4AE2A

Crystal structure of human fibrillar procollagen type iii c- propeptide trimer
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
216
structure length
212
Chain Sequence
PDGSRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKLDAIKVFCNMETGETCISANPLNVPRKHWWTDKKHVWFGESMDGGFQFSYGNPELPEDVLDVQLAFLRLLSSRASQQITYHCKNSIAYMDQASGNVKKALKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYRTRKAVRLPIVDIAPYDIGGPDQEFGVDVGPVCFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLLAGEN ALPHA-1(III) CHAIN
publication title Structural Basis of Fibrillar Collagen Trimerization and Related Genetic Disorders.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 62
structure length 212
sequence length 216
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01410 COLFI Fibrillar collagen C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1000 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ae2A02
3.30.750.130 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 4ae2A01
4AEJA 4AK3A 4AE2A
chains in the Genus database with same CATH superfamily
5BV6A 1CD3G 2VD7A 2OUHA 1RXGA 3TBDA 2JICA 2UWBA 1AL21 1OXCA 2W1QA 5GZEA 1BBT1 1HRI1 4D69A 4Q5OA 4WZFA 5FYUA 1UOBA 5A3PA 1BUZA 4CDUC 5EUSA 5CAZA 5D2AA 1QDCA 2UURA 4QPWA 5G04L 4QKBA 5A1FA 4H2AA 5FZ7A 2DURA 5FOBB 1UL9A 1LGBA 2HBTA 3WCRA 3WQ0A 2VUCA 1SZBA 4Y4RA 4QPGB 1H8VA 1PHMA 4XUOA 1F5FA 2FCTA 2GU9A 2ZHMA 4PF5A 1NE4A 4DXSA 5FZIA 2D6PA 4XF1A 2RMU2 4GWNA 5DZGA 1ZBE1 3ZFGA 3GVJA 5A32B 3ZKYA 2VMEA 5FRAA 4R9AA 3DYMA 3VDDB 2PA7A 5DXDA 1JZ7A 3ZMNA 2VC9A 2ZGUA 1J83A 3CF6E 4FFHA 1JZ8A 2WZR3 4N9IA 4AL9A 3AJYA 3ZO0B 5HCHA 4LLOA 4DMIA 1F4AA 4LORA 2VUJA 3AGDA 3T1LA 2VQUA 3ZSMA 1ZVFA 3D3UA 3KQRA 2WWSA 5FUIA 1THNB 4C1XA 1O59A 1MS9A 1A78A 1C8M1 2XVLA 3C7EA 3RVHA 4LMFA 4S2DA 1H8TA 1WWYA 3AMNA 4RQPA 5DABA 2JKBA 2RS33 2PN5A 3EO6A 5H9SA 5LBFA 1Q56A 2MNGA 1GU3A 3AYCA 4YGCA 5GZFA 5I8YA 3VBUA 1IKPA 3ZXEA 2KD7A 1GV9A 4YPJA 3RYRA 4ZKTB 5C5TA 1NX9A 2V5YA 4NHXA 5CFCB 2GAUA 1F5JA 1VPHA 3O14A 2J7MA 3OY8B 4C91A 1LOEA 5A32A 5C9AB 4HMZA 3ENRA 1Y9MA 2Q30A 1P8JA 5DZFA 4XJUA 1N3PA 1YXWA 1C4RA 4FI9A 2DXLA 1YQ6A 5EQUA 4XJ8A 1S0JA 1IGOA 1CVNA 2WZR1 5AFBA 2D3PA 1GOFA 3ELNA 1QQP3 1DYPA 3KZ4C 3OYWB 3IB3A 1MEC3 4META 2GNBA 1FC7A 1SFNA 5J37A 3KMHA 5GALA 5ERLA 3T4HB 5ABJB 4Y20B 3QACA 1BEV2 2VVEA 5LZ6A 3GZEA 3RWKX 3GGLA 5SV5A 3O1OA 1K45A 3O1MA 2RG4A 4FVVA 4B4QA 2W68A 3C7OA 4CVUA 5JXIA 2OS2A 1D4M2 5F37A 3DPRC 4D8MA 2RS31 2DF7A 4BLJA 3M3CA 4GALA 3RSJA 1K42A 2G9GA 4EWAA 5AVAA 2PHUA 4YW7A 3N9OA 3POJA 2GZWA 3O1UA 2VCMA 2VVDA 4J1XA 4PDWB 1CGPA 5LCWL 1VP6A 1DZQA 2D7FA 1VBB3 1FV2A 2A3WA 2AH2A 2WR9A 2ZJCA 2QCSB 3BN6A 3O5SA 4QDRA 5IJRA 2VY0A 2CWMA 3POEA 4DPNA 2GMMA 4NHYA 4MGIE 1LJ7A 5C71A 4JC0A 3J8F3 1XE7A 2EIEA 2YZ4A 5E88A 3CIHA 3H50A 4DXTA 5AC92 1ZYBA 3ZYPA 2ARXA 5FREA 1QQP1 4FOWA 4MH0E 1MEC1 1OVPA 1S0IA 2NQYA 2O0OA 4LOSA 5FPZA 1AR62 3E97A 4AFAA 2JECA 3ZM8A 3C3VA 3KT4A 2ERFA 3PUHA 4P14A 4Z2AA 1D4VB 5FPBA 3FBMA 2D6MA 3LWCA 3OJBA 4TXWA 3ZN6B 3AXDA 3N36A 2C9KA 2WN3A 2ZZJA 4HZFA 1WMDA 3GHFA 2CAVA 2JDUA 4IGQA 1QIQA 4LO5B 4NPLA 1GNYA 5L7OA 4DZGA 2W3JA 2JDZA 1VBB1 1JZ6A 1R1A3 3FZ3A 5BYNA 3KV4A 1T2XA 2HWE3 4JGZA 4GKXA 5ACA1 1A34A 4Z2WA 2Y6GA 4SLIA 5FYBA 3JQWA 1LOAA 1BLZA 3IN9A 1MS5A 3J8F1 3ZN4A 5BNNB 1OI6A 3IBMA 5DUWA 3OGGA 4UWDA 4COYA 1A8DA 3WV6A 5F6LB 3N4MA 2Q8OA 3POYA 2WIIB 1TNFA 1GWLA 4EZ4A 5C3RA 4GB32 3JBG3 4HVRA 3OBZA 2R7EB 4H7MA 2VCBA 4UBGA 2CY6A 3ZYGA 2P2KA 2FD8A 4LTAA 1CAUB 2MEV3 1PX3A 1AZDA 5FDBA 5J1XA 1ND2A 4TN7A 4WVMB 4Q4V3 5CB7A 4DXZA 3LZZA 1JUHA 2PTMA 4IQPA 1GUIA 3CO2A 3R0RA 4JQRA 2RM22 1LU2A 5L9BA 3PVOA 3UT0A 5JZGB 5JDBA 3FX3A 3LSDA 2VU9A 5KHKA 1ND3A 3VZNA 1NLSA 4X8NA 3WW2A 2YFUA 1RUF3 2AR6A 3VDAA 4GQ7A 2YHJA 4R4ZA 1SHWB 2LROA 5FPVA 4JHZA 4S2GA 1OH4A 1R1A1 4ZU4A 5F7UA 4M0NA 2BRTA 4D7YA 2TUNA 4Q2FA 5FYTA 2SBAA 4CEYA 5BNPA 3SKJE 5BNNA 2J42A 1A8MA 1KJRA 2D3SA 2W47A 2WNOA 3BU7A 4XFAA 5JPNB 3M3QA 4NAMA 3JBG1 1LR5A 1J1TA 3PIJA 3QD6A 5IUQA 2YUEA 4R8HA 1UZYA 4ET7A 5T55A 1VB4A 1AR83 1CIWA 1RYYA 2MEV1 3BOWA 3NVCA 3VZOA 3ZPOA 1ENXA 5CBLA 4WVMA 5LRSA 3OGVA 4QU1A 4Q4V1 3WDYA 3UNPA 4KWKA 1JZ2A 2YY1A 3ILFA 5F5CA 3ZTBA 3KM5A 1SFPA 1W6MA 2HJIA 2GDFA 4XBLA 2D98A 5IWFA 1TMF3 4BQ2A 1DQ1A 2BOIA 2EF6A 1I3HA 5FYCA 1F2NA 5L9VA 1MQTB 1RUF1 1SPPA 3OPWA 3WW1A 4HVQA 5B4XA 2E7QA 1ZX5A 1RUC2 1IPKA 2Q4SA 3HMYA 3ZDVA 2WT0A 4MGQA 4KNCA 3CDZB 4LK6A 3F43A 1FPN2 4QT6A 5A33A 5CFDC 4LITA 4LE3A 3AYDA 1JYVA 5A80A 5IVVA 4ES8A 3I2HA 2NN8A 2HWD2 4LPLA 4AVTA 3BTXA 4CP9B 4Z92B 4E4DX 1A3KA 4QX5A 1JYXA 2WA4A 1PNFA 4GWJA 4TZDA 3N9NA 1CJPA 4B1MA 4CA9A 3AVRA 1AR93 1YLLA 4HK8A 3RMXA 4XFIA 4D7SA 5JPMB 2QKDA 1YI9A 1K3IA 1AR81 4NRMA 2G9ZA 2ILMA 1S0CA 3BALA 4QX7A 2BWCA 3P5BA 1ULGA 3VKOA 5T50A 2UWCA 3U1XA 1IS3A 5A3OA 2DCJA 2QQOA 1S1AA 3PMSA 4CUBA 2VOWA 3V97A 1TMF1 2D3RA 1SEFA 4PBOA 1QJEA 1W8WA 2VMIA 4JZRA 4CU6A 1PGL1 2VPVA 2ZEXA 5C4WA 1ODMA 5FP7A 2R071 1GNHA 4LEJA 1PMJX 4YVWC 4AQ6A 2X29A 2FQPA 2LW8A 1W8UA 2ZGKA 4XACA 3WNOA 4OUMA 5FZ0A 2WO3A 5JMCA 1NXMA 2ZCWA 4RFRB 3HJRA 1PVXA 4IL7A 2UY8A 3NNJA 3NV2A 2XLAA 4YW1A 3PJYA 4HG6B 1RUE1 4EE2A 3VD3A 3GJBA 5ANQA 2ZHNA 4BA6A 4N8MA 3E5UA 1PGW2 5T54A 4QPIA 1K5MC 1AR91 5LBCA 3D6EA 2Z69A 3NWKA 3C0KA 1US2A 2PHRA 1ZA4A 5FXVA 4ISRA 1I5PA 3SC7X 3IMNA 2E33A 3GM8A 2EIGA 4RN5A 4OVEA 3IPVB 1H1IA 2DVBA 4JRAA 4PCRA 4D3WA 4YGBA 2R043 2ZOEB 2DVAA 5BNOA 1YUDA 4DRVA 4DUVA 3VHPA 4MGTA 1UAIA 4PBPA 1QJFA 3NKTA 3VBUC 5CIRA 3SEEA 3B01A 1HB1A 1RUH2 4ZS2A 5F5AA 2BOJA 1HV1A 4JGYC 1W9TA 1W2TA 3CJIA 4AGVA 1ZA7A 3SH5A 2BERA 4EROA 1PO23 2VXRA 3U37A 3WZ1A 4QXCA 1YFYA 4D7TA 4HSLA 1J3RA 3GCXA 2WQ8A 4OI1A 1JI6A 4ONUA 3URFA 3ZIWA 4L8KA 4QGMA 1PVC3 1UMHA 2YB7A 3JQXA 4FO9A 2VOXA 1RUNA 4XIOA 2C4XA 4AYUA 2IVJA 3NNMA 1W8ZA 1UPSA 1GWMA 4DEQA 4DNYA 1ZRIA 3MV01 4Q0QA 2XJTA 2J1SA 3KF3A 1AX0A 3HQXA 5A1LA 1V0AA 2RDQA 3LFIA 2Z42A 1WW6A 3IAPA 5LBEA 2CAUA 2VTXA 4CDQB 1NCRA 1YO8A 2R041 4UFKA 2AC1A 4AGGA 1QKQA 4HL0A 1OOPA 5FY8A 2BGCA 1H1AA 3ITQA 5IVBA 3W9AA 4BHPA 4FBFA 3D03A 1W6QA 4EN0A 2RV9A 3LOIA 5EXOA 2JG8B 1JHJA 3KB5A 2JG9B 4NIHA 3ZXJA 1O4TA 1APNA 1W9YA 4XF0A 4DIQA 1PO21 2Q0AA 2ZTNA 5CYYA 3HQUA 3HVDA 4QX2A 4HKLA 2P17A 2XQXA 1TVGA 4MGZE 3RQ0A 3MIBA 2KA5A 3I4IA 4NUBA 4A7ZA 1PVC1 1S2KA 1ASJ2 2OA2A 4J1WA 2D6KA 4X6RB 4IEPA 2ARAA 2FDHA 1ZM1A 3AP4A 2XWJB 4Q8LA 1UPIA 3LDBA 2HH9A 4XJAA 1OQDA 4B8EA 3MW4A 4XQ4A 3WDXA 1J3PA 4CCDA 1BK1A 1Y7BA 3LE0A 5IVYA 3H8UA 1XYNA 2XPJA 4YYOA 1X9TA 4YARA 1HXS3 5EYYA 1OHFA 4CDUB 4DY3A 4R9DA 2HWF2 3SCFA 3Q9OA 2WAOA 3ZYFA 1VBE3 2JG8A 3F2ZA 1DP0A 2ZXQA 5CG9A 3ZR5A 1AF9A 3H8RA 4Y5SA 1GZTA 3GBGA 4NE9A 5D8AA 5C8CC 3ACLA 1KDKA 5IK7A 1OQEA 3HD8B 3AFGA 4LO7A 4E2QA 4URTA 2ZX2A 1BXHA 3KV6A 1F4HA 3IM0A 5SV8A 3NMBA 3USUB 3GHMA 3AKSA 4H3WA 1GR3A 1U5YA 3N7LA 3T08A 2XDVA 3W58A 1UXXX 1J7XA 3IT8A 5FBJA 1MPXA 4QQPA 3MPBA 4ORFA 3POGA 2WZ8A 5FMCA 5FMOL 1N1VA 1E5RA 3QH6A 3F95A 4DOUA 2VL4A 4LO6B 5FFOC 5HCBA 1C1FA 4CDUA 4PQQA 1HXS1 2DCKA 3VD4A 1EP0A 1W2AX 2R6QA 5CKNA 1J59A 2GC2A 4QD2A 3SH3A 3B9IA 3M1HA 1BMV2 3IWZA 4UI9L 1O8PA 2O8OA 2V4AA 4MXWA 4YW2A 3RWNA 5C3QA 3IDAA 4PLMA 1DQ6A 2B45X 2QQJA 4K20A 2QZ2A 3WD5A 1XQNA 4K8FA 3E1F1 5LB6A 1I5ZA 3RZZA 3KGZA 1W3XA 3AKTA 4BB3A 2YBPA 2A6ZA 1NZIA 2NZ9A 5CVRA 3DJAA 4CCMA 3PNAA 4CPBA 1DIWA 4QKNA 3LD8A 1X9PA 1DYKA 4RR3C 5DUVA 1A6CA 3WT3A 1BK0A 3USUA 4C0HA 3I3MA 3S7IA 1OA4A 5FY5A 4FPCA 4B4RA 5JCTA 2PXJA 1ZZ6A 4V2WA 1H1MA 1V9U2 4YSFA 3WG2A 1ZBA3 4QWNA 1PK6C 4D6SA 2VUAA 3RJ2X 4CPBD 4L92A 1EAH1 2W92A 1PZ8A 5FZLA 2PAKA 3A0NA 1G6NA 5FWEA 4IEYA 1JYCA 1UU4A 1KEXA 1X7NA 4P5HA 4XETA 4CEWC 1W6OA 3M3EA 2O8QA 4J25A 5DAVA 3E5XA 3ZOIA 4O61A 3GBWA 5JSOA 1X36A 1PO12 1DGLA 5DDJ2 1CPMA 1O3SA 4IE6A 4N53A 2V09A 2W5FA 1RGSA 3LEKA 4XYXA 3ES4A 4IE4A 1OQ1A 4JKKA 4UW4A 5F39A 3H3LA 3ACIA 4Q1RA 3HEIA 3RZHA 5J36A 3MIEA 3AKQA 3PL0A 2DUOA 1DBNA 4FPJA 1EV13 2P3YA 5F3EA 3ZYHA 5EYXA 1DGRN 3EB7A 2A3YA 3MFAA 3NY7A 4P08A 5FYSA 2HYXA 2E9QA 3OSDA 4BJ0A 4LBKA 1SMVA 5IHRA 1FNYA 2BBAA 5FZ4A 1ZBA1 5E89A 5GJ6A 2EXHA 2K0GA 1FOD2 2R32A 3IMMA 4LBMA 2FCVA 1XNBA 2QQPA 3K46A 5IW0A 1VBD1 5FMBA 4BIFA 4ASKA 1UY1A 1AL22 1GKBA 1KRIA 1BBT2 1HRI2 1QHDA 1NQJA 1WW4A 3B02A 3H0OA 2JB4A 3MIGA 4IETA 1OUSA 2ZGQA 3SCHA 1QGLA 2VZTA 1BHGA 2E31A 3DPRA 3ZFFC 1D0HA 4JV4A 4QQLA 1WCDJ 1W39A 4EZHA 3P3PA 2H0BA 1LU1A 5JOXA 2ZHLA 4D0QA 1KDMA 2RDSA 4AHZA 1CJDA 4DUWA 1PMHX 2QQMA 4IW3A 1EV11 1JW6A 4YZ3A 4BM8A 1ZBE2 1LTEA 2WINB 4W65A 1CN1A 4LUKA 3VHRA 3IDBB 4XBNA 3EXUA 1NYWA 2XL7A 1HN0A 1YNAA 4JAAA 3UK9A 3MIDA 3AKRA 4CDXC 2C9AA 3W21A 3A7QA 4RGKA 2OQ6A 2OYZA 1DF0A 5F5QA 4BXSV 2VMDA 4MGYE 4YM3A 4AEDB 1KFXL 4FPYA 5DPNA 1C1LA 4HN0A 4I09A 5EJ3A 2VQ0A 1C8M2 3JB8A 2QQNA 1WLTA 3O1PA 4JDOA 4DGFA 2P3JA 1UOJA 2VMGA 1PIV3 4LOTA 3ST7A 1OT5A 5J7MA 2B39A 3UGHA 2KA3A 4ZXEA 4MHRA 1O3TA 2XVGA 4GMP3 4CCKA 3MIFA 1ZZBA 3EYPA 5A3MA 4AI2A 1NKGA 1FXZA 1OLMA 2OPKA 2V73A 1AX2A 4BQ5A 4IEWA 3LDKA 1QOSA 1SG3A 1YC61 2ADEA 4XVHA 5HCAA 1UW8A 2EIBA 1KFUL 5AFEA 2D6LX 4MSVA 1F35A 2WZR2 1JYIA 2XONA 4CZSA 1COV3 4IV3B 4LHKA 2XH6A 5DUXA 2BUKA 3TEXA 3ZYBA 4BZ4A 2Q1MA 2FDJA 2ETEA 3PUSA 3CJXA 1UCXA 4JX0A 4RS5B 5F32A 4AOCA 1LOFC 4Y5TA 3WG3A 1NCRC 3UYJA 4DFSA 3IF5A 4AFMA 2E26A 2PAMA 1UXZA 2RDNA 2VZQA 1T6GC 1DDLA 3K50A 3IZOA 3UL2A 2ADDA 1VMHA 2RR12 3AZXA 2GALA 2PQSA 3HWJA 4IV1B 1QH6A 1H4XA 4EV0A 2RS32 1PIV1 5A3UA 3EH7A 4OZOA 3VBSB 2Y26A 4XC9A 5BY5A 2A6YA 2D6NA 4GMP1 2XKPA 1O3QA 2RDRA 3GMFA 3Q8EA 1YEWA 3FHIB 2C1FA 2BU9A 2ZMKA 1DLCA 1OVSA 1YCIA 2F4PA 2F17A 1POV3 4Y1XA 3TWIA 5FQ0B 2IXJA 3POBA 1WKYA 1D7PM 4AQSA 2WWJA 4QKFA 1JN2P 2IFWA 1GP5A 3P3NA 4XDOA 4Z07A 2PHDA 2EIDA 5K4LA 5K9YA 3NAPC 4AK3A 4OMDA 1GLHA 1N1SA 3WP5A 4U36A 1QQP2 1MEC2 4YG3A 3O1SA 3D3AA 2B9UA 1DFQA 1NAEA 4BDVB 1H2LA 2GC3A 2HWB3 2R061 3GCWA 4BQYA 4GH4C 3QDQA 2ZKLA 2VZOA 4PIZA 3RYKA 1NLRA 2Q5TA 2UY9A 3JCIA 1YQ5A 1J84A 4LBQA 3WDWA 5IVFA 5JXJA 1O3RA 4NIDA 3I3QA 4BU2A 3CNAA 1BYHA 5T5OA 4E9KA 2GSYA 2R0FA 4E8CA 3WQ7A 4LBQD 2PAEA 2JE8A 1POV1 1VBB2 3NNFA 1LODA 5CFDA 5ACA2 2ZGPA 3ZFGB 1DG6A 1S2EA 3PVEA 2PHWA 1HF2A 5CISA 4JQTA 3J8F2 3HN3A 3NJZA 3NKGA 4N43C 2BGOA 4OI4A 3HNMA 3WHUA 1OBNA 1QXJA 3WG1A 1IHMA 5JSRA 4A44A 5I8SA 1IQDC 3I3BA 1W03A 4KU8A 1MS3A 4HONA 2CWWA 1K5MB 4E2GA 4IEVA 4BK5A 2HWB1 1AYN3 2A6VA 2JENA 3KQ4B 4MOAA 2B78A 3MOGA 2XJRA 3D4KA 2WJSA 2ZGOA 2D93A 1DQ0A 1VB2A 4OQ9A 5FOJB 1YFXA 1YHFA 3B94A 3I2FA 1HIXA 1W05A 2ZHKA 4ITCA 3BUCA 4P9XA 2GNDA 1BCXA 5A3TA 3DYOA 2WS93 4IE7A 4A6SA 5GZGA 4Y1ZA 1H8TB 2Q8DA 3UESA 3KV5A 4KL1A 3V0BA 1XNKA 4RQPB 1XSQA 4UW5A 4YVWA 4RL7A 2VOTA 3LF7A 1LRHA 3VKNA 1V6OA 5EUWA 3VBUB 4AHXA 3RG0A 2F6BA 2XWBB 3ZXGA 4YM0A 4ATEA 4A7YA 1R1A2 4JGYB 1LGNA 4QQ2A 4V2VA 3T0BA 2WWUA 1QJZA 4JRLA 2Y6FA 3LEGA 3T30A 1MS0A 2DFBA 2ZA9A 4KGQA 1R093 2E32A 1K5MA 3JBG2 3WW4A 4E8DA 1US3A 1JOPA 1W8HA 1W90A 4Y22A 5IAXA 4IXLA 5J96B 5JOZA 1RIRA 3DKQA 3V64A 1B35C 2WLQA 2MEV2 1RMU3 4LKEA 1IPSA 2D6OX 2WUHA 1G8WA 4NRPA 4Q4V2 4AF9A 3Q8BA 5C3PA 2JDMA 1QY4A 1O4ZA 3GF6A 1LNSA 3K4ZA 3RMYA 3VBFC 5FV3A 4CDWC 4ZU5A 2WS91 1LGCA 2VZUA 1UKGA 4N53C 5FZOB 4WV8A 1MVQA 1V00A 3DXTA 4NMIA 4AFDA 4ZZ8A 5IATA 2JKXA 2VW0A 4QXBA 3KHCA 1RUOA 1QMJA 1RUF2 2WNEA 3KT7A 4UFHA 5JXGA 2D97A 3B9CA 4JGYA 5FXZA 1HN1A 2PHFA 1XYOA 3ETQA 2VO5A 4FOYA 5JR7B 4COUA 4LLFA 1MZ5A 4A7KA 4PT6A 1Z0HA 2W95A 4QU2A 3FHQA 1ENSA 3V56A 1R091 1RHI2 2WDBA 4O9EA 2Y60A 4K1YA 2WFF3 2EAAA 4UF0B 1GQHA 3IKWA 1OFSA 5FBZA 1YJKA 2NLRA 4AW7A 3UJOA 1QDOA 1RJ8A 3KSCA 3U11A 2A3XA 4CP1A 4KH9A 1NA1C 2HEWF 1VMJA 5LBBA 5FZOA 1TMF2 3MDPA 2TNFA 1TEIA 2BFUS 3LA3A 4Q4Y3 2W1WA 3WHTA 4E27A 5J09A 1WMXA 3AMMA 3FLPA 1PGL2 1RUD3 1O91A 1RVF3 2R072 4MV2A 3O1RA 3VDCA 3U75A 4TLGA 2X05A 2GH2A 2PHXA 1YQ8A 4WM7C 2PHTA 2VNOA 1H30A 5L7OB 4JHTA 1HQNA 1E5IA 1WLDA 2AEZA 3TRSB 3U78A 1RUE2 2BTVC 4JGZB 4FPOB 2TEPA 4YVSC 1SBFA 1QF3A 3BTZA 1JUIA 1CAVA 3MFCA 1NE6A 1AR92 2WFF1 1GMMA 4M4PA 4UF0A 4DQAA 3PU3A 4LHSA 5EP9A 3VBHC 3JB4C 1Q8SA 3FBYA 4AAXA 1LHOA 1AHSA 3AZZA 4AHWA 5GZCA 3CMGA 3A22A 2WAAA 1QJU3 4QB2A 5GLUA 3BKZA 1ND2B 4XCBA 3OD4A 3FE5A 3GDBA 4OUEA 1ZZCA 2GC1A 4XF9A 2AEYA 4NHKA 4Q4Y1 2FMDA 1ENRA 2P6HA 3M8LA 3HPNA 5F3CA 2QQKA 1RUD1 3ZLIA 1RVF1 3HNYM 2WNUC 1ND3B 4L2NA 3NW4A 1W28A 1F9KA 1VBA3 3E6CC 5J48A 3BOPA 4ZXKA 1STMA 3C8XA 3B00A 4OMCA 4CCLA 2VZPA 5FY1A 2XJUA 4UW6A 5C8CA 2CYFA 4XFBA 4F83A 2PLV3 2B7YA 4DEVA 2WO2A 2Z79A 5KXEA 5DAXA 1DLLA 5BNPB 4CEYB 1W8FA 4LBOA 5FTTC 2GN3A 5FPLA 3DORA 3T2TA 2AENA 2GNTA 2I2SA 2YC4A 2A1XA 4GULA 4UFLA 3H8XA 1QJX3 1GP6A 2YXSA 3AL6A 3EQEA 1NOVA 2ZAHA 5FZDA 4HIZA 1KGYA 1ZRDA 5DAPA 2ET1A 2ET7A 4IE0A 2ZABA 2BVBA 5IK5A 3I2OA 2GP3A 3BB6A 2XJPA 3H7JA 1HQWA 4COWA 2OT7A 2R042 5JVVA 1W6MB 2RJ2A 3PUIA 4KWLA 3LIHA 4NIGA 1CAXA 3VKMA 1JH5A 2JE7A 4WM8C 5D21A 3WXPA 3AYEA 2G19A 1YYNA 1OLME 1W2UA 3DF0A 1SPPB 1UD1A 4XCAA 1VBA1 4G3YC 4ZONA 5FZFA 1Q43A 3AMPA 3GJAA 3IDCB 2DXNA 1ZRFA 1PO22 3VLBB 2PLV1 5KXBA 2HWE1 4ZPIA 4KGGA 1XJAA 5A33B 1HJFA 1VRBA 3DEMA 1PVC2 1ST8A 4HN1A 5FZHA 4RR3A 1HLCA 2Q1FA 4FPKA 3T2QA 4BQ4A 3H3ZA 4Q0PA 3T2PA 3VL8A 4F8AA 4LT5A 1UU6A 4LE4A 5FAXA 1CONA 4QKDA 3ZSKA 1QJX1 4I02A 1PK6A 1RL3A 1YWKA 1UOGA 1GQPA 2RHPA 4YGEA 2WLPA 4RHV3 3U07A 5FZEA 4FCAA 5KC6A 5DUUA 2I07B 4E4HA 1C8NA 3I8TA 1NZCA 1FNZA 4Y1YA 4XQWA 4CEWA 1HQLA 2TBVA 4JKLA 3T2OA 4OZXA 5A7WA 1GSLA 3KVAA 5KBFA 1IZ3A 4R9BA 3M2MA 1H4YA 1VAVA 3ZXNA 5C4WB 5K0UC 2NPIA 1N6EA 3VKFC 4OYUA 4DMGA 2V4VA 3OB8A 1WCUA 4QDQA 4RGAA 2RS53 2R0HA 4AI1A 1TME2 2ID4A 3ZYJB 2WSUA 1BEV3 5C3SA 1QNYA 4LA2A 4N90A 4YNIA 1WA4A 1WCSA 4M01A 1X50A 1H4ZA 1YIFA 3PU8A 4B7EA 1H6YA 4MGKE 4YWAA 3THPA 1ULFA 3J7HA 4CRQA 1R083 1RB8G 1JTZX 5EIYB 4QPIB 5F9TA 2GP5A 5EWSA 4RHV1 1LOGA 4UFJA 3VBOC 1HDKA 1UF2C 3VBRC 4K7JA 2CGOA 2GC0A 1DQ5A 1S0FA 4XAEA 4B1LA 3HBKA 1OF4A 3WF1A 5FYVA 4CTEA 3MUY1 1HXS2 4BQ3A 1SBOA 5JI7A 3LKLA 1RINA 1Q8PA 2BW8A 1SLIA 2DCZA 2PMWB 4Y5Z0 5BNOB 5JUVA 2BPA2 2HWC2 1V6IA 1W9FA 1D0GA 1VBC2 3KCCA 3ZFFA 3S5QA 2X5IA 1N1TA 2IFRA 2G1MA 2VZ1A 5L73A 2KLNA 2RS51 1UMZA 4AZZA 5C3OA 3CJIB 1FI2A 4BH9A 3Q8FA 2WSVA 1HRV3 5HV0A 4U2AA 2JD4A 3OOXA 3JU9A 3WW3A 1TIDB 4YG6A 1NCQC 1QOTA 3VHNA 1CAWA 5KHJA 3AGEA 2JDKA 1O5UA 2L9LA 3S7EA 5GM0A 5L9RA 3LQCA 1R081 2VMFA 3ACFA 3JD72 5L19A 4AFBA 5IVCA 4MXVA 3MZHA 1OFNA 2O1QA 1EAH2 4JCKA 2IXIA 4JVAA 3WCSA 4CDXA 4XUQA 1H9WA 4Z1VA 3O7OA 1CZTA 4KWJA 2R1DA 2ZKNA 2PFWA 1SLTA 1G86A 1K5JA 4OUSA 4NRQA 3RI8A 1QJY3 1WW7A 1OD3A 2QE3A 1NCRB 4TWTA 1K12A 3HN1A 3VZMA 1BJQA 5EZBA 1XU1A 5A6YA 1OOPB 4QX3A 4JTNA 4MHUA 4UYBA 2YC0A 5DAQA 4E2SA 1DHKB 1W6QB 3LLOA 1POQA 2QQUA 1HKDA 4YG0A 2P4EA 2X53S 1HX6A 2EXKA 2J1VA 4RYDA 3DYPA 1XNTA 1HRV1 1JBCA 3TN93 3RFRA 2RJLA 5FO7B 1ZRCA 2P6CA 1WMFA 2XLFA 3DL3A 4FOQA 3V0AA 4DS0A 1JOJA 3NV4A 3PMEA 1AYM3 2XMLA 4QB6A 3KCXA 4IEZA 3CKHA 1W9SA 1ZBA2 3TEWA 4QPGC 3SMHA 3AFKA 3CLPA 2KM2A 1VBD2 3PTYA 1UY2A 3M7AA 1RC6A 4OHVA 1G9FA 5F3IA 1FV3A 2Y6HA 1T6RA 2C5DA 4HLTA 5FP3A 4CU7A 5FUNA 2Q1ZB 1QJY1 1LOFA 1OPMA 5F3GA 2DDUA 1DCSA 1GBGA 2OPWA 4GMP0 4Q29A 5HV4A 2BVVA 3OIZA 1IKQA 4FXKB 4PI0A 4HPKA 5FZ9A 3VDDC 2PHLA 4OQ8A 4LBJA 1CIYA 2VZSA 4MO3M 2V72A 2IXHA 4XUTA 3K4DA 3ECQA 4CUCA 4L0PA 2W1SA 2MHFA 4XXAA 3U14A 5I91A 1LAJA 2P5BA 2QNKA 1URXA 5D8AB 3DUPA 5CKMA 2OXBA 2BP6A 1XNAA 2BNNA 3OPZA 5HBAA 2YMZA 5IK4A 1RTVA 2VH9A 3INAA 3TN91 1DZRA 1Y9GA 1H2MA 3LA2A 4D6QA 5A3LA 1J58A 3MLJA 5BXXA 1AYM1 2CDOA 1UYYA 2IXLA 1UKRA 2ZX3A 4RGGA 4BISA 3O1TA 4QXHA 2VUDA 3R4DB 3HT2A 2ARBA 3U0ZA 4FQ4A 3NAPA 4AEJA 3JU4A 2OQ7A 3VZJA 4DGHA 1ZZ8A 3VL9A 2EVXA 3B7MA 1UQXA 4NWVA 5CFCC 4A45A 5C9AC 1W99A 3I2GA 4GH4A 3UETA 4M3CE 1PNGA 5B4NA 2VCAA 1AR73 1UIKA 1ZZ7A 5IAVA 1TILB 2Y6KA 3MGUA 2DVGA 4JKMA 3WG4A 2ZOAA 4R9CA 1POV0 4Q4W3 3QBQA 1DU3D 1Q3EA 2R49A 5G05L 2J1EA 4MXWB 2IC1A 4GWMA 3TAYA 4C90A 4JDNA 5ABJC 4AI8A 4Y1UA 1GOHA 4YRDA 5LA1A 5KR7A 5M0TA 1ODNA 1RUI3 4PHZA 2Y34A 3H1WA 3VDBA 3GYDA 3IIIA 4M3CF 2XXZA 4R52A 1V6MA 4N43A 1VAMA 5JSPA 4AAPA 4L11A 5JMOA 4WVWA 5HPOA 4TTGA 5GLVA 1VMFA 3KLSA 4IEQA 4RD7A 4MX3A 3V65A 3QOPA 3PURA 4PDWC 3M70A 4CP2A 2A6XA 4QB1A 4LQRA 2V5DA 1H6XA 5I8TA 1W6OB 1AR71 1RJ7A 4B7KA 4QAWA 3D0SA 2WKKA 3W59A 1U5XA 1VBE1 2VMCA 4S2FA 4YZ2A 4FFIA 4Q4W1 3LOBA 2YFZA 2DVFA 4XFFA 4N53B 1PIV2 2DU1A 4ATFA 4ASMB 3T0DA 4XQDA 5FWJA 1JYWA 5LY1A 5LRRA 3OGSA 3I2IA 3PHMA 3T1MA 4BXFA 5EPAA 2D5FA 3HNBM 1RUI1 1G9CA 2JDHA 3LA7A 3UV9A 3I49A 3M3OA 5A3WA 1QH7A 3OF1A 3VB9A 3IH9A 5KHIA 3THTA 3DCQA 1W2OA 3I3DA 2IUWA 5DG2A 1LHNA 4NR1A 1XE8A 4CE8A 4Z82A 1XU2A 2FZ1A 5FPAA 1OSGA 3VV1A 3TYJA 4WVZA 4P9GA 2R30A 2J1RA 1B35A 2R062 1W0PA 5FY9A 4GD4A 4C8DA 5A6XA 2D43A 3ME2A 5A70A 3OUJA 4XEZA 1HB3A 1IPJA 4CDWA 3VBFA 1YFUA 2VTFA 2X09A 4XJZA 1WD4A 2AACA 2D5HA 2BZDA 2JB8A 1SLAA 4FAGA 4OCTA 2JD9A 2WYSA 1DQ4A 3DPRB 1OC1A 4XFHA 5EUUA 3J7LA 1OKOA 1DYOA 4Y1VA 5FZ1A 1JU4A 2BDRA 2HBUA 2RS13 1QOOA 3N35A 4IESA 4AEKA 1Z7S3 3ACHA 4YM1A 2OZ6A 3R05A 2YBKA 3UJQA 3PIGA 4FSJA 1VJ2A 4G4FA 4IGPA 1JXNA 1OH3A 2VXJA 3NO8A 1C5HA 4XHBA 4YVSB 5LEJA 3R6SA 2VG9A 5FYMA 4X6QB 1UIJA 1S55A 4UOJA 3JXSA 5FJHA 2XHKA 2HWB2 5C8WA 2VNGA 3DECA 2UYBA 1N47A 3N9PA 2FDKA 5L36A 2OIIA 4CXWA 1NA1A 2Y6JA 4NROA 5E1RA 1Y9QA 3NRUA 1RITA 3A0KA 1N3QA 1DQ2A 1VE0A 1ASJ3 1QXPA 1VLNA 3AP5A 3LEMA 1UZZA 2WO1A 4INDA 4MADA 2WA3A 2X5IC 3AMHA 1XYPA 3E6DA 2DVDA 3J26N 3NNGA 3WNNA 3GZTB 4CCCA 5C33A 4BMEA 1L7QA 1FATA 5FYZA 2H6BA 2RS11 4DINB 3UKNA 4WM7A 3K2OA 1Z7S1 1C28A 5EFUA 3WEZA 2VZRA 3LEIA 1WGPA 2CWSA 4GXLA 4FTEA 4WBBA 4YVSA 4YW3A 3RGBA 3ROUA 4AR2A 4I3GA 2K46A 5A7QA 1MQTC 1AX1A 1UX6A 4MUVA 4XDQA 2WBKA 5JWPA 5EJZB 5J98B 5JI9A 3VBHA 3N9QA 4YW5A 3H7YA 2ZX0A 2YGMA 3O1VA 2VW2A 3K4AA 4Q8KA 2VQAA 2WQ4A 4LKDA 1KQRA 2WFPA 5CA6A 2D44A 3CHXA 4ISQA 3W5MA 4EWEA 4I01A 3MYXA 4TLFA 5LASA 1ASJ1 2PQQA 2WS92 2CDPA 2GMPA 2B4KA 5FYIA 3DGTA 5KXCA 2EXIA 4W50A 2WNUA 4XABA 4M00A 1CQ9A 2DBNA 3I7DA 5DQ0A 5FK7A 4BE3A 2DCYA 1UOFA 1GP4A 1SLCA 5F8PA 1AVBA 1OD5A 3FLRA 3DXUA 1V0FA 3RDIA 3UKVA 4KU7A 3WLUA 2WZEA 4P5YA 1VC1A 3WSOA 3N7MA 2CGPA 3MW3A 4L9BA 4QHOA 5CZKA 1WW5A 4IERA 2NP0A 1UY3A 3J9SA 3AJZA 4KG0A 2GMEA 1W6NA 2DTYA 3BPZA 5LK5A 1GOGA 1NY71 1LESA 2W2IA 2BJSA 1I9RA 2WT2A 4I0BA 4CCNA 4CU9A 3OUIA 3MUZ1 4XPVA 1Z78A 2W9XA 2IWGB 3WF2A 5LATA 3I3EA 4LBQB 2WNVA 5FZAA 3WQ1A 4WM8A 5IVJA 2OVUA 1TQ5A 2QDNA 1Q8OA 4CCEA 4H55A 1RUG3 2XUEA 4OHYA 2JEMA 5A3NA 1Y3TA 1X33A 5FKBA 2JDPA 4H14A 1UX7A 2A7AA 5KHHA 4DRRA 1SDWA 2RE9A 1AXZA 5CFDB 2XBO3 1GQGA 2EICA 3QCWA 4DXRA 2DV9A 2Q8EA 2XLGA 3BTYA 1COV1 1ULOA 3AP6A 1PO13 1BMV1 5FO8B 4YZ4A 5FK8A 3P1IA 3ALQA 4FPLA 4P9YA 1EY2A 1AJKA 3AZWA 3DV8A 4PIXA 4QDSA 4AVVA 3FFZA 3LB9A 4Q4X3 2FCUA 1PM7A 3LFMA 3Q8AA 3KF5A 5D1IA 2BYVE 4Q4Y2 4S2HA 5F2WA 4P9IA 1M06G 4ZS3A 4EN8B 1FMD3 1RUD2 1RVF2 3V0BB 2AUYA 4XAAA 2ZGSA 4J6GA 5K0UA 2VZ3A 5FUPA 3S5AA 4YVWB 3I59A 1RUG1 3LSEA 5FZKA 3VD5A 4KG8A 1WXWA 5FZ6A 2Y6LA 5H9QA 2Y64A 4BPZA 1MS4A 1DGWA 4CDQC 2XBO1 2OW4A 5EJ1B 1ULPA 1BBT3 5K7PA 1W04A 4HT1T 3NV1A 2OKXA 4XBQA 2VNRA 4TSVA 4NVPA 1ULDA 5FZBA 1VRH3 1W6PA 3ZFEC 1PM4A 3FN9A 4XDPA 1LENA 5LEKA 1SQ4A 4HK9A 1LOBA 1Y43B 2JG9C 4H7LA 1VR3A 3M3IA 3VBOA 4Y22B 3HQRA 3VBRA 2JIJA 2FDFA 2BEOA 3ASIA 4L1CA 5F2SA 3AP9A 4XFGA 1GANA 3IAQA 1WZXA 4LHLA 4Q4X1 1RUJ3 1UO9A 4IEUA 4ES9A 2A5ZA 1HW5A 3HT1A 4C0BA 1FMD1 3ORJA 4O7XA 3ZN5A 1REEA 2IXKA 3EHKA 5JAXA 3BIEA 3WP6A 1G9DA 4K40A 4OHZA 3ZXLA 3MV11 3PDQA 2I45A 3IIAA 1UU5A 3BYWA 3T09A 5I0RA 1OA3A 4EN6B 3GZUC 2ZGRA 3BTAA 4XTPA 2XQRA 3CZUA 2PLV2 2VCCA 1H2KA 5A7NA 1JU3A 2EAKA 1IQAA 2HWE2 1IS4A 5JLVA 4QHBA 4RFT0 5FCCA 1S2BA 2ZS6B 1W0NA 2ZZQA 3T0AA 2ARCA 1NCQA 2YPJA 4B4PA 2VQTA 3WNLA 4PF1A 2XOMA 2RJKA 1VRH1 4LKFA 1WBFA 3AXEA 1S0BA 2YDEA 3ZXAC 1C8M3 2QDRA 5JXHA 1MZ6A 1QJX2 4XW3A 1AYN1 2ZX1A 3RPQA 5DZEA 2QQVA 3ZDSA 3RNSA 1RUJ1 4FFFA 2YU2A 2WT1A 2ZO9B 3H8OA 1NG0A 2KXLA 4YFWA 3ZR6A 3PVBB 3MGLA 2VMHA 1CWPA 2N7GA 1O4YA 3AZVA 2BFUL 2E7TA 3LCPA 4M3CB 2NMNA 4A42A 4COZA 5FZ3A 2W94A 5FZGA 4XFCA 3NJXA 3RZJA 1TH8B 2ORXA 2VULA 4Q0VA 4BOWA 4ZU7A 1SBDA 2XR4A 5C6CA 1CPNA 2ZGLA 1LOCA 3MPPG 3ILRA 3J7NA 4G9SB 4QMAA 3AC0A 1CAVB 4NIAA 4EQVA 1T6BX 2A70A 2RR13 5EUXA 5BNQA 3WF3A 4TYSA 4QPGA 4RHV2 5KWRA 3VN4A 1AR82 4P00B 1RMU1 1DZTA 3R4UA 3C7GA 3H9AA 3N7JA 4HVOA 4M0HA 4OFGA 1GZCA 2J1UA 3TOJA 3OBRA 3WUDA 2JWPA 2YG0A 2XHNA 3QLQA 2RVAA 5BPXA 5CKQA 3L2YA 2OUJA 1EUUA 4UAPA 3K3NA 5H9PA 1CR7A 4NHLA 5HCFA 3VDDA 4M3CA 1XBFA 1LHVA 4DB5A 3KHBA 2DU0A 5EZWA 1QU0A 3S0MA 3EJKA 4PLOA 2RS52 1UZWA 3HAGA 4AQTA 1B09A 1UZ0A 2WYFA 3KS7A 2UWAA 4D94A 5C8CB 4X8PA 4QX1A 1F31A 5LA0A 3ON7A 3V8VA 2E7AA 2P37A 2XB6C 4XTMA 3SKVA 3BPSA 3KV9A 4JC1A 1UMIA 1J1LA 1R082 4HKWA 2RR11 4AI9A 1HB2A 4NAOA 2GN7A 2Q8CA 1NT0A 1R64A 1VALA 2DYCA 2XJQA 1IS6A 3HR9A 3NJVA 3AX4A 3OGRA 4I0AA 4MYEA 4XZUG 5KHGA 1CZVA 5CFCA 4CYDA 3RZGA 3OY8A 1REFA 5C9AA 2QTWB 3AM2A 4AI3A 1YQ2A 1JYNA 1GWKA 1YQCA 4HOOA 3WP4A 5ACA3 2E6VA 2PELA 4BQXA 4EJRA 1CAXB 2BNOA 2RRLA 1XPWA 2XJVA 2DTWA 2BBVA 1WBLA 5I0UA 4O9GA 1KXGA 3OYWA 5A7SA 5C7GA 4KI5M 3K77A 5FPXA 5GLZA 4GAZA 1E5SA 3RI9A 1ULEA 1HRV2 4Y20A 3G7DA 5ABJA 1OLRA 4DO0A 1MVEA 3SEPA 1BZWA 5LY2A 4RR3B 2P1BA 3BU0A 3FMGA 2ZPXA 3O0XA 5FJKA 2WO7A 4LIVA 1REDA 1CX1A 1PK6B 3R4SA 1UNBA 4W6XA 3ACGA 4LBNA 4QGLA 4MG2A 1QJU1 5FZ8A 4PDWA 3WNMA 1QJY2 4M4RA 4CEWB 3C7HA 1FT9A 2RMU3 4Q26A 4MGSA 5A7WB 2C0ZA 3MIHA 1W8NA 2WNVC 3ZKUA 3AZYA 4QX8A 1PZ9A 1KS4A 3ETPA 1OKQA 5A6QA 4JDMA 5TSWA 2VAUA 3TB0A 2FZ2A 4QX0A 3POWA 1OLQA 2ES3A 5FY4A 1OPOA 3GZAA 4YZ1A 1V6NA 5I93A 4AEDC 1AJOA 4Q1PA 1XC6A 3OUHA 2B8MA 3TN92 3JUUA 3SITA 3WDVA 1J3QA 3PVNA 3IHBA 3ZN6A 5CADA 1AYM2 4Q27A 5EV7A 4FAHA 3OCPA 2DBIA 4NHMA 1XRUA 4BCUA 4WVVA 2OZJA 1FAYA 1TE1B 2CTVA 3OTFA 3A4UA 4LIUA 4KQ7A 3QH7A 3WY6A 1FC6A 2ZGMA 3AL5A 3I2JA 3H1MA 3LAGA 4NIIA 4A41A 5FLIA 2E51A 3IH8A 2B9VA 3PLQA 2YBSA 2RMU1 4XILA 2CSGA 2NYYA 2FMYA 2PYTA 2EXJA 4XJWA 4QHZA 4Y26A 3RRDA 1CZSA 2VBDA 3K75B 1JYTA 2Y0IA 4BQWA 4E4SA 1C5IA 1E5HA 4IV3C 3SH4A 1RHI3 5CU1A 3ZFFB 2X5IB 5AVPA 3RJRA 2C26A 4W4ZA 3ILNA 4RS5C 3VHOA 1HB4A 2YYOA 4F7ZA 5ISLA 1RXFA 3RS6A 4Z8BA 3ZXKA 1CAUA 1OA2A 4FPEA 3LGRA 1IG0A 5IFPA 3OEAA 3TEYA 1R1ZA 5FPUA 3AYAA 1ZREA 1ACCA 1W0OA 1CAWB 4WZCA 4OHWA 2WC2A 4IV1C 5JZGA 5DAWA 4A3ZA 2H0VA 1UYPA 4FPHA 4W6WA 2ZAAA 3WNXA 5CEHA 1D4M3 3VBSC 3ZIXA 2SLIA 1TG7A 2G4IA 2VE1A 2A6WA 2R073 3VD7A 1ALYA 4UW3A 4CDXB 4MZUA 4LXLA 4OULA 3FHAA 2FHRA 1MR5A 2OX0A 4FPGA 4KBBA 1DGRA 4N9HA 1LEMA 5FZCA 2XVKA 3CZJA 1AR72 3TNQA 3EMRA 4NPRA 1VBE2 1RUE3 3RZKA 4Q4W2 3DKWA 2BGPA 2JXAA 1ZRRA 5AC93 1C57A 1RHI1 2YPDA 1EYBA 4QGNA 1WLCA 1N3OA 4SBVA 2ZEYA 1JMUB 4YW6A 2QZ3A 2W46A 2QQLA 4LR4A 1AR63 3SCGA 3U10A 4V1PA 3VKLA 1BEV1 2R16A 3SXWA 2ZGNA 1RUI2 3B69A 3MBWA 5I0DA 1W2NA 2ZEZA 1BVVA 2VW1A 2YGLA 1V6KA 4CXXA 2WL1A 3V0AB 1W9WA 4IGOA 2VOKA 3MLLA 2FBEA 1H2NA 2QQWA 5FXXA 1S0DA 1G9BA 1D4M1 3IHAA 1MQTA 2QUOA 2XKOA 3DN7A 1GFF2 3ES1A 3MICA 1N6DA 4YM2A 3W5NA 1OF3A 1HV0A 2HYKA 3LPGA 4FP2A 3OPTA 1UY4A 4YGDA 1MS1A 4CUGA 2HEYF 3ZFGC 4BK4A 1BPLA 3T6OA 1BKZA 1S4CA 2I74A 4CP9A 3AVSA 3WQBA 4HFSA 4HPKB 4PIYA 1W8TA 5AC91 5FR3A 4FFGA 4Q0SA 2Z5WA 4NWWA 3AKPA 3D0JA 3GBFA 1I1EA 2QJVA 2JDNA 2E63A 3K51A 4GB33 5A6ZA 4P9LA 1SLBA 2BNMA 3ZSJA 5JIUA 1AR61 4NPMA 2XG3A 2BWAA 3SLIA 4BMBA 4L97A 5KXDA 1FYUA 3I2DA 1MZEA 4LO4B 1V70A 3A21A 5FP4A 1ZZ9A 3KCYA 3T4VA 5FO9B 5J3UA 5CG8A 1WXXA 4YW4A 2UU8A 3MF6A 1H8TC 2RM23 4C1WA 1WLWA 1N1YA 4RQPC 1FCFA 1ULCA 1N6FA 3NAPB 3LDFA 3FUQA 4LUMA 4A3XA 4FT8A 2VBBA 1CX4A 5FY7A 2F4LA 3B5LB 2W87A 5A7OA 2A71A 5DN2A 4BYYA 3TNPB 4AFCA 4GH4B 1SCSA 1U5ZA 3M4FA 2CHHA 4XHXA 1JODA 1F8VA 2E53A 5JIAA 3KWVA 1BVP1 5FYHA 1PMIA 4HYLA 1DGWX 1SBEA 1Q8QA 4N7UA 3CBNA 3GHNA 4MVTA 5B2GB 4CSWA 1PGSA 5FP9A 4GB31 4CU8A 4IDZA 3UKTA 2RS12 4F3JA 3GXUA 1LKNA 5I0SA 2O14A 1Z7S2 1EV12 1W3VA 1W8OA 2Y8KA 2Z4FA 3IPVA 2VY9A 4Y4YA 3E5QA 4KBZA 1NXD1 2YV8A 3CEWA 4P9JA 1JHNA 4ZHNA 3ZVXA 4LHNA 4PLNA 2AS0A 2RM21 1XOYA 2WZPP 5DMYA 5JR2A 2AREA 4L99A 1WMEA 4N43B 4LKSA 2K2SA 3BI3A 1XNCA 3ZFEB 4NO4A 3BIWE 4KMQA 3FC0A 3MLKA 1RUC3 4BLIA 2EA7A 1LHUA 5APAA 5HXVA 5LA2A 2BQPA 4BWOA 1FPN3 4EWDA 1TME3 3BCWA 3L9JT 1WCQA 2HWD3 5T5JA 3B93A 2LS6A 1S0EA 4AQ2A 3IDEA 2B5HA 3GNEA 1OURA 2KR2A 3I2KA 4MLOA 1CESA 2JX9A 4HBNA 4GWIA 3K3OA 3OGJA 2Y33A 2Y38A 1YFWA 2FDIA 2G9FA 3WF0A 3N7KA 3WNPA 4D6RA 1OUXA 2JE9A 3I97A 3PUAA 4CDQA 1E57A 3TEZA 2XGXA 4AVBA 2VJXA 1HJGA 4AVAA 1NLQA 3RZMA 3N3HA 3POFA 3B3QE 3NNLA 4LULA 3POIA 1D2SA 4NJ4A 1V6JA 3KD4A 1JZ5A 3S57A 1XSRA 4EN9B 3ZFEA 3T3YA 3OBTA 1XNDA 1QEXA 2JG9A 2HWC3 3WDUA 2EALA 1VBC3 2VM9A 1RUC1 2W1UA 4XS5A 2A73B 1XXNA 2WN2A 3NQHA 5L7OC 1GICA 3CL1A 4XXPA 4K9SA 5FLJA 1B35B 1Q5OA 4W8JA 1FPN1 5F6KA 1NY72 3ZYIB 3BGAA 4JGZC 4BIOA 1TME1 4I3PA 2C6SA 5FIXA 2ZEWA 4YFZA 4FTBA 4EN7B 4XIKA 1KD7A 2HWD1 4CDWB 2YROA 3VBFB 3H42B 1UY0A 4QQOA 5EHDA 5A7PA 3ZSEA 2DUPA 4AWDA 1JS9A 2ZMNA 3MW2A 4Y33A 3JD73 2JJ6A 4K21A 4HANA 4JTOA 2NMOA 4XOGA 4GA9A 1EAH3 3GVKA 3AMQA 3VZLA 3VZKA 4A6OA 1FC9A 5IYYA 1ND2C 3WR0A 3I54A 4HSJA 4UXAA 4CCOA 1AUZA 4R4XA 2ORZA 3AK0A 2ENRA 3N9LA 4QXKA 3USSA 2LRPA 3RYPA 2JDAA 3SISA 1MZFA 2BV4A 4KWUA 1ND3C 1COV2 3O12A 2HWC1 5GKAC 1VBC1 1TZOA 3L2HA 3H1YA 1LCLA 1O7FA 2W39A 5T3NA 1G9AA 1RUH3 4P9WA 2QFEA 3E6BA 4FTSA 2UYAA 5FY0A 4GZ9A 4CEYC 1NA1B 5BNPC 5BNNC 1F15A 4HKOA 5DG1A 4COVA 2DCTA 3A23A 4AI0A 4XMIA 2QBXA 1PGW1 2AGSA 2MPFA 5FLHA 4CP0A 2W0XA 3WUCA 3JD71 1RUG2 5FMOS 1NUKA 1D2QA 1GZWB 1VBD3 3OIRA 2B42B 2LUWA 1VAKA 1LEDA 2VR4A 1QNWA 2VZVA 2ZMLA 4WM7B 3OEBA 3C7FA 1C3HA 1ZNPA 2R1BA 3HOBA 4LK7A 2XBO2 5LWBA 3GK7A 3VSEA 5JZGC 2LALA 3ZXFA 2XJSA 3AP7A 3POSA 3D5OA 3Q8CA 1WUVA 3O0VA 4FPFA 4LBLA 4LO8A 4LNVA 4XF4A 3WP3A 3WOGA 4FOVA 4DY5A 1IOAA 1RUH1 2CL2A 2Z2SB 3VBHB 2J1TA 4GHNA 1IG3A 4NOTA 2ZX4A 5A1AA 1BQPA 1LHWA 5LA9A 4Q4X2 1H4GA 4HXCA 4AXOA 2CU5A 5HI0A 5T52A 3MEPA 3PTRB 4ZZ5A 1FMD2 4FP3A 5BUVA 2QQIA 4IEXA 4Y3OA 4XURA 2IXCA 1O5LA 3DUIA 4CXYA 2WNUB 4OHXA 1GZWA 1QXRA 1U5IA 2AZ5A 3OG2A 1ENQA 4QM9A 2DWRA 5CNAA 4YLZA 3UGGA 1X8EA 3J4UH 1LULA 1PX4A 4NN0A 4QQHA 5GLWA 4BQ1A 2IZWA 1O6UA 1JZ4A 2ATFA 3G6JB 2CNAA 1VIWB 4OI2A 2K9ZA 4OI0A 3K48A 4O65A 5IFTA 3VUOA 3FLTA 4UT5A 2HEVF 4AGRA 4AEMA 1L3JA 1VRH2 2A75A 3CU7A 1L7RA 3KVBA 5C4WC 1XE0A 2HWF3 3X29B 2VOVA 1UWWA 2WRAA 3WF4A 1AYN2 2Y0OA 3WINE 4EYUA 4OLLA 3D82A 3MO4A 3NSTA 2DUQA 1IS5A 3NV3A 5T5PA 3MF9A 4XZPA 4XJ9A 1RUJ2 1W6NB 2XUMA 1YJLA 5I0TA 5T5LA 5E8AA 3WVJA 2X10A 3PUQA 1MS8A 2H6CA 1X82A 4A4AA 1SACA 1V6LA 4QPIC 1AUYA 1GNZA 1NQDA 2WNVB 4WM8B 3S30A 1H4HA 1EPWA 4YZ5A 1LECA 2LTNA 2B46X 3U4XA 4HETA 5FXWA 4GKYA 1AXKA 2D40A 3WNKA 1YIPA 2C24A 1O8SA 4QPYA 1H0BA 5E6HA 3BVCA 3OD0A 2HLEA 5BNOC 2W08A 4IUGA 1R092 2HWF1 5FP8A 5F5IA 5C5UA 3ZYRA 1SDDB 3P6BA 2ZACA 5IT6A 5FZMA 4LA3A 4K6BA 5IVEA 5JOYA 4GIQA 1RMU2 3CJIC 3LIGA 1I6XA 3HBZA 4L8QA 3SHRA 4B29A 2XL9A 1U12A 3D8CA 1X8MA 4K1ZA 2IVIB 4CUAA 3J7MA 1TNRA 2FDGA 1KITA 1OMIA 1KS5A 3NL1A 3JZVA 2CV6A 2VBPA 5JOWA 3HIFA 1SLLA 4ASLA 1GYKA 2VNVA 2ZBJA 3GALA 1S0GA 4ARXA 1JZ3A 4XE9A 2J22A 1V9U3 3LDRA 4AHYA 4E4ZA 5HXMA 4QM8A 5K0UB 4K3UA 4XUNA 5IK8A 3WX5A 5ANNA 3ZX7A 2W52A 3I59B 4RA0A 3UGFA 4URAA 5FKCA 4AEDA 3ATGA 2GH8A 2R063 3BODA 2W91A 4FQZA 2J1AA 1M4WA 3EBRA 5EUZA 3VD9A 1OOPC 4AE2A 5LK7B 4FXGB 4Q0UA 1W6PB 2WFF2 1UYZA 2NM1A 3LKJA 5DDJ3 1U0AA 1XB9A 2DFCA 5C70A 1FX5A 1GZ9A 4N7IA 1Q8VA 4AVCA 2JDYA 3VBOB 1UYXA 3KGLA 1SCRA 3NJYA 2P34A 2VVFA 4XF3A 3VBRB 1EUTA 3WDTA 3FFQA 3ZXDA 2YC2A 1LB2A 2OASA 1MACA 5FMDA 1AL0G 1SFYA 3ABZA 3LPFA 1Y4WA 4P02B 1H9PA 3U4SA 2LM3A 4XMAA 4CCJA 3FJSA 1YI7A 4I2OA 1L7LA 4QTPA 1ONAA 5H9RA 1WCKA 4B3NA 1V9U1 4IE5A 2QVSB 3VGIA 3AB0A 3PJQA 1EPZA 4AG4A 1PZ7A 1FOD3 4DUXA 4IV3A 3C2UA 3FUOA 4IEOA 2JIGA 5GZDA 4ZY9A 4RS5A 4ARYA 3KT1A 3N9MA 4PQ9A 5GLTA 4I30A 1AL23 5FYYA 3MHZA 1QWRA 3SQOA 1HRI3 3S6PA 3ZMOA 4AVSA 4W6YA 2VGDA 5LW9A 3THCA 3MI8A 1NCQB 1UZVA 5F1RA 4UFIA 4K8RB 2CGNA 4LJHA 3SNMA 2WABA 4IV1A 1PO11 5E16A 2GNMA 2JG8C 5DDJ1 3APBA 3CQOA 3ZSLA 1UN1A 4Y24A 3VBSA 2X8KA 3RZLA 5D8AC 2AYHA 3OBAA 2HKXA 4PJYA 1JOBA 2VECA 1KJLA 1W06A 5KC5A 2WQZC 1WD3A 1QJU2 2P3KA 4GJYA 2VTXJ 4GJZA 4UBHA 4A2UA 1V0EA 2YU1A 1WA6X 3H3UA 5FQ0A 4UFMA 5K8SA 2ZGTA 1ZBE3 4XUPA 1G7YA 3FWEA 1YRZA 3W20A 3O0WA 4PI2A 4RSUA 3ZPYA 4I0WB 1K32A 1FOD1 3FL7A 1VBA2 1AXYA 3GVLA 2P3IA 3THDA
chains in the Genus database with same CATH topology
5BV6A 1CD3G 2OUHA 3TBDA 2JICA 2UWBA 1AL21 5GZEA 1BBT1 1HRI1 4D69A 4WZFA 4CDUC 5CAZA 1QDCA 2UURA 2DURA 5FOBB 1UL9A 1LGBA 3WCRA 3WQ0A 4QPGB 1H8VA 1PHMA 1F5FA 2GU9A 2ZHMA 4PF5A 1NE4A 2D6PA 4XF1A 2RMU2 4GWNA 5DZGA 1ZBE1 3ZFGA 5A32B 5FRAA 4R9AA 3VDDB 2PA7A 5DXDA 3ZMNA 2ZGUA 3CF6E 2WZR3 4N9IA 3AJYA 3ZO0B 4LLOA 4DMIA 2VUJA 3T1LA 3ZSMA 1ZVFA 3KQRA 2WWSA 4C1XA 1MS9A 1A78A 1C8M1 2XVLA 4S2DA 1H8TA 3AMNA 4RQPA 2JKBA 2RS33 2PN5A 3EO6A 5H9SA 1Q56A 2MNGA 3AYCA 4YGCA 5GZFA 5I8YA 3VBUA 1IKPA 3ZXEA 1GV9A 3RYRA 4ZKTB 2V5YA 5CFCB 2GAUA 1F5JA 3O14A 3OY8B 5C9AB 4C91A 1LOEA 5A32A 4HMZA 3ENRA 2Q30A 5DZFA 4XJUA 1N3PA 1YXWA 1C4RA 2DXLA 4XJ8A 1S0JA 1IGOA 1CVNA 2WZR1 5AFBA 2D3PA 3ELNA 4META 1QQP3 1DYPA 3KZ4C 3OYWB 1FC7A 1MEC3 2GNBA 1SFNA 5J37A 3KMHA 5GALA 5ABJB 4Y20B 3QACA 1BEV2 2VVEA 5SV5A 4FVVA 4B4QA 2W68A 1D4M2 3DPRC 2RS31 2DF7A 4BLJA 3M3CA 4GALA 3RSJA 2G9GA 4EWAA 5AVAA 2PHUA 2GZWA 1CGPA 2VVDA 4J1XA 4PDWB 1VP6A 1DZQA 2D7FA 1VBB3 1FV2A 2A3WA 2AH2A 2ZJCA 3O5SA 2QCSB 2VY0A 2CWMA 4DPNA 2GMMA 4MGIE 1LJ7A 4JC0A 3J8F3 1XE7A 2YZ4A 5E88A 5AC92 3H50A 1ZYBA 3ZYPA 2ARXA 5FREA 1QQP1 4FOWA 4MH0E 1MEC1 1S0IA 2NQYA 2O0OA 1AR62 5FPZA 3E97A 4AFAA 2JECA 3C3VA 3KT4A 2ERFA 4P14A 1D4VB 3FBMA 2D6MA 3LWCA 3OJBA 3ZN6B 3AXDA 3N36A 2ZZJA 4HZFA 1WMDA 3GHFA 2CAVA 4LO5B 5L7OA 4DZGA 2JDZA 1VBB1 1R1A3 3FZ3A 5BYNA 2HWE3 4JGZA 5ACA1 4GKXA 4Z2WA 4SLIA 3JQWA 1LOAA 3J8F1 3IN9A 1MS5A 3ZN4A 5BNNB 1OI6A 3IBMA 5DUWA 3OGGA 4COYA 3N4MA 1A8DA 3WV6A 5F6LB 2Q8OA 3POYA 2WIIB 1TNFA 4GB32 3JBG3 4HVRA 4H7MA 4UBGA 2CY6A 3ZYGA 2P2KA 4LTAA 1CAUB 2MEV3 5FDBA 1AZDA 1ND2A 4WVMB 4Q4V3 5CB7A 4DXZA 3LZZA 1JUHA 2PTMA 4IQPA 3CO2A 4JQRA 3R0RA 2RM22 1LU2A 3PVOA 5JZGB 5JDBA 3FX3A 3LSDA 2VU9A 5KHKA 1ND3A 3VZNA 1NLSA 4X8NA 3WW2A 1RUF3 2AR6A 4GQ7A 2YHJA 4R4ZA 4S2GA 4ZU4A 1R1A1 4M0NA 4D7YA 2TUNA 4Q2FA 2SBAA 4CEYA 5BNPA 5BNNA 1A8MA 1KJRA 2D3SA 4XFAA 3BU7A 5JPNB 3M3QA 3JBG1 1LR5A 1J1TA 3QD6A 5IUQA 2YUEA 4R8HA 1UZYA 5T55A 1VB4A 1AR83 1CIWA 2MEV1 3BOWA 3NVCA 3VZOA 1ENXA 5CBLA 4WVMA 5LRSA 4Q4V1 3WDYA 4KWKA 2YY1A 3ILFA 3KM5A 1W6MA 2HJIA 2GDFA 4XBLA 2D98A 1TMF3 1DQ1A 2EF6A 1I3HA 1F2NA 1MQTB 1RUF1 3WW1A 4HVQA 2E7QA 1ZX5A 1RUC2 1IPKA 2Q4SA 3HMYA 2WT0A 4KNCA 1FPN2 4QT6A 5A33A 5CFDC 4LE3A 3AYDA 4ES8A 2NN8A 2HWD2 4AVTA 4Z92B 4E4DX 1A3KA 4QX5A 2WA4A 1PNFA 4TZDA 1CJPA 1AR93 1YLLA 4HK8A 3RMXA 4XFIA 4D7SA 5JPMB 2QKDA 1YI9A 1AR81 2ILMA 1S0CA 3BALA 2BWCA 1ULGA 3VKOA 5T50A 2UWCA 1IS3A 2DCJA 3PMSA 1S1AA 2VOWA 1TMF1 2D3RA 1SEFA 4PBOA 2VMIA 1PGL1 2VPVA 5C4WA 2R071 1GNHA 4LEJA 4YVWC 4AQ6A 2X29A 2FQPA 2ZGKA 4OUMA 5JMCA 1NXMA 2ZCWA 1PVXA 4IL7A 2UY8A 3NV2A 2XLAA 4YW1A 3PJYA 1RUE1 2ZHNA 4BA6A 3E5UA 1PGW2 5T54A 4QPIA 1K5MC 1AR91 3D6EA 2Z69A 3NWKA 2PHRA 1ZA4A 4ISRA 3IMNA 2EIGA 4OVEA 3IPVB 1H1IA 2DVBA 4JRAA 4PCRA 4D3WA 4YGBA 2R043 2ZOEB 2DVAA 5BNOA 1YUDA 4DRVA 3VHPA 1UAIA 4PBPA 3NKTA 3VBUC 5CIRA 3B01A 1RUH2 4AGVA 1HV1A 4JGYC 3CJIA 3SH5A 4EROA 1PO23 2VXRA 3WZ1A 1YFYA 4D7TA 4HSLA 1J3RA 4L8KA 4OI1A 3URFA 4ONUA 3ZIWA 4QGMA 1PVC3 3JQXA 4FO9A 2VOXA 1RUNA 4XIOA 4AYUA 1UPSA 4DNYA 4Q0QA 2XJTA 1AX0A 3HQXA 2Z42A 1WW6A 2CAUA 4CDQB 1NCRA 1YO8A 2R041 4AGGA 1QKQA 4HL0A 1OOPA 2BGCA 1H1AA 3W9AA 4BHPA 4FBFA 3D03A 1W6QA 4EN0A 3LOIA 5EXOA 2JG8B 3KB5A 2JG9B 3ZXJA 1O4TA 1APNA 4XF0A 1PO21 2Q0AA 2ZTNA 4HKLA 2P17A 4MGZE 3RQ0A 3MIBA 3I4IA 4A7ZA 1PVC1 1S2KA 1ASJ2 2OA2A 4J1WA 2D6KA 4IEPA 1ZM1A 3AP4A 2XWJB 4Q8LA 1UPIA 4XJAA 1OQDA 4B8EA 3MW4A 4XQ4A 3WDXA 1J3PA 1BK1A 1Y7BA 3H8UA 1XYNA 2XPJA 4YYOA 4YARA 1HXS3 5EYYA 1OHFA 4CDUB 4DY3A 4R9DA 2HWF2 3SCFA 3Q9OA 1VBE3 2JG8A 5CG9A 1AF9A 3GBGA 5D8AA 5C8CC 3ACLA 1KDKA 5IK7A 1OQEA 3HD8B 3AFGA 4LO7A 4E2QA 4URTA 2ZX2A 1BXHA 3IM0A 5SV8A 3USUB 3GHMA 3AKSA 4H3WA 1GR3A 1U5YA 3N7LA 3W58A 1J7XA 3IT8A 4QQPA 3MPBA 4ORFA 5FMOL 1N1VA 3QH6A 4DOUA 4LO6B 5FFOC 5HCBA 1C1FA 4CDUA 1HXS1 2DCKA 1EP0A 2R6QA 1J59A 2GC2A 4QD2A 3SH3A 3B9IA 3M1HA 1BMV2 3IWZA 2O8OA 4MXWA 4YW2A 3RWNA 4PLMA 1DQ6A 2B45X 4K20A 3WD5A 2QZ2A 1XQNA 4K8FA 3RZZA 1I5ZA 3KGZA 3AKTA 2A6ZA 3DJAA 2NZ9A 5CVRA 3PNAA 1DIWA 1DYKA 4RR3C 4C0HA 5DUVA 1A6CA 3WT3A 3USUA 3S7IA 1OA4A 4B4RA 4FPCA 5JCTA 1ZZ6A 1H1MA 1V9U2 4YSFA 3WG2A 1ZBA3 1PK6C 2VUAA 3RJ2X 4L92A 1EAH1 1PZ8A 2PAKA 3A0NA 1G6NA 4IEYA 1JYCA 1UU4A 1X7NA 4P5HA 4XETA 4CEWC 1W6OA 3M3EA 2O8QA 3E5XA 3GBWA 5JSOA 1X36A 1PO12 1DGLA 5DDJ2 1CPMA 1O3SA 4N53A 2V09A 1RGSA 4XYXA 3ES4A 1OQ1A 4UW4A 4Q1RA 5J36A 3MIEA 3AKQA 2DUOA 1DBNA 4FPJA 1EV13 5EYXA 1DGRN 3MFAA 2A3YA 2E9QA 4LBKA 1SMVA 1FNYA 1ZBA1 5E89A 5GJ6A 2EXHA 2K0GA 1FOD2 2R32A 4LBMA 2QQPA 1XNBA 1VBD1 4BIFA 1AL22 1GKBA 1KRIA 1BBT2 1HRI2 1QHDA 1NQJA 1WW4A 3B02A 3H0OA 3MIGA 4IETA 2ZGQA 3SCHA 1QGLA 3DPRA 3ZFFC 1D0HA 4JV4A 4QQLA 1WCDJ 1W39A 3P3PA 2H0BA 1LU1A 2ZHLA 1KDMA 4AHZA 1CJDA 1EV11 1JW6A 4YZ3A 4BM8A 1ZBE2 1LTEA 2WINB 4W65A 1CN1A 4LUKA 3VHRA 3IDBB 4XBNA 3EXUA 1NYWA 2XL7A 1YNAA 4JAAA 3UK9A 3MIDA 3AKRA 4CDXC 2C9AA 2OYZA 1DF0A 5F5QA 4YM3A 4MGYE 4AEDB 1KFXL 4FPYA 1C1LA 4HN0A 4I09A 5EJ3A 2VQ0A 1C8M2 3JB8A 1WLTA 4JDOA 2P3JA 2VMGA 1PIV3 3ST7A 5J7MA 2B39A 2KA3A 1O3TA 2XVGA 4GMP3 3MIFA 1ZZBA 5A3MA 4AI2A 2OPKA 1FXZA 2V73A 1AX2A 4IEWA 1QOSA 5HCAA 1UW8A 1KFUL 5AFEA 2D6LX 4MSVA 2WZR2 1JYIA 4CZSA 1COV3 4IV3B 4LHKA 2XH6A 5DUXA 2BUKA 4BZ4A 2Q1MA 2ETEA 4RS5B 3CJXA 1UCXA 1LOFC 3WG3A 1NCRC 4DFSA 4AFMA 2PAMA 1DDLA 1T6GC 3K50A 3UL2A 3AZXA 2RR12 2GALA 3HWJA 4IV1B 1QH6A 4EV0A 2RS32 1PIV1 3VBSB 2Y26A 5BY5A 2A6YA 2D6NA 4GMP1 2XKPA 1O3QA 3GMFA 3FHIB 2C1FA 2ZMKA 2F4PA 3TWIA 1YCIA 1POV3 4Y1XA 5FQ0B 2IXJA 4AQSA 1JN2P 2IFWA 3P3NA 4Z07A 2PHDA 5K9YA 3NAPC 4AK3A 1GLHA 1N1SA 3WP5A 4U36A 1QQP2 1MEC2 4YG3A 2B9UA 1DFQA 1H2LA 2GC3A 2HWB3 2R061 4GH4C 2ZKLA 3RYKA 4PIZA 1NLRA 2Q5TA 2UY9A 3JCIA 4LBQA 3WDWA 1O3RA 3CNAA 1BYHA 5T5OA 4E9KA 2GSYA 2R0FA 3WQ7A 4LBQD 2PAEA 1POV1 1VBB2 1LODA 5CFDA 5ACA2 2ZGPA 3ZFGB 1DG6A 3PVEA 2PHWA 3J8F2 3NJZA 3NKGA 4N43C 4OI4A 3WHUA 5JSRA 1QXJA 3WG1A 1IHMA 5I8SA 4KU8A 1MS3A 1K5MB 4IEVA 2HWB1 1AYN3 2A6VA 2JENA 3MOGA 2XJRA 3D4KA 2WJSA 2ZGOA 2D93A 1DQ0A 1VB2A 5FOJB 1YFXA 1YHFA 3B94A 1HIXA 4ITCA 2ZHKA 4P9XA 2GNDA 1BCXA 2WS93 5GZGA 4Y1ZA 1H8TB 3V0BA 4KL1A 1XNKA 4RQPB 4UW5A 4YVWA 4RL7A 1LRHA 3VKNA 1V6OA 3VBUB 4AHXA 3RG0A 2F6BA 2XWBB 3ZXGA 4YM0A 4ATEA 4A7YA 1R1A2 4JGYB 1LGNA 4QQ2A 1QJZA 4JRLA 1MS0A 2DFBA 2ZA9A 4KGQA 1R093 1K5MA 3JBG2 3WW4A 5KXCA 5JOZA 4Y22A 5J96B 4IXLA 1RIRA 3V64A 1B35C 2WLQA 2MEV2 1RMU3 2D6OX 1G8WA 4AF9A 4Q4V2 1QY4A 1O4ZA 3GF6A 3RMYA 4CDWC 3VBFC 4ZU5A 2WS91 1LGCA 1UKGA 4N53C 4AFDA 4WV8A 1MVQA 1V00A 1N6DA 1RUOA 2VW0A 1QMJA 1RUF2 2WNEA 3KT7A 2D97A 3B9CA 4JGYA 2PHFA 1XYOA 3ETQA 4FOYA 5JR7B 4COUA 4LLFA 1MZ5A 4A7KA 1Z0HA 4QU2A 1ENSA 3V56A 1R091 1RHI2 4O9EA 4K1YA 2WFF3 2EAAA 4AW7A 1GQHA 3IKWA 1OFSA 5FBZA 1YJKA 2NLRA 3UJOA 1QDOA 1RJ8A 3KSCA 3U11A 2A3XA 4CP1A 4KH9A 1NA1C 2HEWF 1TMF2 3MDPA 2TNFA 1TEIA 2BFUS 3LA3A 4Q4Y3 3WHTA 4E27A 5J09A 3AMMA 3FLPA 1PGL2 1RUD3 1O91A 1RVF3 2R072 4MV2A 2GH2A 2PHXA 4WM7C 2PHTA 2VNOA 1H30A 5L7OB 1HQNA 1WLDA 3TRSB 1RUE2 2BTVC 4JGZB 4FPOB 2TEPA 4YVSC 1SBFA 1QF3A 1JUIA 1CAVA 3MFCA 1NE6A 1AR92 2WFF1 4DQAA 3VBHC 3JB4C 1Q8SA 3FBYA 1LHOA 1AHSA 3AZZA 4AHWA 5GZCA 1QJU3 5GLUA 1ND2B 4XF9A 3OD4A 3FE5A 1ZZCA 2GC1A 4NHKA 4Q4Y1 2FMDA 1ENRA 3M8LA 1RUD1 1RVF1 2WNUC 1ND3B 4L2NA 3NW4A 1F9KA 1VBA3 3E6CC 5J48A 3BOPA 4ZXKA 3B00A 5C8CA 2XJUA 4UW6A 2CYFA 4XFBA 4F83A 2PLV3 2B7YA 5KXEA 2Z79A 1DLLA 5BNPB 4CEYB 4LBOA 5FTTC 2GN3A 3DORA 3T2TA 2AENA 2GNTA 2I2SA 4GULA 1QJX3 2YXSA 3EQEA 1NOVA 2ZAHA 1ZRDA 2ET1A 2ET7A 2ZABA 2BVBA 5IK5A 3BB6A 2XJPA 3H7JA 1HQWA 4COWA 2R042 5JVVA 1W6MB 4KWLA 1CAXA 3VKMA 1JH5A 2JE7A 4WM8C 3WXPA 3AYEA 1YYNA 1W2UA 3DF0A 1UD1A 1VBA1 4G3YC 2DXNA 1Q43A 3AMPA 3IDCB 1ZRFA 1PO22 3VLBB 2PLV1 5KXBA 2HWE1 4KGGA 5A33B 1PVC2 4HN1A 4RR3A 1HLCA 4FPKA 3H3ZA 4Q0PA 3VL8A 4F8AA 4LT5A 1UU6A 4LE4A 5FAXA 1CONA 3ZSKA 1QJX1 4I02A 1PK6A 1RL3A 1YWKA 3U07A 4E2GA 2RHPA 4YGEA 2WLPA 4RHV3 4FCAA 5KC6A 5DUUA 2I07B 1C8NA 3I8TA 1NZCA 1FNZA 4Y1YA 4XQWA 4CEWA 1HQLA 2TBVA 4OZXA 1GSLA 5KBFA 1IZ3A 4R9BA 3M2MA 1VAVA 5C4WB 5K0UC 2NPIA 1N6EA 3VKFC 4RGAA 2RS53 2R0HA 4AI1A 1TME2 3ZYJB 2WSUA 1BEV3 1QNYA 4LA2A 4N90A 4YNIA 1WA4A 1WCSA 4M01A 1X50A 1YIFA 4B7EA 4CRQA 4MGKE 3THPA 1RB8G 1ULFA 1R083 1JTZX 5F9TA 4QPIB 5EWSA 4RHV1 1LOGA 3VBOC 1HDKA 1UF2C 3VBRC 4K7JA 2CGOA 2GC0A 1DQ5A 1S0FA 4CTEA 1HXS2 5JI7A 1RINA 1Q8PA 2BW8A 1SLIA 2DCZA 4Y5Z0 5BNOB 2BPA2 2HWC2 1V6IA 1D0GA 1VBC2 3KCCA 3ZFFA 2X5IA 1N1TA 2IFRA 5L73A 2RS51 1UMZA 3CJIB 1FI2A 4BH9A 2WSVA 1HRV3 4U2AA 2JD4A 3JU9A 3WW3A 4YG6A 1NCQC 1QOTA 3VHNA 1CAWA 5KHJA 1O5UA 3S7EA 5GM0A 1R081 3JD72 5L19A 3MZHA 4MXVA 1OFNA 2O1QA 1EAH2 4JCKA 2IXIA 4JVAA 3WCSA 4CDXA 1H9WA 4Z1VA 3O7OA 4KWJA 2R1DA 2ZKNA 2PFWA 1SLTA 1G86A 4OUSA 3RI8A 1QJY3 1WW7A 4TWTA 2QE3A 1NCRB 3HN1A 3VZMA 1BJQA 1XU1A 1OOPB 4JTNA 2YC0A 4E2SA 1DHKB 1W6QB 1HKDA 4YG0A 2X53S 1HX6A 2EXKA 1HRV1 1JBCA 3TN93 2RJLA 5FO7B 1ZRCA 1WMFA 2XLFA 3DL3A 4FOQA 3V0AA 4DS0A 1JOJA 3NV4A 3PMEA 1AYM3 3KCXA 4IEZA 1ZBA2 4QPGC 3SMHA 3AFKA 3CLPA 2KM2A 1VBD2 3PTYA 3M7AA 1RC6A 4OHVA 1G9FA 1FV3A 2C5DA 4HLTA 2Q1ZB 1QJY1 1LOFA 1OPMA 1GBGA 4GMP0 4Q29A 2BVVA 1IKQA 4FXKB 4HPKA 3VDDC 2PHLA 4LBJA 2IXHA 3ECQA 5I91A 4XXAA 2MHFA 2QNKA 1URXA 5D8AB 3DUPA 2BNNA 3OPZA 5HBAA 2YMZA 5IK4A 1RTVA 2VH9A 3INAA 3TN91 1DZRA 1H2MA 3LA2A 5A3LA 1J58A 3MLJA 5BXXA 1AYM1 2IXLA 2ZX3A 1UKRA 4RGGA 3R4DB 3HT2A 2ARBA 3U0ZA 4FQ4A 3NAPA 4AEJA 3VZJA 1ZZ8A 3VL9A 2EVXA 3B7MA 4NWVA 5CFCC 5C9AC 4GH4A 4M3CE 1PNGA 1AR73 1UIKA 1ZZ7A 3MGUA 2DVGA 3WG4A 2ZOAA 4R9CA 1POV0 4Q4W3 3QBQA 1DU3D 1Q3EA 2R49A 4MXWB 2IC1A 4GWMA 3TAYA 4C90A 4JDNA 5ABJC 4AI8A 4Y1UA 4YRDA 1RUI3 3H1WA 3GYDA 4M3CF 4R52A 1V6MA 4N43A 1VAMA 5JSPA 4L11A 4WVWA 5GLVA 3KLSA 4IEQA 4RD7A 4MX3A 3V65A 3QOPA 4PDWC 4CP2A 3M70A 2A6XA 5I8TA 1W6OB 1AR71 1RJ7A 4B7KA 3D0SA 2WKKA 3W59A 1U5XA 1VBE1 4YZ2A 4S2FA 4Q4W1 3LOBA 2DVFA 4XFFA 4N53B 1PIV2 2DU1A 4ATFA 4ASMB 4XQDA 5LRRA 3PHMA 3T1MA 2D5FA 1RUI1 1G9CA 3LA7A 3UV9A 3M3OA 1QH7A 3OF1A 5KHIA 3THTA 5DG2A 1LHNA 4NR1A 1XE8A 4Z82A 1XU2A 2FZ1A 1OSGA 3VV1A 3TYJA 4WVZA 4P9GA 2R30A 1B35A 2R062 1W0PA 2D43A 3ME2A 4XEZA 4CDWA 1IPJA 3VBFA 1YFUA 4XJZA 1WD4A 2D5HA 1SLAA 4FAGA 1DQ4A 3DPRB 4XFHA 4Y1VA 2RS13 1QOOA 3N35A 4IESA 4AEKA 1Z7S3 4YM1A 2OZ6A 3R05A 3UJQA 4FSJA 1VJ2A 4G4FA 1JXNA 4XHBA 3NO8A 1C5HA 4YVSB 5LEJA 3R6SA 2VG9A 4X6QB 1UIJA 1S55A 2XHKA 2HWB2 5C8WA 2VNGA 2UYBA 1N47A 5L36A 2OIIA 1NA1A 5E1RA 1Y9QA 1RITA 3A0KA 1N3QA 1DQ2A 1VLNA 1ASJ3 1QXPA 3AP5A 3WR0A 1UZZA 4INDA 2WA3A 2X5IC 3AMHA 1XYPA 3E6DA 2DVDA 3J26N 5C33A 5JOXA 3GZTB 4BMEA 1FATA 2H6BA 2RS11 4DINB 3UKNA 4WM7A 1Z7S1 1C28A 5EFUA 1WGPA 2CWSA 4GXLA 4FTEA 4WBBA 4YVSA 4YW3A 3ROUA 4I3GA 1MQTC 1AX1A 1UX6A 4MUVA 4XDQA 5JWPA 5J98B 5JI9A 3VBHA 4YW5A 3H7YA 2ZX0A 2YGMA 2VW2A 4Q8KA 2VQAA 2WQ4A 1KQRA 2WFPA 5CA6A 2D44A 4ISQA 4EWEA 4I01A 3MYXA 4TLFA 1ASJ1 2PQQA 2WS92 2GMPA 3DGTA 2EXIA 2WNUA 4M00A 1CQ9A 3I7DA 4BE3A 2DCYA 1SLCA 1AVBA 1OD5A 3FLRA 3RDIA 3UKVA 4KU7A 3WLUA 3N7MA 2CGPA 3MW3A 4L9BA 1WW5A 4IERA 2NP0A 3J9SA 3AJZA 4KG0A 2GMEA 1W6NA 2DTYA 3BPZA 5LK5A 1NY71 1LESA 1I9RA 2WT2A 4I0BA 4XPVA 1Z78A 2IWGB 4LBQB 2WNVA 3WQ1A 4WM8A 2OVUA 1TQ5A 2QDNA 1Q8OA 4H55A 1RUG3 4OHYA 2JEMA 1Y3TA 1X33A 4H14A 2A7AA 5KHHA 4DRRA 1SDWA 2RE9A 1AXZA 5CFDB 2XBO3 1GQGA 3QCWA 2DV9A 2XLGA 1COV1 3AP6A 1BMV1 1PO13 5FO8B 4YZ4A 4FPLA 3ALQA 4P9YA 1EY2A 1AJKA 3AZWA 3DV8A 4PIXA 4AVVA 3FFZA 3LB9A 4Q4X3 1PM7A 5D1IA 2BYVE 4Q4Y2 4S2HA 1M06G 4P9IA 4EN8B 1FMD3 1RUD2 1RVF2 3V0BB 2AUYA 5K0UA 2ZGSA 4J6GA 4YVWB 3I59A 1RUG1 3LSEA 4KG8A 5H9QA 4BPZA 1MS4A 1DGWA 4CDQC 2XBO1 2OW4A 5K7PA 1BBT3 4HT1T 3NV1A 4XBQA 2VNRA 4TSVA 4NVPA 1ULDA 1VRH3 1W6PA 3ZFEC 5LEKA 1LENA 1SQ4A 4HK9A 1LOBA 1Y43B 2JG9C 4H7LA 1VR3A 3M3IA 3VBOA 4Y22B 3VBRA 2BEOA 3ASIA 4L1CA 3AP9A 4XFGA 1GANA 4LHLA 4Q4X1 1RUJ3 4IEUA 4ES9A 2A5ZA 1HW5A 3HT1A 4C0BA 1FMD1 3ZN5A 1REEA 2IXKA 3EHKA 5JAXA 3WP6A 1G9DA 4K40A 4OHZA 3ZXLA 2I45A 3IIAA 1UU5A 5I0RA 1OA3A 4EN6B 3GZUC 2ZGRA 3BTAA 4XTPA 2PLV2 1H2KA 2HWE2 2EAKA 1IQAA 1IS4A 5JLVA 4QHBA 4RFT0 5FCCA 1S2BA 2ZS6B 2ZZQA 2YPJA 1NCQA 4B4PA 2RJKA 1VRH1 1WBFA 3AXEA 1S0BA 2YDEA 3ZXAC 1C8M3 2QDRA 1MZ6A 1QJX2 4XW3A 1AYN1 2ZX1A 3RPQA 5DZEA 3ZDSA 3RNSA 1RUJ1 2WT1A 2ZO9B 1NG0A 2KXLA 4YFWA 3PVBB 2VMHA 2N7GA 1O4YA 3AZVA 2BFUL 2E7TA 3LCPA 4M3CB 2NMNA 4COZA 4XFCA 2VULA 4Q0VA 4BOWA 4ZU7A 1SBDA 5C6CA 1CPNA 2ZGLA 1LOCA 3MPPG 3ILRA 4G9SB 4QMAA 1CAVB 2A70A 2RR13 5BNQA 4TYSA 4QPGA 4RHV2 5KWRA 3VN4A 1AR82 1RMU1 1DZTA 3R4UA 3H9AA 4M0HA 3N7JA 4HVOA 3TOJA 4OFGA 1GZCA 3WUDA 3OBRA 3QLQA 5BPXA 3L2YA 2OUJA 5H9PA 1CR7A 4NHLA 5HCFA 3VDDA 4M3CA 1LHVA 4DB5A 2DU0A 5EZWA 1QU0A 3S0MA 3EJKA 4PLOA 2RS52 3HAGA 4AQTA 1B09A 3KS7A 2UWAA 4D94A 5C8CB 4X8PA 1F31A 2E7AA 2P37A 2XB6C 4XTMA 4JC1A 1J1LA 1R082 4HKWA 2RR11 2GN7A 2DYCA 1VALA 2XJQA 3HR9A 1IS6A 3AX4A 4I0AA 4MYEA 5KHGA 5CFCA 4CYDA 3OY8A 1REFA 5C9AA 3AM2A 4AI3A 3WP4A 5ACA3 2E6VA 2PELA 4EJRA 1CAXB 2BNOA 2RRLA 2XJVA 2DTWA 2BBVA 1WBLA 5I0UA 4O9GA 1KXGA 3OYWA 5FPXA 5GLZA 3RI9A 1ULEA 1HRV2 4Y20A 3G7DA 5ABJA 1OLRA 1MVEA 1BZWA 4RR3B 3FMGA 2ZPXA 3O0XA 1REDA 1PK6B 3R4SA 4W6XA 4LBNA 4QGLA 1QJU1 4PDWA 1QJY2 4CEWB 1FT9A 2RMU3 4Q26A 2C0ZA 3MIHA 2WNVC 3AZYA 1PZ9A 1KS4A 1OKQA 4JDMA 5TSWA 3TB0A 2FZ2A 3POWA 1OLQA 2ES3A 1OPOA 3GZAA 4YZ1A 1V6NA 5I93A 4AEDC 1AJOA 4Q1PA 2B8MA 3TN92 3JUUA 3SITA 3WDVA 1J3QA