4ADZA

Crystal structure of the apo form of a copper-sensitive operon regulator (csor) protein from streptomyces lividans
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
90
structure length
90
Chain Sequence
YHKQKAEHLKRLRRIEGQIRGLQRMVDEDVYCIDILTQVSASTKALQSFALQLLEEHLRHCVADAALKGGTEIDAKVEEATKAIGRLLRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Response to Copper Stress in Streptomyces Lividans Extends Beyond Genes Under the Direct Control of a Copper Sensitive Operon Repressor Protein (Csor)
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Transcription
molecule keywords CSOR
total genus 40
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02583 Trns_repr_metal Metal-sensitive transcriptional repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1000 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4adzA00
5LCYA 3AAIA 4ADZA 4UIGA 5FMNA 4M1PA 5LBMA 2HH7A
chains in the Genus database with same CATH superfamily
2XQ8A 4UF0B 4NUUA 3E0ZA 3CX7B 2E2AA 2LRLA 1HG2A 3C51A 3JAFA 5FXWA 2WWVA 3PJAA 4JUYA 1HX1B 4TV9E 4TN7B 3VHLA 3QB5K 2IDOB 3JADA 4UELA 3SS1A 5JR9C 4A98A 5JDFA 4G2AA 4H9SE 4DV2T 4ZI2C 2IHR1 1W0BA 4JI1T 2W0GA 2LSKA 2YDSA 3K8PC 4ZI2D 1OEDA 3EI0A 4MFRA 3AVSA 4IHJE 2K24A 3E22E 5FXVA 3UQ4A 3AE9A 4ADZA 3MACA 5HXHA 1SE7A 2WM9A 3BQIA 1IJ6A 5HCJA 3UFGA 4TWFA 3QNUA 4IDZA 1MMNA 2LHRA 2Q9QA 3J9X1 3ZYKA 1MIYA 2WDQA 1YKHB 2VL0A 4A5XA 3RHWA 1JNZA 3H3AA 2F4VT 2ZMAA 3KINB 3U78A 4B6XA 5LGNB 2Y6XA 3I1AA 4GKJT 3RPUA 1HNWT 2BDEA 5IWAT 3UU4A 3UQ7A 5LHHB 4M1PA 3NRYA 3AE8A 3OBVE 1LVKA 2KLQA 3ETUA 3AEAA 5FYMA 3PUGA 5LA6E 4KMCA 4V1Av 3O1HA 4IE7A 2HPJA 2K3WA 2NP9A 3HI2A 4PK4A 1J5ET 1MMDA 2BG9C 2B1EA 4NPPA 4UVAB 4HFIA 2J1DG 5HXEA 1US7B 2KMFA 4HEAA 5LBMA 4U74A 2E9XA 2H89A 2W62A 3WAJA 3ZC0A 3D0TA 4IIJE 3W15B 1CHUA 1CUNA 2WQYA 5EK3A 4CI3B 3IBPA 4P09A 3OTOT 3ONXA 3V5UA 2JMHA 2WP9A 2XSBA 2J47A 4I43B 4ZZBA 5C8YE 4AKRB 2MTQA 3C4XA 3SFEA 4OFZA 4WBNE 3OYXA 4JBWF 1ZKEA 4KI0F 2WWUA 2D2SA 3RLFF 2P9BA 2BBHA 2XM2A 3MA9A 1AJ3A 5AQGB 2H7VC 3G06A 3TLUA 3VRBA 4QX7B 2K48A 4I55E 4ZOLE 4LF7T 2XUEA 3P4WA 1YXRA 3ANWA 3I9WA 4LF9T 1MNEA 5AQMB 3Q5XA 4ANJA 1T7SA 2HH7A 1FEWA 4PNIA 5KXJA 5LNKA 1KNRA 1X79A 3HL6A 3OJAA 3IEEA 2YKSA 4IL4A 1IJ5A 5AQRB 3RKOA 1HNZT 4TWDA 3UUXB 3VKHA 3HR0A 3H37A 3VU7H 3QUJA 3RX6A 4JEHB 2CEAA 5FY1A 1N32T 4ISSA 1SHZC 2UXXB 2NW9A 3B5MA 5KX5E 2JQ9A 4QXHB 2LKHA 2V5CA 3AE2A 2BS4A 4PK5A 5LYJE 2JIWA 3PE0A 2X66A 4ISTA 4TV8E 5L3DB 1MMGA 3UT5E 3NWIA 4UF0A 2EHOC 3C50A 2L8KA 4OX9T 2X9XA 2Z6EA 4QX8B 1QSDA 4ZXLA 5FL0A 3ABVA 4HWHA 3RGLA 2LSJA 3KVAA 2M6BA 2V1DB 1KFYA 2MAWA 3C4WA 3KFWX 3LG7A 3P8CD 4UEMA 5FVLA 5IYZE 3RRWA 3UU5A 3AE7A 4GIWA 3KV9A 5AQHB 3ZCIA 4BAYB 1R8IA 1E1HB 2A9UA 1IZNB 1W9RA 1YKEB 4OK0A 3RQUA 2QVAA 2UU9T 1WRDA 3SRZA 3AA6B 1T8BA 3AE5A 4X1KE 2WDRA 2I0MA 2V6XA 2QRXA 4DUYT 1HS7A 3RYFE 2IC9A 4TZ4C 3C98B 3AAAB 4YTNA 5L47A 4DV6T 3NKZA 1NWMX 3FZFB 3UTKA 2W63A 4ILUA 4PK6A 4TUYE 5HXCA 3TLSA 2BZBA 2JJ9A 2XQ9A 2CE7A 2L9QA 5AQVB 4AQYT 2JRKA 3B57A 1ZEEA 4F8HA 4YXDA 2CBIA 1KEYA 4GYSA 4I4TE 3KVBA 3MXZA 1H7CA 3PDYA 3L09A 3SFDA 4QWNB 5JDGA 5LXTE 2VASA 3T8OA 2NOXA 1EZ3A 3L8RA 1W09A 2E8IA 3GA8A 2LT3A 1OXZA 3M3ZB 4JLEA 1MIWA 5HEGA 1ZOYA 1GQEA 4LMLA 2UXDT 1T98A 2CXFA 2LEHA 4KX6A 2YK0A 4Z91A 1BR0A 2LSYA 1VOMA 2JQHA 3DJBA 5FKYA 4NXMT 2ES0A 2IAKA 1D1AA 4JI6T 5KMGP 4GK5E 3ONLC 4H9RC 2E9XC 5ETWA 3PUAA 2NW8A 3AXJB 5FXXA 4EIWA 4QXCB 2HPLA 2XTLA 4AKHA 4B3TT 3CX6B 3AXJA 3N5LA 2CXDA 5L3EB 3GWHA 3ZSTA 2MOZA 2X9WA 3QC9A 4H9OC 3RF1A 2PJQA 3EAMA 4TX5A 3UUNA 2ZM2A 2CHNA 5CFBA 5JDHA 3J7Yq 2HN2A 2XAHB 1BR2A 4CXYA 1KK7A 1WFDA 3GN5B 4EEDA 1LRZA 4KHZF 3CQXC 3LK3B 3AAEB 3FZMB 3T1YT 1JNRA 2E9XB 4JI8T 2HN1A 3CVRA 3AE3A 5L4EA 4TWHA 2WAUA 3K3QC 5BMVE 4BA9A 4OHFA 2D5UA 1U4QA 1HFAA 2RP4A 2M6IA 3OKQA 4U7IA 2BKPA 5CA1E 4JV5T 2N1GA 3ZKRA 2XAJB 1SA0E 4O4LE 3BQKA 1KNZA 2BG9E 3HA4A 5CJ5A 5AQIB 4YSZA 1XNQT 2BKOA 2ZM6T 2LLYA 1Z8UA 2BS2A 2E5VA 3N2OA 4COFA 4EYUA 2XAGB 5FP3A 2BG9B 4DV3T 1BR1A 2CCQA 2BG9A 2KZ7B 3A8YC 2H3RA 4Z90A 4AQGA 5L3GB 4YHHT 5FXZA 4IREA 2YINA 4DR5T 2VKDA 4K0KT 4U3CA 5JDQA 1WCRA 2E9XD 2WU5A 3F57A 3FHNA 2IC6A 2LSIA 1XNRT 3PUXF 3ZPOA 2UXBT 1UCUA 3CWZB 2GK9A 3CIRA 4YSXA 4CN4A 3N9QA 4P1NA 5ADXL 3SWHA 4X66T 1YQ3A 2Q9QD 2V6YA 2WSSV 1S35A 1Y01A 2BVMA 2V6YB 5ABEA 2LOSA 4O4HE 3X1DA 3A7MA 4IGUA 4DR1T 1HF8A 4PJMA 4DNDA 4L9IA 2BS3A 1OEDB 4OYJA 2Y48B 5AQLB 3RYHE 1Z0PA 2PG8A 2UUBT 3PUZF 1HTJF 5ABGA 3FB2A 4DMWA 2FJAA 5KDMC 2XQYA 4WYVA 5FL1A 1YD8G 4DR6T 4PW8A 4AI6A 2M67A 3HKCE 4JYAT 2FUPA 3Q2MA 3O1IA 2VL8A 4DO0A 2NTXA 1WR6A 3ETVA 3U3IA 5C2TA 5HEUA 2KSRA 1ZV4X 2WS3A 2NW7A 4IL9A 2XHEB 1G73A 3AEBA 4DR2T 3AAIA 5J1GA 4GYRA 3RIUC 5AQOB 4O8SA 4H9QC 1T72A 5L3BB 4H9NC 2X67A 1N34T 1NAFA 1BR4A 3CQCB 2NTYA 3IHRA 5H6RB 2Y8DA 3E08A 5JR9A 4AQFC 5LBQB 4L0RA 4DBQA 3FZKB 2AE9A 2FJBA 1NEKA 2KNDA 4NIQA 5DQWA 3I0OA 4C90A 1QUUA 4CI2B 3AEDA 3CQGB 5DJQC 3EUHA 1HX8A 5LHIB 4DV4T 5F5WA 2ZM0A 5LG4A 1Y64B 4U2YA 4KHPT 2PFVA 3N9MA 4JI3T 4BJMA 5J2TE 2C5JA 3UUBA 3DP7A 5LP6E 1DU2A 5FY7A 1J5WA 2XQAA 4HTEA 3EABA 3F2EA 1E7PA 1KNPA 1V9DA 2DCFA 2VKJA 2ZM8A 3OYZA 2W00A 4YJ3E 5F8PA 4FI5A 4YLHA 2UXCT 5FNVE 3K3OA 2KXPB 3P4RA 4B3ST 4CN1A 2VQET 4EOZB 1VRBA 4WZXA 3AEGA 1SUMB 1MIVA 3ZJ1A 2J4GA 3ZMTB 2ACXA 2ZLYA 2DI4A 2IIUA 4HGAA 5H6QB 2CMRA 3VR8A 4XZCA 5DQVA 4U31A 5TAOA 5JR9B 3UU8A 4PJNA 4TNVA 2V8SV 5C3JA 4DR4T 4YSYA 1HCIA 2XZEA 2J62A 4QH5A 3CPZA 3AB3B 2W4XA 2WY2A 4JI2T 3ZJ2A 4PJLA 1O3XA 4YT0A 2WMOA 4L5GA 1D0YA 4O2BE 2NWBA 2DNXA 2WB5A 3P4QA 5JVDE 3ZSSA 2DLRA 4IDQA 4AQFA 4AXPA 2W66A 2RA1A 3MK7C 3VR9A 1S94A 5LGUB 1WYCA 4PFOA 4PFPA 3CK6A 4YJ2E 4NXNT 2NR4A 3LDQB 4CXWA 1XDOA 1XZYA 2XAFB 2XQ3A 2LM9A 4H63H 3LFMA 3TKLB 1HG5A 1YW0A 1WYBA 2C5KT 2W61A 4KP3C 5GONE 3NVOA 2XQ4A 4U72A 3K1SA 4LFAT 4MLKA 5JDMA 4O4IE 2BBJA 1U5PA 2X51A 3F31A 3A5XA 2UXNB 4X64T 1W0AA 3RQWA 2E5LT 3BQLA 1UURA 4KUMB 2V7LA 3ZYLA 5EK4A 3UU6A 2MYSA 4YY3T 3QB5A 3KBTA 2WDVA 2XY8B 4O4JE 3LK2B 1UX4A 4EGWA 2WMNA 4QHOA 3HKEE 2CXLA 4PAGA 2G0UA 3UFEA 4C91A 4QH4A 1QLBA 4GOUA 1IBKT 5HEJA 1UUSA 2XQ5A 1MMAA 2AXDS 4IE4A 2XM1A 3KV6A 3PU8A 3H3MA 3B13A 4ZS2A 5ABHA 4JI5T 4H9PC 4UXNB 3Q5WA 3HKDE 3R84B 1FMWA 3UUMA 3P4PA 1ZP0A 2CHOA 3LSVA 2FBWA 4AKIA 4ZEYA 2XASB 3TLVA 3V5SA 4IE6A 4WW0A 2VWAA 2KWHA 2WU2A 4HN9A 3RI5A 1IAPA 4UR9A 5AQNB 4HWFA 5ABFB 4ILCA 5L3CB 3AE6A 2YU1A 4LF8T 5IHYA 2LE8A 4G63A 1N36T 4ERRA 3O4XE 2D0TA 2DWKA 5JH7E 3KV5A 4DV1T 2CWOA 5L2LA 5FMNA 3ZYMA 5JRCB 3PUWF 2OLTA 3K3NA 2SPCA 3QOFA 5AFUL 1LKXA 1OWAA 2LJLA 3DTOA 3PUSA 4JI4T 5LJMA 1D0XA 4LF6T 5LB7B 3L39A 4TNWA 3PV0F 4UIGA 5CB4E 4EYYR 4E7ZA 3JC6D 2OV9A 3M65A 4U33A 4AIUA 4UV8B 1UK5A 3PTRB 3N2KE 4HWCA 1WLXA 3AE4A 3Q5DA 4HFVA 3AA7B 4J2CA 1VCSA 1LVFA 1OEDE 4X5TA 2X9YA 2MPKA 4EV6A 2LHNA 3C4ZA 5AQJB 2RPAA 2X0YA 3LK42 3ZN0B 4XBFB 3AE1A 3Q5EA 1D0ZA 4UVBB 3SOLA 4F6RC 5J2UE 3IF8B 2V7JA 2W2UA 3KV4A 2A2FX 4HFEA 5CGMA 3ZMZB 2LOPA 2V5DA 3RYCE 2X0LB 3ZMSB 4YTPA 1IBMT 5AQPB 4MALA 3EHZA 3GN5A 4HKAA 1YQ4A 4ILBA 2YN6A 5L3FB 2W67A 3PUQA 5AQKB 2CLYC 2XPKA 3RIAA 5AQFB 1I94T 3NBXX 5FY0A 4A97A 2D0UA 2N2NA 3OPCA 4ASKA 1XMQT 3VKGA 2JQKA 5J0ZA 2CBJA 5HCMA 3EVYA 2IMLA 4XAXB 2MBGA 4QXBB 5LHGB 2VVNA 5HYAA 3RYIE 2X9HA 3KDSE 4EZ4A 2PBIA 2VURA 4DV0T 5FVKA 4ZI3C 1FMVA 2N9DA 4DV7T 3CKDA 4IE5A 2KWIB 2EHOB 2IW5B 3ZN1B 2XJ7A 2D9DA 5DABA 2LM2A 2CPTA 4HFCA 3GMIA 4HWDA 4WBOA 4Z8XA 4EB6E 3EDVA 2XAQB 3AA0B 4H63V 2CLYB 2WBLA 4K0UA 3RH3A 1HNXT 5JRCA 4DR7T 2X68A 3PUYF 5HAXA 5E0OA 2YDQA 2H88A 3ESLA 4N78D 3WAKA 2WCAA 3LBXB 2A3DA 4BJNA 3AECA 4ZS3A 1J1JA 3N9PA 1X9BA 2YOEA 3FZHB 3R6NA 3RIUA 4A56A 3N9OA 1E2AA 3ZLIA 4YTMA 5JREA 5AQQB 4PJJA 2CM0A 5LMNT 2YU2A 4X20E 1NENA 2I6HA 3I9YA 1B7TA 3FZLB 4ZI7E 5A1LA 4EAHA 3AEEA 2CWYA 3MJXA 4CI1B 5EZYE 3ZMUB 5JTGA 3JCFA 1M7KA 2VB6A 3P7IA 4U2ZA 3RC3A 4LFBT 1I6ZA 3ZT7A 4CZZB 5AQSB 5HEOA 3AVRA 4YFSA 3VRAA 3AEFA 3PJAJ 5JDNA 3CMLA 2JQQA 4IDOA 4GKKT 2V7IA 2OA5A 2JMKA 4HFHA 2WZIA 5CA0E 2PTFA 3FXEB 5JDLA 1G8XA 1WR0A 4X65T 5HWYA 2JPFA 2VKOA 4IDNA 4DUZT 3ANWB 1OEDC 2L3LA 2LKGA 2C5IT 2LRKA 3PUVF 3TLWA 5IUXA 3RKGA 4JI7T 3FBZA 4ZHQE 3EDUA 4UV9B 4OYKA 4ZZCA 4FJOA 3ONJA 1FJGT 2EHOD 2DL1A 3MKDA 3L3PA 4GK0E 4U7YA 4CQIA 3QK6A 3N9LA 4Q25A 2LSGA 2V26A 2BKNA 2CA5A 4MHCA 4IDPA 3I0QA 4NUVA 3ZT5A 4E7SA 1D1CA 4KBMB 3C64A 5BR8T 4DIDB 5HWXA 2UUCT 2V7KA 4I0UA 4QH1A 3AA1B 4I50E 3WI3A 5LGTB 4AKGA 2EHOA 3S4UA 2KINB 1UGOA 2I59A 4IE0A 4JEUB 1XDPA 1FIOA 2Q9QC 3HKBE 3O1JA 2UUAT 4DR3T 4X1YE 4LMKA 1M62A 1L0VA 4LF4T 2B76A 3PURA 3LBXA 3O9XA 4ILAA 1MNDA 3N9NA 4HE8A 4MBQA 4ZI3D 5HXSA 2DWGA 4P0BA 5LCYA 5AQUB 4B3RT 4EZHA 3NRXA 2XSAA 4WNKA 4CXXA 5JQGE 2KT9A 3CX8B 2QGSA 2DHRA 3NZPA 3P50A 5LOVE 2XQ7A 4QKNA 4X1IE 4UVCB 3UULA 3BK9A 2QYWA 2ACZA 2K9AA 2H7OA 1VCTA 2YEVC 1XWMA 2CRBA 2Q9QB 2V7MA 3RRCA 5F3JA 4P0AA 3UU3A 3LJCA 2XQ6A 4DMVA 1XMOT 2YDRA 2VVSA 3TLTA 5ABFA 4DV5T 2K5BB 3ZCJA 5AQTB 2X0HA 3MZKB 4EXTA 3IA3A 2IUBA 3RC8A 2WZHA 4IT4A 4JI0T 2FJEA 4HFBA 4LF5T 2R6GF 1HR0T 2C0SA 3N2GE 4YHJA 5LG3A 2VKHA 5M4YA 3P4SA 3ZMVB 4EEBA 4LFCT 3JAEA 3ZT6A 4DVDA 4DBRA 1IBLT 4AKLA 3ZC1A 2FJDA 2QA7A 3NZQA 4CN6A 1UX5A 4HFDA 4O2AE 3T1HT 3KBUA 2HHHT 3OVUA 2ODVA 4AISA 4X62T 1N33T 2VK9A 1ZHCA 2BVLA 3FXDB 1D1BA 2ODUA 5L4HA 4B3MT 4LMJA 3JC6C 3PU3A 5LMUT 2VQFT 4HWIB 5HXRA 5EK2A 3ZEFB 3RIFA 5LJNA 3Q9DA 2A72A 5HEHA 3FBLA 1KF6A
chains in the Genus database with same CATH topology
4UF0B 4NUUA 3E0ZA 3CX7B 1HG2A 3C51A 5FXWA 4JUYA 4TV9E 4TN7B 3VHLA 4UELA 3SS1A 5JDFA 4G2AA 4H9SE 4ZI2C 2W0GA 2LSKA 3K8PC 4ZI2D 4MFRA 3AVSA 4IHJE 2K24A 3E22E 5FXVA 4ADZA 3MACA 5HXHA 2WM9A 3BQIA 1IJ6A 4IDZA 1MMNA 2LHRA 2Q9QA 3J9X1 3ZYKA 1MIYA 1YKHB 3H3AA 2ZMAA 3KINB 3U78A 4B6XA 5LGNB 2Y6XA 3I1AA 3RPUA 2BDEA 5LHHB 4M1PA 3NRYA 3OBVE 1LVKA 2KLQA 3ETUA 5FYMA 5LA6E 3PUGA 4KMCA 4V1Av 3O1HA 4IE7A 2HPJA 2NP9A 3HI2A 4PK4A 1MMDA 2B1EA 4UVAB 2J1DG 5HXEA 1US7B 2KMFA 4HEAA 5LBMA 4U74A 2E9XA 2W62A 3WAJA 3ZC0A 3D0TA 4IIJE 3W15B 1CUNA 4CI3B 5EK3A 3IBPA 4P09A 3ONXA 3V5UA 2JMHA 4I43B 5C8YE 4AKRB 2MTQA 3C4XA 4OFZA 4WBNE 3OYXA 1ZKEA 2WWUA 2D2SA 1AJ3A 2P9BA 3MA9A 2H7VC 4QX7B 2K48A 4I55E 4ZOLE 2XUEA 3ANWA 3I9WA 1MNEA 3Q5XA 4ANJA 2HH7A 1FEWA 4PNIA 5LNKA 1X79A 3HL6A 3OJAA 3IEEA 3RKOA 3VKHA 1IJ5A 3UUXB 3HR0A 3H37A 3VU7H 3QUJA 3RX6A 4JEHB 2CEAA 5FY1A 4ISSA 1SHZC 2UXXB 2NW9A 5KX5E 4QXHB 4PK5A 5LYJE 3PE0A 2X66A 4ISTA 4TV8E 5L3DB 1MMGA 3UT5E 4UF0A 2EHOC 3C50A 2L8KA 2X9XA 2Z6EA 4QX8B 1QSDA 2LSJA 3KVAA 3LG7A 2V1DB 3C4WA 3KFWX 3P8CD 5IYZE 3RRWA 4UEMA 3ZCIA 4BAYB 4GIWA 3KV9A 1E1HB 1IZNB 1YKEB 4OK0A 1WRDA 3SRZA 3AA6B 4X1KE 1HS7A 3RYFE 2IC9A 4TZ4C 3C98B 3AAAB 1NWMX 3UTKA 2W63A 4ILUA 4PK6A 4TUYE 5HXCA 2BZBA 2JJ9A 2CE7A 2L9QA 2JRKA 3B57A 1ZEEA 4I4TE 4GYSA 3KVBA 3MXZA 1H7CA 3PDYA 3L09A 5JDGA 4QWNB 5LXTE 2VASA 3T8OA 2NOXA 1EZ3A 2E8IA 3GA8A 4JLEA 2LT3A 1OXZA 1MIWA 1T98A 2CXFA 2LEHA 2YK0A 1BR0A 2LSYA 1VOMA 3DJBA 2ES0A 2IAKA 1D1AA 5KMGP 4GK5E 4H9RC 2E9XC 5ETWA 3PUAA 2NW8A 5FXXA 4EIWA 4QXCB 2HPLA 2XTLA 4AKHA 3CX6B 3N5LA 2CXDA 5L3EB 3GWHA 2MOZA 2X9WA 3QC9A 4H9OC 2PJQA 4TX5A 3UUNA 2ZM2A 5JDHA 3J7Yq 2XAHB 1BR2A 4CXYA 1KK7A 3GN5B 1LRZA 3CQXC 3LK3B 3AAEB 2E9XB 3CVRA 2WAUA 3K3QC 5BMVE 4BA9A 4OHFA 2D5UA 1U4QA 1HFAA 2RP4A 5CA1E 3OKQA 2N1GA 2XAJB 1SA0E 4O4LE 3BQKA 1KNZA 3HA4A 4EYUA 3N2OA 2XAGB 5FP3A 1BR1A 2CCQA 5L3GB 2KZ7B 2H3RA 4AQGA 5FXZA 2YINA 2VKDA 5JDQA 2E9XD 3F57A 3FHNA 2IC6A 2LSIA 3ZPOA 1UCUA 3CWZB 2GK9A 3N9QA 5ADXL 3SWHA 2Q9QD 2WSSV 1S35A 2BVMA 2LOSA 4O4HE 4IGUA 1HF8A 4PJMA 4DNDA 4L9IA 4OYJA 3RYHE 2Y48B 1Z0PA 2PG8A 1HTJF 4DMWA 3FB2A 5KDMC 2XQYA 1YD8G 4AI6A 4PW8A 2M67A 3HKCE 3Q2MA 3O1IA 2VL8A 4DO0A 2NTXA 1WR6A 3ETVA 3U3IA 1ZV4X 2NW7A 2XHEB 1G73A 3AAIA 5J1GA 4GYRA 4O8SA 4H9QC 5L3BB 4H9NC 2X67A 1NAFA 1BR4A 3CQCB 2NTYA 3IHRA 5H6RB 2Y8DA 3E08A 5JR9A 4AQFC 5LBQB 4L0RA 4DBQA 2KNDA 5DQWA 3I0OA 4C90A 1QUUA 4CI2B 3CQGB 5DJQC 3EUHA 1HX8A 5LHIB 2ZM0A 5LG4A 1Y64B 2PFVA 3N9MA 4BJMA 5J2TE 2C5JA 5LP6E 3DP7A 5FY7A 4HTEA 3F2EA 2ZM8A 1V9DA 2DCFA 2VKJA 3OYZA 4YJ3E 5F8PA 2W00A 4FI5A 4YLHA 5FNVE 3K3OA 2KXPB 4EOZB 1VRBA 1MIVA 3ZJ1A 3ZMTB 2ACXA 2ZLYA 2DI4A 4HGAA 5H6QB 2CMRA 4XZCA 5DQVA 5TAOA 5JR9B 4PJNA 1HCIA 3CPZA 3AB3B 3ZJ2A 4PJLA 1O3XA 2WMOA 4L5GA 1D0YA 4O2BE 2NWBA 2DNXA 4AQFA 4AXPA 5JVDE 5CA0E 2DLRA 2RA1A 3MK7C 1S94A 5LGUB 1WYCA 4PFOA 4PFPA 4YJ2E 4CXWA 2XAFB 2LM9A 4H63H 3LFMA 3TKLB 1HG5A 1YW0A 1WYBA 2C5KT 2W61A 4KP3C 5GONE 4U72A 4MLKA 5JDMA 4O4IE 1U5PA 2X51A 3F31A 3A5XA 2UXNB 3BQLA 4KUMB 2V7LA 3ZYLA 5EK4A 2MYSA 3KBTA 4O4JE 3LK2B 1UX4A 4F6RC 2WMNA 4QHOA 3HKEE 2CXLA 4PAGA 2G0UA 3UFEA 4C91A 4GOUA 1MMAA 4IE4A 3KV6A 3PU8A 4ZS2A 3B13A 4H9PC 4UXNB 3Q5WA 3HKDE 3R84B 1FMWA 3UUMA 4AKIA 2XASB 3V5SA 4IE6A 4WW0A 2VWAA 2KWHA 4HN9A 1IAPA 5L3CB 2YU1A 5IHYA 2LE8A 4G63A 4ERRA 3O4XE 2D0TA 2DWKA 5JH7E 3KV5A 2CWOA 5L2LA 5FMNA 3ZYMA 5JRCB 3K3NA 2SPCA 5AFUL 1LKXA 1OWAA 2LJLA 3DTOA 3PUSA 5LJMA 1D0XA 4UIGA 5CB4E 4EYYR 4E7ZA 3JC6D 3M65A 4UV8B 3PTRB 3N2KE 1WLXA 4HFVA 3AA7B 4J2CA 1LVFA 2X9YA 2LHNA 3C4ZA 4XBFB 3LK42 3ZN0B 4UVBB 1D0ZA 3SOLA 5J2UE 3IF8B 2V7JA 3KV4A 2A2FX 3ZMZB 2LOPA 3RYCE 2X0LB 3ZMSB 4MALA 3GN5A 4HKAA 5L3FB 3PUQA 2CLYC 3NBXX 5FY0A 2D0UA 2N2NA 4ASKA 3VKGA 3EVYA 4XAXB 2MBGA 4QXBB 5LHGB 5HYAA 3RYIE 2X9HA 3KDSE 4EZ4A 2PBIA 4ZI3C 1FMVA 2N9DA 3CKDA 4IE5A 2KWIB 2EHOB 2IW5B 3ZN1B 5DABA 3GMIA 4WBOA 4EB6E 4Z8XA 3EDVA 2XAQB 3AA0B 4H63V 2CLYB 2WBLA 4K0UA 3RH3A 5JRCA 2X68A 5HAXA 5E0OA 3ESLA 4N78D 3WAKA 3LBXB 2A3DA 4BJNA 4A56A 4ZS3A 3N9PA 4EXTA 3R6NA 3N9OA 3ZLIA 5JREA 4PJJA 2CM0A 2YU2A 4X20E 3I9YA 1B7TA 5A1LA 4ZI7E 4EAHA 3MJXA 2CWYA 4CI1B 5EZYE 3ZMUB 2VB6A 3P7IA 3RC3A 4CZZB 3AVRA 4YFSA 5JDNA 3CMLA 2JQQA 2V7IA 2OA5A 2JMKA 5JDLA 3FXEB 1G8XA 5HWYA 2JPFA 2VKOA 3ANWB 2L3LA 2C5IT 3FBZA 4ZHQE 3EDUA 4UV9B 4OYKA 4FJOA 2EHOD 3MKDA 3L3PA 4GK0E 4CQIA 3QK6A 3N9LA 5JR9C 2LSGA 2V26A 2CA5A 4MHCA 4NUVA 3I0QA 4E7SA 1D1CA 4KBMB 3C64A 5HWXA 2V7KA 3WI3A 5LGTB 3AA1B 4I50E 4AKGA 2EHOA 3S4UA 2KINB 2I59A 4IE0A 4JEUB 1FIOA 2Q9QC 3HKBE 3O1JA 4X1YE 3PURA 3LBXA 3O9XA 1MNDA 3N9NA 4HE8A 4MBQA 4ZI3D 5HXSA 2DWGA 4P0BA 5LCYA 4EZHA 3NRXA 4WNKA 4CXXA 5JQGE 3CX8B 2KT9A 2QGSA 2DHRA 3NZPA 5LOVE 4QKNA 4X1IE 4UVCB 3UULA 3BK9A 2K9AA 2H7OA 2YEVC 5F3JA 2Q9QB 3RRCA 2V7MA 4P0AA 3LJCA 4DMVA 2K5BB 3ZCJA 3RC8A 3MZKB 2C0SA 3N2GE 4YHJA 2VKHA 5M4YA 3ZMVB 4DBRA 4DVDA 4AKLA 3ZC1A 2QA7A 3NZQA 1UX5A 4O2AE 3KBUA 2ODVA 2VK9A 1ZHCA 2BVLA 3FXDB 1D1BA 2ODUA 3JC6C 3PU3A 5HXRA 5EK2A 3ZEFB 5LJNA 3Q9DA 2A72A 3FBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LCY A;  3AAI A;  4ADZ A;  4UIG A;  5FMN A;  4M1P A;  5LBM A;  2HH7 A; 
#chains in the Genus database with same CATH topology
 2XQ8 A;  4UF0 B;  4NUU A;  3E0Z A;  3CX7 B;  2E2A A;  2LRL A;  1HG2 A;  3C51 A;  3JAF A;  5FXW A;  2WWV A;  3PJA A;  4JUY A;  1HX1 B;  4TV9 E;  4TN7 B;  3VHL A;  3QB5 K;  2IDO B;  3JAD A;  4UEL A;  3SS1 A;  5JR9 C;  4A98 A;  5JDF A;  4G2A A;  4H9S E;  4DV2 T;  4ZI2 C;  2IHR 1;  1W0B A;  4JI1 T;  2W0G A;  2LSK A;  2YDS A;  3K8P C;  4ZI2 D;  1OED A;  3EI0 A;  4MFR A;  3AVS A;  4IHJ E;  2K24 A;  3E22 E;  5FXV A;  3UQ4 A;  3AE9 A;  4ADZ A;  3MAC A;  5HXH A;  1SE7 A;  2WM9 A;  3BQI A;  1IJ6 A;  5HCJ A;  3UFG A;  4TWF A;  3QNU A;  4IDZ A;  1MMN A;  2LHR A;  2Q9Q A;  3J9X 1;  3ZYK A;  1MIY A;  2WDQ A;  1YKH B;  2VL0 A;  4A5X A;  3RHW A;  1JNZ A;  3H3A A;  2F4V T;  2ZMA A;  3KIN B;  3U78 A;  4B6X A;  5LGN B;  2Y6X A;  3I1A A;  4GKJ T;  3RPU A;  1HNW T;  2BDE A;  5IWA T;  3UU4 A;  3UQ7 A;  5LHH B;  4M1P A;  3NRY A;  3AE8 A;  3OBV E;  1LVK A;  2KLQ A;  3ETU A;  3AEA A;  5FYM A;  3PUG A;  5LA6 E;  4KMC A;  4V1A v;  3O1H A;  4IE7 A;  2HPJ A;  2K3W A;  2NP9 A;  3HI2 A;  4PK4 A;  1J5E T;  1MMD A;  2BG9 C;  2B1E A;  4NPP A;  4UVA B;  4HFI A;  2J1D G;  5HXE A;  1US7 B;  2KMF A;  4HEA A;  5LBM A;  4U74 A;  2E9X A;  2H89 A;  2W62 A;  3WAJ A;  3ZC0 A;  3D0T A;  4IIJ E;  3W15 B;  1CHU A;  1CUN A;  2WQY A;  5EK3 A;  4CI3 B;  3IBP A;  4P09 A;  3OTO T;  3ONX A;  3V5U A;  2JMH A;  2WP9 A;  2XSB A;  2J47 A;  4I43 B;  4ZZB A;  5C8Y E;  4AKR B;  2MTQ A;  3C4X A;  3SFE A;  4OFZ A;  4WBN E;  3OYX A;  4JBW F;  1ZKE A;  4KI0 F;  2WWU A;  2D2S A;  3RLF F;  2P9B A;  2BBH A;  2XM2 A;  3MA9 A;  1AJ3 A;  5AQG B;  2H7V C;  3G06 A;  3TLU A;  3VRB A;  4QX7 B;  2K48 A;  4I55 E;  4ZOL E;  4LF7 T;  2XUE A;  3P4W A;  1YXR A;  3ANW A;  3I9W A;  4LF9 T;  1MNE A;  5AQM B;  3Q5X A;  4ANJ A;  1T7S A;  2HH7 A;  1FEW A;  4PNI A;  5KXJ A;  5LNK A;  1KNR A;  1X79 A;  3HL6 A;  3OJA A;  3IEE A;  2YKS A;  4IL4 A;  1IJ5 A;  5AQR B;  3RKO A;  1HNZ T;  4TWD A;  3UUX B;  3VKH A;  3HR0 A;  3H37 A;  3VU7 H;  3QUJ A;  3RX6 A;  4JEH B;  2CEA A;  5FY1 A;  1N32 T;  4ISS A;  1SHZ C;  2UXX B;  2NW9 A;  3B5M A;  5KX5 E;  2JQ9 A;  4QXH B;  2LKH A;  2V5C A;  3AE2 A;  2BS4 A;  4PK5 A;  5LYJ E;  2JIW A;  3PE0 A;  2X66 A;  4IST A;  4TV8 E;  5L3D B;  1MMG A;  3UT5 E;  3NWI A;  4UF0 A;  2EHO C;  3C50 A;  2L8K A;  4OX9 T;  2X9X A;  2Z6E A;  4QX8 B;  1QSD A;  4ZXL A;  5FL0 A;  3ABV A;  4HWH A;  3RGL A;  2LSJ A;  3KVA A;  2M6B A;  2V1D B;  1KFY A;  2MAW A;  3C4W A;  3KFW X;  3LG7 A;  3P8C D;  4UEM A;  5FVL A;  5IYZ E;  3RRW A;  3UU5 A;  3AE7 A;  4GIW A;  3KV9 A;  5AQH B;  3ZCI A;  4BAY B;  1R8I A;  1E1H B;  2A9U A;  1IZN B;  1W9R A;  1YKE B;  4OK0 A;  3RQU A;  2QVA A;  2UU9 T;  1WRD A;  3SRZ A;  3AA6 B;  1T8B A;  3AE5 A;  4X1K E;  2WDR A;  2I0M A;  2V6X A;  2QRX A;  4DUY T;  1HS7 A;  3RYF E;  2IC9 A;  4TZ4 C;  3C98 B;  3AAA B;  4YTN A;  5L47 A;  4DV6 T;  3NKZ A;  1NWM X;  3FZF B;  3UTK A;  2W63 A;  4ILU A;  4PK6 A;  4TUY E;  5HXC A;  3TLS A;  2BZB A;  2JJ9 A;  2XQ9 A;  2CE7 A;  2L9Q A;  5AQV B;  4AQY T;  2JRK A;  3B57 A;  1ZEE A;  4F8H A;  4YXD A;  2CBI A;  1KEY A;  4GYS A;  4I4T E;  3KVB A;  3MXZ A;  1H7C A;  3PDY A;  3L09 A;  3SFD A;  4QWN B;  5JDG A;  5LXT E;  2VAS A;  3T8O A;  2NOX A;  1EZ3 A;  3L8R A;  1W09 A;  2E8I A;  3GA8 A;  2LT3 A;  1OXZ A;  3M3Z B;  4JLE A;  1MIW A;  5HEG A;  1ZOY A;  1GQE A;  4LML A;  2UXD T;  1T98 A;  2CXF A;  2LEH A;  4KX6 A;  2YK0 A;  4Z91 A;  1BR0 A;  2LSY A;  1VOM A;  2JQH A;  3DJB A;  5FKY A;  4NXM T;  2ES0 A;  2IAK A;  1D1A A;  4JI6 T;  5KMG P;  4GK5 E;  3ONL C;  4H9R C;  2E9X C;  5ETW A;  3PUA A;  2NW8 A;  3AXJ B;  5FXX A;  4EIW A;  4QXC B;  2HPL A;  2XTL A;  4AKH A;  4B3T T;  3CX6 B;  3AXJ A;  3N5L A;  2CXD A;  5L3E B;  3GWH A;  3ZST A;  2MOZ A;  2X9W A;  3QC9 A;  4H9O C;  3RF1 A;  2PJQ A;  3EAM A;  4TX5 A;  3UUN A;  2ZM2 A;  2CHN A;  5CFB A;  5JDH A;  3J7Y q;  2HN2 A;  2XAH B;  1BR2 A;  4CXY A;  1KK7 A;  1WFD A;  3GN5 B;  4EED A;  1LRZ A;  4KHZ F;  3CQX C;  3LK3 B;  3AAE B;  3FZM B;  3T1Y T;  1JNR A;  2E9X B;  4JI8 T;  2HN1 A;  3CVR A;  3AE3 A;  5L4E A;  4TWH A;  2WAU A;  3K3Q C;  5BMV E;  4BA9 A;  4OHF A;  2D5U A;  1U4Q A;  1HFA A;  2RP4 A;  2M6I A;  3OKQ A;  4U7I A;  2BKP A;  5CA1 E;  4JV5 T;  2N1G A;  3ZKR A;  2XAJ B;  1SA0 E;  4O4L E;  3BQK A;  1KNZ A;  2BG9 E;  3HA4 A;  5CJ5 A;  5AQI B;  4YSZ A;  1XNQ T;  2BKO A;  2ZM6 T;  2LLY A;  1Z8U A;  2BS2 A;  2E5V A;  3N2O A;  4COF A;  4EYU A;  2XAG B;  5FP3 A;  2BG9 B;  4DV3 T;  1BR1 A;  2CCQ A;  2BG9 A;  2KZ7 B;  3A8Y C;  2H3R A;  4Z90 A;  4AQG A;  5L3G B;  4YHH T;  5FXZ A;  4IRE A;  2YIN A;  4DR5 T;  2VKD A;  4K0K T;  4U3C A;  5JDQ A;  1WCR A;  2E9X D;  2WU5 A;  3F57 A;  3FHN A;  2IC6 A;  2LSI A;  1XNR T;  3PUX F;  3ZPO A;  2UXB T;  1UCU A;  3CWZ B;  2GK9 A;  3CIR A;  4YSX A;  4CN4 A;  3N9Q A;  4P1N A;  5ADX L;  3SWH A;  4X66 T;  1YQ3 A;  2Q9Q D;  2V6Y A;  2WSS V;  1S35 A;  1Y01 A;  2BVM A;  2V6Y B;  5ABE A;  2LOS A;  4O4H E;  3X1D A;  3A7M A;  4IGU A;  4DR1 T;  1HF8 A;  4PJM A;  4DND A;  4L9I A;  2BS3 A;  1OED B;  4OYJ A;  2Y48 B;  5AQL B;  3RYH E;  1Z0P A;  2PG8 A;  2UUB T;  3PUZ F;  1HTJ F;  5ABG A;  3FB2 A;  4DMW A;  2FJA A;  5KDM C;  2XQY A;  4WYV A;  5FL1 A;  1YD8 G;  4DR6 T;  4PW8 A;  4AI6 A;  2M67 A;  3HKC E;  4JYA T;  2FUP A;  3Q2M A;  3O1I A;  2VL8 A;  4DO0 A;  2NTX A;  1WR6 A;  3ETV A;  3U3I A;  5C2T A;  5HEU A;  2KSR A;  1ZV4 X;  2WS3 A;  2NW7 A;  4IL9 A;  2XHE B;  1G73 A;  3AEB A;  4DR2 T;  3AAI A;  5J1G A;  4GYR A;  3RIU C;  5AQO B;  4O8S A;  4H9Q C;  1T72 A;  5L3B B;  4H9N C;  2X67 A;  1N34 T;  1NAF A;  1BR4 A;  3CQC B;  2NTY A;  3IHR A;  5H6R B;  2Y8D A;  3E08 A;  5JR9 A;  4AQF C;  5LBQ B;  4L0R A;  4DBQ A;  3FZK B;  2AE9 A;  2FJB A;  1NEK A;  2KND A;  4NIQ A;  5DQW A;  3I0O A;  4C90 A;  1QUU A;  4CI2 B;  3AED A;  3CQG B;  5DJQ C;  3EUH A;  1HX8 A;  5LHI B;  4DV4 T;  5F5W A;  2ZM0 A;  5LG4 A;  1Y64 B;  4U2Y A;  4KHP T;  2PFV A;  3N9M A;  4JI3 T;  4BJM A;  5J2T E;  2C5J A;  3UUB A;  3DP7 A;  5LP6 E;  1DU2 A;  5FY7 A;  1J5W A;  2XQA A;  4HTE A;  3EAB A;  3F2E A;  1E7P A;  1KNP A;  1V9D A;  2DCF A;  2VKJ A;  2ZM8 A;  3OYZ A;  2W00 A;  4YJ3 E;  5F8P A;  4FI5 A;  4YLH A;  2UXC T;  5FNV E;  3K3O A;  2KXP B;  3P4R A;  4B3S T;  4CN1 A;  2VQE T;  4EOZ B;  1VRB A;  4WZX A;  3AEG A;  1SUM B;  1MIV A;  3ZJ1 A;  2J4G A;  3ZMT B;  2ACX A;  2ZLY A;  2DI4 A;  2IIU A;  4HGA A;  5H6Q B;  2CMR A;  3VR8 A;  4XZC A;  5DQV A;  4U31 A;  5TAO A;  5JR9 B;  3UU8 A;  4PJN A;  4TNV A;  2V8S V;  5C3J A;  4DR4 T;  4YSY A;  1HCI A;  2XZE A;  2J62 A;  4QH5 A;  3CPZ A;  3AB3 B;  2W4X A;  2WY2 A;  4JI2 T;  3ZJ2 A;  4PJL A;  1O3X A;  4YT0 A;  2WMO A;  4L5G A;  1D0Y A;  4O2B E;  2NWB A;  2DNX A;  2WB5 A;  3P4Q A;  5JVD E;  3ZSS A;  2DLR A;  4IDQ A;  4AQF A;  4AXP A;  2W66 A;  2RA1 A;  3MK7 C;  3VR9 A;  1S94 A;  5LGU B;  1WYC A;  4PFO A;  4PFP A;  3CK6 A;  4YJ2 E;  4NXN T;  2NR4 A;  3LDQ B;  4CXW A;  1XDO A;  1XZY A;  2XAF B;  2XQ3 A;  2LM9 A;  4H63 H;  3LFM A;  3TKL B;  1HG5 A;  1YW0 A;  1WYB A;  2C5K T;  2W61 A;  4KP3 C;  5GON E;  3NVO A;  2XQ4 A;  4U72 A;  3K1S A;  4LFA T;  4MLK A;  5JDM A;  4O4I E;  2BBJ A;  1U5P A;  2X51 A;  3F31 A;  3A5X A;  2UXN B;  4X64 T;  1W0A A;  3RQW A;  2E5L T;  3BQL A;  1UUR A;  4KUM B;  2V7L A;  3ZYL A;  5EK4 A;  3UU6 A;  2MYS A;  4YY3 T;  3QB5 A;  3KBT A;  2WDV A;  2XY8 B;  4O4J E;  3LK2 B;  1UX4 A;  4EGW A;  2WMN A;  4QHO A;  3HKE E;  2CXL A;  4PAG A;  2G0U A;  3UFE A;  4C91 A;  4QH4 A;  1QLB A;  4GOU A;  1IBK T;  5HEJ A;  1UUS A;  2XQ5 A;  1MMA A;  2AXD S;  4IE4 A;  2XM1 A;  3KV6 A;  3PU8 A;  3H3M A;  3B13 A;  4ZS2 A;  5ABH A;  4JI5 T;  4H9P C;  4UXN B;  3Q5W A;  3HKD E;  3R84 B;  1FMW A;  3UUM A;  3P4P A;  1ZP0 A;  2CHO A;  3LSV A;  2FBW A;  4AKI A;  4ZEY A;  2XAS B;  3TLV A;  3V5S A;  4IE6 A;  4WW0 A;  2VWA A;  2KWH A;  2WU2 A;  4HN9 A;  3RI5 A;  1IAP A;  4UR9 A;  5AQN B;  4HWF A;  5ABF B;  4ILC A;  5L3C B;  3AE6 A;  2YU1 A;  4LF8 T;  5IHY A;  2LE8 A;  4G63 A;  1N36 T;  4ERR A;  3O4X E;  2D0T A;  2DWK A;  5JH7 E;  3KV5 A;  4DV1 T;  2CWO A;  5L2L A;  5FMN A;  3ZYM A;  5JRC B;  3PUW F;  2OLT A;  3K3N A;  2SPC A;  3QOF A;  5AFU L;  1LKX A;  1OWA A;  2LJL A;  3DTO A;  3PUS A;  4JI4 T;  5LJM A;  1D0X A;  4LF6 T;  5LB7 B;  3L39 A;  4TNW A;  3PV0 F;  4UIG A;  5CB4 E;  4EYY R;  4E7Z A;  3JC6 D;  2OV9 A;  3M65 A;  4U33 A;  4AIU A;  4UV8 B;  1UK5 A;  3PTR B;  3N2K E;  4HWC A;  1WLX A;  3AE4 A;  3Q5D A;  4HFV A;  3AA7 B;  4J2C A;  1VCS A;  1LVF A;  1OED E;  4X5T A;  2X9Y A;  2MPK A;  4EV6 A;  2LHN A;  3C4Z A;  5AQJ B;  2RPA A;  2X0Y A;  3LK4 2;  3ZN0 B;  4XBF B;  3AE1 A;  3Q5E A;  1D0Z A;  4UVB B;  3SOL A;  4F6R C;  5J2U E;  3IF8 B;  2V7J A;  2W2U A;  3KV4 A;  2A2F X;  4HFE A;  5CGM A;  3ZMZ B;  2LOP A;  2V5D A;  3RYC E;  2X0L B;  3ZMS B;  4YTP A;  1IBM T;  5AQP B;  4MAL A;  3EHZ A;  3GN5 A;  4HKA A;  1YQ4 A;  4ILB A;  2YN6 A;  5L3F B;  2W67 A;  3PUQ A;  5AQK B;  2CLY C;  2XPK A;  3RIA A;  5AQF B;  1I94 T;  3NBX X;  5FY0 A;  4A97 A;  2D0U A;  2N2N A;  3OPC A;  4ASK A;  1XMQ T;  3VKG A;  2JQK A;  5J0Z A;  2CBJ A;  5HCM A;  3EVY A;  2IML A;  4XAX B;  2MBG A;  4QXB B;  5LHG B;  2VVN A;  5HYA A;  3RYI E;  2X9H A;  3KDS E;  4EZ4 A;  2PBI A;  2VUR A;  4DV0 T;  5FVK A;  4ZI3 C;  1FMV A;  2N9D A;  4DV7 T;  3CKD A;  4IE5 A;  2KWI B;  2EHO B;  2IW5 B;  3ZN1 B;  2XJ7 A;  2D9D A;  5DAB A;  2LM2 A;  2CPT A;  4HFC A;  3GMI A;  4HWD A;  4WBO A;  4Z8X A;  4EB6 E;  3EDV A;  2XAQ B;  3AA0 B;  4H63 V;  2CLY B;  2WBL A;  4K0U A;  3RH3 A;  1HNX T;  5JRC A;  4DR7 T;  2X68 A;  3PUY F;  5HAX A;  5E0O A;  2YDQ A;  2H88 A;  3ESL A;  4N78 D;  3WAK A;  2WCA A;  3LBX B;  2A3D A;  4BJN A;  3AEC A;  4ZS3 A;  1J1J A;  3N9P A;  1X9B A;  2YOE A;  3FZH B;  3R6N A;  3RIU A;  4A56 A;  3N9O A;  1E2A A;  3ZLI A;  4YTM A;  5JRE A;  5AQQ B;  4PJJ A;  2CM0 A;  5LMN T;  2YU2 A;  4X20 E;  1NEN A;  2I6H A;  3I9Y A;  1B7T A;  3FZL B;  4ZI7 E;  5A1L A;  4EAH A;  3AEE A;  2CWY A;  3MJX A;  4CI1 B;  5EZY E;  3ZMU B;  5JTG A;  3JCF A;  1M7K A;  2VB6 A;  3P7I A;  4U2Z A;  3RC3 A;  4LFB T;  1I6Z A;  3ZT7 A;  4CZZ B;  5AQS B;  5HEO A;  3AVR A;  4YFS A;  3VRA A;  3AEF A;  3PJA J;  5JDN A;  3CML A;  2JQQ A;  4IDO A;  4GKK T;  2V7I A;  2OA5 A;  2JMK A;  4HFH A;  2WZI A;  5CA0 E;  2PTF A;  3FXE B;  5JDL A;  1G8X A;  1WR0 A;  4X65 T;  5HWY A;  2JPF A;  2VKO A;  4IDN A;  4DUZ T;  3ANW B;  1OED C;  2L3L A;  2LKG A;  2C5I T;  2LRK A;  3PUV F;  3TLW A;  5IUX A;  3RKG A;  4JI7 T;  3FBZ A;  4ZHQ E;  3EDU A;  4UV9 B;  4OYK A;  4ZZC A;  4FJO A;  3ONJ A;  1FJG T;  2EHO D;  2DL1 A;  3MKD A;  3L3P A;  4GK0 E;  4U7Y A;  4CQI A;  3QK6 A;  3N9L A;  4Q25 A;  2LSG A;  2V26 A;  2BKN A;  2CA5 A;  4MHC A;  4IDP A;  3I0Q A;  4NUV A;  3ZT5 A;  4E7S A;  1D1C A;  4KBM B;  3C64 A;  5BR8 T;  4DID B;  5HWX A;  2UUC T;  2V7K A;  4I0U A;  4QH1 A;  3AA1 B;  4I50 E;  3WI3 A;  5LGT B;  4AKG A;  2EHO A;  3S4U A;  2KIN B;  1UGO A;  2I59 A;  4IE0 A;  4JEU B;  1XDP A;  1FIO A;  2Q9Q C;  3HKB E;  3O1J A;  2UUA T;  4DR3 T;  4X1Y E;  4LMK A;  1M62 A;  1L0V A;  4LF4 T;  2B76 A;  3PUR A;  3LBX A;  3O9X A;  4ILA A;  1MND A;  3N9N A;  4HE8 A;  4MBQ A;  4ZI3 D;  5HXS A;  2DWG A;  4P0B A;  5LCY A;  5AQU B;  4B3R T;  4EZH A;  3NRX A;  2XSA A;  4WNK A;  4CXX A;  5JQG E;  2KT9 A;  3CX8 B;  2QGS A;  2DHR A;  3NZP A;  3P50 A;  5LOV E;  2XQ7 A;  4QKN A;  4X1I E;  4UVC B;  3UUL A;  3BK9 A;  2QYW A;  2ACZ A;  2K9A A;  2H7O A;  1VCT A;  2YEV C;  1XWM A;  2CRB A;  2Q9Q B;  2V7M A;  3RRC A;  5F3J A;  4P0A A;  3UU3 A;  3LJC A;  2XQ6 A;  4DMV A;  1XMO T;  2YDR A;  2VVS A;  3TLT A;  5ABF A;  4DV5 T;  2K5B B;  3ZCJ A;  5AQT B;  2X0H A;  3MZK B;  4EXT A;  3IA3 A;  2IUB A;  3RC8 A;  2WZH A;  4IT4 A;  4JI0 T;  2FJE A;  4HFB A;  4LF5 T;  2R6G F;  1HR0 T;  2C0S A;  3N2G E;  4YHJ A;  5LG3 A;  2VKH A;  5M4Y A;  3P4S A;  3ZMV B;  4EEB A;  4LFC T;  3JAE A;  3ZT6 A;  4DVD A;  4DBR A;  1IBL T;  4AKL A;  3ZC1 A;  2FJD A;  2QA7 A;  3NZQ A;  4CN6 A;  1UX5 A;  4HFD A;  4O2A E;  3T1H T;  3KBU A;  2HHH T;  3OVU A;  2ODV A;  4AIS A;  4X62 T;  1N33 T;  2VK9 A;  1ZHC A;  2BVL A;  3FXD B;  1D1B A;  2ODU A;  5L4H A;  4B3M T;  4LMJ A;  3JC6 C;  3PU3 A;  5LMU T;  2VQF T;  4HWI B;  5HXR A;  5EK2 A;  3ZEF B;  3RIF A;  5LJN A;  3Q9D A;  2A72 A;  5HEH A;  3FBL A;  1KF6 A; 
#chains in the Genus database with same CATH homology
 4UF0 B;  4NUU A;  3E0Z A;  3CX7 B;  1HG2 A;  3C51 A;  5FXW A;  4JUY A;  4TV9 E;  4TN7 B;  3VHL A;  4UEL A;  3SS1 A;  5JDF A;  4G2A A;  4H9S E;  4ZI2 C;  2W0G A;  2LSK A;  3K8P C;  4ZI2 D;  4MFR A;  3AVS A;  4IHJ E;  2K24 A;  3E22 E;  5FXV A;  4ADZ A;  3MAC A;  5HXH A;  2WM9 A;  3BQI A;  1IJ6 A;  4IDZ A;  1MMN A;  2LHR A;  2Q9Q A;  3J9X 1;  3ZYK A;  1MIY A;  1YKH B;  3H3A A;  2ZMA A;  3KIN B;  3U78 A;  4B6X A;  5LGN B;  2Y6X A;  3I1A A;  3RPU A;  2BDE A;  5LHH B;  4M1P A;  3NRY A;  3OBV E;  1LVK A;  2KLQ A;  3ETU A;  5FYM A;  5LA6 E;  3PUG A;  4KMC A;  4V1A v;  3O1H A;  4IE7 A;  2HPJ A;  2NP9 A;  3HI2 A;  4PK4 A;  1MMD A;  2B1E A;  4UVA B;  2J1D G;  5HXE A;  1US7 B;  2KMF A;  4HEA A;  5LBM A;  4U74 A;  2E9X A;  2W62 A;  3WAJ A;  3ZC0 A;  3D0T A;  4IIJ E;  3W15 B;  1CUN A;  4CI3 B;  5EK3 A;  3IBP A;  4P09 A;  3ONX A;  3V5U A;  2JMH A;  4I43 B;  5C8Y E;  4AKR B;  2MTQ A;  3C4X A;  4OFZ A;  4WBN E;  3OYX A;  1ZKE A;  2WWU A;  2D2S A;  1AJ3 A;  2P9B A;  3MA9 A;  2H7V C;  4QX7 B;  2K48 A;  4I55 E;  4ZOL E;  2XUE A;  3ANW A;  3I9W A;  1MNE A;  3Q5X A;  4ANJ A;  2HH7 A;  1FEW A;  4PNI A;  5LNK A;  1X79 A;  3HL6 A;  3OJA A;  3IEE A;  3RKO A;  3VKH A;  1IJ5 A;  3UUX B;  3HR0 A;  3H37 A;  3VU7 H;  3QUJ A;  3RX6 A;  4JEH B;  2CEA A;  5FY1 A;  4ISS A;  1SHZ C;  2UXX B;  2NW9 A;  5KX5 E;  4QXH B;  4PK5 A;  5LYJ E;  3PE0 A;  2X66 A;  4IST A;  4TV8 E;  5L3D B;  1MMG A;  3UT5 E;  4UF0 A;  2EHO C;  3C50 A;  2L8K A;  2X9X A;  2Z6E A;  4QX8 B;  1QSD A;  2LSJ A;  3KVA A;  3LG7 A;  2V1D B;  3C4W A;  3KFW X;  3P8C D;  5IYZ E;  3RRW A;  4UEM A;  3ZCI A;  4BAY B;  4GIW A;  3KV9 A;  1E1H B;  1IZN B;  1YKE B;  4OK0 A;  1WRD A;  3SRZ A;  3AA6 B;  4X1K E;  1HS7 A;  3RYF E;  2IC9 A;  4TZ4 C;  3C98 B;  3AAA B;  1NWM X;  3UTK A;  2W63 A;  4ILU A;  4PK6 A;  4TUY E;  5HXC A;  2BZB A;  2JJ9 A;  2CE7 A;  2L9Q A;  2JRK A;  3B57 A;  1ZEE A;  4I4T E;  4GYS A;  3KVB A;  3MXZ A;  1H7C A;  3PDY A;  3L09 A;  5JDG A;  4QWN B;  5LXT E;  2VAS A;  3T8O A;  2NOX A;  1EZ3 A;  2E8I A;  3GA8 A;  4JLE A;  2LT3 A;  1OXZ A;  1MIW A;  1T98 A;  2CXF A;  2LEH A;  2YK0 A;  1BR0 A;  2LSY A;  1VOM A;  3DJB A;  2ES0 A;  2IAK A;  1D1A A;  5KMG P;  4GK5 E;  4H9R C;  2E9X C;  5ETW A;  3PUA A;  2NW8 A;  5FXX A;  4EIW A;  4QXC B;  2HPL A;  2XTL A;  4AKH A;  3CX6 B;  3N5L A;  2CXD A;  5L3E B;  3GWH A;  2MOZ A;  2X9W A;  3QC9 A;  4H9O C;  2PJQ A;  4TX5 A;  3UUN A;  2ZM2 A;  5JDH A;  3J7Y q;  2XAH B;  1BR2 A;  4CXY A;  1KK7 A;  3GN5 B;  1LRZ A;  3CQX C;  3LK3 B;  3AAE B;  2E9X B;  3CVR A;  2WAU A;  3K3Q C;  5BMV E;  4BA9 A;  4OHF A;  2D5U A;  1U4Q A;  1HFA A;  2RP4 A;  5CA1 E;  3OKQ A;  2N1G A;  2XAJ B;  1SA0 E;  4O4L E;  3BQK A;  1KNZ A;  3HA4 A;  4EYU A;  3N2O A;  2XAG B;  5FP3 A;  1BR1 A;  2CCQ A;  5L3G B;  2KZ7 B;  2H3R A;  4AQG A;  5FXZ A;  2YIN A;  2VKD A;  5JDQ A;  2E9X D;  3F57 A;  3FHN A;  2IC6 A;  2LSI A;  3ZPO A;  1UCU A;  3CWZ B;  2GK9 A;  3N9Q A;  5ADX L;  3SWH A;  2Q9Q D;  2WSS V;  1S35 A;  2BVM A;  2LOS A;  4O4H E;  4IGU A;  1HF8 A;  4PJM A;  4DND A;  4L9I A;  4OYJ A;  3RYH E;  2Y48 B;  1Z0P A;  2PG8 A;  1HTJ F;  4DMW A;  3FB2 A;  5KDM C;  2XQY A;  1YD8 G;  4AI6 A;  4PW8 A;  2M67 A;  3HKC E;  3Q2M A;  3O1I A;  2VL8 A;  4DO0 A;  2NTX A;  1WR6 A;  3ETV A;  3U3I A;  1ZV4 X;  2NW7 A;  2XHE B;  1G73 A;  3AAI A;  5J1G A;  4GYR A;  4O8S A;  4H9Q C;  5L3B B;  4H9N C;  2X67 A;  1NAF A;  1BR4 A;  3CQC B;  2NTY A;  3IHR A;  5H6R B;  2Y8D A;  3E08 A;  5JR9 A;  4AQF C;  5LBQ B;  4L0R A;  4DBQ A;  2KND A;  5DQW A;  3I0O A;  4C90 A;  1QUU A;  4CI2 B;  3CQG B;  5DJQ C;  3EUH A;  1HX8 A;  5LHI B;  2ZM0 A;  5LG4 A;  1Y64 B;  2PFV A;  3N9M A;  4BJM A;  5J2T E;  2C5J A;  5LP6 E;  3DP7 A;  5FY7 A;  4HTE A;  3F2E A;  2ZM8 A;  1V9D A;  2DCF A;  2VKJ A;  3OYZ A;  4YJ3 E;  5F8P A;  2W00 A;  4FI5 A;  4YLH A;  5FNV E;  3K3O A;  2KXP B;  4EOZ B;  1VRB A;  1MIV A;  3ZJ1 A;  3ZMT B;  2ACX A;  2ZLY A;  2DI4 A;  4HGA A;  5H6Q B;  2CMR A;  4XZC A;  5DQV A;  5TAO A;  5JR9 B;  4PJN A;  1HCI A;  3CPZ A;  3AB3 B;  3ZJ2 A;  4PJL A;  1O3X A;  2WMO A;  4L5G A;  1D0Y A;  4O2B E;  2NWB A;  2DNX A;  4AQF A;  4AXP A;  5JVD E;  5CA0 E;  2DLR A;  2RA1 A;  3MK7 C;  1S94 A;  5LGU B;  1WYC A;  4PFO A;  4PFP A;  4YJ2 E;  4CXW A;  2XAF B;  2LM9 A;  4H63 H;  3LFM A;  3TKL B;  1HG5 A;  1YW0 A;  1WYB A;  2C5K T;  2W61 A;  4KP3 C;  5GON E;  4U72 A;  4MLK A;  5JDM A;  4O4I E;  1U5P A;  2X51 A;  3F31 A;  3A5X A;  2UXN B;  3BQL A;  4KUM B;  2V7L A;  3ZYL A;  5EK4 A;  2MYS A;  3KBT A;  4O4J E;  3LK2 B;  1UX4 A;  4F6R C;  2WMN A;  4QHO A;  3HKE E;  2CXL A;  4PAG A;  2G0U A;  3UFE A;  4C91 A;  4GOU A;  1MMA A;  4IE4 A;  3KV6 A;  3PU8 A;  4ZS2 A;  3B13 A;  4H9P C;  4UXN B;  3Q5W A;  3HKD E;  3R84 B;  1FMW A;  3UUM A;  4AKI A;  2XAS B;  3V5S A;  4IE6 A;  4WW0 A;  2VWA A;  2KWH A;  4HN9 A;  1IAP A;  5L3C B;  2YU1 A;  5IHY A;  2LE8 A;  4G63 A;  4ERR A;  3O4X E;  2D0T A;  2DWK A;  5JH7 E;  3KV5 A;  2CWO A;  5L2L A;  5FMN A;  3ZYM A;  5JRC B;  3K3N A;  2SPC A;  5AFU L;  1LKX A;  1OWA A;  2LJL A;  3DTO A;  3PUS A;  5LJM A;  1D0X A;  4UIG A;  5CB4 E;  4EYY R;  4E7Z A;  3JC6 D;  3M65 A;  4UV8 B;  3PTR B;  3N2K E;  1WLX A;  4HFV A;  3AA7 B;  4J2C A;  1LVF A;  2X9Y A;  2LHN A;  3C4Z A;  4XBF B;  3LK4 2;  3ZN0 B;  4UVB B;  1D0Z A;  3SOL A;  5J2U E;  3IF8 B;  2V7J A;  3KV4 A;  2A2F X;  3ZMZ B;  2LOP A;  3RYC E;  2X0L B;  3ZMS B;  4MAL A;  3GN5 A;  4HKA A;  5L3F B;  3PUQ A;  2CLY C;  3NBX X;  5FY0 A;  2D0U A;  2N2N A;  4ASK A;  3VKG A;  3EVY A;  4XAX B;  2MBG A;  4QXB B;  5LHG B;  5HYA A;  3RYI E;  2X9H A;  3KDS E;  4EZ4 A;  2PBI A;  4ZI3 C;  1FMV A;  2N9D A;  3CKD A;  4IE5 A;  2KWI B;  2EHO B;  2IW5 B;  3ZN1 B;  5DAB A;  3GMI A;  4WBO A;  4EB6 E;  4Z8X A;  3EDV A;  2XAQ B;  3AA0 B;  4H63 V;  2CLY B;  2WBL A;  4K0U A;  3RH3 A;  5JRC A;  2X68 A;  5HAX A;  5E0O A;  3ESL A;  4N78 D;  3WAK A;  3LBX B;  2A3D A;  4BJN A;  4A56 A;  4ZS3 A;  3N9P A;  4EXT A;  3R6N A;  3N9O A;  3ZLI A;  5JRE A;  4PJJ A;  2CM0 A;  2YU2 A;  4X20 E;  3I9Y A;  1B7T A;  5A1L A;  4ZI7 E;  4EAH A;  3MJX A;  2CWY A;  4CI1 B;  5EZY E;  3ZMU B;  2VB6 A;  3P7I A;  3RC3 A;  4CZZ B;  3AVR A;  4YFS A;  5JDN A;  3CML A;  2JQQ A;  2V7I A;  2OA5 A;  2JMK A;  5JDL A;  3FXE B;  1G8X A;  5HWY A;  2JPF A;  2VKO A;  3ANW B;  2L3L A;  2C5I T;  3FBZ A;  4ZHQ E;  3EDU A;  4UV9 B;  4OYK A;  4FJO A;  2EHO D;  3MKD A;  3L3P A;  4GK0 E;  4CQI A;  3QK6 A;  3N9L A;  5JR9 C;  2LSG A;  2V26 A;  2CA5 A;  4MHC A;  4NUV A;  3I0Q A;  4E7S A;  1D1C A;  4KBM B;  3C64 A;  5HWX A;  2V7K A;  3WI3 A;  5LGT B;  3AA1 B;  4I50 E;  4AKG A;  2EHO A;  3S4U A;  2KIN B;  2I59 A;  4IE0 A;  4JEU B;  1FIO A;  2Q9Q C;  3HKB E;  3O1J A;  4X1Y E;  3PUR A;  3LBX A;  3O9X A;  1MND A;  3N9N A;  4HE8 A;  4MBQ A;  4ZI3 D;  5HXS A;  2DWG A;  4P0B A;  5LCY A;  4EZH A;  3NRX A;  4WNK A;  4CXX A;  5JQG E;  3CX8 B;  2KT9 A;  2QGS A;  2DHR A;  3NZP A;  5LOV E;  4QKN A;  4X1I E;  4UVC B;  3UUL A;  3BK9 A;  2K9A A;  2H7O A;  2YEV C;  5F3J A;  2Q9Q B;  3RRC A;  2V7M A;  4P0A A;  3LJC A;  4DMV A;  2K5B B;  3ZCJ A;  3RC8 A;  3MZK B;  2C0S A;  3N2G E;  4YHJ A;  2VKH A;  5M4Y A;  3ZMV B;  4DBR A;  4DVD A;  4AKL A;  3ZC1 A;  2QA7 A;  3NZQ A;  1UX5 A;  4O2A E;  3KBU A;  2ODV A;  2VK9 A;  1ZHC A;  2BVL A;  3FXD B;  1D1B A;  2ODU A;  3JC6 C;  3PU3 A;  5HXR A;  5EK2 A;  3ZEF B;  5LJN A;  3Q9D A;  2A72 A;  3FBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...