4AEAA

Dimeric alpha-cobratoxin x-ray structure: localization of intermolecular disulfides and possible mode of binding to nicotinic acetylcholine receptors
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
67
structure length
67
Chain Sequence
IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LONG NEUROTOXIN 1
publication title Dimeric Alpha-Cobratoxin X-Ray Structure: Localization of Intermolecular Disulfides and Possible Mode of Binding to Nicotinic Acetylcholine Receptors.
pubmed doi rcsb
molecule tags Toxin
total genus 5
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4aeaA00
1ES7B 1KC4A 1IJCA 1TGXA 1W6BA 2N99A 2H7ZA 2OFSA 2MJ4A 1KBSA 1IK8A 1XT3A 1KL8A 3KFDE 3EBXA 3QB4B 3BT1U 1LX5B 1I02A 1IDGA 1ZADA 1CHVS 3NEQA 1ABTA 1RGJA 1CDSA 1IDHA 2GOOC 4UY2C 1KS6A 1S4YA 4LFTA 2BHIA 2LA1A 2CRSA 4OM4A 4QTIU 2QJAC 5DU1A 2H5FA 1CXOA 1JE9A 3FEVA 2HLRA 1HAAA 2LCRA 1FSCA 1ERAA 1KBAA 2L03A 4ZQYA 2JQPA 1CVOA 4BIKB 1NORA 1NTXA 1KTZB 1CTXA 1NYSA 1FSSB 5EBXA 1B41B 1UG4A 1IQ9A 4FAOC 2K3GA 3KFDI 2QJBC 2X8BB 3NH7A 2H64C 1CODA 2CTXA 3U73U 2MJYA 2CDXA 1TFSA 3U74U 5DO6A 4DO8A 1MR6A 1IKCA 1QM7A 1HAJA 3LAQU 2UX2A 2H8UA 2NBTA 3BT2U 5IMTD 1F8UB 1CDTA 4FAOE 2CCXA 1CXNA 2GOOB 1CRFA 1CCQA 1COEA 2L5SA 1CB9A 1NEAA 1L4WA 2QC1A 4BDTB 1FASA 4RUDA 2H62D 2MUOA 4P7UA 3NDSA 1CREA 2H62C 2QJ9C 2MFAA 4XJJA 1FF4A 5DZ5A 3ERAA 1ERGA 2UWRA 1JBDA 4IYEA 1G6MA 1V6PA 1TXAA 1DRSA 1H0JA 2ABXA 2PJYC 2I9BE 1NTNA 2MHYA 1HC9B 2VLWA 1RL5A 2JVEA 2H64B 1BTEA 1LJZA 1M9ZA 2MJ0A 5IMYC 1TXBA 2MUPA 2PJYB 1KFHA 1FRAA 1MAHF 2CRTA 1F94A 1FFJA 3VTSA 1REWC 4AEAA 2BTXA 2H7ZB 1JGKA 1VB0A 6EBXA 1PLOA 3EVSC 1YWHA 4OM5A 1LSIA 4HQPF 4EY8B 1BXPA 1ONJA 1HC9A 1IDIA 1QKDA 1KXIA 2FD6U 2ERAA 3PLCA 1IDLA 1KBTA 1HOYA 3HH7A 1LXGA 1NYUA 1LXHA 2HLQA 1CDRA 2J8BA 1QKEA 1NXBA 1KU6B 1CDQA
chains in the Genus database with same CATH superfamily
1ES7B 1KC4A 1IJCA 1TGXA 1W6BA 2N99A 2H7ZA 2OFSA 2MJ4A 1KBSA 1IK8A 1XT3A 1KL8A 3KFDE 3EBXA 3QB4B 3BT1U 1LX5B 4KSNA 1IDGA 1ZADA 1CHVS 3NEQA 1I02A 1RGJA 1ABTA 1CDSA 1IDHA 2GOOC 4UY2C 1KS6A 1S4YA 4LFTA 2BHIA 2LA1A 2CRSA 4OM4A 4QTIU 2QJAC 5DU1A 2H5FA 1CXOA 1JE9A 3FEVA 2HLRA 1HAAA 2LCRA 1FSCA 1ERAA 1KBAA 2L03A 4ZQYA 2JQPA 1CVOA 4BIKB 1NORA 1NTXA 1KTZB 1CTXA 1NYSA 1FSSB 5EBXA 1B41B 1UG4A 1IQ9A 4FAOC 2K3GA 3KFDI 2QJBC 2X8BB 3NH7A 2H64C 1CODA 2CTXA 3U73U 2MJYA 2CDXA 1TFSA 3U74U 5DO6A 4DO8A 1MR6A 1IKCA 1QM7A 1HAJA 3LAQU 2UX2A 2H8UA 2NBTA 3BT2U 5IMTD 1F8UB 1CDTA 4FAOE 2CCXA 1CXNA 2GOOB 1CRFA 1CCQA 1COEA 2L5SA 1CB9A 1NEAA 1L4WA 2QC1A 4BDTB 1FASA 4RUDA 2H62D 2MUOA 4P7UA 3NDSA 1CREA 2H62C 2QJ9C 2MFAA 4XJJA 1FF4A 5DZ5A 3ERAA 1ERGA 2UWRA 1JBDA 4IYEA 1G6MA 1V6PA 1TXAA 1DRSA 1H0JA 2ABXA 2PJYC 2I9BE 1NTNA 2MHYA 1HC9B 2VLWA 1RL5A 2JVEA 2H64B 1BTEA 1LJZA 1M9ZA 2MJ0A 5IMYC 1TXBA 2MUPA 2PJYB 1KFHA 1FRAA 1MAHF 2CRTA 1F94A 1FFJA 3VTSA 1REWC 4AEAA 2BTXA 2H7ZB 1JGKA 1VB0A 6EBXA 1PLOA 3EVSC 1YWHA 4OM5A 1LSIA 4HQPF 4EY8B 1BXPA 1ONJA 1HC9A 1IDIA 1QKDA 1KXIA 2FD6U 2ERAA 3PLCA 1IDLA 1KBTA 1HOYA 3HH7A 1LXGA 1NYUA 1LXHA 2HLQA 1CDRA 2J8BA 1QKEA 1NXBA 1KU6B 1CDQA
chains in the Genus database with same CATH topology
1ES7B 1KC4A 1IJCA 1TGXA 1W6BA 2N99A 2H7ZA 2OFSA 2MJ4A 1KBSA 1IK8A 1XT3A 1KL8A 3KFDE 3EBXA 3QB4B 3BT1U 1LX5B 4KSNA 1IDGA 1ZADA 1CHVS 3NEQA 1I02A 1RGJA 1ABTA 1CDSA 1IDHA 2GOOC 4UY2C 1KS6A 1S4YA 4LFTA 2BHIA 2LA1A 2CRSA 4OM4A 4QTIU 2QJAC 5DU1A 2H5FA 1CXOA 1JE9A 3FEVA 2HLRA 1HAAA 2LCRA 1FSCA 1ERAA 1KBAA 2L03A 4ZQYA 2JQPA 1CVOA 4BIKB 1NORA 1NTXA 1KTZB 1CTXA 1NYSA 1FSSB 5EBXA 1B41B 1UG4A 1IQ9A 4FAOC 2K3GA 3KFDI 2QJBC 2X8BB 3NH7A 2H64C 1CODA 2CTXA 3U73U 2MJYA 2CDXA 1TFSA 3U74U 5DO6A 4DO8A 1MR6A 1IKCA 1QM7A 1HAJA 3LAQU 2UX2A 2H8UA 2NBTA 3BT2U 5IMTD 1F8UB 1CDTA 4FAOE 2CCXA 1CXNA 2GOOB 1CRFA 1CCQA 1COEA 2L5SA 1CB9A 1NEAA 1L4WA 2QC1A 4BDTB 1FASA 4RUDA 2H62D 2MUOA 4P7UA 3NDSA 1CREA 2H62C 2QJ9C 2MFAA 4XJJA 1FF4A 5DZ5A 3ERAA 1ERGA 2UWRA 1JBDA 4IYEA 1G6MA 1V6PA 1TXAA 1DRSA 1H0JA 2ABXA 2PJYC 2I9BE 1NTNA 2MHYA 1HC9B 2VLWA 1RL5A 2JVEA 2H64B 1BTEA 1LJZA 1M9ZA 2MJ0A 5IMYC 1TXBA 2MUPA 2PJYB 1KFHA 1FRAA 1MAHF 2CRTA 1F94A 1FFJA 3VTSA 1REWC 4AEAA 2BTXA 2H7ZB 1JGKA 1VB0A 6EBXA 1PLOA 3EVSC 1YWHA 4OM5A 1LSIA 4HQPF 4EY8B 1BXPA 1ONJA 1HC9A 1IDIA 1QKDA 1KXIA 2FD6U 2ERAA 3PLCA 1IDLA 1KBTA 1HOYA 3HH7A 1LXGA 1NYUA 1LXHA 2HLQA 1CDRA 2J8BA 1QKEA 1NXBA 1KU6B 1CDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ES7 B;  1KC4 A;  1IJC A;  1TGX A;  1W6B A;  2N99 A;  2H7Z A;  2OFS A;  2MJ4 A;  1KBS A;  1IK8 A;  1XT3 A;  1KL8 A;  3KFD E;  3EBX A;  3QB4 B;  3BT1 U;  1LX5 B;  1I02 A;  1IDG A;  1ZAD A;  1CHV S;  3NEQ A;  1ABT A;  1RGJ A;  1CDS A;  1IDH A;  2GOO C;  4UY2 C;  1KS6 A;  1S4Y A;  4LFT A;  2BHI A;  2LA1 A;  2CRS A;  4OM4 A;  4QTI U;  2QJA C;  5DU1 A;  2H5F A;  1CXO A;  1JE9 A;  3FEV A;  2HLR A;  1HAA A;  2LCR A;  1FSC A;  1ERA A;  1KBA A;  2L03 A;  4ZQY A;  2JQP A;  1CVO A;  4BIK B;  1NOR A;  1NTX A;  1KTZ B;  1CTX A;  1NYS A;  1FSS B;  5EBX A;  1B41 B;  1UG4 A;  1IQ9 A;  4FAO C;  2K3G A;  3KFD I;  2QJB C;  2X8B B;  3NH7 A;  2H64 C;  1COD A;  2CTX A;  3U73 U;  2MJY A;  2CDX A;  1TFS A;  3U74 U;  5DO6 A;  4DO8 A;  1MR6 A;  1IKC A;  1QM7 A;  1HAJ A;  3LAQ U;  2UX2 A;  2H8U A;  2NBT A;  3BT2 U;  5IMT D;  1F8U B;  1CDT A;  4FAO E;  2CCX A;  1CXN A;  2GOO B;  1CRF A;  1CCQ A;  1COE A;  2L5S A;  1CB9 A;  1NEA A;  1L4W A;  2QC1 A;  4BDT B;  1FAS A;  4RUD A;  2H62 D;  2MUO A;  4P7U A;  3NDS A;  1CRE A;  2H62 C;  2QJ9 C;  2MFA A;  4XJJ A;  1FF4 A;  5DZ5 A;  3ERA A;  1ERG A;  2UWR A;  1JBD A;  4IYE A;  1G6M A;  1V6P A;  1TXA A;  1DRS A;  1H0J A;  2ABX A;  2PJY C;  2I9B E;  1NTN A;  2MHY A;  1HC9 B;  2VLW A;  1RL5 A;  2JVE A;  2H64 B;  1BTE A;  1LJZ A;  1M9Z A;  2MJ0 A;  5IMY C;  1TXB A;  2MUP A;  2PJY B;  1KFH A;  1FRA A;  1MAH F;  2CRT A;  1F94 A;  1FFJ A;  3VTS A;  1REW C;  4AEA A;  2BTX A;  2H7Z B;  1JGK A;  1VB0 A;  6EBX A;  1PLO A;  3EVS C;  1YWH A;  4OM5 A;  1LSI A;  4HQP F;  4EY8 B;  1BXP A;  1ONJ A;  1HC9 A;  1IDI A;  1QKD A;  1KXI A;  2FD6 U;  2ERA A;  3PLC A;  1IDL A;  1KBT A;  1HOY A;  3HH7 A;  1LXG A;  1NYU A;  1LXH A;  2HLQ A;  1CDR A;  2J8B A;  1QKE A;  1NXB A;  1KU6 B;  1CDQ A; 
#chains in the Genus database with same CATH topology
 1ES7 B;  1KC4 A;  1IJC A;  1TGX A;  1W6B A;  2N99 A;  2H7Z A;  2OFS A;  2MJ4 A;  1KBS A;  1IK8 A;  1XT3 A;  1KL8 A;  3KFD E;  3EBX A;  3QB4 B;  3BT1 U;  1LX5 B;  4KSN A;  1IDG A;  1ZAD A;  1CHV S;  3NEQ A;  1I02 A;  1RGJ A;  1ABT A;  1CDS A;  1IDH A;  2GOO C;  4UY2 C;  1KS6 A;  1S4Y A;  4LFT A;  2BHI A;  2LA1 A;  2CRS A;  4OM4 A;  4QTI U;  2QJA C;  5DU1 A;  2H5F A;  1CXO A;  1JE9 A;  3FEV A;  2HLR A;  1HAA A;  2LCR A;  1FSC A;  1ERA A;  1KBA A;  2L03 A;  4ZQY A;  2JQP A;  1CVO A;  4BIK B;  1NOR A;  1NTX A;  1KTZ B;  1CTX A;  1NYS A;  1FSS B;  5EBX A;  1B41 B;  1UG4 A;  1IQ9 A;  4FAO C;  2K3G A;  3KFD I;  2QJB C;  2X8B B;  3NH7 A;  2H64 C;  1COD A;  2CTX A;  3U73 U;  2MJY A;  2CDX A;  1TFS A;  3U74 U;  5DO6 A;  4DO8 A;  1MR6 A;  1IKC A;  1QM7 A;  1HAJ A;  3LAQ U;  2UX2 A;  2H8U A;  2NBT A;  3BT2 U;  5IMT D;  1F8U B;  1CDT A;  4FAO E;  2CCX A;  1CXN A;  2GOO B;  1CRF A;  1CCQ A;  1COE A;  2L5S A;  1CB9 A;  1NEA A;  1L4W A;  2QC1 A;  4BDT B;  1FAS A;  4RUD A;  2H62 D;  2MUO A;  4P7U A;  3NDS A;  1CRE A;  2H62 C;  2QJ9 C;  2MFA A;  4XJJ A;  1FF4 A;  5DZ5 A;  3ERA A;  1ERG A;  2UWR A;  1JBD A;  4IYE A;  1G6M A;  1V6P A;  1TXA A;  1DRS A;  1H0J A;  2ABX A;  2PJY C;  2I9B E;  1NTN A;  2MHY A;  1HC9 B;  2VLW A;  1RL5 A;  2JVE A;  2H64 B;  1BTE A;  1LJZ A;  1M9Z A;  2MJ0 A;  5IMY C;  1TXB A;  2MUP A;  2PJY B;  1KFH A;  1FRA A;  1MAH F;  2CRT A;  1F94 A;  1FFJ A;  3VTS A;  1REW C;  4AEA A;  2BTX A;  2H7Z B;  1JGK A;  1VB0 A;  6EBX A;  1PLO A;  3EVS C;  1YWH A;  4OM5 A;  1LSI A;  4HQP F;  4EY8 B;  1BXP A;  1ONJ A;  1HC9 A;  1IDI A;  1QKD A;  1KXI A;  2FD6 U;  2ERA A;  3PLC A;  1IDL A;  1KBT A;  1HOY A;  3HH7 A;  1LXG A;  1NYU A;  1LXH A;  2HLQ A;  1CDR A;  2J8B A;  1QKE A;  1NXB A;  1KU6 B;  1CDQ A; 
#chains in the Genus database with same CATH homology
 1ES7 B;  1KC4 A;  1IJC A;  1TGX A;  1W6B A;  2N99 A;  2H7Z A;  2OFS A;  2MJ4 A;  1KBS A;  1IK8 A;  1XT3 A;  1KL8 A;  3KFD E;  3EBX A;  3QB4 B;  3BT1 U;  1LX5 B;  4KSN A;  1IDG A;  1ZAD A;  1CHV S;  3NEQ A;  1I02 A;  1RGJ A;  1ABT A;  1CDS A;  1IDH A;  2GOO C;  4UY2 C;  1KS6 A;  1S4Y A;  4LFT A;  2BHI A;  2LA1 A;  2CRS A;  4OM4 A;  4QTI U;  2QJA C;  5DU1 A;  2H5F A;  1CXO A;  1JE9 A;  3FEV A;  2HLR A;  1HAA A;  2LCR A;  1FSC A;  1ERA A;  1KBA A;  2L03 A;  4ZQY A;  2JQP A;  1CVO A;  4BIK B;  1NOR A;  1NTX A;  1KTZ B;  1CTX A;  1NYS A;  1FSS B;  5EBX A;  1B41 B;  1UG4 A;  1IQ9 A;  4FAO C;  2K3G A;  3KFD I;  2QJB C;  2X8B B;  3NH7 A;  2H64 C;  1COD A;  2CTX A;  3U73 U;  2MJY A;  2CDX A;  1TFS A;  3U74 U;  5DO6 A;  4DO8 A;  1MR6 A;  1IKC A;  1QM7 A;  1HAJ A;  3LAQ U;  2UX2 A;  2H8U A;  2NBT A;  3BT2 U;  5IMT D;  1F8U B;  1CDT A;  4FAO E;  2CCX A;  1CXN A;  2GOO B;  1CRF A;  1CCQ A;  1COE A;  2L5S A;  1CB9 A;  1NEA A;  1L4W A;  2QC1 A;  4BDT B;  1FAS A;  4RUD A;  2H62 D;  2MUO A;  4P7U A;  3NDS A;  1CRE A;  2H62 C;  2QJ9 C;  2MFA A;  4XJJ A;  1FF4 A;  5DZ5 A;  3ERA A;  1ERG A;  2UWR A;  1JBD A;  4IYE A;  1G6M A;  1V6P A;  1TXA A;  1DRS A;  1H0J A;  2ABX A;  2PJY C;  2I9B E;  1NTN A;  2MHY A;  1HC9 B;  2VLW A;  1RL5 A;  2JVE A;  2H64 B;  1BTE A;  1LJZ A;  1M9Z A;  2MJ0 A;  5IMY C;  1TXB A;  2MUP A;  2PJY B;  1KFH A;  1FRA A;  1MAH F;  2CRT A;  1F94 A;  1FFJ A;  3VTS A;  1REW C;  4AEA A;  2BTX A;  2H7Z B;  1JGK A;  1VB0 A;  6EBX A;  1PLO A;  3EVS C;  1YWH A;  4OM5 A;  1LSI A;  4HQP F;  4EY8 B;  1BXP A;  1ONJ A;  1HC9 A;  1IDI A;  1QKD A;  1KXI A;  2FD6 U;  2ERA A;  3PLC A;  1IDL A;  1KBT A;  1HOY A;  3HH7 A;  1LXG A;  1NYU A;  1LXH A;  2HLQ A;  1CDR A;  2J8B A;  1QKE A;  1NXB A;  1KU6 B;  1CDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...