4AE2A

Crystal structure of human fibrillar procollagen type iii c- propeptide trimer
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
216
structure length
212
Chain Sequence
b'PDGSRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKLDAIKVFCNMETGETCISANPLNVPRKHWWTDKKHVWFGESMDGGFQFSYGNPELPEDVLDVQLAFLRLLSSRASQQITYHCKNSIAYMDQASGNVKKALKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYRTRKAVRLPIVDIAPYDIGGPDQEFGVDVGPVCFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLLAGEN ALPHA-1(III) CHAIN
publication title Structural Basis of Fibrillar Collagen Trimerization and Related Genetic Disorders.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 62
structure length 212
sequence length 216
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01410 COLFI Fibrillar collagen C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1000 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ae2A02
3.30.750.130 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 4ae2A01
4AEJA 4AE2A 4AK3A
chains in the Genus database with same CATH superfamily
1V6NA 2WFF3 1ZA4A 1H6XA 4QX8A 3WR0A 1GMMA 4META 1TMF3 3DYPA 2E53A 3ZXKA 1MS3A 1O59A 2FBEA 1V9U2 5F8PA 2V09A 5HCAA 1BEV2 4O61A 3AMPA 4QAWA 1AR93 1LNSA 3U11A 4DMIA 5A32B 4RS5C 2Z79A 4XETA 4XJZA 1GZWA 3QH6A 4XQDA 1J3RA 1QJY2 2ZGQA 4KGQA 2XKPA 2RS13 3FUQA 3B93A 2UWBA 3UL2A 3VD5A 2I07B 4ASKA 4IETA 3FN9A 3NJVA 1RUH1 4J1WA 2FHRA 2ZGSA 4G4FA 1HX6A 2LTNA 5A7QA 2A5ZA 3VLBB 1URXA 4A7KA 2ZHNA 3FE5A 2Q8EA 5IFPA 4AFAA 5H9QA 3ON7A 4BQWA 1XNAA 4YLZA 4EWAA 4UF0A 2GAUA 4AQ6A 2VMHA 2R063 1RHI2 1ZZBA 2Y6GA 4JX0A 5FXVA 3ALQA 1N6EA 3DPRA 1GNHA 2JWPA 3QACA 3POYA 3URFA 4KG8A 1NLSA 1QWRA 3BTZA 2YY1A 3OJBA 2WS93 5FPBA 2D5HA 1S2KA 2JXAA 4FCAA 4LKSA 4CDWA 5L9VA 1OT5A 1RUF3 3K77A 4KU8A 5AFEA 3IF5A 5A7NA 4UI9L 1THNB 5HBAA 3BODA 1YQ2A 1VBD3 3FHAA 4LXLA 4A4AA 1V9U1 2KD7A 4D0QA 5F3CA 1BEV1 1GZWB 2HKXA 4GZ9A 1SBEA 1H6YA 2BOJA 2KXLA 1N1SA 1QJY1 4EN6B 2Y6LA 5FJKA 4UXAA 4X6QB 1BCXA 3ZXLA 4YVSC 1ZRRA 1W6QA 1RUOA 3OEAA 4E2QA 5LK7B 3Q8BA 2DXNA 5FZMA 1X7NA 4BE3A 3OPWA 3J7HA 5C3QA 2NZ9A 3LE0A 3DF0A 1CZVA 3AK0A 1LRHA 3A23A 5EYYA 5JSOA 1JODA 2VUJA 3IIIA 1O3QA 3GCXA 5EFUA 1LHWA 1HB3A 5H9PA 4AR2A 1J1TA 5A80A 5HCHA 2Q4SA 5K0UC 3VBFB 2D40A 5JR7B 3EQEA 3DPRB 2WQZC 2OW4A 1RHI1 2VULA 2VGDA 1V6MA 2K9ZA 3A7QA 4Z82A 5EP9A 1RUG2 3EBRA 1ZVFA 4CDWB 2BP6A 3AZYA 1WD3A 3PIGA 4FFFA 1SLIA 4QHBA 5F2WA 3WW2A 1EAH1 4JGYC 1WWYA 2PA7A 3NQHA 4YM0A 5BNNB 5CIRA 1KDKA 2ENRA 2XLAA 2D6MA 2JDMA 3QDQA 3VV1A 1XQNA 3WDWA 1RC6A 1QJX1 4CU8A 3S5QA 2VNGA 5DN2A 5F3IA 3FC0A 1WXXA 1VB4A 3OG2A 4CEWC 5JOWA 4BIFA 1R093 4Q4Y3 1W6QB 2NN8A 5EQUA 1DQ0A 5DUWA 2D3SA 5FLHA 1ND3A 3ZYFA 2VOKA 4N90A 5LK5A 2GP5A 3FL7A 4PIYA 1AYM2 1I5PA 4QB2A 1YEWA 4B4RA 4CA9A 2RS52 4FPCA 1K12A 5SV8A 1QEXA 4N53A 3NV1A 5D8AC 2WNEA 4LLFA 2VTFA 3HN1A 1TEIA 3ACLA 3ZX7A 4QM9A 1TNRA 4YW3A 2X29A 4CUCA 4XDPA 4ZPIA 1JOBA 2WLQA 1RUG1 2DDUA 1SLLA 3AP5A 2VW0A 2XVKA 4Q4W3 2R041 1RUJ1 1YFUA 5DZFA 2W92A 5T5OA 5CFCC 1ZRFA 1B35B 4KL1A 3QOPA 3VBSA 1US2A 1LOAA 3AZXA 5LBEA 3CHXA 1SFPA 1FT9A 3NW4A 1MR5A 1C5IA 1SG3A 1LESA 2VECA 5KHIA 4PCRA 4W4ZA 4XE9A 2HWE3 2R071 3H50A 4J6GA 3EHKA 1V0AA 1DGWA 3IAPA 1ND3B 3PURA 3OSDA 5AVAA 4XFIA 4IQPA 3ZFGA 5A3OA 4CYDA 2QKDA 5A3PA 4PIXA 4XJWA 1Q5OA 1PMHX 3ORJA 1FNZA 2O0OA 4N53B 4HVOA 1AYM1 4TLFA 4CUAA 2RS51 1SBFA 1O7FA 4LUMA 1A8MA 4XJAA 2XDVA 3TEZA 2VBBA 4IE5A 3RRDA 2FDHA 2WO3A 1PMIA 1SFYA 5CYYA 1DLCA 4DPNA 1ONAA 2W1WA 1R083 2XG3A 1NQDA 3NJXA 5FYIA 5AFBA 1KDMA 1FX5A 1WCKA 2VMEA 1H4ZA 5DAPA 2P17A 2VUAA 4DB5A 4DFSA 1RMU3 1LB2A 4SBVA 5JAXA 3OIRA 1BLZA 3DYOA 1PM4A 1YUDA 1ZNPA 3J7NA 4ISRA 5DZEA 1D4VB 5JXGA 3SEPA 3VBSB 3P6BA 1BPLA 3GK7A 5DAWA 5EYXA 1WW4A 1IS6A 1GANA 4P00B 5I0SA 1O4ZA 3LA3A 5IJRA 3FHIB 1DU3D 1Q8OA 4AVVA 3AKSA 3N9LA 5JI7A 3ZN6B 3DN7A 2R30A 3B01A 2Y38A 4AZZA 1QXJA 1W8TA 4RQPC 5F3EA 5F3GA 2RMU2 3ZLIA 3DKWA 4AHXA 1PVC3 1AR72 1X36A 4G3YC 1VAKA 2JECA 1SQ4A 4NHLA 2AS0A 2CDOA 4LR4A 4BISA 3ECQA 2FZ1A 3NAPB 4B8EA 2YFUA 3AKPA 1VBA2 1POQA 1NUKA 1FATA 1YJKA 3DUIA 4FQ4A 4MX3A 4XPVA 3WF3A 3HT1A 5LBBA 1NX9A 4GQ7A 2WN3A 4G9SB 1WCQA 4LE3A 3ME2A 4DRRA 1FV3A 4E9KA 1UY4A 4CXXA 2VCMA 5FP7A 3ZYGA 4EROA 2DCKA 2TBVA 3MHZA 1QQP2 3E1F1 3SH4A 1N3OA 1U5ZA 2B7YA 2D7FA 3H7YA 3L2HA 4FPFA 4A7ZA 4D94A 1UMHA 1XNCA 2GC1A 2VZQA 2WNUC 5T54A 1QNWA 1Z78A 4BB3A 4DXRA 1QY4A 1BKZA 4HVRA 2BRTA 1I5ZA 2J1UA 2YG0A 3HD8B 3KCYA 2RR13 3LEKA 5BNPC 4KU7A 4NJ4A 2ZMNA 1ND2C 3NV2A 4ZHNA 1UD1A 3H1MA 3K46A 5CZKA 1KS5A 3ZN4A 2RMU1 2WFF2 2P37A 1ZBA2 2W47A 2LM3A 3AP6A 1TMF2 3AFKA 2PHWA 3H42B 4MYEA 2RM23 2Q30A 4S2FA 2RG4A 1ZZCA 4LJHA 5LATA 2W68A 1F35A 3BVCA 3ZN5A 5T3NA 4NAOA 1PX4A 2FZ2A 1DQ2A 2P6HA 2VZUA 1FC9A 4P14A 3IN9A 3T2QA 1O3RA 1JU4A 3I3DA 3PTRB 4MGTA 4QHZA 1UL9A 4B3NA 2YBPA 3E97A 5L9BA 3S30A 5A3UA 2PFWA 5KHKA 4NIHA 2ZX3A 2YB7A 4NPRA 3KT7A 2H6BA 2EALA 4CEYA 2QE3A 5FZ7A 1RIRA 1HJGA 1QQP1 2G1MA 4KWKA 4UBHA 4XHBA 5A3LA 2HWB1 1PNFA 5B4XA 3RYKA 5ANQA 4MSVA 4NN0A 4E27A 5FMBA 2J7MA 3QD6A 2WSVA 4GJZA 3WW3A 1D0HA 1CAVA 1FV2A 4LBJA 1D2QA 4IV3A 2P3JA 4LEJA 2O8OA 2JIJA 3POFA 4IL7A 4QPWA 1POV3 4W6YA 3PVEA 5LWBA 2WS92 4EN0A 4RSUA 1BVVA 4QDSA 2RJ2A 2XBO3 5JCTA 4CXYA 4ONUA 2WFF1 3CU7A 1ZBA1 4WM8C 1CVNA 1HB1A 1TMF1 1CGPA 5FOBB 3C0KA 3PNAA 1VR3A 2A6ZA 1VMHA 4O7XA 2CL2A 4K9SA 4AHYA 4K1ZA 1QMJA 1CJPA 1BBT3 4XIKA 1R64A 3GJAA 1AR91 4P08A 5CKMA 3ZFEA 1CR7A 5I8SA 3WDXA 4OMDA 1RUE2 4XCBA 4NROA 4PHZA 3H3UA 2RS11 5ISLA 1JYIA 2WL1A 3H1WA 5FXWA 2VY0A 3HNBM 4Y5Z0 5FKCA 2WWSA 3WDVA 2OQ7A 3AX4A 4QU1A 3UV9A 2WZR3 2VAUA 3IMMA 1UXZA 1YI7A 1VC1A 4L0PA 4CEYB 3ITQA 4NAMA 1HRI2 3C2UA 2WLPA 1OA3A 1QDCA 2E7AA 5JPMB 1WKYA 4W8JA 5LRRA 3S0MA 3CLPA 2ARAA 1ULOA 5CA6A 1GQGA 2R061 4HFSA 1GLHA 2VXJA 2XVGA 4P02B 2AR6A 3FJSA 4CP9A 4LHNA 1OXCA 1QOTA 1J7XA 4YVWC 1OD5A 2WS91 1FI2A 4LNVA 1XC6A 5DZGA 3ZXGA 2R6QA 2J1TA 5FP8A 1FC7A 2OZ6A 1J58A 4YM3A 1DIWA 2ZA9A 2D44A 4YGDA 3M3IA 3LD8A 3WDUA 2ID4A 1ND3C 4Z2WA 4QPGC 4HLTA 4MO3M 5FYTA 1N1YA 3UKVA 2BV4A 3ZDVA 3ZFEB 1O3SA 3IWZA 1BMV1 1OH4A 2ORZA 3E5QA 4COVA 1CQ9A 5C8CC 4MG2A 3MDPA 1Q8VA 2PAEA 1GOHA 4XYXA 4PF5A 1OQEA 3MICA 5FY1A 1IKPA 1WUVA 1UZYA 1QU0A 1W8FA 3MW4A 2PLV2 4AF9A 5C3RA 3M1HA 1CAUA 2HWF2 4QKNA 1EPZA 4GD4A 3LA7A 1S55A 5DUXA 1UY3A 2DXLA 3V97A 1YIFA 2D6NA 2N7GA 1HRI1 5FTTC 5BNOA 4QQPA 3ZPYA 4YRDA 1Q43A 4IE0A 3RZZA 4AEDA 1PGL2 1H1MA 4GWMA 4AEMA 2R7EB 4CP9B 2R16A 1GBGA 2EAAA 1WA6X 3T2OA 2B9UA 5I0DA 1AL0G 5JR2A 3ABZA 4BQ4A 1XPWA 3V56A 2OZJA 1KFXL 1ZM1A 4TXWA 1UYPA 1VBC3 4Q4W2 1CIWA 3OF1A 1UMZA 2ZGKA 3CBNA 4I09A 5FP3A 3MPPG 4QPIA 1JS9A 2WQ8A 3N9MA 3ACIA 4Y22A 3ZFGC 2AH2A 3VZJA 3D03A 1GWLA 4Q4V3 3WVJA 3ZMOA 3HQUA 3ZPOA 1N1TA 2PHFA 1H1AA 4I0BA 2KA5A 1EYBA 1R091 1YO8A 1CAUB 3A21A 2P6CA 4OCTA 2K2SA 2RS32 3HNMA 4Q4Y1 2W91A 3TWIA 3U10A 2WNVA 2GDFA 1O4YA 1UXXX 2HWF1 1MS9A 2VJXA 2XKOA 2XUMA 1W8HA 3EO6A 2UYBA 3FMGA 2GH2A 2VH9A 1NLRA 3I59A 5BNOB 2VCBA 4AEDB 2QVSB 1H8TA 3MW3A 1TME2 1PGL1 4OZXA 3UJQA 1LODA 3RSJA 4A41A 1M06G 3SH3A 1NQJA 3T1MA 3Q8EA 2MPFA 3UKNA 4LBQD 3MW2A 1NXMA 3RDIA 4OLLA 1ZZ9A 4Q4W1 4QPIB 5FZFA 5IHRA 1C8M2 3KZ4C 4AGGA 3RZGA 1UOFA 1AR83 2A1XA 2WC2A 4FPLA 4KWLA 1V6IA 3O1PA 5CKNA 1W06A 1LGNA 5FDBA 4CDUA 3KQRA 2ERFA 3GCWA 4FPGA 3W59A 3WEZA 1W9SA 1PVC2 5FREA 3SLIA 4C1XA 3EXUA 1UY0A 4ET7A 2CDPA 2GP3A 2PHRA 2WAOA 4XACA 3AB0A 5IATA 3DKQA 3I59B 3PVNA 4JDMA 4RS5A 1JYNA 3B02A 3SEEA 3RVHA 4JKKA 4HK8A 3WDTA 4XF0A 4UT5A 1XXNA 2DTYA 1H8TB 3NNJA 4JVAA 5EWSA 4IV1C 2ZEYA 3POGA 3TEYA 4C0HA 5FXZA 4EQVA 3NVCA 5KHJA 4RN5A 4FXGB 2CV6A 1TME1 4IE6A 3ZR6A 5C3OA 3WF2A 1VLNA 3KF5A 5JSRA 2ZHKA 3IKWA 1W8NA 5J37A 1PNGA 4V1PA 1R081 5FR3A 1FXZA 1PM7A 5FXXA 4RHV3 1F31A 2JDYA 1RMU1 4LK6A 2IVIB 2BNOA 1CZTA 4IGPA 3GYDA 3ZSJA 2NMNA 1C8M1 3CF6E 1PO13 3A0KA 4XFHA 3ZYBA 4UW3A 1U12A 3D6EA 2CY6A 2YC2A 2RR12 3O1SA 3VZKA 3PU3A 5EJ1B 4YZ3A 1T6BX 4CDUB 3I3MA 4FO9A 2ZEWA 3H8UA 1Q8QA 1Z7S3 3MFAA 1N3QA 3KM5A 3M8LA 1PVC1 2XL9A 3B3QE 4XZPA 4URAA 2W5FA 1QH6A 3THPA 2CSGA 4RS5B 2RM22 4JHTA 2R1BA 4PLMA 4UFLA 4P9GA 3AJYA 3VGIA 5IVBA 1XU1A 3RZJA 2V5DA 2SBAA 3AC0A 4BM8A 3WNXA 1UY2A 4HG6B 1HW5A 4KQ7A 1AL22 1V0FA 3DJAA 2HWC2 2W46A 2C0ZA 4DUXA 2B9VA 2ZOAA 1OOPC 4LBLA 4IV3C 4E4SA 3WD5A 1RYYA 3NV4A 4UFJA 1STMA 2HBTA 4YGEA 5A6ZA 5F39A 5EUXA 4WVZA 3ZOIA 1LU2A 3S57A 5C3SA 2ZGUA 4LE4A 4QB6A 2YC0A 3I3EA 2WJSA 1NYWA 1REEA 4Y4YA 1ULPA 3K2OA 2RR11 1DZRA 5KR7A 4W50A 4QD2A 5C33A 5C71A 4JGYA 2XMLA 4R52A 1VBE3 3V0BA 1SBOA 4FPJA 1CIYA 1ASJ3 5G04L 4BQ5A 4BLIA 4QWNA 1IG0A 1F15A 3ZXJA 4A3XA 2RM21 4TZDA 1FOD3 1Y4WA 4IGOA 3VZNA 2O14A 4A42A 2WAAA 4CEWA 1WBLA 4YVSB 5FLJA 1W0PA 3DXUA 3ETPA 5C6CA 3ILNA 1VP6A 4B29A 4BA6A 2JG9C 5EIYB 4YW4A 3K4ZA 5AC93 3UNPA 4EN8B 2HWC1 5FZ3A 2WZR2 3O14A 4JC0A 1UKGA 2C4XA 2OIIA 4ZU4A 3MV11 3H7JA 5K0UB 3ZYIB 5FK8A 2RV9A 4Q5OA 1XYNA 2AREA 4IEPA 4COYA 1K45A 1NCRC 4LORA 4K8RB 4RR3A 4XFFA 3OBRA 2BVBA 2VO5A 1Y3TA 4Z92B 4CE8A 2ZO9B 4PF1A 4AVSA 5LZ6A 4QDQA 2XHKA 2Z4FA 1Y7BA 4JGYB 1WLDA 2KA3A 2FDGA 1POV1 5GLVA 2IC1A 2D6LX 4ZZ8A 5CFCA 3V0BB 1F8VA 1QOOA 1MZEA 3VD3A 1CWPA 1S0FA 3CDZB 1AXZA 5FLIA 5J7MA 2C1FA 2DV9A 3RJ2X 4KI5M 4Q0UA 3V64A 3WNMA 1W8OA 3JD72 4CEWB 1WZXA 4NPLA 2D6PA 2SLIA 3WSOA 4V2WA 4NO4A 1RXGA 4XDOA 2HYKA 5FYMA 3IIAA 2D3RA 4TLGA 5FY8A 3MUY1 4D3WA 4CTEA 2JE7A 2LS6A 4FPHA 4QKDA 2WABA 1O5UA 2AUYA 2BGOA 3GF6A 3WP6A 4ZS3A 4LO5B 1Q3EA 4ZU7A 4FOYA 2Y6JA 4LIVA 1U5IA 2W94A 2WZR1 5D8AB 4COWA 1SACA 2RE9A 4I02A 4HBNA 3VBOC 2ZOEB 2W1QA 4BK5A 4UW6A 5LA9A 5FYUA 2QZ2A 4LBQA 1UIKA 4F8AA 5K4LA 2ET7A 4OHWA 1LOFC 2HEYF 4QQOA 4QDRA 4BQ3A 4FVVA 5EJ3A 3TN92 3GMFA 1SLBA 2FCUA 2G9ZA 1LJ7A 2WNOA 3R05A 2VQAA 5B2GB 1E5SA 5CFCB 3LOBA 4PBPA 4CVUA 2YBSA 2J1AA 3TNPB 2X10A 2ZMKA 5EUZA 4Q0SA 1ZZ7A 1W6PA 1OQDA 2GC3A 2ZZQA 2VM9A 5HXMA 2VBDA 1AYN2 2WNVC 4QMAA 3VHOA 1NG0A 1UU5A 2DVGA 5DAVA 4FAGA 3JD71 4RQPA 1XYPA 1L3JA 4NE9A 3WP3A 3DYMA 4N7IA 2AGSA 4KWJA 4O9EA 4XVHA 3W20A 3OY8A 1C3HA 3POJA 2H0VA 3BIEA 4DZGA 5GZDA 1JZ8A 4GULA 4DUWA 2VUDA 4X6RB 4XF4A 3PTYA 2B46X 4LHSA 4I3GA 3GBFA 3MBWA 3ILFA 4M3CF 5FMOS 2NMOA 4UW4A 4WVMA 4FTEA 1W9YA 1L7QA 1V0EA 1VE0A 4YPJA 5CG9A 2VPVA 1YIPA 5L36A 3BUCA 3I2FA 3QCWA 5J36A 4LBQB 1EP0A 1TG7A 3FUOA 3WV6A 4MGZE 1OC1A 1GR3A 1MEC3 3KB5A 5FKBA 1W99A 1WCSA 2F6BA 2B8MA 3TN91 3HBKA 1SDWA 1OA4A 1V6JA 1CAXA 1GWKA 5FPZA 3SC7X 1VBC1 1W2UA 2PMWB 1W6PB 2WNUA 3NNMA 1WLCA 4LO6B 5FZ4A 4FOVA 4RGGA 1LHNA 1PGW2 5GLTA 5BNPA 4W6WA 5FMOL 5KWRA 1AYN1 4RQPB 1K42A 3LLOA 5JXIA 1ND2A 1PIV3 4Q4V1 3CEWA 5E6HA 4NWWA 3NJZA 4I0AA 5KXDA 3OY8B 1TIDB 1OUSA 4SLIA 4AFBA 2H0BA 4XILA 4BK4A 4D6QA 4Q8KA 3NWKA 2P3IA 2RVAA 4M3CB 5FJHA 2D6KA 1EUUA 4JCKA 1YXWA 3NRUA 1EY2A 2BWCA 4YZ4A 5A70A 5A33B 1JYXA 2FD8A 3HR9A 1W0OA 4KH9A 2IXCA 4IGQA 2JDZA 5BNQA 1OBNA 4CRQA 1G6NA 5FOJB 2XJVA 1W9WA 2ORXA 5A7SA 3MIBA 1EAH2 1YFWA 2DYCA 4FFHA 2DU1A 2QQMA 4FP3A 2JDPA 4M3CE 3U1XA 1AR63 5LCWL 1REDA 2QJVA 2WNUB 3WCSA 2B4KA 4W65A 1LR5A 2ZTNA 1SDDB 3ETQA 3VZOA 3OBTA 2AEZA 5BNPB 1B09A 1QJX2 1ND2B 1WA4A 1JBCA 1PGW1 3POWA 4QHOA 5ANNA 3T6OA 2VZOA 3AYAA 3L9JT 3WY6A 2BBVA 2VC9A 4BLJA 1MS0A 4XJUA 3WNOA 1P8JA 1VJ2A 4WM8A 1KITA 2GU9A 5GLUA 5HI0A 1D4M2 3JU9A 1S2BA 4XW3A 1XNTA 5DXDA 3TYJA 4NIDA 3MOGA 1UU4A 1LGCA 1OFSA 1REFA 2F4PA 3LDBA 4DXZA 3LCPA 4FTBA 2P4EA 3WNLA 5DDJ3 5FO8B 4UF0B 2VY9A 1JZ5A 4DY5A 5LA0A 1AX2A 4CCLA 5CU1A 1OLME 2WWUA 3G7DA 1FMD3 1LHVA 2WT0A 4HETA 3KMHA 5F6KA 1J59A 3IDCB 2R042 1RUJ2 3D5OA 5FWJA 4EE2A 2QBXA 4RHV1 1OMIA 1CONA 4IEXA 1HV1A 3WOGA 3JBG3 4LA2A 1BHGA 3O0WA 3VBHA 1ST8A 3WW4A 1RUC3 1ULGA 1A3KA 1PO11 2BGCA 2BYVE 1QDOA 3GNEA 3J8F2 5H9SA 1F2NA 4JGZC 3RYRA 3VKLA 2JD9A 4YVWA 4UFMA 4Z8BA 2LUWA 2R072 3WDYA 4WM8B 1UYXA 4IEWA 5HV4A 4PIZA 1H9WA 1Z7S1 4LBNA 5F5AA 1KEXA 2J22A 4OHVA 4WZCA 3PUAA 3ZSEA 4XF1A 1D4M1 1QKQA 5FY7A 2AZ5A 4QPGA 1YFXA 4K7JA 1DCSA 1FOD2 4F7ZA 5DUVA 4A7YA 4D8MA 5C8CA 4K20A 3O1RA 4O65A 3DGTA 1AUZA 1IGOA 2JX9A 4OULA 2D97A 4EN9B 5KBFA 1FPN2 3CO2A 3B9IA 4RR3C 5AC92 3AFGA 3SMHA 2HWD3 1FCFA 3BGAA 3H1YA 2EXHA 1XB9A 3VDDC 3NY7A 1YQCA 2PHLA 4UFKA 1XE7A 4K8FA 1QH7A 3U4XA 4GMP3 4Y24A 4JKMA 2YROA 4A3ZA 1F5FA 3OTFA 2ATFA 4LBOA 4YVWB 1HXS3 2FDKA 2F4LA 3J8F1 3SCHA 4XIOA 4MH0E 4KMQA 5T55A 4Z1VA 1KXGA 4R9AA 2ZX4A 1ZX5A 1VBE1 4QPGB 1PHMA 2A3XA 4URTA 4CCNA 3T30A 1YLLA 3PU8A 1UIJA 4BMEA 4GKXA 2MEV3 4AYUA 2DUQA 5C8CB 1CZSA 1KQRA 1FOD1 4GHNA 1TQ5A 4OI2A 4YW5A 2JB8A 3VUOA 3S5AA 2QQLA 3MIGA 1IG3A 3CMGA 3R4SA 4K6BA 4JHZA 4QT6A 4QKBA 3U75A 1FPN1 2PQQA 5E1RA 2XQXA 5DQ0A 1CX1A 5AC91 4BYYA 4LMFA 5C9AC 1VMFA 3JU4A 5IAXA 3N3HA 4GAZA 2ZGMA 3CIHA 1SFNA 1YQ6A 3WP4A 5LBFA 3MO4A 1F5JA 3JCIA 4COUA 3VZLA 3WQBA 3V8VA 4Q0QA 3V0AA 2ZBJA 3IAQA 3N9NA 3LPFA 3I2JA 5FYSA 2VZRA 1WLTA 4LIUA 2IXHA 1O4TA 3PUHA 1LHUA 1UZVA 1UF2C 1ULEA 4IUGA 4MGQA 2P2KA 4PQQA 5C4WC 4H55A 4ISQA 4OHZA 1PO23 5A1FA 1UKRA 1PGSA 3GBGA 3HPNA 3JQXA 3AZZA 3GHMA 4INDA 1MZFA 3ZFGB 3O12A 4N43C 1CJDA 4DRVA 5JOZA 3H8RA 4OUSA 1KS4A 1QJU3 2C24A 4RGAA 1DQ4A 3FZ3A 1TVGA 2VNOA 4UFIA 1HJFA 4M00A 3CJIC 5A3MA 1H2KA 4H3WA 1NA1C 4R4XA 5FY4A 3R6SA 2E6VA 4MGSA 5C5TA 3HJRA 5FUIA 5EUSA 2Y8KA 3ZYHA 2ZAAA 1JYTA 5FUPA 2GMMA 3IDEA 4AWDA 4BMBA 3DECA 4XJ9A 1MQTA 1GP5A 4L9BA 3MI8A 5A3NA 4NIAA 4RL7A 4FBFA 1H2NA 4XFAA 4IV1A 3I7DA 2HWB2 3V0AB 4A6OA 1H8VA 2RJKA 2HH9A 1GYKA 5A7PA 1QJEA 4XFBA 1HQLA 4D69A 3AKTA 1IZ3A 2IXLA 1KGYA 4UBGA 4CCEA 2VUCA 4EZHA 2IXKA 2Z69A 3FLTA 3ZR5A 1LOCA 2JD4A 2CTVA 2XQRA 3SH5A 1YFYA 3LIGA 3TEXA 2BW8A 2YU2A 5CB7A 2Q1FA 3T0AA 2RHPA 3LEMA 2OQ6A 1D2SA 2PHTA 4JDOA 3MIDA 3ZTBA 4XHXA 1AR92 2Q8OA 2RDQA 1PIV2 3BTXA 2W0XA 5GM0A 1G9AA 4XMAA 4B7EA 2WZEA 4CPBA 2RS12 2WRAA 4XF9A 5EZWA 1OI6A 4XBLA 4OQ8A 2WYFA 3ZYRA 5H9RA 3BYWA 3QLQA 4AW7A 1JYVA 4DMGA 3GGLA 5I93A 4HZFA 5FYBA 5J98B 3K50A 2WKKA 4IV1B 1AHSA 4L92A 3VKNA 3RJRA 4FPKA 3MIFA 2HEVF 2GMEA 1KJRA 4GXLA 4XUOA 5IVFA 1X8MA 1HRV3 4EWEA 2I2SA 2VMCA 4IEZA 2R062 1ZZ8A 3OD0A 1Q56A 3AL6A 2R0HA 1OOPA 2BOIA 2YMZA 5L73A 1F4AA 1MEC1 3AMNA 3WW1A 5G05L 4ASLA 1RUF2 5IYYA 3WHTA 5KC6A 4HSJA 5FYZA 3GJBA 4YG3A 1UZ0A 1VBD2 3FLRA 5FMCA 3T2TA 4E2GA 1JZ6A 4O9GA 5KHHA 3A0NA 2J1SA 3LGRA 3QBQA 1BMV2 1Q8PA 5FV3A 4BH9A 2BTVC 1RVF3 3AXDA 1OLQA 3P1IA 4D7YA 2UY8A 4CP0A 5LA1A 1PIV1 1VB2A 3VL9A 3RNSA 1XOYA 4HL0A 4Q2FA 4LHKA 5L7OC 2XL7A 3OGVA 4FPYA 5C70A 4AQTA 1ODNA 1X82A 3AZVA 3S7IA 5FP4A 5C8WA 1S1AA 3GBWA 5FO9B 3K4DA 2ZAHA 1ENSA 5I0UA 2B5HA 1XE0A 1ZYBA 2VNVA 4IEYA 1H2MA 5FZOA 2NP0A 4B4PA 4QQ2A 1WGPA 3JUUA 4ARXA 2CWSA 4DY3A 2JG9A 4P9LA 4HMZA 3T2PA 1CAVB 1OOPB 4IV3B 3VBHC 1LEDA 3PJYA 1KFUL 4HK9A 3MIEA 5FZDA 2QDRA 1S0JA 3HAGA 3LOIA 3OGSA 1PK6C 4CXWA 3C7HA 1GUIA 2ILMA 1YYNA 2E33A 5HV0A 1RUF1 2ES3A 3MLLA 2ZGPA 1NCRA 1G86A 2Q1MA 5JOXA 3JBG2 1COV3 1N3PA 5L9RA 1VBD1 4LA3A 1RUC2 4AEJA 2D5FA 1WMXA 3FHQA 1H4XA 5IW0A 2AC1A 3NKTA 5BXXA 1JW6A 3AXEA 4GWNA 4CDUC 4ZU5A 3OIZA 1R092 2LALA 3AKQA 4Q4Y2 1S0CA 4YZ2A 3M3OA 3MGLA 5FY9A 2DCJA 2VOXA 3OGJA 4CCOA 1DLLA 1JMUB 2QQWA 1ZRIA 4XDQA 5A6QA 5HPOA 4BZ4A 3A22A 3Q8AA 3WF4A 4GMP0 2EIBA 5FZOB 4HVQA 3RQ0A 3E5XA 4NMIA 4N8MA 4QQHA 2Z2SB 2JG9B 3RS6A 4M01A 1JU3A 2Q5TA 3IB3A 2V5YA 2C9AA 3P3PA 1SLCA 2BFUS 2XJQA 2D98A 2CGPA 3PUQA 2XJTA 2JE9A 2HWD2 4GB33 1FMD1 1G9BA 2YPDA 2IXJA 3C7GA 3O1UA 2GZWA 3VBOA 4XC9A 3AM2A 3H3ZA 1EV13 1NCRB 4MUVA 3KD4A 2DUPA 1QJZA 3H3LA 2W9XA 3LAGA 2VG9A 4FI9A 3DUPA 1LOFA 3JBG1 3ELNA 1A6CA 1RUC1 2VQ0A 1NT0A 4NRMA 2VZ3A 3MYXA 1O8PA 2OVUA 1OPMA 2DVBA 2X53S 1HXS2 4XBQA 4CDXA 4F83A 2DFCA 4WVWA 3VN4A 1NLQA 2HWE2 3H8OA 2G9GA 3SHRA 4Y1ZA 2VZPA 3GHNA 4XBNA 4L11A 1G8WA 1VAMA 4WV8A 5ERLA 4F3JA 3P5BA 2BFUL 1W9TA 1WW6A 3K51A 1AX1A 4BQYA 1LECA 2C9KA 1E5HA 3LB9A 4R9CA 1CX4A 1QXPA 4Y3OA 5JOYA 3TOJA 1HN0A 1JN2P 1RJ8A 3GZUC 2JENA 4M0HA 4XQ4A 1JUHA 3AZWA 3KS7A 5FWEA 1I9RA 5I8YA 1W6OA 2D93A 4AHWA 3U4SA 4FOWA 1R082 4NRQA 2YV8A 3HOBA 4BQ1A 2HWD1 4LQRA 3ZDSA 2A3YA 3HIFA 3VBOB 1RUH3 3T0BA 1RMU2 1V6KA 3MF6A 3WX5A 4ZZ5A 1LCLA 1QOSA 2BDRA 2NQYA 3C8XA 1GFF2 3B7MA 3MGUA 4QX0A 4Y26A 2YYOA 4AG4A 4FAHA 4Y22B 1JXNA 1WW7A 4LITA 3KT4A 3N7LA 3TRSB 4AVTA 4XS5A 4LBKA 3M4FA 3VZMA 5FPAA 2RDNA 5KC5A 2Y64A 2H6CA 1HXS1 1RUD3 4OYUA 1OF4A 1ZBE3 4IEQA 2VCAA 2ZCWA 2HWE1 1UNBA 4I2OA 2FCTA 5IT6A 4BCUA 3BI3A 2WNVB 3USSA 1MS5A 2GMPA 3OGGA 3UYJA 4RFRB 5T5JA 2DWRA 3FLPA 2ZJCA 4CCJA 1MQTC 2MEV1 3CZJA 1V9U3 1UO9A 4NWVA 4MXWA 4HN1A 1BEV3 1NY72 5FZ6A 2YGMA 4YZ5A 3W5MA 1W6OB 2JDUA 1W03A 1X8EA 4KNCA 3MEPA 3WF1A 4C91A 3LEGA 5CKQA 2VTXJ 4BQ2A 1UU6A 3ZM8A 1OA2A 1H4GA 2D3PA 3RYPA 5JWPA 1EPWA 1H2LA 2QTWB 1JOJA 4AFMA 4AI3A 1E57A 3OPTA 2BNNA 2XUEA 1V70A 5JLVA 1NCQC 1PZ9A 1OFNA 1K3IA 2DCTA 3R4DB 3WG2A 2GNMA 3NSTA 4TSVA 4AI1A 5A6YA 3IZOA 4IESA 1I1EA 3OB8A 3BOWA 4QGMA 4U36A 3RPQA 3ZXDA 4ARYA 2EXIA 3IDBB 4EJRA 5JMOA 1MZ6A 5I91A 1GZ9A 1PO21 3B5LB 4Y1UA 2I45A 2ZPXA 4LK7A 1S0DA 1WW5A 3TBDA 1L7LA 4LHLA 1KJLA 4AI2A 1JZ7A 3WINE 3BPZA 1UCXA 2PAMA 5FZBA 2XB6C 4XEZA 1QJU1 2FMYA 2G4IA 4FFIA 4MXWB 3KVAA 4DS0A 1FAYA 2HEWF 5FUNA 2A73B 2DUOA 4Q0VA 2L9LA 4BXFA 3JQWA 5FCCA 1NY71 3NO8A 4TYSA 4WM7C 1SLAA 2LROA 2J42A 1NZIA 1X9TA 1YCIA 5EJZB 3OBZA 3A4UA 1GOGA 2NM1A 2R0FA 4YM2A 5GZFA 1WCUA 3HQXA 4HPKA 3ZXEA 2ZX1A 4NPMA 1OPOA 2VOVA 2WT2A 3QH7A 5L19A 2IWGB 1BYHA 1SEFA 3UJOA 1OF3A 2K0GA 3BPSA 3L2YA 3PL0A 4XCAA 1J83A 4UFHA 5FZLA 3I4IA 3KF3A 3GXUA 3I97A 5IUQA 2WR9A 2RDSA 5TSWA 2CGNA 3DXTA 5F1RA 3PJQA 3LFIA 2BZDA 1G7YA 1VBB3 3LPGA 4QB1A 2XBO2 3IBMA 5T50A 5F37A 3VD4A 3M3QA 3VBRA 3EB7A 1LEMA 1MPXA 1RUG3 2VXRA 5F5CA 2GNTA 3OCPA 3KV6A 2V72A 4Y20A 4AEKA 2XGXA 3AYCA 3HT2A 4JGZA 2VTXA 1BBT2 4P9IA 3WNKA 1RVF2 4Y5TA 4S2GA 5FPVA 4CU6A 4DGHA 3ZSKA 2PELA 4XFGA 3GALA 2A6YA 1PMJX 3IPVA 3LDFA 4WBBA 4KG0A 3SQOA 1SZBA 2XOMA 2WFPA 3VHNA 3VDCA 4PLOA 4IW3A 2VW2A 4NR1A 4HPKB 1W8ZA 3WNNA 2E7QA 4YSFA 3ACGA 3TEWA 4BDVB 4L97A 3PVOA 1GP4A 1DQ5A 2ADEA 2ARBA 3KGZA 4OI1A 3DV8A 2R49A 3ZMNA 1HRV1 2VCCA 4YFZA 4YG6A 3C7EA 2RS53 4Y33A 2X5IC 4ES8A 4J25A 2WWJA 2Y26A 1YRZA 5DABA 4NIGA 3VDDA 4AAPA 2RJLA 1UOBA 2JDKA 2PN5A 2XBO1 5C5UA 5GZGA 3OGRA 4Y20B 2JKXA 1FC6A 2Z42A 4JRAA 4UWDA 3ZYJB 3LKLA 3CNAA 4JGZB 2BNMA 1JHNA 5BV6A 1W2NA 1HV0A 4MHRA 1A78A 4YNIA 3WCRA 3ZIWA 3ZYPA 5FBJA 1BBT1 1RVF1 3VHPA 3MPBA 1C57A 5FO7B 3IPVB 3RFRA 1WMEA 1AXYA 2EF6A 2W1UA 2YGLA 3T4HB 2ZEXA 1U0AA 3ZXNA 3Q8FA 1YHFA 1CD3G 2XH6A 5F2SA 5FZIA 3WQ1A 5IVJA 2LRPA 4BOWA 1HLCA 1ENRA 5GALA 3J7MA 5BY5A 5BPXA 5CG8A 4OHYA 3NNLA 2GN3A 3CJXA 2DVAA 3IM0A 4ZY9A 5GZCA 4RR3B 3N9PA 2WZ8A 2XJSA 4OUMA 3T09A 1K5MA 5LB6A 3HMYA 5C9AA 4XAAA 1C5HA 4GB32 3LQCA 3VDDB 4Q1PA 2AACA 4CDXC 4HONA 3I2HA 1VBC2 2WYSA 2B78A 3JB4C 3KV5A 2GC2A 3HEIA 4B1LA 3K75B 3OUHA 1MACA 2VW1A 2XR4A 4JDNA 4PDWC 4LO4B 2E51A 5JZGC 3O1MA 3RZMA 5FYHA 4AI0A 1NE4A 1COV1 5C4WA 4Q4V2 5JDBA 3GVLA 1W39A 1HIXA 1D0GA 4L2NA 1DYKA 2A3WA 1ZA7A 3HQRA 3ATGA 1DGLA 2VNRA 2XHNA 3GM8A 1ULDA 2DTWA 2KR2A 3OEBA 4QX2A 4Z2AA 2DBNA 2ZS6B 3R4UA 2DCYA 2ZKLA 4N43A 4NHMA 4AK3A 2ZACA 4OHXA 2Y6KA 3E6CC 4P9YA 2NPIA 1GOFA 1ENQA 4JZRA 3HNYM 5FPLA 2J1VA 4JTNA 1AR73 4C0BA 3O1VA 2YHJA 1W6NA 2XJUA 1F9KA 3CJIA 1SLTA 1NA1A 3O1OA 3VL8A 1YJLA 2WIIB 4CUBA 4HOOA 5LBCA 5CISA 1AF9A 3D3UA 1US3A 2NLRA 3O5SA 3P3NA 1DFQA 1O8SA 5JPNB 1VBA3 2OS2A 5C9AB 2CNAA 4XTPA 4GALA 1H0BA 3MZHA 1J3PA 1T2XA 1R1A3 4MGKE 5BYNA 4GB31 1O91A 3BKZA 1PVXA 2GC0A 5FRAA 4C8DA 2P1BA 1W90A 4NHXA 4LOTA 3ZIXA 2YU1A 4UW5A 4YW2A 1WLWA 1AR82 5C4WB 3LFMA 5LA2A 1YI9A 4LUKA 1QQP3 4GIQA 2WT1A 1TILB 3ENRA 4AE2A 4GH4C 4R9DA 5F9TA 1AJOA 1RINA 2D43A 1RUD2 1IOAA 2VMFA 3CQOA 3ST7A 3VBUC 4N9IA 1ALYA 4QQLA 4N43B 3K3OA 4P9XA 4BQXA 3APBA 2E9QA 1UWWA 3T0DA 1V00A 4H7LA 3NNFA 4K21A 1G9CA 4XXAA 3NV3A 4WVMB 4TTGA 4BJ0A 1S0BA 1W6NB 3I8TA 3USUA 4Q8LA 1ZBA3 2Y33A 4M0NA 3CJIB 2PXJA 2ADDA 4AVBA 1NA1B 3POEA 2VU9A 5EV7A 3CZUA 1GZTA 4AI9A 4JRLA 4AHZA 1X50A 4ZONA 3EYPA 1UX6A 4K40A 3RMYA 4DXSA 2Z5WA 2OUJA 1CPNA 3N9OA 2JDNA 1CAXB 3K3NA 4RHV2 2QQIA 3WUCA 5CNAA 1H4YA 4W6XA 2WBKA 4FPOB 1W05A 4IE7A 5EUWA 4L8QA 4XURA 2VVDA 2ZZJA 5JUVA 4ZXEA 3UKTA 4EYUA 4FSJA 1DZTA 1PO12 5JVVA 3IH8A 4MVTA 1AR81 1TE1B 4YGCA 5FY0A 3OBAA 5IVVA 2GNBA 3IHAA 2AYHA 4M4PA 1IQAA 2EVXA 2Y0IA 1AZDA 2W39A 3KWVA 1Z7S2 3K48A 1RUD1 1DGRA 1ZBE1 4L99A 1AX0A 4WZFA 3VBFA 4FXKB 2ETEA 3B94A 3IT8A 1C28A 3W5NA 4XTMA 4QTPA 2EA7A 4CPBD 3USUB 1OLRA 5I8TA 2ZGRA 2P3YA 2JG8C 4R8HA 2QZ3A 1A8DA 3LWCA 2R1DA 4XZUG 2V73A 1XNDA 3AP9A 5ABJA 5BNNA 4AOCA 4OFGA 5L7OA 1GV9A 3BOPA 2JDHA 2XPJA 3GZEA 3OOXA 4CSWA 3ACFA 1GICA 1GNZA 4RFT0 3TAYA 2Y0OA 2UURA 2Y6HA 4AL9A 2ZGNA 3UESA 1RUE3 3FBMA 4MOAA 3D8CA 4PI0A 2ARCA 4KBZA 5FZCA 2MNGA 2CWMA 5FK7A 4E2SA 2OX0A 1ENXA 3LSEA 3VBRC 2WSUA 1W6MA 2VQUA 3AYEA 1NZCA 4MHUA 3KGLA 1RXFA 1W8UA 3N7KA 4XUTA 3UGHA 1HQWA 1A34A 2VD7A 1HRI3 3KHCA 1I3HA 2VZSA 1GQPA 4OUEA 1HB4A 1YWKA 1PK6A 2BEOA 3FWEA 1VBB2 1VBE2 5JXJA 4JKLA 1ASJ2 1DGRN 2IUWA 4QX5A 4CUGA 3KVBA 1OVPA 2OPWA 5FYYA 3H0OA 3GDBA 5CFDC 4LTAA 2YBKA 1JYCA 5T5LA 5ABJB 4R9BA 1IS5A 5L7OB 1B35A 3C3VA 3PLQA 1C4RA 1D7PM 2A6XA 4Q0PA 2UU8A 2ZGOA 5T5PA 1UN1A 1CAWA 4D6SA 4QGNA 4EV0A 4J1XA 2JEMA 4ES9A 4NRPA 3JB8A 5HCFA 3KV4A 4B4QA 5FZHA 2ZGTA 2ZHLA 4CDQC 5FIXA 1XBFA 2PLV3 2GSYA 1W6MB 2HWF3 3VHRA 4IEVA 3VBHB 1O3TA 3ZSLA 2TUNA 4NUBA 5FZGA 4DNYA 4X8NA 1S2EA 3WF0A 4R4ZA 2E63A 2GH8A 2QUOA 3KV9A 3SISA 2X09A 5F32A 1PK6B 5DAQA 4D6RA 4CU7A 3RZLA 2VBPA 1AVBA 1CPMA 3SCGA 4MLOA 4AQSA 1VBB1 2VQTA 1RJ7A 3U14A 5J3UA 2CYFA 5I0TA 2W3JA 2I74A 1ASJ1 3BU7A 3ES1A 4RD7A 3THDA 4YW6A 2J1RA 4Q29A 3ZFFC 4EZ4A 5IVEA 3EMRA 1GZCA 1UW8A 5APAA 4QXKA 5A1AA 1CAWB 1MS8A 1T6GC 2QQJA 1HN1A 2JIGA 1QIQA 3LDRA 1E5RA 1K5MC 2FCVA 3ZN6A 4LLOA 4AQ2A 4XF3A 1BK1A 1LGBA 2IZWA 2PAKA 2RS33 4YFWA 1VMJA 4A6SA 1I6XA 1IS4A 4HKOA 5EXOA 3BCWA 5LASA 4B1MA 2K46A 4Y1XA 2YPJA 1JOPA 3NAPA 3OUJA 4YG0A 3ROUA 5J1XA 1G9DA 3GVJA 3O0XA 2UWAA 3T3YA 5BUVA 3BB6A 2QQVA 3OPZA 4XMIA 1TME3 5EUUA 1UPSA 4OZOA 3T1LA 3VKMA 4A45A 1SPPA 2O1QA 2BPA2 5A7WA 4YGBA 2WO2A 4ITCA 4Q4X3 3KSCA 4MGYE 2QFEA 4QX7A 1UOGA 3MV01 2W52A 5KHGA 1VIWB 2ET1A 1ZREA 2BGPA 1C8M3 1FNYA 1RGSA 3BTYA 5CADA 2BBAA 4FFGA 4ORFA 2P3KA 5K8SA 1GWMA 3ASIA 4Q1RA 1GNYA 3GHFA 2QQOA 4WVVA 2LW8A 2AENA 1KD7A 2W08A 5E88A 2B42B 4LO8A 3FFQA 2ZX0A 4XABA 3KHBA 4GWJA 2ZX2A 3MLJA 1AXKA 5K9YA 2DBIA 1K5JA 4CP2A 1RUNA 1VAVA 2A6VA 2VE1A 4HIZA 5FZEA 3H8XA 2C6SA 5ACA3 3H9AA 5FY5A 4AGRA 1YQ5A 4YW1A 2VOWA 3B69A 4FOQA 4X8PA 1JYWA 1MEC2 2CU5A 5DG1A 1RUI3 4HKLA 4ZS2A 5FMDA 5FZ0A 4DO0A 1LENA 1IPJA 1R1A2 2W87A 4HANA 1SPPB 2OASA 5LY1A 4H14A 5FYCA 2X05A 5A7WB 2VVEA 2IFWA 2ZMLA 2VZTA 4I01A 1JH5A 1NCQA 2YC4A 4IEUA 2WN2A 5IK8A 2QCSB 4B7KA 2C26A 2QDNA 4UOJA 4Q26A 4DINB 2ZKNA 1LOBA 3NL1A 2YUEA 3OUIA 3AGEA 2W95A 2GN7A 1S4CA 4ZXKA 4BXSV 2ZXQA 3NJYA 5E89A 4Y4RA 4P5YA 1DF0A 3POBA 4K1YA 5IWFA 3VD7A 3M2MA 1TZOA 3S6PA 2A6WA 2W2IA 1MQTB 1SBDA 2WA3A 2Q8CA 4ASMB 4DQAA 4P9JA 3B9CA 1W3VA 3KCXA 3C7OA 4LKEA 1VRH3 5IAVA 1WMFA 2FQPA 3EH7A 1Z0HA 1AR71 1N47A 3NMBA 1QHDA 3OYWA 4XOGA 1GP6A 4MXVA 5FQ0A 4A2UA 2J1EA 1LOGA 2F17A 4WM7A 2A71A 2KLNA 1OHFA 4S2HA 3MIHA 1F4HA 2EXKA 1VBA1 2DURA 3M3EA 3PUSA 4NIIA 3G6JB 2JKBA 4DEQA 1J3QA 2BERA 4V2VA 2BJSA 1LULA 3ES4A 5F7UA 1R1A1 5LRSA 5F5IA 4KBBA 1AL23 1AR62 1NCQB 4DGFA 2HWC3 3PUIA 5DMYA 3VBFC 3E5UA 1JZ4A 3DPRC 1DDLA 3J9SA 3JXSA 3IDAA 4CCDA 2BUKA 3PIJA 1BQPA 2R32A 4CDWC 3DL3A 2CGOA 3UGGA 1UZZA 2BWAA 3W21A 5BNNC 3I54A 3RWNA 5ABJC 2NYYA 3UETA 2WZPP 3SXWA 1C1LA 4YM1A 3WG3A 5JXHA 1R1ZA 4LULA 2OYZA 2VR4A 2TNFA 1DQ1A 1HKDA 1XYOA 3UGFA 4XAEA 3OYWB 2PYTA 2WO1A 3ZKUA 5FQ0B 5DDJ2 2PQSA 2Q1ZB 4WM7B 1W2TA 4IE4A 2RRLA 1NAEA 4I0WB 1XJAA 1ULFA 1IKQA 1W3XA 4QKFA 2Q8DA 1FMD2 2A70A 4XUPA 3IMNA 1PX3A 3LZZA 2DU0A 1UX7A 5A3TA 1AR61 5FPUA 3WZ1A 1DZQA 5KXCA 4BU2A 3RG0A 2QQPA 2X5IA 2XVLA 4BIOA 2A75A 1S0EA 4Y5SA 5HCBA 3BN6A 1JTZX 4H2AA 4E8CA 3RZKA 1RB8G 4QXBA 2B45X 1OKQA 1GQHA 3JZVA 1UQXA 2CAUA 4XUQA 1DGWX 1IPKA 1B35C 3NKGA 2XJPA 3LF7A 4RGKA 3N35A 4LOSA 5EHDA 2QQUA 3W9AA 4YZ1A 3DORA 2XLGA 1QGLA 2VZVA 1XSQA 1W04A 3M70A 4HT1T 3PDQA 1X9PA 1Y9GA 4HXCA 4AFCA 4EN7B 3VDAA 1YC61 2QNKA 2IFRA 4GJYA 5DDJ1 1UAIA 2TEPA 1GU3A 3F2ZA 3EJKA 3VKOA 2CHHA 3J26N 5E8AA 3JD73 2JB4A 5M0TA 1AUYA 4FP2A 4MADA 3WHUA 3ZXFA 2Y6FA 2FDIA 3WQ7A 4Y1VA 4N53C 3SCFA 4E8DA 3M7AA 3AMHA 1RUE1 3AP4A 3RGBA 3I2IA 3SITA 1M4WA 3ZO0B 1TH8B 4AVAA 1YNAA 3D0JA 1DG6A 1JZ3A 1W2OA 3BALA 2HLEA 1J84A 1V6LA 4JV4A 3U78A 4I3PA 2X5IB 2ZEZA 2WQ4A 4AI8A 2CWWA 1U5XA 2E31A 5IFTA 2DCZA 4XQWA 1S0IA 4E4DX 1G9FA 1UYZA 1DYPA 3PMEA 1ZZ6A 4AXOA 1BJQA 1RTVA 3VBSC 4L8KA 3AKRA 1E5IA 3LSDA 5EPAA 3KQ4B 4DXTA 3Q8CA 1OKOA 2CAVA 4PDWA 5JZGA 1IQDC 2G19A 4PI2A 5DUUA 1SHWB 3TN93 2JDAA 4OI4A 3ILRA 2Y60A 3BIWE 3D3AA 1GKBA 2MEV2 4P5HA 4BWOA 2B39A 1GSLA 4ZKTB 2WO7A 2JICA 4Q27A 1ZRCA 5GLZA 3AJZA 1O6UA 1UZWA 1FYUA 5IVYA 5LEKA 1XNBA 2OUHA 3RI9A 1ZRDA 2GNDA 2VZ1A 5J96B 3LKJA 1NXD1 3OD4A 4YW7A 1AYN3 2X8KA 3T4VA 4FQZA 5B4NA 3UT0A 3U0ZA 1HF2A 1PZ7A 3AYDA 3NAPC 5EZBA 1WD4A 3U37A 2OT7A 5FZ9A 2YZ4A 3J4UH 4FT8A 4Y1YA 3THCA 4QXHA 5A7OA 2EIEA 5F5QA 4YARA 4D7SA 2PLV1 1RITA 4QX3A 1VRBA 2Q0AA 3KT1A 3POSA 4CU9A 4PBOA 5FAXA 5CEHA 1IS3A 4GMP1 2ZABA 5I0RA 2DVDA 4CDXB 3SKVA 1IHMA 1PO22 3N4MA 3I2GA 4JQTA 4HN0A 1JI6A 3E6BA 1Y9MA 3NNGA 4PDWB 5JZGB 4OI0A 1ODMA 1OQ1A 2EXJA 3IH9A 4TN7A 3MFCA 4PJYA 4Q4X2 4N9HA 3RZHA 4KGGA 4CP1A 2VMIA 3V65A 1QJU2 1LHOA 3FBYA 3FX3A 3VSEA 1H30A 3O0VA 4GH4A 3WUDA 1EUTA 1UYYA 1JZ2A 4JQRA 3VBUA 1OURA 2WA4A 1XSRA 2UWCA 3E6DA 1LKNA 5K7PA 2XXZA 1XU2A 1QJY3 1LTEA 5F6LB 4Z07A 1SMVA 3U07A 1JHJA 4K3UA 4MZUA 2WUHA 4BPZA 3AVRA 2VMDA 4YYOA 3WQ0A 4GKYA 2RS31 3HBZA 3DEMA 3WNPA 5ACA2 3IHBA 1W9FA 1DHKB 4RYDA 4MV2A 4NHKA 4IXLA 5FP9A 5A1LA 1CESA 3TNQA 4QGLA 3UK9A 1RUI2 3RI8A 4AFDA 5CBLA 5HXVA 3I2OA 3ACHA 4DUVA 5JSPA 1RHI3 2OXBA 1APNA 3AMQA 1HDKA 3N9QA 4LBMA 3POIA 3ZSMA 1QXRA 2G9FA 1VPHA 1BK0A 3AL5A 1HB2A 2XWBB 5SV5A 3LDKA 4CCCA 1EAH3 4Q4X1 2P5BA 4FPEA 4OMCA 4GH4B 2IVJA 2RDRA 2IXIA 1L7RA 2C5DA 4XUNA 3N7MA 3ZVXA 1V6OA 4C90A 5FZ1A 3VBUB 2Y34A 3T08A 1QF3A 1SCSA 4CCMA 4LO7A 4NVPA 4FTSA 4JAAA 1QJX3 2KM2A 1W0NA 2D6OX 3AMMA 3D0SA 3GZTB 3KLSA 1IPSA 1J1LA 4L1CA 2EIDA 4H7MA 3D4KA 4XXPA 2PTMA 4UAPA 2PHXA 2OKXA 1C8NA 1UPIA 4S2DA 2XLFA 4IDZA 4NOTA 2VVFA 2JG8A 3AGDA 1ACCA 1VRH2 1W2AX 1D4M3 4C1WA 1WCDJ 3VD9A 2YFZA 1HRV2 4GWIA 1S0GA 3ZXAC 1QNYA 4E4ZA 1U5YA 4PQ9A 5ACA1 3I2DA 3I3BA 3F43A 5FYVA 4OQ9A 3I49A 5GLWA 3J7LA 3PVBB 1OD3A 4CCKA 5JMCA 4CEYC 5FFOC 1RUI1 1W8WA 4YVSA 4U2AA 1OVSA 1POV0 1OUXA 2W1SA 2QQNA 3WLUA 3B00A 3BU0A 1H9PA 1N1VA 2JE8A 4XFCA 1BVP1 1RUJ3 2R043 1MZ5A 2EAKA 1C1FA 5C3PA 1JUIA 3HN3A 5T52A 3MF9A 5K0UA 3KCCA 2HBUA 2A7AA 2BQPA 3J8F3 4QU2A 1K32A 1SCRA 2V4VA 5CFDA 3ZFEC 2R073 2JG8B 5J48A 3LIHA 4HYLA 5DAXA 2VMGA 1VRH1 4CZSA 3AP7A 3O7OA 4AAXA 2XWJB 1XE8A 2YDEA 3MUZ1 4LKDA 1AYM3 3MLKA 2E26A 2E7TA 3LA2A 3BTAA 1WBFA 5JIUA 1VALA 5LEJA 4ATEA 4I30A 4CDQA 2VOTA 3VBRB 1FPN3 1UOJA 5CVRA 1Y43B 1HQNA 1AL21 2DVFA 5FZKA 3SKJE 4ATFA 1COV2 3N36A 4TWTA 3GZAA 3C7FA 4RA0A 4IERA 1DQ6A 5C7GA 3X29B 5D8AA 5IK5A 4UYBA 4MGIE 5IVCA 2QQKA 3AVSA 1XRUA 4XJ8A 2P34A 2UY9A 3CKHA 4AGVA 4EWDA 5IK7A 5IK4A 2AEYA 1Y9QA 2ZHMA 4COZA 1DBNA 5CFDB 5J09A 4LKFA 2HYXA 3VB9A 2UYAA 1NE6A 1MS1A 1DP0A 4GA9A 4NHYA 3ZFFA 3GVKA 3Q9OA 1NKGA 1XNKA 3TB0A 3PHMA 4M4RA 5AVPA 4N7UA 1QJFA 1H4HA 2FDJA 4QX1A 3HWJA 2BVVA 1DYOA 4AVCA 5A3WA 5GKAC 1W28A 1LOEA 1LU1A 4DOUA 2JJ6A 5A6XA 3WT3A 1MS4A 3N7JA 4CDQB 5BNOC 1UMIA 4YWAA 4QM8A 2XONA 2DF7A 4AEDC 4JC1A 1BUZA 2DFBA 2GALA 1EV12 5JIAA 5D21A 4HKWA 3WP5A 5DG2A 4DEVA 3VDBA 4LPLA 3O1TA 5E16A 1RL3A 1UY1A 3WG4A 2VL4A 2PHUA 3I3QA 3S7EA 5JI9A 1N6DA 1LAJA 5FZAA 1H1IA 2PHDA 4DIQA 2OA2A 1WXWA 1Q8SA 4QPIC 3K4AA 3M3CA 4OVEA 1WMDA 1BZWA 1MVEA 1YQ8A 4KWUA 4E4HA 4IEOA 5KXBA 4P9WA 5GJ6A 3ZFFB 2RMU3 1X33A 3THTA 5D2AA 1OH3A 1OSGA 3SNMA 2EICA 5D1IA 2FDFA 4M3CA 4PT6A 1N6FA 4LT5A 2OPKA 3R0RA 2V4AA 3WXPA 3I2KA 5KXEA 1PZ8A 3RWKX 2EIGA 4BHPA 1K5MB 2XJRA 2YXSA 1NOVA 3FFZA 1MVQA 2ZGLA 3WG1A 4PLNA 1KRIA 2E32A 5A32A 5FZ8A 3F95A 3HVDA 3INAA 1RUH2 5FBZA 1H8TC 1BXHA 4HSLA 5CAZA 3RMXA 2MHFA 1EV11 3LEIA 3PMSA 4A44A 3CL1A 2WDBA 5GZEA 3DCQA 5LY2A 1O5LA 5LW9A 2HJIA 2HWB3 2ARXA 2O8QA 4QXCA 4D7TA 5DPNA 5A33A 1ZBE2 2BU9A 1TNFA 4JTOA 4QPYA 1AJKA 3ZKYA 1ULCA 3D82A 5FPXA 1OLMA 2FMDA 1T6RA 3W58A 3VKFC 1CN1A 2WINB
chains in the Genus database with same CATH topology
1V6NA 2WFF3 1ZA4A 3WR0A 4CDUC 4META 1TMF3 3ZXKA 2E53A 1MS3A 2FBEA 1V9U2 2V09A 5HCAA 1BEV2 3AMPA 1AR93 3U11A 4DMIA 5A32B 4RS5C 2Z79A 4XETA 4XJZA 1GZWA 3QH6A 4XQDA 1J3RA 1QJY2 2ZGQA 4KGQA 2XKPA 2RS13 3FUQA 3B93A 2UWBA 3UL2A 2I07B 4IETA 1RUH1 4J1WA 2FHRA 2ZGSA 4G4FA 1HX6A 2LTNA 3VLBB 2A5ZA 1URXA 4A7KA 2ZHNA 3FE5A 4AFAA 5H9QA 4YLZA 4EWAA 2GAUA 4AQ6A 2VMHA 2R063 1RHI2 1ZZBA 1N6EA 3ALQA 3DPRA 1GNHA 3QACA 3POYA 3URFA 4KG8A 1NLSA 1QWRA 2YY1A 3OJBA 2WS93 2D5HA 1S2KA 2JXAA 4FCAA 3GHFA 4CDWA 1RUF3 4KU8A 5AFEA 5HBAA 3BODA 1VBD3 1V9U1 1BEV1 1GZWB 2HKXA 1SBEA 2KXLA 1N1SA 1QJY1 4EN6B 4UXAA 4X6QB 1BCXA 3ZXLA 4YVSC 1ZRRA 1W6QA 1RUOA 4E2QA 5LK7B 2DXNA 1X7NA 4BE3A 2NZ9A 3DF0A 3AK0A 1LRHA 5EYYA 5JSOA 1O3QA 2VUJA 5EFUA 1LHWA 5H9PA 1J1TA 2Q4SA 5K0UC 3VBFB 2D40A 5JR7B 3EQEA 3DPRB 2WQZC 2OW4A 1RHI1 2VULA 2VGDA 1V6MA 2K9ZA 4Z82A 1RUG2 3EBRA 1ZVFA 4CDWB 3AZYA 1WD3A 4QHBA 3WW2A 1SLIA 1EAH1 4JGYC 2PA7A 4YM0A 5BNNB 5CIRA 1KDKA 2ENRA 2XLAA 2D6MA 3VV1A 1XQNA 3WDWA 1RC6A 1QJX1 2VNGA 3FC0A 1VB4A 4CEWC 5JOWA 4BIFA 1R093 4Q4Y3 1W6QB 2NN8A 1DQ0A 5DUWA 2D3SA 5FLHA 1ND3A 2VOKA 4N90A 5LK5A 4PIYA 4B4RA 1AYM2 2RS52 4FPCA 5SV8A 4N53A 3NV1A 5D8AC 2WNEA 4LLFA 3HN1A 1TEIA 3ACLA 3ZX7A 4QM9A 1TNRA 4YW3A 2X29A 2WLQA 1RUG1 1SLLA 3AP5A 2VW0A 2XVKA 4Q4W3 2R041 1RUJ1 1YFUA 5DZFA 5T5OA 5CFCC 1ZRFA 1B35B 4KL1A 3QOPA 3VBSA 1LOAA 3AZXA 1FT9A 3NW4A 1MR5A 1C5IA 2VECA 1LESA 5KHIA 4PCRA 4XE9A 2HWE3 2R071 3H50A 4J6GA 3EHKA 1DGWA 1ND3B 5AVAA 4XFIA 4IQPA 3ZFGA 4CYDA 2QKDA 4PIXA 4XJWA 1Q5OA 1FNZA 2O0OA 4N53B 4HVOA 1AYM1 4TLFA 2RS51 1SBFA 1O7FA 4LUMA 1A8MA 4XJAA 3RRDA 1PMIA 1SFYA 4DPNA 1ONAA 1R083 2XG3A 1NQDA 5AFBA 1KDMA 1FX5A 1WCKA 2P17A 2VUAA 4DB5A 4DFSA 1RMU3 1LB2A 4SBVA 5JAXA 4ISRA 1YUDA 1ZNPA 5DZEA 1BPLA 1D4VB 3VBSB 5EYXA 1WW4A 1IS6A 1GANA 5I0SA 1O4ZA 3LA3A 3FHIB 1DU3D 1Q8OA 4AVVA 3AKSA 5JI7A 3ZN6B 3DN7A 2R30A 3B01A 2Y38A 1QXJA 4RQPC 4AHXA 2RMU2 3DKWA 1PVC3 1AR72 1X36A 4G3YC 1VAKA 2JECA 1SQ4A 4NHLA 4LR4A 3ECQA 2FZ1A 3NAPB 4B8EA 3AKPA 1VBA2 1YJKA 1FATA 3DUIA 4FQ4A 4MX3A 4XPVA 3HT1A 4GQ7A 4G9SB 4LE3A 3ME2A 4DRRA 1FV3A 4E9KA 3ZYGA 4EROA 2DCKA 2TBVA 1QQP2 3SH4A 1N3OA 1U5ZA 2B7YA 2D7FA 3H7YA 3L2HA 4FPFA 4A7ZA 4D94A 5T54A 1XNCA 2GC1A 2WNUC 1QNWA 1Z78A 1QY4A 1BKZA 4HVRA 3KCYA 1I5ZA 3HD8B 2RR13 5BNPC 4KU7A 2ZMNA 1ND2C 3NV2A 1UD1A 3H1MA 4AE2A 1KS5A 3ZN4A 2RMU1 2WFF2 2P37A 1ZBA2 3AP6A 2LM3A 1TMF2 3AFKA 2PHWA 4MYEA 2RM23 2Q30A 4S2FA 1ZZCA 2W68A 3ZN5A 5T3NA 2FZ2A 1FC9A 1DQ2A 4P14A 3IN9A 1O3RA 4B3NA 1UL9A 3E97A 3S30A 2PFWA 5KHKA 2ZX3A 4NPRA 3KT7A 2H6BA 2EALA 4CEYA 2QE3A 1RIRA 4UBHA 1QQP1 4KWKA 4XHBA 5A3LA 2HWB1 1PNFA 3RYKA 4MSVA 4NN0A 4E27A 3QD6A 2WSVA 3WW3A 1D0HA 1CAVA 1FV2A 4LBJA 1D2QA 4IV3A 2P3JA 4LEJA 2O8OA 4IL7A 1POV3 4W6YA 3PVEA 2WS92 4EN0A 4RSUA 1BVVA 5JCTA 2XBO3 4ONUA 2WFF1 3CU7A 1ZBA1 4WM8C 1CVNA 1CGPA 1TMF1 5FOBB 3PNAA 1VR3A 2A6ZA 2CL2A 4K9SA 4AHYA 4K1ZA 1QMJA 1CJPA 1BBT3 4XIKA 3ZFEA 1AR91 1CR7A 5I8SA 3WDXA 1RUE2 3H3UA 2RS11 1JYIA 2WL1A 3H1WA 2VY0A 4Y5Z0 2WWSA 3WDVA 3AX4A 3UV9A 2WZR3 1YI7A 4CEYB 1HRI2 3C2UA 2WLPA 1OA3A 1QDCA 2E7AA 5JPMB 5LRRA 3S0MA 3CLPA 5CA6A 1GQGA 2R061 4HFSA 1GLHA 2XVGA 2AR6A 3FJSA 4LHNA 1QOTA 1J7XA 4YVWC 1OD5A 2WS91 1FI2A 4LNVA 5DZGA 3ZXGA 2R6QA 1FC7A 2OZ6A 1J58A 4YM3A 1DIWA 2ZA9A 2D44A 4YGDA 3M3IA 3WDUA 1ND3C 4Z2WA 4QPGC 4HLTA 3UKVA 1N1YA 3ZFEB 1O3SA 3IWZA 1BMV1 3E5QA 4COVA 1CQ9A 5C8CC 3MDPA 2PAEA 1Q8VA 4XYXA 4PF5A 1OQEA 3MICA 1IKPA 1WUVA 1UZYA 1QU0A 4AF9A 3MW4A 2PLV2 3M1HA 1CAUA 2HWF2 1EPZA 3LA7A 1S55A 5DUXA 2DXLA 1YIFA 2D6NA 2N7GA 1HRI1 5FTTC 5BNOA 4QQPA 3ZPYA 4YRDA 1Q43A 3RZZA 1PGL2 4AEDA 1H1MA 4GWMA 4AEMA 2R16A 1GBGA 2EAAA 2B9UA 1AL0G 3V56A 2OZJA 1KFXL 1ZM1A 1VBC3 4Q4W2 1CIWA 3OF1A 1UMZA 2ZGKA 4I09A 3MPPG 4QPIA 4Y22A 3ZFGC 2AH2A 3VZJA 3D03A 4Q4V3 3WVJA 3ZMOA 1N1TA 2PHFA 1H1AA 4I0BA 1EYBA 1R091 1YO8A 1CAUB 4Q4Y1 2K2SA 2RS32 3TWIA 3U10A 2WNVA 2GDFA 1O4YA 2HWF1 3EO6A 1MS9A 2XKOA 2XUMA 3FMGA 2UYBA 2GH2A 2VH9A 1NLRA 3I59A 5BNOB 4AEDB 2QVSB 1H8TA 3MW3A 1TME2 1PGL1 4OZXA 3UJQA 1LODA 3RSJA 1M06G 3SH3A 1NQJA 3T1MA 2MPFA 3UKNA 4LBQD 3MW2A 1NXMA 3RDIA 4OLLA 1ZZ9A 4Q4W1 4QPIB 1C8M2 3KZ4C 4AGGA 1AR83 2WC2A 4FPLA 4KWLA 1V6IA 1LGNA 5FDBA 4CDUA 3KQRA 2ERFA 4FPGA 3W59A 5FREA 1PVC2 3SLIA 4C1XA 3EXUA 2PHRA 3AB0A 3I59B 3PVNA 4JDMA 4RS5A 3B02A 4HK8A 3WDTA 4XF0A 1XXNA 2DTYA 1H8TB 4JVAA 5EWSA 4IV1C 4C0HA 3NVCA 5KHJA 4FXGB 2CV6A 1TME1 5J37A 1VLNA 5JSRA 2ZHKA 3IKWA 1PNGA 4V1PA 1R081 1FXZA 1PM7A 4RHV3 1F31A 1RMU1 2BNOA 3ZSJA 3GYDA 2NMNA 1C8M1 3CF6E 1PO13 3A0KA 4XFHA 4UW3A 1U12A 3D6EA 2CY6A 2RR12 3VZKA 4YZ3A 4CDUB 4FO9A 3H8UA 1Q8QA 1Z7S3 3MFAA 1N3QA 3KM5A 3M8LA 1PVC1 2XL9A 3B3QE 4XZPA 1QH6A 3THPA 4RS5B 2RM22 2R1BA 4PLMA 4P9GA 3AJYA 3VGIA 1XU1A 2SBAA 4BM8A 3WNXA 1HW5A 4KQ7A 1AL22 3DJAA 2HWC2 2C0ZA 2ZOAA 1OOPC 4LBLA 4IV3C 4E4SA 3WD5A 3NV4A 4YGEA 4WVZA 1LU2A 2ZGUA 4LE4A 2YC0A 2WJSA 1NYWA 1REEA 4Y4YA 2RR11 1DZRA 4QD2A 5C33A 4JGYA 4R52A 1VBE3 3V0BA 4FPJA 1ASJ3 4BLIA 3ZXJA 4A3XA 2RM21 4TZDA 1FOD3 3VZNA 4CEWA 1WBLA 4YVSB 5FLJA 1W0PA 5C6CA 3ILNA 1VP6A 4B29A 4BA6A 2JG9C 4YW4A 5AC93 4EN8B 2HWC1 2WZR2 3O14A 4JC0A 1UKGA 4ZU4A 2OIIA 3H7JA 5K0UB 3ZYIB 1XYNA 2AREA 4IEPA 4COYA 1NCRC 4RR3A 4XFFA 3OBRA 2BVBA 1Y3TA 4Z92B 2ZO9B 4AVSA 2XHKA 1Y7BA 4JGYB 1WLDA 2KA3A 1POV1 5GLVA 2IC1A 2D6LX 5CFCA 3V0BB 1F8VA 1QOOA 1MZEA 1S0FA 1AXZA 5FLIA 5J7MA 2C1FA 2DV9A 3RJ2X 4Q0UA 3V64A 3JD72 4CEWB 2D6PA 2SLIA 4NO4A 2HYKA 3IIAA 2D3RA 4D3WA 4CTEA 2JE7A 4FPHA 1O5UA 2AUYA 3GF6A 3WP6A 4LO5B 1Q3EA 4ZU7A 4FOYA 1U5IA 2WZR1 4COWA 5D8AB 1SACA 2RE9A 4I02A 4HBNA 3VBOC 2ZOEB 4UW6A 2QZ2A 4LBQA 1UIKA 4F8AA 2ET7A 4OHWA 1LOFC 2HEYF 4QQOA 4FVVA 5EJ3A 3TN92 3GMFA 1SLBA 5B2GB 1LJ7A 3R05A 2VQAA 5CFCB 3LOBA 4PBPA 3TNPB 2ZMKA 4Q0SA 1ZZ7A 1W6PA 1OQDA 2GC3A 2ZZQA 1AYN2 2WNVC 4QMAA 3VHOA 1NG0A 1UU5A 2DVGA 4FAGA 3JD71 4RQPA 1XYPA 1L3JA 3WP3A 4N7IA 2AGSA 4KWJA 4O9EA 3OY8A 1C3HA 2H0VA 4DZGA 5GZDA 4GULA 4XF4A 4X6RB 3PTYA 2B46X 4I3GA 3GBFA 3ILFA 4M3CF 5FMOS 2NMOA 4UW4A 4WVMA 4FTEA 5CG9A 2VPVA 1YIPA 5L36A 3QCWA 5J36A 4LBQB 1EP0A 3FUOA 3WV6A 4MGZE 1GR3A 1MEC3 3KB5A 1WCSA 2F6BA 2B8MA 3TN91 1SDWA 1OA4A 1V6JA 1CAXA 5FPZA 1VBC1 1W2UA 1W6PB 2WNUA 4LO6B 1WLCA 4FOVA 4RGGA 1LHNA 1PGW2 5GLTA 5BNPA 4W6WA 5FMOL 5KWRA 1AYN1 4RQPB 1ND2A 1PIV3 4Q4V1 3CEWA 4NWWA 3NJZA 4I0AA 5KXDA 3OY8B 4SLIA 4AFBA 2H0BA 4XILA 4Q8KA 3NWKA 2P3IA 4M3CB 2D6KA 4JCKA 1YXWA 1EY2A 2BWCA 4YZ4A 5A33B 3HR9A 1W0OA 4KH9A 2IXCA 2JDZA 5BNQA 4CRQA 1G6NA 5FOJB 2XJVA 3MIBA 1EAH2 1YFWA 2DYCA 4FP3A 2DU1A 4M3CE 1AR63 1REDA 2QJVA 2WNUB 3WCSA 4W65A 1LR5A 2ZTNA 3ETQA 3VZOA 3OBTA 5BNPB 1B09A 1QJX2 1ND2B 1WA4A 1JBCA 1PGW1 3POWA 3WY6A 3AYAA 3L9JT 2BBVA 4BLJA 1MS0A 4XJUA 4WM8A 1VJ2A 1KITA 2GU9A 5GLUA 5HI0A 1D4M2 3JU9A 1S2BA 4XW3A 5DXDA 3TYJA 3MOGA 1UU4A 1LGCA 1OFSA 1REFA 2F4PA 4DXZA 3LCPA 4FTBA 5DDJ3 5FO8B 4DY5A 1AX2A 5CU1A 3G7DA 1FMD3 1LHVA 2WT0A 4HETA 3KMHA 5F6KA 1J59A 3IDCB 2R042 1RUJ2 3D5OA 4RHV1 1OMIA 1CONA 4IEXA 1HV1A 3WOGA 3JBG3 4LA2A 3O0WA 3VBHA 3WW4A 1RUC3 1ULGA 1A3KA 1PO11 2BGCA 2BYVE 1QDOA 3GNEA 3J8F2 5H9SA 1F2NA 4JGZC 3RYRA 3VKLA 3ZO0B 4YVWA 4Z8BA 2LUWA 2R072 3WDYA 4WM8B 4IEWA 4PIZA 1H9WA 1Z7S1 4LBNA 4OHVA 4WZCA 3ZSEA 4XF1A 1D4M1 1QKQA 2AZ5A 4QPGA 1YFXA 4K7JA 1FOD2 4F7ZA 5DUVA 4A7YA 5C8CA 4K20A 3DGTA 1IGOA 2JX9A 4OULA 2D97A 4EN9B 5KBFA 1FPN2 3CO2A 3B9IA 4RR3C 5AC92 3AFGA 3SMHA 2HWD3 1FCFA 3H1YA 2EXHA 3VDDC 2PHLA 1XE7A 4K8FA 1QH7A 3U4XA 4GMP3 4Y24A 2YROA 1F5FA 3OTFA 2ATFA 4LBOA 4YVWB 1HXS3 3J8F1 3SCHA 4XIOA 4MH0E 5T55A 4Z1VA 1KXGA 4R9AA 2ZX4A 1ZX5A 1VBE1 4QPGB 1PHMA 2A3XA 4URTA 1YLLA 1UIJA 4BMEA 4GKXA 2MEV3 4AYUA 2DUQA 5C8CB 4GHNA 1KQRA 1FOD1 1TQ5A 4OI2A 4YW5A 3VUOA 3MIGA 3R4SA 4K6BA 4QT6A 1FPN1 2PQQA 5E1RA 5AC91 4BYYA 5C9AC 3N3HA 2ZGMA 1SFNA 3WP4A 4COUA 1F5JA 3JCIA 3VZLA 4Q0QA 3V0AA 2ZBJA 1WLTA 2IXHA 1O4TA 1LHUA 1ULEA 1UF2C 2P2KA 5C4WC 4H55A 4ISQA 4OHZA 1PO23 1UKRA 1PGSA 3GBGA 3JQXA 3AZZA 3GHMA 4INDA 1MZFA 3ZFGB 3O12A 4N43C 1CJDA 4DRVA 5JOZA 4OUSA 1KS4A 1QJU3 4RGAA 1DQ4A 3FZ3A 2VNOA 4M00A 3CJIC 5A3MA 1H2KA 4H3WA 1NA1C 4R4XA 3R6SA 2E6VA 2ZAAA 2GMMA 3IDEA 4AWDA 4BMBA 4XJ9A 1MQTA 4L9BA 3MI8A 4RL7A 4FBFA 1H2NA 4XFAA 4IV1A 3I7DA 2HWB2 3V0AB 1H8VA 2RJKA 1GYKA 4XFBA 1HQLA 4D69A 3AKTA 1IZ3A 2IXLA 4UBGA 2IXKA 2Z69A 3FLTA 1LOCA 2JD4A 2CTVA 3SH5A 1YFYA 2BW8A 5CB7A 2RHPA 1D2SA 2PHTA 4JDOA 3MIDA 4XHXA 1AR92 2Q8OA 1PIV2 2W0XA 5GM0A 1G9AA 4XMAA 4B7EA 2RS12 4XF9A 5EZWA 1OI6A 4XBLA 3ZYRA 5H9RA 3QLQA 4AW7A 5I93A 4HZFA 5J98B 3K50A 2WKKA 4IV1B 1AHSA 4L92A 3VKNA 3RJRA 4FPKA 3MIFA 2HEVF 2GMEA 1KJRA 4GXLA 1X8MA 1HRV3 4EWEA 2I2SA 4IEZA 2R062 1ZZ8A 3OD0A 1Q56A 2R0HA 1OOPA 2YMZA 5L73A 1MEC1 3AMNA 3WW1A 4ASLA 1RUF2 3WHTA 5KC6A 4HSJA 4YG3A 1VBD2 3FLRA 4E2GA 3T2TA 4O9GA 5KHHA 3A0NA 3QBQA 3LGRA 1BMV2 1Q8PA 4BH9A 2BTVC 1RVF3 3AXDA 1OLQA 4D7YA 2UY8A 4CP0A 1PIV1 1VB2A 3VL9A 3RNSA 4HL0A 4Q2FA 4LHKA 5L7OC 2XL7A 4FPYA 4AQTA 1X82A 3AZVA 3S7IA 5C8WA 1S1AA 3GBWA 5FO9B 2ZAHA 1ENSA 5I0UA 2B5HA 4IEYA 1ZYBA 1H2MA 2NP0A 4B4PA 4QQ2A 1WGPA 3JUUA 4DY3A 2CWSA 2JG9A 4P9LA 4HMZA 1CAVB 1OOPB 4IV3B 3VBHC 1LEDA 3PJYA 1KFUL 4HK9A 3MIEA 2QDRA 1S0JA 3HAGA 3LOIA 1PK6C 2ILMA 1YYNA 1RUF1 2ES3A 3MLLA 2ZGPA 1NCRA 1G86A 2Q1MA 5JOXA 3JBG2 1COV3 1N3PA 1VBD1 4LA3A 1RUC2 4AEJA 2D5FA 3NKTA 5BXXA 1JW6A 3AXEA 4GWNA 4ZU5A 1R092 2LALA 3AKQA 4Q4Y2 1S0CA 4YZ2A 3M3OA 2DCJA 2VOXA 3OGJA 1DLLA 4XDQA 4BZ4A 4GMP0 4HVQA 3RQ0A 3E5XA 4QQHA 2Z2SB 2JG9B 3RS6A 4M01A 2Q5TA 2V5YA 2C9AA 3P3PA 1SLCA 2BFUS 2XJQA 2D98A 2CGPA 2XJTA 2JE9A 2HWD2 4GB33 1FMD1 1G9BA 2IXJA 2GZWA 3VBOA 3AM2A 3H3ZA 1EV13 1NCRB 4MUVA 3KD4A 2DUPA 1QJZA 3LAGA 2VG9A 3DUPA 1LOFA 3JBG1 3ELNA 1A6CA 1RUC1 2VQ0A 3MYXA 2OVUA 1OPMA 2DVBA 2X53S 1HXS2 4XBQA 4CDXA 4F83A 2DFCA 4WVWA 3VN4A 2HWE2 2G9GA 3SHRA 4Y1ZA 3GHNA 4XBNA 4L11A 1G8WA 1VAMA 4WV8A 4F3JA 2BFUL 1WW6A 3K51A 1AX1A 1LECA 3LB9A 4R9CA 5JOYA 1CX4A 1QXPA 3TOJA 1JN2P 1RJ8A 3GZUC 2JENA 4M0HA 4XQ4A 1JUHA 3AZWA 3KS7A 1I9RA 5I8YA 1W6OA 2D93A 4AHWA 4FOWA 1R082 2YV8A 4BQ1A 2HWD1 3ZDSA 2A3YA 3HIFA 3VBOB 1RUH3 1RMU2 1V6KA 3MF6A 3WX5A 1LCLA 1QOSA 2NQYA 3MGUA 4Y26A 1GFF2 3B7MA 4AG4A 4FAHA 2YYOA 4Y22B 1JXNA 1WW7A 3TRSB 3KT4A 3N7LA 4AVTA 4LBKA 3M4FA 3VZMA 5KC5A 2H6CA 1HXS1 1RUD3 1ZBE3 4IEQA 2ZCWA 2HWE1 4I2OA 5IT6A 4BCUA 2WNVB 3USSA 1MS5A 2GMPA 3OGGA 5T5JA 2DWRA 3FLPA 2ZJCA 1MQTC 2MEV1 1V9U3 4NWVA 4MXWA 4HN1A 1BEV3 1NY72 4YZ5A 2YGMA 1W6OB 1X8EA 4KNCA 3MEPA 4C91A 1UU6A 1OA2A 1H4GA 2D3PA 3RYPA 5JWPA 1EPWA 1H2LA 1JOJA 4AFMA 4AI3A 1E57A 2BNNA 5JLVA 1V70A 1NCQC 1PZ9A 1OFNA 2DCTA 3R4DB 4AI1A 3WG2A 2GNMA 3NSTA 4TSVA 1I1EA 4IESA 3BOWA 4QGMA 4U36A 3RPQA 2EXIA 3IDBB 4EJRA 1MZ6A 5I91A 1GZ9A 1PO21 3B5LB 4Y1UA 2I45A 2ZPXA 1S0DA 1WW5A 3TBDA 4LHLA 1KJLA 4AI2A 3WINE 3BPZA 1UCXA 2PAMA 2XB6C 4XEZA 1QJU1 2FMYA 2G4IA 4MXWB 4DS0A 1FAYA 2HEWF 2A73B 2DUOA 4Q0VA 3JQWA 5FCCA 1NY71 3NO8A 4TYSA 4WM7C 1SLAA 1YCIA 3A4UA 2NM1A 2R0FA 4YM2A 5GZFA 3HQXA 4HPKA 3ZXEA 2ZX1A 1OPOA 2VOVA 2WT2A 3QH7A 5L19A 2IWGB 1BYHA 1SEFA 3UJOA 2K0GA 3L2YA 3I4IA 5IUQA 5TSWA 2CGNA 5F1RA 3PJQA 1G7YA 1VBB3 2XBO2 3IBMA 5T50A 3M3QA 3VBRA 1LEMA 1RUG3 2VXRA 2GNTA 3OCPA 4Y20A 4AEKA 2XGXA 3AYCA 3HT2A 4JGZA 4P9IA 1BBT2 1RVF2 4S2GA 3ZSKA 2PELA 4XFGA 3GALA 2A6YA 3IPVA 4WBBA 4KG0A 2WFPA 3VHNA 4PLOA 2VW2A 4NR1A 4HPKB 2E7QA 4YSFA 4L97A 3PVOA 4OI1A 1DQ5A 3KGZA 2ARBA 3DV8A 2R49A 3ZMNA 1HRV1 4YFZA 4YG6A 2RS53 2X5IC 4ES8A 2Y26A 1YRZA 3VDDA 2RJLA 2PN5A 2XBO1 5GZGA 4Y20B 1FC6A 2Z42A 4JRAA 3ZYJB 3CNAA 4JGZB 2BNMA 1JHNA 5BV6A 1HV0A 4YNIA 1A78A 3WCRA 3ZIWA 3ZYPA 1BBT1 1RVF1 3VHPA 3MPBA 1C57A 5FO7B 3IPVB 1WMEA 1AXYA 2EF6A 2YGLA 1U0AA 1YHFA 1CD3G 2XH6A 3WQ1A 4BOWA 1HLCA 1ENRA 5GALA 5BY5A 5BPXA 5CG8A 4OHYA 2GN3A 3CJXA 2DVAA 3IM0A 5GZCA 4RR3B 2XJSA 4OUMA 1K5MA 3HMYA 5C9AA 1C5HA 4GB32 3VDDB 4Q1PA 4CDXC 1VBC2 3JB4C 2GC2A 1MACA 2VW1A 4JDNA 4PDWC 4LO4B 2E51A 5JZGC 4AI0A 1NE4A 1COV1 5C4WA 4Q4V2 5JDBA 1W39A 1HIXA 1D0GA 4L2NA 1DYKA 2A3WA 3ATGA 1DGLA 2VNRA 1ULDA 2DTWA 2ZS6B 3R4UA 2DCYA 2ZKLA 4N43A 4NHMA 4AK3A 2ZACA 4OHXA 3E6CC 4P9YA 2NPIA 4C0BA 1ENQA 4JTNA 1AR73 2YHJA 1W6NA 2XJUA 1F9KA 3CJIA 1SLTA 1NA1A 3VL8A 1YJLA 2WIIB 1AF9A 2NLRA 3O5SA 3P3NA 1DFQA 5JPNB 1VBA3 5C9AB 2CNAA 4XTPA 4GALA 1H0BA 3MZHA 1J3PA 5BYNA 1R1A3 4MGKE 4GB31 1O91A 1PVXA 2GC0A 5FRAA 3ZIXA 4YW2A 4UW5A 1WLWA 1AR82 5C4WB 1YI9A 4LUKA 1QQP3 4GIQA 2WT1A 3ENRA 4GH4C 4R9DA 1AJOA 1RINA 2D43A 1RUD2 1IOAA 3ST7A 3ZXDA 3VBUC 4N9IA 1ALYA 4QQLA 4N43B 4P9XA 3APBA 2E9QA 1V00A 4H7LA 4K21A 1G9CA 4XXAA 3NV3A 4WVMB 1S0BA 1W6NB 3I8TA 3USUA 4Q8LA 1ZBA3 4M0NA 3CJIB 4AVBA 1NA1B 2VU9A 5EV7A 4JRLA 4AHZA 1X50A 1UX6A 4K40A 3RMYA 2Z5WA 2OUJA 1CPNA 1CAXB 4RHV2 3WUCA 5CNAA 4W6XA 4FPOB 4L8QA 2VVDA 2ZZJA 3UKTA 4FSJA 1DZTA 1PO12 5JVVA 4MVTA 1AR81 1TE1B 4YGCA 2GNBA 2AYHA 1IQAA 2EVXA 2Y0IA 1AZDA 2W39A 1Z7S2 3K48A 1RUD1 1DGRA 1ZBE1 4L99A 1AX0A 4WZFA 3VBFA 4FXKB 2ETEA 3B94A 3IT8A 1C28A 4XTMA 2EA7A 3USUB 1OLRA 5I8TA 2ZGRA 2JG8C 4R8HA 2QZ3A 1A8DA 3LWCA 2R1DA 5BNNA 2V73A 1XNDA 3AP9A 5ABJA 5L7OA 4OFGA 1GV9A 3BOPA 2XPJA 1GICA 1GNZA 4RFT0 3TAYA 2Y0OA 2UURA 2ZGNA 1RUE3 3FBMA 3D8CA 2MNGA 2CWMA 4E2SA 1ENXA 3LSEA 3VBRC 2WSUA 1W6MA 3AYEA 1NZCA 3KGLA 3N7KA 1HQWA 1HRI3 1I3HA 1YWKA 1PK6A 2BEOA 3FWEA 1VBB2 1VBE2 1ASJ2 1DGRN 4QX5A 3H0OA 5CFDC 4LTAA 1JYCA 5T5LA 5ABJB 4R9BA 1IS5A 5L7OB 1B35A 3C3VA 3PLQA 1C4RA 2A6XA 4Q0PA