4AE5A

Structure of a major regulator of staphylococcal pathogenesis
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
159
Chain Sequence
MKKLYTSYGTYGFLHQIKINNPTHQLFQFSASDTSVIFEETDGETVLKSPSIYEVIKEIGEFSEHHFYCAIFIPSTEDHAYQLEKKLISVDDNFRNFGGFKSYRLLRPAKGTTYKIYFGFADRHAYEDFKQSDAFNDHFSKDALSHYFSYFERYLYPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Signal Transduction Protein Trap (Target of Rnaiii-Activating Protein).
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords SIGNAL TRANSDUCTION PROTEIN TRAP
total genus 48
structure length 159
sequence length 166
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-01-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3430 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ae5A00
3FEZA 4KIAA 4JOUA 3FJ2A 4OZ5A 4AE5A 4FVCA 3TVZA
chains in the Genus database with same CATH superfamily
5KFKA 1OQ6A 1FJCA 2HS3A 2R2TA 2V50A 2FLLA 3EICA 2ADBA 4FYYB 1KLMB 4LR8A 2DNPA 2R9LA 2YH0A 2XCAA 3KTQA 3ZZYA 4LVOP 2Z0GA 4N8NA 1FWKA 1NBEB 2DBBA 2DGVA 3BGRA 3EGVA 4NLPA 3UNYA 1TFWA 4W90B 4R8UB 1Q4RA 4CLTA 3AH6A 5L1KA 1NEEA 2KJVA 4OYBA 4NOHA 4WIIA 3CCES 4A8FA 3QPIA 2J6SA 1TMMA 2CJBA 1X9MA 4FVMA 4DS5A 3KLHB 4F4AA 3CCUS 2FZGB 2JL9A 2XS5A 5KT3A 2AEJA 3TQEA 4ZJQA 1NB7A 4J90A 3M8WA 1B4SA 3RYLA 2BE9B 2P9CA 4PQAA 4GC6A 5EN1A 4NLXA 3O6QA 1IBKF 3B8HA 3U1NA 2JFKA 3F56A 5FLXU 3DM2A 2XY5A 3LA0A 4FF4A 2IM2A 3TWZA 1EQ0A 2FJDB 1HNXF 3MMJA 3G82A 3RBZA 4EGLA 4X4PA 2VHGA 4AQYJ 3CIZA 4O4GA 2K1RB 3M4XA 2MY8A 3AAWB 4DR2F 2OGUA 2DNOA 2NLWA 1XBWA 2VDIA 2CQ0A 3TR5A 1MN7A 5A0YB 3PX0A 4ZIVA 1MMDA 5IZHA 1RUSA 2ZHOA 3NGUA 4X62F 1S6PB 2J0SD 4UOCA 3JYTB 2F8HA 2V8VA 2IRUA 3TAMA 3Q0AA 4J9RA 2UU9J 1VQSA 1B99A 3FCWA 4OYZA 3M2UB 4LBIA 4RNMA 1HNZF 2HEKA 2L9NA 4G65A 1FX2A 4RW9B 5KFRA 1C0UB 1HR0F 2QLJB 4TVAB 4WKRA 1T9VA 2YQ1A 5CXTA 2ATLA 4ILLA 3CF5Q 1Z1ZA 2ASYA 4K4TA 2GS8A 2BA9A 1CC7A 2ZM6J 3F41A 3BQ2A 2PD1A 2LQ8A 2FVSA 1X5PA 3NCRA 4Q45A 4FYXB 4ZS6A 3HT3A 3BQ0A 4K50A 3NS6A 5DS7A 1JKHB 3J7AN 2LXFA 4B3RF 1LWFB 3AQPA 2O67A 4OFZA 2M5YA 4M63A 4RWXA 4YR2A 2K7KA 1L5UA 2K2PA 3EMTA 1HNWF 1Q79A 4U67Q 2OJ3A 4RW6A 2V69A 4P2XA 3OVBA 3THVA 2ZBPA 1GTHA 1EB0A 2RAQA 4ZVGA 2FC8A 2ASDA 1KDNA 2AX0A 4BWJA 3DLHA 3ZTOA 4KT0C 2NUUG 4X4SA 5KFPA 2RB7A 4MIWA 4NEZA 4OX7A 4KQZA 1X9WA 4LFCJ 2O5DA 1DQ9A 3CCZA 4PWUA 4DV7F 1N36J 5KG3A 2FJEB 2PC6A 4OZNA 3ZNJ1 2Z2YB 5C42A 2VOPA 1AZSB 3JS9A 2VU5A 3GJSB 3MM7B 4USMA 3RZAA 4M5IA 4DR7F 1F9EB 2QZ8A 3G6VA 2YKMB 1YJ9S 4LF5F 1JIHA 2AJ2A 4F4WA 2DNQA 2CNKB 4WYWA 1S9FA 1EARA 2BANB 2FVRA 3IP0A 1LK7A 2B6AA 1SQGA 3PO5A 2NSBA 1URNA 3D1QA 1YHQS 4HL9A 4QWEA 2GIFA 4YUDA 2EK1A 5KFMA 4JI7J 1ZM3A 1F3VA 3AXMA 3OTEA 1H73A 1TUWA 4Y65A 3W8GA 1VFJA 5A8WA 2R7SA 4DJBA 2FJAB 1TU0B 2C3OA 2J0XA 3MOZA 3NEKA 2OKQA 3DCAA 5KG6A 1S79A 2I6WA 3ENWA 2E1AA 3QWPA 4NYOA 4PXDA 5BYQA 1CJVB 1T05A 2FHOB 4HTJA 4R25A 4A8YA 1JLBB 2KYXA 3QRRA 4I2QB 2ZH5A 1RT7A 2CDQA 1HBUB 1BQMB 2EG2A 1IWGA 5BR8F 1IKYB 4OHVA 4KBIA 1J27A 2XSJA 4U7UK 4P2MA 2W9CB 1DTQB 1WKKA 2BACA 2Q3PA 2GQCA 1YJVA 2UV8A 1FRXA 2V0NA 2KVQE 4ZLJA 5KT7A 1QD1A 4K5SA 1LWCB 2GGPA 2MQOA 3QRQA 4NXMF 3PDNA 3KJQB 2VD3A 3KLIB 4FYWB 9RUBA 2LQ5A 4WTYA 4DSEA 2WVCA 2OTLS 1UVJA 2AYGA 2GGPB 2CPFA 2VG7A 4LF9J 2VPWB 5KFUA 1D3WA 2A1BA 2QSWA 1D9FA 2L9DA 4I56A 5J1NA 2UVRA 3H59A 2VPXB 2I1RA 4O3OA 1OO0B 2JZ5A 2LXIA 2OLWA 1U4BA 3R27A 1YBAA 1T03B 3I32A 3K5OA 4QPXA 2ROEA 5CH7B 4ICLB 5C5JA 2HQFA 3H20A 3NWRA 1CJVA 1U02A 4PWDB 2AU0A 1VC6A 4QIFA 4USIA 3FSIA 3BDPA 2APOA 1H2VZ 5B0GA 1CSJA 2DVIA 1GQEA 1P8GA 1SJRA 2GC8A 3L7UA 3ILOA 1RU2A 1X4EA 2IPOB 5HVFA 5A8WB 3BBBA 1FKPA 1B0TA 2VICA 2FZKB 1FFWB 1ZAXA 2DPJA 2RNEA 3UN3A 3MECA 1XNRF 1X0PA 2DGSA 1F6TA 2B9YA 5SUHA 2ZD1A 5F0UA 2KT2A 2ILYA 2DEJA 2PSZA 1S6UA 2X3DA 4G1PA 2YKMA 2IFXA 3X3UA 1FO1A 3D5MA 3L09A 1RU1A 1VS3A 4UUXA 5J2PB 2ZH4A 1DZ5A 4PWDA 3PW2A 1N5VA 3BPDA 3CNQP 3WC0A 3G71S 3UD5A 1NJZA 3R2DJ 3CJ5A 1NH8A 4ZP9A 3S1TA 4ECWA 4DV6F 2YWKA 3DLGA 4NMXA 4M5HA 2HS4A 2HNYB 1QJHA 2OPSB 1TUVA 2IM0A 3HFVA 5FLXY 4ES3A 4DCOB 1S9EA 3J7ZT 3QGIA 4ZVRB 2UUAJ 2H1YA 5A8RA 3JQKA 2FZCB 5EDWA 4Y2KA 3BR9A 4DZ6A 5F8GA 5LMUJ 3SMZA 5EWGA 4JI4J 4YR3A 1KVJA 3A8KA 1DFDA 2KJWA 5KFSA 1QVGR 4OYMA 4RW6B 1PGZA 3CWJA 4DR5J 1T9YA 1U8WA 1R7IA 3FNNA 3FCVA 4RNHA 3V6DB 2J7KA 2R7OA 1N5YA 2D74B 3GZ7A 2W9CA 1RADB 1NDPA 2OPRA 3FKBA 1TL5A 4M5DA 1S49A 3CPWR 1S77D 2HBRB 1R31A 4L6V3 3QWUA 5DG7A 1HBUA 3VAFA 2E5HA 2WVEA 1RT7B 2XMTA 4ZPTR 3OXFA 1BQXA 4DCJB 3CTRA 3BSNA 4GMKA 3J80Y 1CEZA 5L46A 3D6TB 4ECXA 3TUJC 2UUAF 1T05B 1C0UA 4AE5A 4CI0B 2LKZA 4ID5A 2OFGX 2ZKUA 3C15B 3A3OB 3ETMA 4A47A 1FHTA 3TAMB 2ZBIA 4JOUA 4ZVOB 1GEHA 4FF1A 2PEBA 2V5HG 1S6PA 2BJDA 2RMLA 3HD2A 4H4OB 5B0FA 1FTCA 2HGMA 2PDAA 3I31A 4MH8A 3WZ0A 4ZLLA 5KAKA 2VL1A 5DM6Q 1SL0A 2XGPA 3N4WA 2PA3A 1TAQA 2LQJA 3DGVA 5GVQA 3LGNA 3RRKA 5EGYA 5KT4A 2ABYA 4F25A 1VK3A 3D3BJ 4HYKA 2CPHA 1D8YA 1RWOB 2L08A 1SCJB 2CQ1A 2UUTA 5LJ3Y 2F1FA 5E3CA 2VG6A 2MXYA 4ZPBA 3QIDA 1A9NB 3BKFA 4LFBJ 2CQBA 3BSCA 1FD2A 4J9QA 4KH1B 4OMFG 5D4PA 4M5MA 4U96A 2UXDF 1RJJA 3UN5A 4ZVEA 1UVIA 4KH0B 4ZIWA 3EPGA 5JVHQ 4LIWA 1P6TA 2WCXA 1M0SA 3BM7A 4FDFA 3KLEB 4F4ZA 2QJ3A 2ZH1A 2HK2A 3L3CA 1IM6A 2WOMB 3U1MA 1TK0A 4J37A 1NRKA 3D66A 4OHZA 3HHLB 3SQOP 2ZH7A 1U8SA 5AE3A 2F4FA 4OZ1A 3IM8A 2RHSB 5GMKa 3K58A 4FF3A 4C3LA 4Q0BB 1B0VA 2HAIA 1TK8A 4QIWD 3KOAA 3QT8A 3B78A 2HQIA 2O3DA 1WC6A 4UZCA 2R7VA 1QE1B 4Y3CA 5HMYA 4OYPA 4DFJA 1JB0C 1YIJS 3MOJB 3MXHP 4UOFA 1KWMA 1R8AA 1X0FA 5K8MA 3A13A 1KTVA 2QTWA 3UN2A 4F02A 4QIGA 1QSLA 2KH9A 4EK2A 3VAMA 2CDRB 4Z7YA 1GMUA 5C7PA 1T02A 4Z37A 2OO4A 2B7BB 3HI9A 4OX9F 2AYBA 2F9DA 1N6QA 4LF7J 2R8KA 4WCEQ 2KT5A 2OMOA 3FEXB 2BVZA 4RW9A 3V2UC 3Q24A 5ETRA 2Z56B 3HDSA 3M2UA 1U7LA 4RU9A 4R5PA 1ZS6A 2JC1A 3WHIA 4CYUB 2PEHA 1HLWA 2QMWA 2QX0A 4OYIA 2RKIB 2RQ4A 5C2CA 3GG1A 1HBMA 1WOSA 3IR5B 4DSFA 1ACMB 4B3SJ 5A0YA 5E7OB 3J7YU 2HHHF 1IXKA 1S1UB 1TL7A 4CLUA 3CEDA 1VRUA 2W2OP 3I6PA 3CDWA 2J0WA 1R8PA 2RIJA 2GQ2A 3M1VB 2KM8B 1U6BA 5K14A 1RABB 2FJXA 1GH8A 4LQ9A 2G1HA 2MLXA 1RLCL 3PHTA 4PZVA 5KFCA 4F4YA 5IT9U 1Q1KA 3NMAA 4NYZA 4G6VB 3GQCA 2IVFB 1HQUB 4DFMA 1JLGA 2AMCB 2X51A 3T1YJ 3NGDA 3BEGB 3DM2B 4CH1A 3R5GA 1M5PC 4PQUA 4USJC 1DHMA 2LYVA 3G4SS 4DXLA 2AD9A 1X31C 4KYZA 4ES2A 1CQNA 3THPA 3FQLA 1JXVA 5K14B 1AYEA 2ZH6A 4IH7A 4EU0A 4WP8A 4KPCA 2VQFF 3C2PA 2CZ4A 1SIZA 3BO3A 1VRUB 4K2JA 4B3MJ 1FXRA 1GXTA 3KLHA 4DV2F 3R1LA 1LK5A 2KRBA 2ILZA 3TJ9A 3D68A 4R0EA 4DQQA 1AW0A 2E66A 4NLRA 1L3SA 4NX9A 1W7WA 2POKA 5KG5A 4CO0A 2NREA 3HVTB 2HW3A 1VGYA 4CYUA 1M5HA 2MTLA 1KLMA 2N7YA 1XMOF 4DN9A 1NJWA 4Q7AA 4OX6A 1S0VA 3IS9B 3JSYA 2LXUA 4E2FB 3J81U 4DV2J 1U6ZA 2IBOA 3AA9A 5B09A 1X5OA 2X3GA 1CVJA 1I3OB 1AFIA 2HQ3A 2V2KA 4GVBA 4ZKAA 1WSVA 4I2PA 3PEJA 1X9SA 3CCMS 4ETXA 5LSRA 4I6AA 4OZ5A 4ECTA 3QIPB 5CYJA 2R7WA 3QO9A 2OPQA 2ZM6F 1S99A 1QE1A 4X66F 3PW5A 2AJ0A 2BDPA 2DR5A 1NK7A 5F8NA 3BO4A 2FPHX 1U09A 2JWNA 4OZ2A 4QOTA 3PR4A 3KYLA 2QGFB 4AT1B 4KSEB 3KUHA 2FTRA 4Q0BA 4DX7A 1RWKB 3DRPB 3LUYA 5K5MA 5J2MA 4K8RA 1D9AA 4FKYA 5A8KB 8ATCB 4OI6A 2RF2B 5LT5A 3R5JB 4CLPA 1GFWB 4PXEA 4JV5F 1O0PA 1S7IA 3PHEA 2W7AA 3FEYB 5HANA 4X62J 1RTJB 1FF2A 2EKNA 2QYGA 3T41A 3US5A 4LF2A 4NA3A 4CTAA 4L76A 1RKJA 5B0DA 3SSSA 1FT8A 3TNVA 4Q8EA 2PMZD 3TEHB 5BYRA 5KT2A 2ZHAA 4DV6J 1U47A 4MJKA 5HK4A 3S01A 4LUBA 2GO8A 4K4VA 2PN6A 3HSZA 2KG0A 1SQFA 2YNIB 3SI8A 2BX6A 2FJWA 2YPYA 4LF7F 2UXCF 3O1LA 1DTTB 3W2VA 3LALA 2PI4A 2LLZA 3WC2A 2VG6B 4L3NA 3AHPA 3D28A 3ZZRA 2AJQA 3JTNA 1VLYA 1HW8A 4DV4J 4DR4F 5DG8A 4DV5F 2WVDA 3FEZA 1RT3B 2CWKA 3CXCR 1KS2A 1N0VC 4N77A 4QPTA 2AV5A 2AWZA 2ZC3A 3W2WA 2NCKL 3GFZA 4H4OA 3MR2A 3JB9k 2C22A 2QA2A 1RK8A 1NHUA 2ZOGA 2DHHA 3A8IA 5F8HA 5KFNA 2A18A 2QA4G 2XMVA 1RT5B 1HWJA 4DPXA 2IRXA 4GC7A 1Q86T 3D4JA 4A46A 4ID5B 5D8HB 4LIRA 4N56A 1YZ7A 3SQGB 1NHVA 3D0GE 4ZP8A 3CJSA 4A8XA 3ENVA 4YB5A 4QWCA 3R9LA 2G0JA 3HVWA 3C46A 4IR1A 1J2VA 4GO7X 4ZA1A 1RYSA 3I87A 5KTQA 1F5AA 1VK8A 2XLJA 1KN6A 1ZOTA 3T19A 3J80U 3HSDA 2GX8A 1GTEA 2QV6A 4RBUA 4KGXB 4URQU 1FCAA 2OPRB 1X4CA 2NXEA 5KFWA 1UVLA 1N5YB 2D9PA 4O3QA 2DCLA 1FA0A 3UW1A 4K4XA 4EYIB 4B9NA 2JVRA 1LOUA 1H7WA 2HZAA 2Q1LA 2DNNA 1NMEB 2M8HA 4Y34A 2HHTA 4CO5A 2IY5B 3FFIA 5AT1B 1FDNA 3VAGA 3IR7B 3N5BA 5LL6d 3TA0A 1NM2A 3ZZUA 4EMDA 2CXEA 2WB4A 4ANCA 3M9MB 2AGOA 1M1KT 4DQIA 2KXNB 4DMZA 3QSYB 1CULA 2IC3B 2QIFA 2YX7A 2AF6A 4DCPB 2G2YA 1PO6A 5B0EA 4C8OA 2CPDA 5HI7A 2HNYA 2OPSA 1HFEL 2OPPA 2V68A 3DLGB 4USHA 3H2UB 3F73A 3I5CA 4ECRA 3M32A 3OL9A 1HD0A 2CA9A 2WBMA 3AOAA 4E0DA 3OR1A 4HHUA 1T9XA 1U0HB 4M1KA 4MMOA 4ERDA 3FRYA 5F8JA 5J2PA 4WXOA 4K0KJ 1R89A 4DL3A 1FJ7A 4Z7CA 1VOMA 3MMBA 4X4UA 4XDDA 1T3OA 2R8IA 4IFYB 3BGOP 1JLQA 2D3O1 1S48A 4P75A 1OYEA 1RSCA 2CPJA 1I94F 1QUPA 4ZLPA 3CCSS 5A76A 2YWFA 1OYDA 3BKUA 2IM3A 3LQVA 3Q8UA 2XG8A 2XC9A 2ZZNA 3QATA 1Z4UA 2BKNA 3FCHA 4BC9A 3IG1A 4P2FA 3M9OB 1H0HB 3DOMA 5E3QA 2GMJA 5I3UB 3MR6A 4OZLA 4WP9A 4NI2B 1WF2A 2UXBJ 4PG6A 4RZRA 3K8WA 2C42A 2MJUA 2P9GA 1KOOA 4JI0J 3M8YA 1I94J 5J1PA 1F9HA 1RAFB 1BQNA 2B51A 2WZ1A 4GRSA 4JP8A 5F0WA 2I38A 3VAIA 4J9LA 3T5LA 2DR6A 1T03A 3FC9A 1ZTWA 1U1MA 1RTHA 5K9FA 4YS2A 1NKEA 1PAUB 5HAOA 3RJMB 2GZOA 2BRKA 3MPWA 1N5QA 3CO0P 5CYMB 1WTBA 1JK9B 2R7RA 4NLYA 1WI6A 1QSYA 5LXYA 2WHOA 4YR0A 4DSIA 4YHHJ 4P72A 3MDFA 4Q8FA 2X1GA 4HI2A 3SCLE 1NSQA 4DL4A 4C3KA 5ETKA 3DDNA 5T7LB 1MNEA 3AT1B 2IAJB 2XSJB 4ECQA 3MI7X 4FF2A 4GKJJ 2NYHA 2MQMA 1IKYA 5CABA 1LXJA 3QT5A 2Z2ZA 4DR5F 1BQMA 1NKBA 2V8GA 3B6BA 3IBCB 4ZVHA 2M9KA 3W1YC 3CUNA 2LDIA 4I2QA 4JV0A 2XMKA 5LSLA 1PYSB 4S0MA 4WXWA 3EVWA 3L95X 3D3CJ 2VC1A 1DJ0A 1X5SA 2BKPA 3Q89A 4MIBA 3MAQA 5G0RA 3RB0A 2ZZMA 3MUMP 3R1HA 3AB4B 3NY0A 5KG1A 4N47A 1BUXA 2U2FA 3OTDA 2ZJRQ 4DV1J 2HNZB 4C2MA 3KK3B 2ZOMA 2GNKA 1X4BA 3HK2A 4K2XA 1U1PA 1U2CA 3ZTPA 4LQ3A 2C3UA 4NCAA 1XR5A 4ED1A 1GMVA 3J7YI 2Y1RI 2B6AB 3MFHA 1HI8A 2BANA 2LQBA 3NAHA 3M6VA 4CLLA 5L1JA 2R7XA 4DWIA 2KFNA 4ZHRB 4K59A 1N48A 3MM7A 4F0MA 1JXLA 1SKRA 4M5LA 1H72C 3IRXA 3UR0A 2EFVA 2E5IA 5B0BA 4B9MA 4YB6A 3G8TA 4F4XA 2HVIA 2WONA 4RO0A 1B3TA 4OI2A 3ILLA 1C4CA 4XIUA 3LOUA 4FZVA 3QNWB 3KDNA 4UQGA 6FDRA 1YX2A 3GV5B 2QYCA 1F2HA 2XM3A 2J9CA 1H3DA 1KTQA 2KXFA 3CMAS 3ITHB 2AGPA 3ETOA 1RAGB 2E29A 2YXLA 2UUCF 3ZNUA 3HCXA 2ZDPA 5HP1B 1KHVA 1LEOA 4AUKA 1HHTP 4WF9Q 2NSCA 4CT8A 2GJIA 2ZEJA 3IWXA 2HBYB 1SUQA 2ROPA 3C6TA 4P52A 1TKDA 4JV5J 3CMES 3TVZA 3KG1A 2BJ1A 4ZDNA 5HQ8A 1JKHA 3FBFA 4NEYA 2D69A 2CJQA 3OXGA 1IKXA 1TAUA 2PE8A 2EFQA 3AJ2A 3QT6A 1ZETA 2GIQA 3ZFVA 3UVJA 2ZC4A 1R8BA 2GVDA 2LECA 1IUJA 1IBCB 3O5TB 3EDRB 4I7FB 4IFVB 3W5XA 2CG8A 1WEYA 1GAOA 5GAEU 1DAXA 3GJTB 1IWAA 1UZDA 2SXLA 1QAYA 2KVIA 2UV8G 1KOHA 4EUVA 5EWFA 4Q44A 2R4FA 1KFSA 4HT5A 2J7UA 5LMUF 2EPIA 1CQMA 1M5OC 3HSJA 1ZM9A 2W01A 4AL6A 5DLFA 4O3PA 5IWAJ 1SC6A 2BW7A 1WNEA 1HHQA 4AXIA 1FVSA 4YDDB 1DBDA 5DLGA 4ED3A 3PIOQ 2QL9B 2OTJS 4I6YA 3GYGA 5KFIA 3TA1A 3M8SA 2XBPA 1OJ4A 1WC5A 1REVB 1WD6A 3DFEA 5GAGU 3TANA 2K1RA 2MHEA 1KP6A 4Y28C 2KRRA 4JV2A 1PSDA 4ED8A 4FP9A 2W8KA 2DHGA 5IWAF 1FD8A 2A2DA 3D6MB 1J5EJ 4CCHA 5CQGA 1MROB 1GMWD 4PXCA 1R3NA 3ZTSA 3ZTQA 3JQJA 5C25B 5D3GB 3UFCX 3BBFA 1JWWA 5AE2A 3T1AA 1EETA 3WX8A 2BYCA 1IQTA 1IKWB 3MTJA 1V5VA 2D1CA 2HURA 1RT6B 4UUWA 3CCRS 1YBUA 3LP2B 3MPVA 4WJBA 4DPYA 4M94A 1FXDA 4DFKA 1RISA 2UUWA 4RLEA 3S7RA 2RQMA 1TTHB 4M5KA 4LF5J 1NAQA 2J9EA 1N34F 2JX2A 3EGNA 4LSLB 4DPTA 3KJVB 1NK8A 3HHEA 3KHRA 3DDIA 2Z58B 2KFZA 4MYUA 4UOHA 5AXKA 2M2BA 3UDCA 2N7CA 4RUBA 3CT9A 3F0NA 2GHWA 2P6TA 3L4BC 4C0OC 3R7BB 3BGRB 3NNAA 1SJ1A 3G87A 4GKKF 1A0OB 2CAJA 3FJ2A 3QZ8A 5HMZA 2A6OA 1MSWD 4LRAA 1S0MA 4P73A 1FRJA 3EWGA 5CYQA 5D0HA 3H7HB 5KFXA 2ZVSA 1RT1A 4ED2A 1M5SA 1NK6A 1IBMF 5J2NB 3AD9C 3I4PA 3G2XA 5D4LA 1RTIB 2DD8S 3R5CA 5IV3A 4KB7A 4K4ZA 1RT4A 1SI9A 3I0SB 4ZPWR 3FZ2A 3EPIA 4X64J 4J7CA 4WE1B 3W65A 1IKVB 1S72S 2UUBF 3WDOA 4ETZA 2ZITA 5CHCB 1R27B 2EFOA 5IV4A 3J81j 2HHWA 2HVZA 2IM1A 1S6QA 2HIYA 3MEGA 2F9JA 3DYAA 2YNGB 1T11A 2Q43A 1XMQF 3K8VA 2VG5A 5F3ZA 5BR8J 4YHHF 4RUCA 1OY6A 2PGCA 1AT1B 2OD4A 4UF4A 1SH2A 4O44A 4UZBA 1VBYA 2CQCA 4A8MP 4WZQA 3DGPA 4F8RA 5KFHA 3BO2A 1LFPA 1QM9A 4F0KA 1S5ZA 3QSIA 1EZZB 3CJ0A 3Q83A 4V19X 1VBZA 2HPUA 4A8KA 1MMNA 2B4PA 2OHDA 3D9BA 3M05A 3TJ8A 2VJUA 1NK0A 4LF4J 4KJIA 5KOXA 4K4SA 1ZAWA 3BBCA 2GV1A 3P5BP 4EFAC 3KLVA 2G1DA 2X1FA 3A3PB 3O2IA 1KD1T 1IR2A 4IG0A 4USWA 3D0IE 1UJ5A 4ZVUB 2DXFA 1UJ4A 2YKNA 1BY9A 3QLHA 1HNVA 4NLTA 3Q8PB 1JLFA 2DNKA 2LFVA 4PXBA 1LW2A 4NL5A 4MKAA 4G1QA 4YEAA 5FDLB 4EO8A 2IDEA 1L3KA 4CLZA 3V81A 1JLAB 1DRZA 3IGVA 3BDEA 2ZVIA 4NPOA 4FYVB 2HHXA 1VQYA 2AEFA 2ZE2B 4ILRA 1EP4A 2MQQA 3OUYA 2R7QA 2DPIA 4DR7J 1I5OB 3EJMA 2DEIA 4NCGB 5IC4B 1RWMB 1SV5A 3N6LA 2FYXA 1NNDA 2O1PA 2HKEA 4DL5A 1Y7PA 2DGXA 3K89A 4KO0A 4CLSA 5HMXA 3N01A 1VQ9S 3EGZA 5IT9Y 1JQGA 1TKTA 1BGXT 5KFQA 1J5OA 2MZJA 3MZIA 3QGPA 3K0JA 2CNOB 2HQGA 2F63A 3LWLA 2MGZB 2MKIA 4ER8A 2FQQB 2VBWA 5D78A 3TUZC 2GAGC 3E01B 3VAJA 3PY8A 3R3TA 5DDQC 1K9MT 5KFOA 4ED7A 2DXEA 4KHRA 2DH8A 3QJLA 3CJRA 3R6GB 2IJRA 2PO4A 4EYHB 4KE5A 4YY3F 1PBAA 1Y9OA 2K8GA 1F1BB 3C16A 3PJWA 4LR7A 2GJFA 1WG1A 2FJBB 4M8LA 4ALZA 1SJ3P 3W8PA 3P96A 2YTCA 2HBQB 3AOCA 3SIPB 4QIVA 2JSXA 1UTAA 3CSKA 3WIUA 1YBTA 3R2CJ 1KRPA 3DMJA 1D9DA 2Y8WA 3M30A 3M2VB 4MFBA 5E5NA 3UDVA 3CD6S 5D6GA 2HZCA 4LF1A 2RILA 3RAQA 1UWBA 2LMIA 2IHR1 4DLGA 2XSFA 4FXWA 2AW0A 1KR4A 4C8ZA 3G6XA 3SCIE 1RYRA 2WSFC 2HNDA 3GPAA 3KK2A 5H9EJ 1K0VA 4ZJLA 1PILA 1Y5LB 2EBGA 3B4MA 4URSA 4B9SA 3X1LB 1TL4A 1FE0A 3FZBA 3I96A 3KLGA 2A10A 4A8QA 1W26A 4Q2MA 2DIUA 3NKYA 2AJFE 2CJXB 5I42B 2XYHB 4J9MA 2XWYA 5GADI 2W2MP 4RR5A 1PG5B 3IRWP 3QT7A 1OPZA 2H48B 1DURA 3NGRA 2GVZB 4NA1A 3Q2SC 4OQJA 2XMMA 4LT6A 4ZJOA 4O4RA 4DL6A 1FX4A 4UOGA 2XS2A 5JJBA 1VIOA 5E0OA 1IBKJ 3RRHA 1JMTA 1RT2B 4Y2CA 3VVUA 1S4FA 4N7TA 4DBQA 4LF4F 4IRKA 1P9YA 4RBTA 4KKOA 2U1AA 4C11A 5B0AA 1C1BA 1FFSB 1Q5YA 2BJ7A 2QSFA 4NRTA 4PG8A 2I5JB 4J91A 2GFFA 1T7PA 4ELUA 1VRTA 4L3KA 2N4DA 4X65F 2CPYA 5K8PA 4MKBA 4CRJA 1RKIA 4WBFA 1PIEA 2K3KA 1WC0A 2NXJA 1I51B 1RZMA 3GCXP 3TEGA 2Y8YA 2QO3A 1WELA 1FRHA 3T6JA 2KFYA 1X4HA 1HBOB 1TL1B 1PCAA 1WI8A 3H2VE 2MMYA 3MM6A 3NOGA 4TY8B 1Q8IA 4TKTA 4JI0F 1K1SA 3OQ2A 2E7XA 1N34J 1RTDB 2B4OA 4B3MF 3M2RB 5IFMA 1Q81T 2VA2A 4B3TJ 5H9FK 2IBKA 1AXQA 1KKHA 1R6VA 1NDKA 1UW9A 2E1PA 2FGOA 1HNIA 3PRVA 3HVRA 5HLFA 4DR3J 2QRRA 5GAHI 3KMQA 1BC6A 2LCWA 5A6WA 1FDBA 5LJ5Y 1U1KA 3RBXA 2MDAA 5HBMA 3TYTA 3ZTRA 5IOLA 3JSMA 1T8EA 2NXNA 1XR7A 2WBRA 2H4WB 3PRBA 2MZQA 4NZ0A 4YMEA 3OJSA 3GIRA 2CQ4A 1T9UA 3KUGA 3G96A 4NMLA 1WSRA 2J0QD 2JEFA 3AXKA 4Y6IA 2DGQA 3IWLA 4ZOSA 1OPIA 2F8MA 3CVKA 4YY3J 1K8AT 1HPZA 1U26A 2CYYA 2EXUA 1CG2A 3KWMA 5KFZA 2HFVA 4JI6F 3I0RA 2LEPA 2RT3A 2B5JB 5KFJA 1HQEB 1LW0A 3DLKA 1FVQA 1TMJA 3HJVA 1F3FA 4NLWA 2EVZA 1T95A 4ZPCA 3CJKA 4DV3F 1SJFA 3GIJA 4M95A 1NPRA 1MG7A 5KFEA 5FJ4A 2AEMA 3NRBA 4DUTA 3OLAA 2ASLA 4KGVB 2KXHA 4RW8A 3OW2R 1SL2A 3RB6A 3I55S 2F4VF 2ZKTA 1NXIA 3EXCX 1XR6A 2CUYA 2EG1A 4TY9A 3W61A 5DGBA 5LMNF 1S0NA 2J6TA 1OSDA 4MTPA 2O01C 4ZVTB 2CPXA 4DU7A 3CCVS 2IA6A 2J6UA 5ETPA 1FRKA 2MQ8A 1TVRB 1VCTA 1CJTA 1UEKA 3RG6A 4F3MA 4FYDA 2W4CA 4J9SA 1Y11A 1YJUA 3RAXA 1O51A 1UFWA 3HO1A 1UP1A 3BJYA 3TO8A 3H2LA 4JI3J 3NNHA 3OV7A 2RQCA 3NCPA 1VQMS 5KT6A 3E2EA 3POTB 4ZVFA 2DH7A 1QY7A 4H4MB 3GCWP 4PABA 4DPWA 2EFNA 2QN6B 2FVQA 1O6XA 3MF5A 4B9LA 1AROP 1VQOS 4DV0F 1RHQB 3E8OA 3Q86A 4IDKB 1EKRA 1GMWA 3O44A 1M1GA 5HL7Q 2XMJA 1S1VA 3HMJG 2JLGA 5A6PA 1ZH5A 3LP0A 1BD6A 4NRUA 1IJFB 2Y9HA 3U1LA 3MAHA 3U7JA 2V8DA 3LPYA 3MM8A 4C6AA 4CO2A 3OVAA 3DLEA 2Q6CA 3HKZD 5D77A 3R97A 1MU2A 1JLEA 4QYRA 1UCNA 3FK4A 1EAYC 5J1EB 3GSDA 3MEEB 1PYOB 1X7VA 4PKDB 2RS2A 5KT5A 4M5JA 1JNRB 1UWAA 1VMBA 1R0AB 4DR6F 7AT1B 2Y1JA 3J81Y 2BXJA 2KTQA 1FI4A 2VA3A 4RW4B 4ZVSB 3RW6A 3GFHA 3T5KA 3RB4A 1ZM4A 2KI2A 1S1XA 4NLOA 4OLOA 3TARA 5AJ3J 4O23A 3SEOA 1CLFA 2E1CA 4F2RA 3WBZA 2OEJA 2BJ9A 1YZ6A 2DGWA 3MMAB 3SDEA 4RU2A 2CIMA 4BWMA 2EW9A 4U7CA 3P49B 1BE4A 3D1OA 1ZBTA 3V6JA 1FEHA 2CQGA 4DF4A 2WAQD 4BCAA 3MUVP 1KVIA 3K59A 2VASA 1WACA 2E1RA 4IG3A 5BXIA 4KFBB 4HACA 1YITS 5KG2A 2FB0A 3J7Z5 3KLFA 1UW4A 2C1EB 2CZVC 3D1HA 3P3DA 4V1Ak 4NXNF 1M1HA 1SJQA 3G8SA 5L1LA 1N52B 2PA8D 3S6EA 5D4OA 3W7BA 4WZMA 2CQIA 3R8YA 2XULA 3Q8YA 3AY0A 4KV8B 1ITPA 3CCWA 4V19J 2RHQB 2GQQA 5F9NA 3MWBA 5M2PA 1FKOA 1XWLA 3P4UB 2C2DA 3PIPQ 4PUOA 2CQ2A 4HTIA 3VGVA 5B08A 3CJ2A 3MAAB 2JVOA 3H42A 5C24B 1E6VB 5I4MA 2DK2A 1YI2S 1LWEB 2GO9A 3KK1A 2C2KB 2XEXA 2NZ4A 4BS2A 3KNAA 2NPIA 3DDKA 1NJIT 4PR6A 1R0BG 2HWIA 1X60A 4PG4A 4DL0C 5KG7A 1GT8A 3TZWA 3VZHA 4XPCA 1RWNB 2J76E 2B8PA 2YNFA 3MR5A 1PYTA 3NCQA 1U2FA 1ZA1B 5D15A 2HFUA 2GA7A 6AT1B 4ECZA 2LQ9A 4DHVA 4TN2A 3OR2A 1LQ9A 1RTZA 4DLEA 1MWYA 3OL8A 4HI1A 4R0JA 1H6KX 3R7NB 3IFEA 8AT1B 3OL7A 2Y1IA 2YKOA 2JEJA 3TUIC 3RGIA 4WIQA 3M8PA 3TOQA 4DQRA 4DUYJ 1S1WB 3Q8RB 2DYAA 2XO6A 4J9KA 1IBMJ 2ALYB 2ZH2A 2VF3A 2KB2A 3OXLA 2XYGB 3LH2S 3THTA 2V4JA 4LREA 3RR7A 4FBUA 2OEKA 1OSCA 3LP1A 2IJFA 3WX4A 1TKXB 3PFEA 1U0SA 5I3QA 3OR2B 5DQIA 1UA0A 2E5JA 5AXLA 1B70B 3BN7A 2MKHA 3ZZ0A 2P6SA 2X1BA 2EK6A 3GG0A 3CJ3A 3HLUA 5IXUA 5HROA 1E6YA 4EBDA 1C2PA 1YKWA 1U2RA 1JLCA 1WOPA 1U25A 2YWWA 2DHSA 3HKWA 4P10A 1S1TA 3F44A 1UA1A 2BABA 2YX4A 1GNKA 3R5BA 4WFBQ 1FJGF 4J9VA 4DR1J 1DLOB 2BE7D 3MD1A 3V4IB 2QLFB 5C24A 3OT9A 1NJXA 2KM8C 1FKOB 2V9KA 1VISA 4UY85 2PFDA 2EBEA 4Z2XA 2ATCB 5KFDA 3CJTA 2R3VA 5HJXA 5KFYA 1RQ0A 1NSAA 3TW0A 4DL2A 3C14A 2HHUA 3PO4A 3NBPA 1HBNA 1NDLA 1RHUB 4K4YA 3NMRA 2V94A 1HW9A 3OFFA 4HACB 1RGVA 1RWUA 4HLBA 3R5DA 3NGKA 1F5CA 1S4EA 3SZ2A 1BHNA 2HGNA 1AUSL 3ILIA 2OEMA 2YPZA 4AL5A 1JNZB 4ZVQB 4TQRA 2W9BB 4TLRA 1KSPA 2IMWP 5G4DA 2WVBA 3CO9A 3QJPA 4ID8A 2UXBF 2YY3A 3M8ZA 2FJVA 2JLFA 1TKZB 3CDEA 1EJ7L 3H8YA 3BH7B 4AL7A 2NUHA 4CH7A 4TU9A 2DGOA 4WFYA 1SVDA 3HZGA 4ZCLA 4ANDA 2E5GA 5AE1A 3PTWA 2MPUA 4RW4A 2F40A 2QA1A 3IA0A 1Q95G 1U1OA 3KG0A 1JJ2R 1VBKA 2H9ZA 3UO0A 4NXMJ 3J7A1 2QMUB 4QJVA 1FEEA 4AFFA 1CS4B 3H5YA 3N9UC 4IO9Q 1WDTA 1R0AA 2CJKA 3DLLQ 1QVFR 3CCLS 1R8CA 3K2YA 3DI6A 2EKYA 4IR9A 5EHHA 3K17A 4OJ1A 3DLEB 3I4HX 3OFEA 4C9DA 4ZCKA 1XIQA 3VAKA 2D3UA 1UVKA 2RS8A 4RWWA 1HYSA 4LRDA 3H5XA 3KDOA 1WTFA 2QC3A 3A3NB 3LP0B 3FBBA 2L41A 1UFKA 1G6BA 1S1VB 4I1TA 2HMIA 2L3MA 2RDJA 4JV1A 1FXLA 4RJVA 1A7GE 2HG4A 4OYOA 2H5IB 3TA2A 2C3MA 4C8MA 1S59A 5GMDA 3D54A 2XNQA 1ULRA 2H54B 1FJEB 4LSNB 3ZZZA 3BPSP 2DCUB 3T1HF 3ET6A 2MB0B 4QWDA 3POTA 4I69A 4OX9J 3FVYA 3ZC4A 1SQEA 2GHVC 4RUAA 4KRWA 4WKYA 1NB2A 4A8OA 1NK9A 2RVJA 2RU9A 1XTZA 1KLNA 1FTRA 4QR0A 5EX3A 2DNYA 2M70A 1TL3B 2EWHA 1UZHA 2MZTA 3NXZA 3M7VA 5T41A 5J2QB 3C6UB 1Y5NB 5HJYA 1FNMA 4CO3A 1NSPA 1X4FA 1VHFA 2F8EX 1TV6A 3PYGA 3RUBL 4DQPA 2JOQA 4LF6F 4ZPAA 4C48A 1Q8LA 3Q2TC 3VHQA 1CJKA 3Q8VA 4RW7A 3IGNA 3CJKB 5GAHU 1C0TB 3L9ZA 1RLDA 1LW0B 3UI3A 1RP5A 2RRBA 5C2GA 1M5KC 2KHCA 3CB4A 4MAKA 1XERA 3I0RB 1R43A 1VIXA 1RBAA 3MMCA 2H3EB 4NASA 1A6LA 2YNHA 5B0CA 2DT9A 4ECSA 1ELOA 1AUDA 4OLPA 2E1MC 2HBZB 1VLOA 2XHCA 4HDHA 2MQLA 5DZ7A 2JEIA 4F50A 4LRFA 1FRIA 4C7QA 1RI7A 3EVOA 1HI1A 4XPEA 2GHPA 4JYAF 3N5FA 5DG9A 1RA7A 4C4WA 3PW4A 1SXLA 1U1NA 1D8ZA 2MYFA 3NLCA 3AOBA 5IM0A 5IM0B 2FVPA 4ATNA 1Z2ZA 2RRNA 4WTOB 1EKSA 5HBMB 1ZZFA 3T5HA 2DR7A 4XAKA 4N41A 3MM5B 3ISZA 5HLFB 4X4VA 1HKAA 1WDDA 4JI2F 4DQSA 2W2PP 2ZJQQ 3BV8A 3BF4A 4MK8A 4QR2A 4C98A 2Q6BA 1H2TZ 2QG9B 5L8RC 5DDRC 1HI0P 3HP6A 4XK8C 1Y0HA 4F0HA 5LXRA 1RTDA 2R7TA 4QBUA 2R8JA 5KG0A 3MEDA 4G1IA 4O3RA 1O8BA 4PCQA 2HFNA 4W98A 3JTOA 4B02A 4OYXA 3EVMA 1C0TA 4J5OA 1T9WA 3BYRA 1S9GB 1WEXA 3RW7A 3PW7A 3KJNB 1S97A 4W4MA 2VONA 1TV6B 2JH3A 1VQ4S 2N4CA 1C1BB 1YVFA 2ALZA 4C11B 1Z2LA 3DRSB 1K0TA 2C3YA 3C6UA 4MKVA 1BXNA 4CLKA 2LU2A 3NGTA 4O3NA 3M9NB 1TL3A 2QFIA 4DR3F 3DRSA 3CJ4A 2G4BA 4ZN3A 3M6WA 1HMVB 1SC4B 3FSXA 3D67A 4TQSA 3PKYA 3UD3P 3TQ1A 4XO0A 1MWZA 1N5TA 3EYZA 4CQ1A 3HHLC 2CPIA 2QMXA 2XTJP 3V4MA 4KR0B 3IAM9 4RUHA 3TJAA 4DSKA 3CE8A 4PEOA 3MCOA 5FIIA 3H5SA 4LFCF 2Y3YA 1LV5A 1HNZJ 2HFZA 2KO1A 3NL0A 4KHMA 1FKAF 2MQNA 2W2NP 1IR1A 3JTPA 1CJUB 7FDRA 2LU1A 3MM9A 3PYFA 1T0TV 4U8YA 1JJ4A 3EUNA 5ADZA 4N76A 1VC5A 3FMWA 1QAXA 1WKLA 3U02A 3HZEA 3BREA 2DNMA 4L73A 1OIAA 2HVEA 5D0GA 4ED0A 3VGUA 2W7OA 4MYTA 2P2CB 3HHLD 3LO3A 2R8GA 1RB0A 2M52A 1FNOA 4DG1B 4C8KA 5F8LA 4IRCA 2B3TB 4I6WA 3IO1A 1UPPA 3IC1A 3SCKE 4A4JA 1YDLA 3N79A 1VQ5S 4ECUA 1UJ6A 1FK9B 1NCLA 3T1YF 2KDOA 1G2EA 4KAIA 3VWSA 3W9JA 1U24A 2YNHB 3EM1A 2X1AA 3Q23A 4LF6J 3IAS9 3R6LB 5DGAA 3MUTP 1GXLA 3CDUA 1RE1B 4P74A 1T3NA 1TKZA 4NLSA 4QW8A 1LFWA 2BE2A 1WORA 2B4VA 3MGJA 3BGLA 4RW7B 1JX4A 1CJKB 4DFPA 2M8DB 1KQKA 3NWGA 2CPEA 4K7QA 1Q82T 2QL5B 4ZP6A 2MHNA 2J9DA 4BBYA 3SYZA 2RUGA 2JNJA 1P1LA 3SSRA 4OJ3A 3MPDA 5KG4A 5CA5A 2XCPA 5J2QA 4C0BA 2HRUA 2W8LA 2VQEF 1L3VA 4KO0B 3OD2A 3RR8A 3GR1A 3ULHA 3DRRA 3NBPB 1RAAB 1SV5B 2BR0A 1HNXJ 4WU2A 2IYIA 4NCGA 4P9SA 3H4BA 2HFSA 1YJNS 2B8QA 4JB8B 4KHPF 1OQ3A 3VGTA 1V3RA 1KQGB 2E9ZA 3ET6B 2UXCJ 1OWXA 4HVZA 2XQCA 2VC0A 4ZVPB 4G1QB 1J5EF 2BJ8A 1V6HA 2ZDOA 1JLFB 5HVHA 2RU3A 3W9IA 3QFHA 3EZOA 3ZXWA 4B9VA 1DLOA 3V4IA 2B9XA 2ZZTA 3M6XA 1L3TA 2XGQA 2I0XA 3QMQA 2UU9F 3FBEA 3CMQA 2IRYA 3GSIA 5T14A 2HMIB 1N32F 4PYDA 1JLCB 1HYSB 1ZPWX 3LTOA 4RNOA 1E6YB 1B64A 4RX6A 2R2RA 1WF1A 4WP3A 4CNYA 1EIYB 2MKKA 3JAMY 4DUZF 4FKXA 2V4QA 2DNGA 2VFVA 3ONQA 5L9NA 3M8RA 3FQKA 3ILJA 4UT4A 2V2ZA 2V4JB 1NZAA 2B43A 3DOKB 4OJHA 2WB1D 3PW0A 1W2IA 1S12A 3UR3C 2ZH8A 3TX8A 2E5LF 4CLWA 3H0PA 2YKPA 3RBEA 2PMWA 5RUBA 1GK8A 2B56A 3DNCA 3M8QB 4NLQA 4DEZA 2DO4A 1RAIB 1S1WA 1IKVA 3DOLA 3VV2B 5D0RA 3M8PB 2ZJPQ 1XEZA 1LWXA 5H9FJ 4X64F 3T3FA 4NXNJ 1RAJA 4ZCMA 3ISND 3GJRB 3MCMA 1VBXA 4LSZB 1UVNA 1WG5A 3ZZPA 2ZBRA 5CCLA 1RCXB 2VJVA 4B3TF 2W9BA 2FY1A 3HHKA 1VHIA 1VJWA 1WHWA 3O8WA 3GU0A 4DUZJ 1N0UA 1H2UX 3BKTA 2Y0SD 4M5NA 1VQPS 3TAPA 1Q7YT 1I6JA 2YBVA 1O5JA 2CRLA 3GMGA 3TZYA 4KIAA 4H4KC 4PPZA 4USVA 1HBNB 2YKQA 4H54A 3UD4P 1RDRA 1GX5A 2HVDA 1OY9A 2AJ1A 2ZWOA 3BN4A 1ZA2B 2IVMA 2B7CB 2RE1A 3VZIA 4QCLA 5AJ3F 1E6VA 3L7OA 3CC4S 3CCQS 2W1BA 3MAAA 1WJ9A 4RBVA 1H38A 4ED5A 3AQOA 2C3PA 2Z2LA 5IC6B 2PI5A 4ANEA 4CM0A 4NLGA 4G3IA 2QL7B 2GMLA 4ZN1A 4RNFA 2UVUA 3QBCA 5GMEA 3LP2A 1RXOB 2NXCA 2CJ9A 1UAWA 1TFYA 1N33J 2D3OR 3FDSA 1V3ZA 3B4DA 4CO4A 3KJFB 3QFWA 4X4OA 4DR1F 3HM9A 3KLFB 1SJ4P 5C25A 3ZZOA 1N8RT 3ELHA 1MN9A 4KFBA 4OV1A 5KFLA 5THWA 1QUVA 4GVLA 2W2QP 5HROB 1UEVA 1K1QA 2C2RA 1XNQJ 5IT4A 1FNXH 1REVA 3MTKA 1ZYQA 1XN9A 2DNRA 3LP1B 2YWGA 1M90T 3SDEB 2PIIA 1GX6A 3LF0A 4HH0A 4IKAA 4DSLA 1VC0A 4DN0A 3FSYA 3DOLB 4PAAA 3HJFA 4ZPDA 1PJ7A 3GB0A 3I82A 2M7SA 4E8UA 2DIVA 3M8QA 4OJGA 2XHWA 3IBFB 4X84A 3W63A 1PKUA 2ZOFA 5CCMA 2LP4A 4YQWA 3BGFA 4HT7A 2CVEA 3DLBA 4K5RA 3UCUP 1HWUA 3DOKA 4OV6A 4CM2A 5ETNA 1NPKA 2G2OA 5U47A 4IUFA 2NPFA 1VQLS 4P7TA 1QDUB 4O3SA 4IFVA 4I7FA 1AFJA 1QAIA 2GVDB 5J1EA 3BYPA 1MU2B 3OTOJ 2MSSA 5F3TA 3SSQA 2GMHA 4OL8A 4UW2A 3UWTA 5AXNA 3Q22A 2L9WA 1D1UA 2HHQA 2M0GB 4NWBA 3PJ9A 2ZNYA 1SUQB 4KY3A 2G9OA 3KK1B 1XJWB 2VH7A 3PEHA 2VODA 1LWEA 2I9SA 4MKYA 3EZ5A 5KFFA 2XO7A 1DARA 3G8QA 4J9OA 2AQ4A 3PKMA 5CAAA 4WYLA 1VRQC 3G6ES 1N88A 2D3ZA 4FBTA 5HSPA 3IMQJ 2YQ0A 2AHOB 4H4MA 4RL1A 2VFUA 3T6BA 1UL3A 3QQCD 4KV8A 3LW5C 2RDIA 5JVGQ 3PYEA 1U1QA 1S76D 2MQPA 4OI4A 1NSKL 3VVTA 1REGX 4UTGA 2NR0A 1M5VC 4USUA 4DV4F 4F4KA 3P8BB 1QTNB 2AYMA 2AKWB 2FHKA 3DRRB 3N28A 2RQKA 3TRGA 4NLUA 3KG4A 3OVSA 3CCTA 1BMQB 3UPFA 4IG3B 1U1RA 2JEGA 4MK7A 5DZ6A 5CD4A 4DF8A 5DETA 2D9OA 2YWEA 1SPBP 4QWBA 3OHAA 4CO1A 1CC8A 2GAHC 5HATA 4I64A 4DS4A 4NCBA 4IOAQ 4J9NA 1JJCB 1WG4A 4B9TA 2AX1A 1IVZA 3I9V9 4ZITA 4OYWA 3MMAA 2BE2B 3VAHA 5BYSA 2YKAA 1UETA 2DHXA 2FHJA 2CNNB 2Z2MA 3V5RA 5SZTA 2CVIA 3O3LA 4CDIA 2HK3A 4IH5A 1S1XB 1F2GA 2D41A 3G86A 5G0RB 4AXJA 4N5SA 1Q53A 8RUCA 1V3SA 3GIIA 5ETOA 3CGIA 5H9EK 3I9ZA 4JI3F 2V34A 1HPZB 2I8EA 3W9HA 1NZ8A 1FK9A 1Y3JA 4B3RJ 2F5GA 1KONA 4IYQA 5D4NA 1TK5A 3MHYA 9ATCB 4RNNA 1RBOB 4HR2A 2CKWA 1WOOA 3B82A 2BW2A 1BLUA 5DJBA 4U6PA 4KPYA 1JLEB 4DG1A 3GIMA 4F3QA 3C8YA 1NHKL 4EO6A 4QU7A 4QWAA 3FBCA 2P9EA 3PFOA 3T1HJ 3SFUA 4QW9A 1NDCA 4JYAJ 2OMLA 2AZ1A 2AGQA 1XC9A 2L48A 4O0NA 1ICEB 4DX6A 2CPZA 2YQ3A 3MPYA 3MM9B 3M2RA 5DO2A 1CJUA 4IDKA 5M2RA 2I2YA 4TY8A 2AP6A 3A12A 2PFFB 4IQMA 4X4TA 4JBCA 5E3AA 3CIMA 4X4NA 4FNIA 5KFGA 3OLBA 4P7VA 1KQFB 2QEXS 4Q2LA 2DH9A 2DGTA 3JSRA 2OSRA 4NYPA 3VF0B 1CJTB 1HMVA 2LDYA 3DXBA 4DV5J 2ZUAA 1TVRA 1PJ6A 2Z57B 4KKOB 1YTYA 4CLFA 1RHMB 2ZFHA 3LAMA 4F7VA 5F9LA 1SB6A 4EEYA 2CJAA 2W4PA 1RT2A 4D3HA 5IQ6A 3DOMB 2RD5C 5I3UA 2HHPA 2DR8A 1BWVA 2ZBQA 4NE9C 3RU0A 2K3IA 3IG1B 3OTBA 4NLDA 5LMNJ 4QU6A 3BS9A 1S9GA 1P27B 1UPMB 3TZXA 3W3SA 3K5NA 3NAIA 4I67A 2JJ4D 3CJQA 4WFAQ 3QZ7A 3HVAA 5IQQA 3DLKB 2DITA 2BOPA 2B5JA 3VGSA 3GYXB 3MEDB 3NS5A 5DQHA 3SXLA 1XMOJ 4KGMA 5I42A 2XWXA 1UFLA 1KC8T 4M5GA 4U95A 5BJRA 1TZ0A 3KLGB 1YRUA 1NK5A 3H90A 1F5BA 3NG8A 1D0EA 4X4RA 4OYAA 5A2QY 2W7PA 2A3JA 1SL1A 2HS0A 2HNDB 3OR1B 3MM5A 5ETLA 4D3GA 1SC1B 2MKJA 4F04B 1XK8A 4JI8F 1KHWA 3A1YG 4LBPA 1UWBB 2XMAA 3RTVA 5A2QU 1ZPVA 2EFPA 2CNLB 2J8SA 1L3UA 2DB1A 3D6HB 3M2VA 4MFBB 2OSQA 3PR5B 3DMJB 4DPOA 4FXDA 1HNIB 5ETTA 2G0CA 1XNRJ 3LANA 1ZTTA 1G1XA 5DRKA 2QE5A 1IQZA 3FFIB 3LWMA 1YSJA 2EI5A 4U9RA 3MMCB 4CWBA 2MZ1A 2OAUA 3IR6B 2W4DA 3C16B 1HIYA 3DU5A 3IXQA 1HQ2A 4A48A 1NPPA 3TAQA 2BJ3A 4OZ3A 4Y0FA 4JI6J 2XI3A 1TELA 5EUHA 1G4CA 3E01A 2BQRA 4B3SF 2I5JA 2FUG9 4B17A 3W66A 2M88A 2VKZG 2VPYB 2V67A 4PWWA 2R2UA 2NXUA 2ZWPA 4ENOA 1N56A 4C8LA 1HARA 2KU7A 3SQGA 3LPEA 3OTOF 2HZVA 4JI2J 1UVMA 4B3OA 3LAKA 3GIKA 2H5JB 1OY8A 1RT5A 3W5ZA 4ES1A 4CT9A 1UMJA 4IH6A 2VIHA 2JLEA 1B0PA 4Q43A 4ZP7A 3KHGA 4KC5A 1RHRB 2GVZA 4OZJA 4JI5J 2BM0A 2IMOA 1WEZA 2MKYA 3BZQA 3FRZA 1HL6A 4C97A 4X2BA 1WUUA 3V81B 4LSNA 1YGYA 1VJQA 2QLWA 4FPRA 3QYYA 2HHSA 2MLZA 4F2SA 3CULA 1FRLA 2K06A 2RRAA 2YKNB 3QLHB 3ZO7A 2VQEJ 2K7JA 1Y4ZB 4IG0B 1RAHB 3W2VB 1DTTA 2AT1B 3CDBA 3A8EA 2FC9A 1G7CB 4LRCA 4NLVA 3KNGA 3TZZA 5IT0A 3QJJA 3BQ1A 1FDDA 3KK2B 4PRFA 2H65B 3SFGA 3P6YC 3EZUA 2IIHA 5HQLA 4U7UD 1KFDA 3OJUA 1VYAA 4CTAB 3SV4A 2M3DA 3TVKA 3KXDA 3A8JA 1WHVA 2KHDA 3DI6B 2H4YB 3PJXA 3PYDA 3DHXA 2DXDA 5L39A 4ITSA 3GV7B 1V5IB 2G13A 5A8KA 1CS4A 4O0IA 1TUGB 2NQPA 1IBLJ 4FNHA 2VG5B 1X8DA 1WHYA 1X5TA 2CQPA 2W24A 3H98A 2ZH3A 3QGHA 1RAOA 1VQ6S 1P9QC 2FHMA 3MEKA 4KTQA 2V63A 1U49A 7FD1A 3E51A 3QO9B 1OMSA 2DGUA 2N3LA 1PJ5A 1RT4B 2FGCA 1X4GA 4J9UE 2ERRA 4DDFA 1WHXA 5MAOA 3H5UA 3UDEA 5ETQA 3Q8QB 1WC4A 3TVYA 3IS9A 4ZLNA 3BSOA 1J5OB 3CD7A 2MKCA 2O66A 5CYQB 4DX8H 4I0WA 3DN9A 3D0HE 2XY7A 2HLUA 3I5AA 2DR9A 1SH3A 3H4DA 1QLNA 3C66A 1PAEX 1IR0A 5L9XA 4YFUA 4BHQA 1VQNS 2R42A 3C14B 2HSEB 3KUEA 3VR1A 4BLGA 1EP4B 3IBWA 4AQYF 2WW4A 5KFAA 1KNZA 1XNQF 2VOOA 2ZNZA 1TR0A 5LM7E 3VTIA 3KJVA 3VQTA 2KG1A 1JLAA 2UXDJ 4LSLA 3HF5A 3GJQB 5ETMA 3UCGA 4EWTA 4PG7A 3GTYX 2XS7A 1FWPA 1HNVB 4L75A 2KN4A 1NO8A 1YJRA 3N0VA 3NP5A 3VCDA 1Y10A 2ADCA 2C2EA 1VQ8S 3P45B 2J7WA 1S1TB 4LMZA 1VQ7S 3L7PA 2HWHA 2ASJA 4PQUB 4OHYA 1MMLA 2MKSA 1JLGB 1MROA 1HQUA 3H40A 4F26A 1NU4A 1T94A 3JSBA 3N6MA 4QIEA 3PXGa 3T9ZA 3Q8SB 3VQSA 5HVGA 1PC4A 1T9TA 2A0FB 2XMWA 3OTCA 2N3OA 4DV1F 3D2WA 1R6YA 4GKKJ 4O44B 1YLXA 3M1VA 2F3JA 2OIHA 1TKXA 2DRAA 2CZ9A 2NS1B 4QQBA 1UKUA 1TL7B 5IS2A 4EZ6A 4ED6A 1FDAA 1HBMB 1GXUA 1HA1A 2YNGA 3DYAB 3DU6A 2YWHA 5GAGI 1WKJA 2UVWA 1C4AA 3HD1A 3EXYA 1SBRA 4QZVB 5H1SV 2WTFA 4ILMA 2H5EA 4R5PB 4HHHA 4WE1A 3WQPA 1KVKA 1JXEA 1URRA 3PX4A 2UVVA 3I0SA 1W25A 1FFGB 3EGWB 2BMBA 2DTJA 2H51B 1R0CB 4FVCA 3DHWC 2OP5A 4EBEA 2AJ4A 2COLA 3W60A 1K47A 4OIXA 1WF0A 3RRGA 4ZMMA 1Q78A 5J2NA 4LRBA 1RT1B 1S57A 2FHJD 4TXSA 2Y1LB 2YNFB 2G2ZA 4RKUC 3HHDA 2BV3A 3GWCA 5JXSA 1QSSA 3NNCA 2FIUA 2LA4A 5ITHA 2HIQA 1TQLA 4P2SA 2FLNA 3C6TB 4LR9A 2DY1A 3PX6A 1HR0J 4BDPA 3AJ1A 3OBIA 4UY8T 3D6FB 4OI0A 4TNOA 1YK9A 5ETSA 3MCNA 1N54B 3AD8C 3MCSA 4IOCQ 1Y00A 5HP1A 2E44A 4WU3A 1N32J 1SH0A 1D09B 1YG0A 3HHLA 4PUOB 1RA6A 3U27A 2VV5A 3FGVA 2DRBA 4F3OA 4LFAF 2NZCA 2WOMA 2KL8A 3KMSA 3IN5A 2BRLA 3UE2A 4DSJA 3LGMA 3BH6B 2PT0A 2XLIA 2E7VA 4YOEA 2WW8A 1K44A 1RT6A 2Y0BB 2BJEA 4ZPVR 1DY3A 5LOQA 1IKWA 4YB1P 3KLEA 2HFOA 2V9WA 3CD5A 2UP1A 1EETB 1FRMA 2WVFA 4GO5X 1R8HA 4P71A 5D3GA 2KZMA 3T5JA 4DUYF 3MFIA 2HWTA 1I1GA 2MLYA 4TYAA 1YRXA 2CFXA 4ZHRA 1NJYA 4DR4J 1UEUA 3HHNB 1JJHA 2DNLA 2GJ2A 3EE3A 3JXOA 4TU8A 4Y2IA 2NYIA 1SIWB 2OD6A 2OFHX 1RBLA 1XMBA 4JI1F 3CC7S 4LF8J 5K8OA 1BWEA 1HWIA 4IQXA 1Y3KA 2J5AA 3GP9A 6FD1A 3OSPA 2XZTB 4FXVA 1U1LA 1G3OA 3C19A 2DO0A 5F8MA 1HHSA 4HEA9 2VBZA 1S7HA 1YWXA 1U6FA 2RUSA 5GAEI 2XI2A 1LNQA 2D7SA 1RHKB 1PBUA 3C15A 4ZK7M 4WFNQ 3NOCA 4J9PA 1P1TA 5EX0A 3PCOB 2XZDB 1HNWJ 3AD7C 2V4RA 4YDXA 5ETVA 1APSA 3AFGA 4JI7F 3UCZP 3MEEA 3UNGC 3HFZB 3MPUB 3UVJB 4JI1J 4LF8F 5HN0A 2GW8A 2JFDA 3CD0A 2HAFA 1Y5IB 3P5TL 3DLJA 1IKXB 4N8OA 4M5DB 1WC1A 4JUZA 2YH1A 3TUPA 2R8HA 5T7LA 3MM8B 2BQ3A 3V6DA 1RWPB 5CD4H 3M6UA 5FD1A 3V6HA 2VBXA 4USKA 3ICLA 2XNRA 2Z30B 1RACB 4JI8J 5CZXA 1B7YB 1MW7A 3OFHA 2ZBCA 5HO4A 2M4MA 3ITHA 4MK9A 2DHAA 2VFSA 4QR1A 4DV7J 1N36F 3W62A 1U48A 2XYPB 1Q7LB 2Q79A 3KHHA 5CZVA 5A8RB 2V8HA 3G6YA 3ENQA 1S9EB 2XY6A 3HSGA 2MZSA 1EHWA 2LVWA 2MSTA 1F0XA 3OFGA 3UDLA 3TX0A 5E41A 4L74A 3DKDA 3R7SB 2R2SA 4QYZK 1NKCA 2CWXA 2WONB 4I68A 2P5VA 3CW2C 3HX9A 5F41A 4DR2J 3AJDA 1BQNB 3IRXB 3PZPA 2DY9A 1AB8A 2ACYA 5JMNA 1H98A 4C3MA 4DU8A 4FS1A 2LA6A 2A6MA 5K20B 4ECYA 2KKHA 2N82B 1Q8BA 4PPDA 3K57A 4C8YA 3OHBA 2CQHA 4NZ6A 4USTA 1XMQJ 3TI0A 4EZ9A 2ZD1B 1HD1A 2C2OB 1MLAA 3GE9A 3ENAA 4DL7A 2FY8A 3CDAA 4RW8B 3MECB 4OHXA 4PYAA 1H74A 1WC3A 5DM7Q 1XQIA 2IVYA 3TP2A 2F4VJ 4CZCA 4LFAJ 3GLJA 2ACMA 1FKPB 3LGHA 1W2BR 2CQDA 3DRYA 2HNZA 2MZRA 3KK3A 3CCJS 1S10A 1B7FA 3ZZTA 2RH3A 5JUMA 1SC3B 1HQEA 5E3RA 1JLQB 2UZAA 4P6QA 4CLYA 2P8IA 3R5AA 2LEAA 2FLPA 2EEYA 3CJ8A 4FN5A 4ECVA 3FUYA 5I3PA 2HGLA 4A8SA 2XB2D 4YN3B 3D7SB 4DV0J 4URGA 4E98A 4ICLA 5E33A 2WRMA 3RAMA 3A4TA 4OHWA 3MD3A 2Q66A 1X4DA 1N33F 3FMBA 2RDDA 3GYNA 2OPPB 4X4QA 3K7RA 3JSMB 3QGGA 2UUBJ 1N5SA 4HKQA 3MR7A 2IAJA 4UQTA 1YJWS 1QAJA 4NA2A 2VG7B 4B3OB 4K4WA 4TYBA 5KFBA 4LF9F 5DQGA 2DISA 4WFXA 2CADA 2VB6A 2WSEC 2VBYA 3KLIA 3GV8B 3I56S 1MWQA 1ZM2A 2OUGA 3K5PA 4ZCIA 3OSNA 5M2UA 1LWCA 1RWVB 1HWLA 3MM6B 1HBOA 1TL1A 2Z4PA 2HQDA 3JAMU 1LKZA 3RB3A 2V2VA 5CYMA 2LEBA 2BQUA 2EC0A 5L1IA 1DTQA 1VDHA 2VDHA 2HHHJ 2HLTA 3BGUA 2KYZA 3AODA 3V6KA 1K73T 1DQAA 3QAEA 1RTHB 2MEWA 4Y2AA 4W92B 2OH2A 3PG9A 4K0KF 1VRTB 1IJEB 4DX5A 4Y2MA 2ZHBA 1NK4A 1JLBA 2HQCA 2VPZB 3ISNC 5KFVA 3SCJE 5LSOA 3I5BA 2B0GA 4NI2A 1F9FA 1KEKA 4YP3A 5D0EA 1KBRA 1ZAVA 4YB7A 1Q16B 2V8PA 1YRTA 2B9WA 2KT3A 2WSCC 3GFYA 3W64A 4CP5A 1KQSR 2HRYA 2YX1A 2PMHA 5E3PA 1TP7A 1VI7A 2FD2A 2VKRA 2IA0A 2VFRA 2CQ3A 4WWSA 4B08A 3HPOA 3K5LA 1X4AA 2DKOB 2DNZA 4I4BA 3OPKA 3HFKA 4L72B 3EX7B 1RCOB 4U8VA 1SKWA 3HT0A 2MJNA 2R7UA 2BEFA 4IFYA 2E7WA 1RAEB 2QA4S 4ELVA 4KHPJ 1AA1B 1VR6A 2B4UA 2IYGA 1FERA 3MMBB 4IO1A 4LVNP 4OX8A 2JDJA 2MY7A 2GIRA 4AYBD 2JC0A 2AZ3A 2YNIA 2Z8QA 4CH0S 4DOZA 3PVXA 4FS2A 1U0HA 1YQHA 4CNZA 1AZSA 2E9TA 2V6AA 5C42B 2IDLA 3M32B 3HULA 4EBCA 4DZDA 2HYIB 2KZZA 5KOWA 2JRSA 1IM4A 2VQFJ 1RTJA 5EWEA 2UUCJ 4WFZA 5E2QA 3SBMA 3M30B 1CULB 2IC3A 2E9RX 4HDGA 2AYEA 2VUGA 4NZ7A 3H25A 3ADAC 3W5YA 4HH1A 5GADU 3KFWX 1CBKA 3DRPA 1NLKL 1IN0A 3S8SA 4X66J 1RWXB 2GCFA 2ZUGA 4ELTA 3MURP 4GKJF 1YJTA 4LFBF 1FWLA 1YJ7A 5L38A 3DC2A 4OI3A 2C2ZB 2VZ9A 4HHJA 3AB2B 4JI5F 2XZWA 4Q5VA 2OPQB 3OL6A 3QIPA 1LWFA 2V2QA 2W25A 3BR8A 2E5LJ 3IM9A 2VFTA 4GVBB 1V9OA 2CJYB 4Y00A 4X65J 2QT7A 4DPUA 5HQMA 2HRTA 1H7XA 1RHJB 3VALA 4QYZJ 3AA8A 1SKUB 2BM1A 3E3XA 2MGZA 2BKOA 2CG4A 2QLXA 2XMUA 4IOBA 3GONA 5HMWA 4XTTA 1FJGJ 3IWNC 4XDCA 2EC2A 1TKTB 2FVCA 4TLQA 4KGKA 3PV8A 3RBDA 4MT1A 4F36A 1QTMA 2C2MB 2DNHA 5DDPC 4CIOA 4IRDA 3T9NA 3JYTA 3HVTA 2W9AA 2C28A 1N4LA 1FESA 2ZH9A 3W2WB 1S6OA 2BZ2A 4WK3A 2BUNA 2ZE2A 2J9DE 3OUYB 3BB5A 1RT3A 3MR3A 5AXMA 2HHVA 5MLCV 5KFTA 2JHEA 2OELA 1LW2B 3DXSX 2G0IA 2EFGA 5FDLA 1U45A 2XLKA 2B9EA 4B9UA 4A8WA 4KGZB 4O4GB 1EX8A 2RSQA 4WPAA 5DDOC 3G9CA 2WK4A 3G82B 1Q5VA 2F65A 2RJZA 3B54A 5K8NA 1IBLF 1EQMA 3GFXA 2A2CA 2BOAA 2X7IA 4WK1A 3WIVA 2DRDA 3NGSA 2J8AA 3PRDA 4H4KA 4TU7A 3K5MA 1F60B 2BBEA 2IJNA 4BC7A 3GILA 1LXNA 4JI4F 1Q8KA 3QAUA 2QFJA 4F67A 2HVHA 2YVSA 3GR0A 4C8NA 2FLOA 3DGPB 3N6NA 4DV3J 1SKSA 4ED4A 5B7WA 2RF2A 3BSAA 4AD6A 2ROGA 2QLBB 4LBHA 3QRPA 1ROFA 1S1UA 4RPFA 3PACA 5J2MB 1S0OA 1DQ8A 4DI6A 3EDQB 3NS7B 3JQMA 3KKFA 4OI1A 2AIRB 4EI2A 1OS5A 2RKIA 1S6QB 1NUEA 1NH7A 3DRXA 3MEGB 3KHLA 1Q0NA 1PC5A 3PNIA 4R8UA 5F8IA 1ZZNA 4OZ0A 4DR6J 4K4UA 3UQSA 2OI2A 3PM9A 4PG5A 1FE4A 4FPIA 1RWWB 4I2PB 4LJMA 1WWHA 2DJWA 2C2NA 3SV3A 1HWKA 4MIAA 1C1CB 1N6QB 3CC2S 1RTIA 3HXMA 1VQKS 3C3LA 1CPZA 2F7VA 1C1CA 4C0HA 2FDNA
chains in the Genus database with same CATH topology
5KFKA 1OQ6A 1FJCA 2HS3A 2R2TA 2FLLA 2ADBA 1KLMB 2DNPA 2R9LA 2YH0A 2XCAA 3ZZYA 4LVOP 2Z0GA 4N8NA 3BGRA 2DBBA 4NLPA 2DGVA 2VQFF 3SI8A 1TFWA 4W90B 4R8UB 1Q4RA 3AH6A 5L1KA 1NEEA 2KJVA 4WIIA 4NOHA 3CCES 4A8FA 3QPIA 2J6SA 2CJBA 1X9MA 4FVMA 4DS5A 3KLHB 3CCUS 2JL9A 2XS5A 5KT3A 1NB7A 3RYLA 2P9CA 4PQAA 4GC6A 5EN1A 4NLXA 3O6QA 1IBKF 3B8HA 3U1NA 2JFKA 3F56A 2XY5A 3DM2A 4FF4A 2IM2A 2FJDB 1HNXF 3MMJA 4EGLA 4X4PA 3CIZA 4O4GA 2K1RB 3M4XA 2MY8A 3AAWB 4DR2F 2DNOA 2NLWA 1XBWA 3TR5A 2CQ0A 5A0YB 3PX0A 1MMDA 5IZHA 2ZHOA 4X62F 1S6PB 2J0SD 4UOCA 3JYTB 2F8HA 2V8VA 2IRUA 3TAMA 3Q0AA 4J9RA 1VQSA 3M2UB 4RNMA 1HNZF 2L9NA 4RW9B 5KFRA 1HR0F 1C0UB 4WKRA 5CXTA 2ATLA 4ILLA 3CF5Q 1Z1ZA 2ASYA 4K4TA 2BA9A 1CC7A 3F41A 3BQ2A 2PD1A 2FVSA 1X5PA 3NCRA 4Q45A 4K50A 4ZS6A 3HT3A 3BQ0A 3NS6A 5DS7A 1JKHB 4B3RF 2LXFA 1LWFB 3AQPA 2O67A 4OFZA 2M5YA 4M63A 4RWXA 4YR2A 2K7KA 1L5UA 2K2PA 1HNWF 1Q79A 4U67Q 2OJ3A 4RW6A 3OVBA 3THVA 1GTHA 2ASDA 4ZVGA 2FC8A 2AX0A 4BWJA 3DLHA 4KT0C 2NUUG 4X4SA 5KFPA 2RB7A 4MIWA 4OX7A 4KQZA 1X9WA 2O5DA 1DQ9A 3CCZA 4PWUA 4DV7F 5KG3A 2FJEB 2PC6A 4OZNA 5C42A 2VOPA 3MM7B 4DR7F 3RZAA 2QZ8A 3G6VA 1YJ9S 2YKMB 4LF5F 1JIHA 4F4WA 2DNQA 4WYWA 1S9FA 2FVRA 2BANB 1LK7A 2B6AA 3PO5A 2NSBA 1URNA 3D1QA 1YHQS 4HL9A 4QWEA 4YUDA 5KFMA 2EK1A 1ZM3A 3OTEA 4Y65A 5A8WA 2ADCA 1VFJA 2R7SA 4DJBA 2FJAB 2C3OA 2J0XA 3MOZA 2OKQA 3DCAA 5KG6A 1S79A 3ENWA 2E1AA 3QWPA 4NYOA 4PXDA 5BYQA 1T05A 2FHOB 4HTJA 4R25A 4A8YA 1JLBB 2KYXA 4I2QB 2ZH5A 1RT7A 2CDQA 1HBUB 1BQMB 2EG2A 5BR8F 1IKYB 4OHVA 4KBIA 4U7UK 2XSJA 2W9CB 1DTQB 2BACA 2Q3PA 2GQCA 1YJVA 2UV8A 1FRXA 2V0NA 5KT7A 4K5SA 1LWCB 2GGPA 2MQOA 4NXMF 3PDNA 2VD3A 3KLIB 4DSEA 2LQ5A 4WTYA 2OTLS 1UVJA 2AYGA 2GGPB 2CPFA 2VG7A 2VPWB 5KFUA 1D3WA 2A1BA 2QSWA 1D9FA 2L9DA 4I56A 5J1NA 2UVRA 3H59A 2VPXB 2I1RA 4O3OA 1OO0B 2JZ5A 2LXIA 2OLWA 1U4BA 3R27A 1YBAA 1T03B 3I32A 3K5OA 4QPXA 2ROEA 5CH7B 4ICLB 5C5JA 3H20A 4PWDB 2AU0A 1VC6A 4QIFA 4USIA 3FSIA 3BDPA 2APOA 1H2VZ 5B0GA 1CSJA 2DVIA 1GQEA 1P8GA 1SJRA 2GC8A 1X4EA 5A8WB 1FKPA 1B0TA 1ZAXA 2DPJA 2RNEA 1XNRF 3MECA 1X0PA 2DGSA 2B9YA 5SUHA 2ZD1A 5F0UA 2KT2A 2ILYA 2PSZA 1S6UA 4G1PA 2YKMA 2IFXA 3X3UA 1FO1A 3D5MA 3L09A 4PWDA 1VS3A 4UUXA 5J2PB 2ZH4A 1DZ5A 3PW2A 1N5VA 3WC0A 1NJZA 3G71S 3CJ5A 1NH8A 4ZP9A 3S1TA 4ECWA 4DV6F 2YWKA 3DLGA 2HS4A 2HNYB 1QJHA 2OPSB 1TUVA 2IM0A 5FLXY 4ES3A 1S9EA 3J7ZT 3QGIA 5A8RA 5EDWA 4Y2KA 3BR9A 5F8GA 3SMZA 5EWGA 4YR3A 1KVJA 1DFDA 2KJWA 5KFSA 1QVGR 4RW6B 1PGZA 3CWJA 1R7IA 3FNNA 4RNHA 3V6DB 2J7KA 2R7OA 1N5YA 2D74B 3GZ7A 2W9CA 2OPRA 1S77D 1TL5A 4M5DA 1S49A 3CPWR 1R31A 4L6V3 3QWUA 5DG7A 1HBUA 3VAFA 2E5HA 1RT7B 2XMTA 4ZPTR 3OXFA 1BQXA 3CTRA 3BSNA 4GMKA 3J80Y 1CEZA 2UUAF 4ECXA 3TUJC 1T05B 1C0UA 4AE5A 4CI0B 2LKZA 4ID5A 2OFGX 2ZKUA 4A47A 1FHTA 3TAMB 2ZBIA 4JOUA 4FF1A 2V5HG 1S6PA 2BJDA 2RMLA 4H4OB 5B0FA 4X65F 1FTCA 2HGMA 2PDAA 3I31A 4MH8A 3WZ0A 5KAKA 5DM6Q 2VL1A 1SL0A 3CC4S 2XGPA 3N4WA 2PA3A 1TAQA 2LQJA 5GVQA 3RRKA 3LGNA 5EGYA 5KT4A 4HYKA 2ABYA 4F25A 1VK3A 1D8YA 4LF7F 2CPHA 2L08A 2CQ1A 2UUTA 5LJ3Y 2F1FA 5E3CA 2VG6A 2MXYA 4ZPBA 3QIDA 1A9NB 2CQBA 3BSCA 1FD2A 4J9QA 4OMFG 5D4PA 2UXDF 1RJJA 4ZVEA 1UVIA 3EPGA 5JVHQ 4LIWA 1P6TA 2WCXA 1M0SA 3BM7A 3KLEB 4F4ZA 2ZH1A 3L3CA 2WOMB 3U1MA 1TK0A 4J37A 1NRKA 4OHZA 3HHLB 2ZH7A 1U8SA 5AE3A 4OZ1A 5GMKa 4FF3A 4C3LA 4Q0BB 1B0VA 2HAIA 1TK8A 4QIWD 3KOAA 3B78A 2HQIA 2O3DA 2R7VA 1QE1B 4Y3CA 5HMYA 4DFJA 1YIJS 1JB0C 3MOJB 3MXHP 1R8AA 1X0FA 5K8MA 1KTVA 4F02A 4QIGA 1QSLA 2KH9A 3VAMA 1T02A 4Z37A 2OO4A 2B7BB 3HI9A 4OX9F 2AYBA 2F9DA 1N6QA 2R8KA 4WCEQ 2KT5A 2OMOA 3FEXB 2BVZA 4RW9A 3V2UC 3Q24A 3HDSA 3M2UA 1U7LA 4RU9A 4R5PA 2JC1A 2PEHA 2QMWA 2RKIB 2RQ4A 3GG1A 1HBMA 3IR5B 4DSFA 5A0YA 5E7OB 3J7YU 2HHHF 1IXKA 1S1UB 3CEDA 1VRUA 3I6PA 3CDWA 2RIJA 2J0WA 1R8PA 2GQ2A 3M1VB 2KM8B 1U6BA 5K14A 2FJXA 1GH8A 4LQ9A 4F4YA 5KFCA 1Q1KA 3NMAA 4NYZA 4G6VB 3GQCA 2IVFB 1HQUB 4DFMA 1JLGA 2X51A 3NGDA 3BEGB 3DM2B 4CH1A 1M5PC 4PQUA 4USJC 1DHMA 2LYVA 3G4SS 2AD9A 4ES2A 1CQNA 3THPA 3FQLA 5K14B 2ZH6A 4IH7A 4EU0A 3C2PA 2CZ4A 1SIZA 3BO3A 1VRUB 1FXRA 1GXTA 3KLHA 4DV2F 3R1LA 1LK5A 2KRBA 2ILZA 4R0EA 4DQQA 1AW0A 2E66A 4NLRA 1L3SA 4NX9A 2POKA 5KG5A 4CO0A 2NREA 3HVTB 2HW3A 1VGYA 1M5HA 1KLMA 2N7YA 1XMOF 4DN9A 1NJWA 4Q7AA 4OX6A 1S0VA 3IS9B 3JSYA 2LXUA 1U6ZA 2IBOA 3AA9A 5B09A 1X5OA 2X3GA 2HQ3A 2V2KA 4ZKAA 4I2PA 1X9SA 3PEJA 3CCMS 4ETXA 5LSRA 4I6AA 4OZ5A 4ECTA 3QIPB 5CYJA 2R7WA 3QO9A 2OPQA 2ZM6F 1S99A 1QE1A 4X66F 3PW5A 2AJ0A 2BDPA 2DR5A 1NK7A 5F8NA 3BO4A 1U09A 2FPHX 2JWNA 4QOTA 3PR4A 3KYLA 4KSEB 4Q0BA 2FTRA 3DRPB 3LUYA 5K5MA 5J2MA 1D9AA 5A8KB 4OI6A 2RF2B 5LT5A 4PXEA 4JV5F 1O0PA 3PHEA 1AFIA 2W7AA 3FEYB 3KTQA 1RTJB 1FF2A 3US5A 1RKJA 4NA3A 4CTAA 4Q8EA 5B0DA 3SSSA 1FT8A 3TNVA 2PMZD 5BYRA 5KT2A 2ZHAA 1U47A 4MJKA 3S01A 4LUBA 2GO8A 4K4VA 2PN6A 2KG0A 2UXCF 2YNIB 2FJWA 3O1LA 1DTTB 3W2VA 3LALA 2PI4A 2LLZA 3WC2A 2VG6B 4L3NA 3AHPA 3D28A 3ZZRA 2AJQA 3JTNA 1VLYA 1HW8A 4DR4F 5DG8A 4DV5F 3FEZA 1RT3B 3CXCR 1KS2A 1N0VC 4N77A 4QPTA 2AV5A 2AWZA 2ZC3A 3W2WA 4H4OA 3GFZA 3MR2A 2C22A 3JB9k 2HYIB 2QA2A 1RK8A 1NHUA 2ZOGA 5F8HA 5KFNA 2QA4G 2A18A 2XMVA 1RT5B 1HWJA 4GC7A 2IRXA 1Q86T 4A46A 4ID5B 5D8HB 4LIRA 4N56A 3SQGB 1NHVA 3D0GE 4ZP8A 4A8XA 4QWCA 3ENVA 4YB5A 3HVWA 3C46A 4IR1A 1J2VA 4GO7X 4ZA1A 1RYSA 3I87A 5KTQA 1F5AA 1VK8A 2XLJA 1KN6A 1ZOTA 3T19A 2GX8A 1GTEA 2QV6A 4RBUA 4URQU 1FCAA 2OPRB 1X4CA 1UVLA 5KFWA 1N5YB 2D9PA 4O3QA 2DCLA 1FA0A 3UW1A 4K4XA 4EYIB 4B9NA 2JVRA 1LOUA 1H7WA 2Q1LA 2HHTA 2DNNA 2M8HA 4Y34A 4CO5A 3FFIA 3VAGA 1FDNA 3IR7B 3N5BA 5LL6d 3TA0A 3ZZUA 3M9MB 2AGOA 1M1KT 2WB4A 4DQIA 2KXNB 4DMZA 2IC3B 2QIFA 2YX7A 2AF6A 1PO6A 5B0EA 4C8OA 2CPDA 5HI7A 2HNYA 2OPSA 1HFEL 2OPPA 3DLGB 3F73A 4USHA 3H2UB 4ECRA 3I5CA 3M32A 3OL9A 1HD0A 2WBMA 4E0DA 3OR1A 4M1KA 4MMOA 4ERDA 3FRYA 5J2PA 4WXOA 1FJ7A 1R89A 4DL3A 1VOMA 3MMBA 4X4UA 4XDDA 1T3OA 2R8IA 4IFYB 1JLQA 1S48A 2CPJA 1I94F 1QUPA 4ZLPA 3CCSS 2YWFA 2ZZNA 3LQVA 2IM3A 2XC9A 2XG8A 1Z4UA 3FCHA 4BC9A 3IG1A 3M9OB 1H0HB 3DOMA 5E3QA 2GMJA 5I3UB 3MR6A 4OZLA 1WF2A 4PG6A 4RZRA 3K8WA 2C42A 2MJUA 2P9GA 1KOOA 5J1PA 5F0WA 1BQNA 2B51A 1T03A 3VAIA 2I38A 4J9LA 3T5LA 1ZTWA 1U1MA 1RTHA 5K9FA 1NKEA 3MPWA 2BRKA 1N5QA 5CYMB 1WTBA 1JK9B 2R7RA 4NLYA 1WI6A 1QSYA 5LXYA 2WHOA 4YR0A 4DSIA 3MDFA 4Q8FA 2X1GA 4HI2A 3SCLE 4DL4A 4C3KA 3DDNA 5T7LB 1MNEA 2IAJB 2XSJB 4ECQA 3MI7X 4FF2A 2MQMA 1IKYA 1LXJA 4DR5F 1NKBA 1BQMA 2V8GA 4ZVHA 2M9KA 3CUNA 2LDIA 4I2QA 4JV0A 2XMKA 5LSLA 4WXWA 3L95X 2VC1A 1DJ0A 1X5SA 4MIBA 3MAQA 5G0RA 3RB0A 2ZZMA 3MUMP 3R1HA 3AB4B 5KG1A 4N47A 2U2FA 3OTDA 2ZJRQ 2HNZB 4C2MA 3KK3B 2ZOMA 2GNKA 1X4BA 3HK2A 4K2XA 1U1PA 4LQ3A 4NCAA 2C3UA 1XR5A 4ED1A 3J7YI 2Y1RI 2B6AB 3MFHA 1HI8A 2BANA 2LQBA 3NAHA 3M6VA 5L1JA 2R7XA 4DWIA 2KFNA 4ZHRB 4K59A 1N48A 3MM7A 1JXLA 1SKRA 3IRXA 3UR0A 2EFVA 2E5IA 5B0BA 4B9MA 4YB6A 3G8TA 4F4XA 2HVIA 2WONA 4OI2A 1C4CA 4XIUA 3LOUA 4FZVA 4UQGA 6FDRA 3GV5B 2QYCA 2J9CA 1H3DA 1KTQA 2KXFA 3CMAS 3ITHB 2AGPA 3ETOA 2E29A 2UUCF 2ZDPA 5HP1B 1KHVA 4AUKA 1HHTP 4WF9Q 2NSCA 4CT8A 2GJIA 3IWXA 1TKDA 2ROPA 1SUQA 3C6TA 3CMES 3TVZA 3KG1A 4ZDNA 5HQ8A 1JKHA 3OXGA 2CJQA 1TAUA 1IKXA 2PE8A 3AJ2A 2EFQA 1ZETA 2GIQA 3ZFVA 2ZC4A 1R8BA 1CVJA 2LECA 1IUJA 3O5TB 4I7FB 4IFVB 1WEYA 1GAOA 5GAEU 1DAXA 5EWFA 4Q44A 2SXLA 1QAYA 2KVIA 2UV8G 1KOHA 4EUVA 2R4FA 1KFSA 4HT5A 2J7UA 5LMUF 2EPIA 1CQMA 1M5OC 1ZM9A 4AL6A 5DLFA 4O3PA 1SC6A 1WNEA 4AXIA 1FVSA 4YDDB 1DBDA 5DLGA 4ED3A 3PIOQ 2OTJS 4I6YA 5KFIA 3TA1A 3M8SA 2XBPA 1REVB 1WD6A 3DFEA 5GAGU 3TANA 2K1RA 2MHEA 4Y28C 2KRRA 4JV2A 1PSDA 4ED8A 4FP9A 2W8KA 2DHGA 5IWAF 1FD8A 2A2DA 4CCHA 5CQGA 1MROB 4PXCA 1R3NA 5C25B 5D3GB 3UFCX 1JWWA 5AE2A 3T1AA 1EETA 2BYCA 1IKWB 3MTJA 2D1CA 1RT6B 4UUWA 3CCRS 3LP2B 3MPVA 4WJBA 4M94A 1FXDA 4DFKA 1RISA 2UUWA 4RLEA 3S7RA 2RQMA 1NAQA 2J9EA 1N34F 2JX2A 3EGNA 4LSLB 3KJVB 1NK8A 3HHEA 3KHRA 2KFZA 4MYUA 5AXKA 2M2BA 3UDCA 2N7CA 3CT9A 2GHWA 2P6TA 4C0OC 3NNAA 3BGRB 4GKKF 1SJ1A 3FJ2A 3QZ8A 5HMZA 1MSWD 1S0MA 1FRJA 5KFXA 5CYQA 4ED2A 1NK6A 2ZVSA 1RT1A 1M5SA 1IBMF 5J2NB 3I4PA 5D4LA 1RTIB 2DD8S 3R5CA 4KB7A 4K4ZA 1RT4A 1SI9A 3I0SB 4ZPWR 3FZ2A 3EPIA 4WE1B 1S72S 1IKVB 2UUBF 3WDOA 4ETZA 2ZITA 5CHCB 1R27B 2EFOA 2HHWA 2HVZA 2IM1A 1S6QA 3MEGA 1XMQF 2F9JA 3DYAA 2YNGB 2Q43A 3K8VA 2VG5A 5F3ZA 4YHHF 4RUCA 2PGCA 2OD4A 1SH2A 4O44A 1VBYA 2CQCA 4A8MP 4WZQA 3DGPA 4F8RA 5KFHA 3BO2A 1LFPA 1QM9A 3CJ0A 4V19X 1VBZA 2HPUA 4A8KA 1MMNA 2B4PA 3M05A 1NK0A 3CULA 4KJIA 5KOXA 4K4SA 1ZAWA 3KLVA 2GV1A 4EFAC 2X1FA 2G1DA 3O2IA 1KD1T 4IG0A 3D0IE 1UJ5A 4ECVA 2YKNA 1UJ4A 1BY9A 3QLHA 1HNVA 4NLTA 3Q8PB 1JLFA 2DNKA 4PXBA 5FDLB 1LW2A 4NL5A 4MKAA 4G1QA 4YEAA 4EO8A 3V81A 1L3KA 1JLAB 1DRZA 3IGVA 3BDEA 4NPOA 2HHXA 1VQYA 2ZE2B 4ILRA 1EP4A 2MQQA 3OUYA 2R7QA 2DPIA 4NCGB 1SV5A 3N6LA 1NNDA 2O1PA 4DL5A 4B3OB 1Y7PA 2DGXA