;  2CLY B;  4H9N C;  5HWY A;  3KVA A;  3N2G E;  5JDQ A;  4UEM A;  3PE0 A;  5JDN A;  3N9Q A;  3TKL B;  1D1B A;  5JDM A;  3V5S A;  4CXY A;  3JC6 C;  4U72 A;  3I0O A;  4DMW A;  2NTX A;  5HYA A;  2NW7 A;  2Q9Q D;  3N9L A;  4OFZ A;  2LSI A;  1WR6 A;  5LOV E;  5KX5 E;  2XHE B;  3M65 A;  2L8K A;  1MMG A;  2XTL A;  1MND A;  2G0U A;  3ANW B;  3QK6 A;  3K3Q C;  5LHI B;  3J9X 1;  2MOZ A;  3F2E A;  2MTQ A;  4YJ3 E;  2W63 A;  1Z0P A;  4QX7 B;  4WBN E;  1S94 A;  4O4I E;  3K3O A;  2JRK A;  4H9Q C;  4AQF C;  4UF0 A;  2W0G A;  2QGS A;  4PFP A;  5JRE A;  2HPL A;  2EHO D;  3ETV A;  1Y64 B;  1US7 B;  2XAQ B;  3AAA B;  4I55 E;  2ZLY A;  5JRC B;  2K24 A;  4P09 A;  2IW5 B;  3HL6 A;  3LK3 B;  2C5I T;  2VK9 A;  3AAE B;  3BQK A;  4IE0 A;  3KFW X;  3SOL A;  5LGN B;  4XBF B;  3JC6 D;  5C8Y E;  4GOU A;  2RP4 A;  5FY7 A;  4ERR A;  3HKC E;  1CUN A;  2DNX A;  2Q9Q A;  2BZB A;  5JQG E;  2ZM8 A;  3LBX B;  4EYU A;  3KV5 A;  1YD8 G;  2JMH A;  3B57 A;  3UUL A;  2ACX A;  4GYS A;  3N2K E;  2X9X A;  2ZM2 A;  4PK6 A;  3T8O A;  2CMR A;  2ZM0 A;  3RRC A;  3VKG A;  3Q5X A;  1MIY A;  3FXD B;  5LCY A;  4E7S A;  2EHO A;  3I9Y A;  5LNK A;  2D2S A;  2LOP A;  4HGA A;  5IHY A;  2W62 A;  4C91 A;  4PJN A;  2WMN A;  3AAI A;  4UVA B;  1LKX A;  1V9D A;  4PJM A;  3NBX X;  1HS7 A;  1NWM X;  1MMD A;  1UX5 A;  1SA0 E;  2K5B B;  3VKH A;  1EZ3 A;  3NZP A;  3CPZ A;  4HN9 A;  3B13 A;  3CQG B;  2L3L A;  4UF0 B;  2MBG A;  5HXE A;  5HXH A;  3CX6 B;  2CWO A;  2X67 A;  4X20 E;  2BDE A;  4QXB B;  3ZCI A;  4F6R C;  2Y8D A;  2ZMA A;  3KVB A;  1D1C A;  3CWZ B;  3AA0 B;  4HTE A;  3U3I A;  3KIN B;  3ZMS B;  1FMV A;  2N9D A;  2E9X D;  5JDH A;  5LJN A;  4OYJ A;  4HE8 A;  1LRZ A;  4XAX B;  1BR1 A;  5JDL A;  2KWI B;  3O9X A;  2Y48 B;  2Q9Q B;  3C4X A;  4AKG A;  2LE8 A;  2KLQ A;  5KMG P;  3NRY A;  5HXR A;  3RX6 A;  3ZCJ A;  4PK4 A;  4ADZ A;  3PUQ A;  3IHR A;  4Z8X A;  1B7T A;  1G73 A;  2HH7 A;  2CE7 A;  2VB6 A;  3KBU A;  4QX8 B;  5JDF A;  3PUA A;  3ZJ2 A;  1O3X A;  4GYR A;  3QC9 A;  3AVS A;  2V26 A;  4KBM B;  4UV8 B;  2X68 A;  4PAG A;  2LM9 A;  3UUX B;  3S4U A;  2KMF A;  3LBX A;  1E1H B;  2EHO B;  4P0B A;  4K0U A;  4EB6 E;  5M4Y A;  3AA1 B;  5DQV A;  3GA8 A;  5H6R B;  5IYZ E;  5LGT B;  4OYK A;  4O2A E;  1HF8 A;  2E9X A;  4CZZ B;  4ZS2 A;  2CXD A;  3RYH E;  1S35 A;  4PJL A;  5L3B B;  4IE6 A;  5FP3 A;  3EVY A;  2BVM A;  5JR9 C;  3N9N A;  1WRD A;  2NTY A;  2IC6 A;  4YHJ A;  2X51 A;  1MIV A;  1LVF A;  2D0U A;  4ZI2 C;  4HKA A;  3K3N A;  4QKN A;  4O8S A;  3H37 A;  2WSS V;  4H9R C;  3OJA A;  4PK5 A;  3UFE A;  3ZYM A;  2CLY C;  2XUE A;  2CXF A;  2V7K A;  4EOZ B;  4AQG A;  3MA9 A;  5EK3 A;  2MYS A;  2P9B A;  3HKD E;  4UVC B;  1IJ5 A;  2YEV C;  4EIW A;  3OYX A;  2XAS B;  2W00 A;  5F8P A;  4MHC A;  5EK2 A;  3H3A A;  3I1A A;  3WAJ A;  3N2O A;  4H63 H;  4TX5 A;  2XAG B;  2JPF A;  4X1K E;  3ZC1 A;  2LT3 A;  3Q5W A;  2XAH B;  5FNV E;  5J1G A;  4IST A;  3FBL A;  5L3F B;  1D0Y A;  3OKQ A;  4H9O C;  3OYZ A;  5F3J A;  1ZEE A;  2NWB A;  4H9P C;  1MMA A;  4WNK A;  5EK4 A;  5LJM A;  4BAY B;  4DMV A;  1YKH B;  4ZI7 E;  5LHH B;  2OA5 A;  1MNE A;  4MAL A;  4JLE A;  3ZN0 B;  5L3D B;  1HTJ F;  5FXV A;  4ASK A;  3PUG A;  1ZKE A;  4MBQ A;  2V7J A;  2J1D G;  4CQI A;  4G63 A;  4UIG A;  2E9X B;  3LJC A;  1NAF A;  3FHN A;  4QXC B;  3RYF E;  4OHF A;  2W61 A;  4BJN A;  3ZN1 B;  4DO0 A;  2CEA A;  2KIN B;  2VKJ A;  3C50 A;  3KV4 A;  4BJM A;  4A56 A;  5FMN A;  2XAF B;  2H7V C;  2PG8 A;  3VHL A;  5J2T E;  2LHN A;  4ANJ A;  3ZYL A;  3O1I A;  3KBT A;  3PU3 A;  2DCF A;  2GK9 A;  3N9P A;  5FY0 A;  3I9W A;  4N78 D;  2YK0 A;  4HEA A;  2C0S A;  2V7L A;  3R6N A;  2KXP B;  3AA7 B;  4H63 V;  5J2U E;  2V7M A;  4AKL A;  2DI4 A;  2C5K T;  3ONX A;  4IHJ E;  4V1A v;  3Q9D A;  4QHO A;  4CI2 B;  3NRX A;  4YLH A;  2XAJ B;  1UX4 A;  2Y6X A;  2WM9 A;  1QUU A;  2ODU A;  2V1D B;  4I50 E;  3KV6 A;  4XZC A;  2LJL A;  1ZHC A;  5TAO A;  5FY1 A;  2WWU A;  3AVR A;  4TV8 E;  4E7Z A;  4TV9 E;  5LBQ B;  4AQF A;  5JH7 E;  1IZN B;  5L3G B;  4EXT A;  3RKO A;  2KZ7 B;  4AI6 A;  2DHR A;  4M1P A;  2A3D A;  3EDU A;  2XQY A;  3F31 A;  2LEH A;  3MJX A;  3GMI A;  4CI1 B;  2X0L B;  1HG2 A;  4J2C A;  1OWA A;  2JMK A;  2YIN A;  5EZY E;  3UT5 E;  5L2L A;  3HR0 A;  1HCI A;  2NW8 A;  3C4W A;  4JEH B;  3FBZ A;  3N5L A;  4L0R A;  1D1A A;  4AXP A;  4G2A A;  3SWH A;  2A72 A;  2PJQ A;  5DJQ C;  4AKR B;  5LGU B;  4HFV A;  2NOX A;  1FIO A;  3GN5 A;  3O4X E;  4X1Y E;  1WYC A;  2N2N A;  3HI2 A;  5LP6 E;  3ZEF B;  3RYI E;  3HKB E;  5A1L A;  1FMW A;  5DQW A;  4WW0 A;  2LSG A;  2Q9Q C;  4DVD A;  3K8P C;  3CX8 B;  4BA9 A;  4NUU A;  2E8I A;  2NW9 A;  4ZOL E;  3MXZ A;  4P0A A;  3EDV A;  3EUH A;  5LYJ E;  1OXZ A;  3PUR A;  4GK5 E;  2UXX B;  3CQX C;  2D0T A;  3PDY A;  5JR9 B;  3R84 B;  3A5X A;  2IC9 A;  2N1G A;  2CA5 A;  2X9W A;  3FB2 A;  1UCU A;  1U5P A;  2WMO A;  3RRW A;  3PTR B;  4KP3 C;  4O2B E;  2JJ9 A;  4NUV A;  2X66 A;  4O4L E;  5ETW A;  4UV9 B;  1G8X A;  3ZC0 A;  3WI3 A;  4IE5 A;  2EHO C;  1FEW A;  2WBL A;  4L9I A;  3SS1 A;  1X79 A;  4KMC A;  1WYB A;  3MK7 C;  3SRZ A;  5HXS A;  2QA7 A;  4GIW A;  4C90 A;  3DJB A;  3UUN A;  4PJJ A;  2RA1 A;  3IEE A;  3L3P A;  3ZMU B;  4EYY R;  5HAX A;  3RC3 A;  4IDZ A;  3ZJ1 A;  1YKE B;  2VWA A;  3LK4 2;  3OBV E;  3ZLI A;  3MKD A;  3IBP A;  4L5G A;  1VRB A;  4WBO A;  5CA0 E;  3ZMZ B;  2IAK A;  4U74 A;  5FXX A;  3U78 A;  5AFU L;  5L3C B;  3CML A;  4CXW A;  3W15 B;  4KUM B;  1VOM A;  2VAS A;  4EZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...