4AEDB

Crystal structure of human enterovirus 71
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
245
structure length
236
Chain Sequence
b'SDRVAQLTIGNSTITTQEAANIIVGYGEWPSYCSDDDATAVDKPTRPDVSVNRFYTLDTKLWEKSSKGWYWKFPDVLTETGVFGQNAQFHYLYRSGFCIHVQCNASKFHQGALLVAILPEYVIGTSHPPYKQTQPGADGFELQHPYVLDAGIPISQLTVCPHQWINLRTNNCATIIVPYMNTLPFDSALNHCNFGLLVVPISPLDFDQGATPVIPITITLAPMCSEFAGLRQAVTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Crystal Structure of Human Enterovirus 71.
pubmed doi rcsb
molecule tags Virus
total genus 41
structure length 236
sequence length 245
ec nomenclature
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4aedB00
1PGW1 1R1A3 1RUC2 3VBSB 5ABJB 1AUYA 1Z7S1 2GSYA 1VBA1 2PLV3 4CDWC 2MEV1 5FOJB 4JGYA 5A33B 3ZXAC 1VBD1 2R061 1PGW2 4N53A 4RHV1 5JZGC 1VBA2 1VBD3 2HWD1 5DDJ3 4GH4C 4IV1B 1FMD3 2MEV2 1ND2A 1CD3G 2HWD3 1VBD2 3ZFFB 5C4WC 1A6CA 3VBFC 1MQTA 3J8F3 2RS51 1RMU3 2HWD2 1C8M1 1NG0A 1OOPB 5LK7B 2ZTNA 3DPRA 5BNPA 3J8F2 1C8M3 3CJIA 4FSJA 1RMU2 1ASJ1 1E57A 3JBG1 1FOD1 3VDDB 5BNNC 1K5MC 4CEWB 1PO21 1GFF2 5CFCC 4JGZB 1H8TB 4CDQC 1C8M2 2FZ2A 2HWB1 2VQ0A 5FMOL 4WM8C 2BPA2 3VBOA 4GMP0 1ASJ2 4Q4W3 3JBG2 2RS11 1EV11 3VBRB 1PO22 4YVWB 1F2NA 4QPIC 1POV1 4RR3C 2RS13 1EV13 2WLPA 5L7OB 2XPJA 1PIV3 1ND2B 4CDWA 4EJRA 2WWSA 3ZFEA 1COV1 1D4M3 2RS12 2DF7A 1EV12 1QJY1 3TN91 1PIV2 1COV3 4RFT0 4AEDC 4RQPB 5C8CC 1D4M2 4IV3B 4GH4A 1VAKA 5A33A 1NCRA 2RS31 1COV2 1RUH3 3TN92 2BBVA 1PGL1 1AYM1 2RS33 5J96B 2X5IC 2WFF1 2BFUS 5GKAC 1MEC1 1RUH2 4QPGC 1AR61 1HRV1 2RS32 4YVSB 1W39A 3ZFFA 1FPN1 1QQP3 1R083 4GB31 1HRV3 1PGL2 4FTSA 2WFF2 3VBHC 1FPN3 1HQNA 1OOPA 5CFDC 3VBUC 1MEC2 4CDWB 4WM8A 1AR62 1HRV2 1HRI1 4GMP1 2RR11 1FPN2 1SMVA 1RUE3 3VDDA 4CDXC 3NAPC 4CEWA 2XBO1 1HRI3 1POV0 4GMP3 1ZBE1 4JGZA 1H8TA 5JZGB 1VRH1 2GH8A 1R091 1Z7S3 4GH4B 1RUF1 1RUE2 2XBO3 1VBA3 1ZBE3 1NCRB 4CDUC 1HRI2 1VRH3 1BMV2 1F8VA 2RR12 1RUF3 2MEV3 5C4WB 1Z7S2 3VBFB 3VBRA 2XBO2 4YVWA 1ZBE2 2R063 4Q4X1 1VRH2 1R092 3M8LA 5K0UC 4AEDA 5L7OA 1RUF2 4RHV3 2RM21 2HWC1 2R062 5D8AA 5C9AC 1V9U1 4PDWC 5BNNB 4Z92B 4Q4V1 1K5MB 4RHV2 3VBSC 4Q4X2 2WS91 1BEV1 4CDQB 4RQPA 4RS5C 1V9U3 4IV3A 2RS53 4WM8B 1BEV3 2RM22 2HWC2 5BNOC 3JD71 1V9U2 1QJX1 2RS52 1ASJ3 1BEV2 1RUD1 1CJDA 3JBG3 1B35C 1FOD3 3JD73 4QPIB 4RR3B 5ACA1 4LLFA 1PO23 5CFDA 1RUD3 4IV1C 4CEYC 2HWB3 4YVSA 1IHMA 3JD72 1FOD2 1RUD2 3JB8A 1ND3C 2HWB2 4AEDB 5C8CB 1BBT1 3ZFGC 1RB8G 4NWVA 1POV3 1TMF1 1VBC1 5D8AB 1BBT3 1VBB1 4NWWA 1HX6A 4Q4Y1 1RHI1 1NOVA 5JZGA 2BFUL 1QJY3 3TN93 1BBT2 1RUJ1 1RHI3 1RUI1 4JGYC 1RUG1 1VBC2 1QJY2 1RUJ3 1ZBA1 5C4WA 1RUI3 3VBFA 4N53C 1RHI2 1RUG3 1X36A 3VBHB 5CFDB 4RS5A 1RUJ2 1QJU1 2TBVA 1AYM3 3VBUB 1RUI2 1EAH1 2WFF3 1RUG2 1MEC3 5BNOA 1AYN1 5BNNA 1AR63 4CDXB 1K5MA 3NAPB 1AYM2 1MQTC 5AC91 5CFCA 4CDQA 4WM7C 1B35A 4GB33 1AL21 3DPRC 5J98B 5BNPC 4CDUB 1NCQC 3CJIC 4CEYA 1AR91 1AL23 1AYN2 4GB32 5AC92 1AR71 2RR13 4QPIA 1AR93 4SBVA 1QJZA 4RR3A 5K0UB 1AL22 3VBOC 1NA1C 1R093 1R1A1 4FTBA 1AR92 4N43C 5C9AB 4PDWB 1AR72 2PLV1 1AL0G 4RS5B 5C8CA 4Q4X3 1X33A 2HWE1 1R1A2 5BNOB 3ZFEC 2HWE3 2RM23 5DDJ1 5ABJC 2HWC3 5CFCB 1OPOA 2PLV2 1FMD1 2X5IA 1B35B 4Q4V3 2WS93 2HWE2 1TME1 3S6PA 4CEYB 4QPGA 1NCRC 3J8F1 1RMU1 1C8NA 4Q4V2 2R041 5DDJ2 2WS92 1TME3 1FMD2 1ND3B 1QJX3 5A32B 3VBHA 4WM7A 2R043 3VBUA 3ZFGB 1PO11 1TME2 5ACA3 1QJX2 1NCQA 1VB2A 3ZFFC 3LOBA 2R042 2RMU1 4CDXA 1PO13 3NAPA 2QQPA 5ACA2 1OOPC 4FTEA 2RMU3 4Q4W1 1PO12 4CDUA 4JGYB 1NA1A 1AR81 3VDDC 4N43A 2RMU2 1TMF3 4CEWC 4N53B 1VBC3 1VBB3 2X5IB 4JGZC 1H8TC 1PIV1 1AR83 4Q4Y3 1RVF1 4Y4YA 5K0UA 3HAGA 2Y26A 4BCUA 4Q4W2 1TMF2 1D4M1 4QPGB 5FMOS 1RVF3 1VBB2 2FZ1A 3JB4C 2ZAHA 1AR82 4Q4Y2 5C9AA 4PDWA 3VBRC 1VBE1 4YVWC 1MQTB 3VBSA 5ABJA 2WZR1 1ZBA3 1RVF2 4WM7B 5L7OC 1VBE3 1HXS1 1ND2C 2R071 3DPRB 2HWF1 2WZR3 5BNPB 1RUH1 1NCQB 3CJIB 1QJU3 1ZBA2 1OHFA 1EAH3 5D8AC 1HXS3 2R073 1VBE2 1DDLA 2HWF3 2WZR2 1AYN3 4RQPC 5AC93 1QJU2 2IZWA 4IV3C 1EAH2 1HXS2 2R072 1NY71 4IV1A 2HWF2 3VBOB 1NA1B 1PVC1 1VB4A 1QQP1 1R081 4N43B 2ZZQA 1WCDJ 1RUC1 3FBMA 1PVC3 1ND3A 3IDEA 2BUKA 5A32A 1AR73 3ZFGA 1RUC3 1NY72 1RUE1 4Y5Z0 1M06G 1PVC2 4YVSC 1QQP2 1R082 3ZFEB 1BMV1
chains in the Genus database with same CATH superfamily
3PIGA 1AUYA 1Z7S1 1CZSA 1YFXA 1RYYA 5LEJA 2GALA 2ORXA 2GN7A 4GALA 4AI1A 2CY6A 2PLV3 5FYVA 1W9YA 5FOJB 3S30A 1S1AA 1QOOA 4IXLA 3ZXAC 4WBBA 3CBNA 1PGW2 5L9BA 3MUZ1 2L9LA 2P3IA 2J22A 4HN1A 3AP9A 3MPPG 2PHFA 1VBD3 3TNQA 2NN8A 5K8SA 1DU3D 2Y6GA 5DDJ3 5FZDA 5GLZA 5FZLA 2WNEA 2AEYA 3T2TA 3LQCA 1ZZ6A 2P3YA 4CZSA 5M0TA 1LHUA 2WJSA 4O9EA 2BU9A 2PAEA 2H0VA 3IMMA 2ZBJA 5FQ0B 1FX5A 4O65A 1VBD2 2C5DA 3ZFFB 1G9FA 1CIWA 3AL6A 3DECA 5HCAA 3QH7A 4W6XA 1MQTA 1P8JA 2LTNA 5K7PA 5FXXA 2IWGB 3MI8A 4C1XA 3RZKA 2RJLA 1LTEA 1NG0A 1AVBA 1OOPB 4GXLA 3UETA 3NV4A 2CSGA 4RD7A 4UF0B 5BPXA 5LK7B 4YM2A 2VR4A 5FZOA 3CMGA 3J7HA 1C8M3 3CJIA 3ACGA 4FBFA 1H30A 5A6YA 2CL2A 3JBG1 2PELA 1FOD1 5K4LA 1UIJA 2Z79A 4CEWB 1I3HA 1U5ZA 1S2KA 4CCJA 5HV0A 5L19A 1GFF2 4NIDA 1WMXA 4CDQC 3AJZA 1IS6A 4Q0PA 1C8M2 3ZYHA 1W04A 5LK5A 2FZ2A 2ZGOA 4RGAA 3O1OA 4WV8A 2VQ0A 1BQPA 2BWCA 2WO7A 4RGKA 2OXBA 1XYOA 1WUVA 3MV01 4CE8A 4C90A 1BLZA 5B4XA 4UW4A 1JZ3A 1W8NA 3FHQA 4YGBA 5JPMB 1HW5A 4M3CE 3ZN4A 4CP2A 3ETPA 5KHHA 1O7FA 1PO22 2R6QA 1BZWA 2W1WA 4QPIC 3WDTA 1YO8A 3A22A 4GKYA 3GZUC 3N9OA 3HQUA 2XPJA 1PIV3 2UYBA 5BV6A 3NJVA 2OW4A 5A1LA 1W6OA 3HIFA 4FPGA 4LXLA 3ZPOA 4EJRA 2WT1A 1COV1 1Q56A 1FV2A 2CWMA 3LEIA 4HT1T 5EYYA 3JXSA 3T09A 4D3WA 1PIV2 4RFT0 4QKFA 1WW6A 1O4TA 3CDZB 3D3AA 3OBAA 4PBOA 5LBEA 4IV3B 5KC5A 3TRSB 3T08A 4Z07A 4RGGA 5FUIA 3HD8B 1VAKA 4ZPIA 3UYJA 4DPNA 4GD4A 4Q0QA 2VECA 5A33A 1DGRA 2P34A 2RS31 3C8XA 1ZRIA 4N9HA 1OVSA 2ZPXA 4IEYA 5EQUA 2ZKLA 3EJKA 5DAPA 5FYMA 3RZZA 5AVAA 2XJPA 3OEAA 1PGL1 3NV1A 5J96B 4IEUA 4AW7A 1G7YA 2MPFA 2WFF1 1OC1A 1J59A 2BFUS 2JB4A 5GKAC 1VAMA 2ZGTA 5FZBA 3PVBB 4HFSA 2OQ7A 1J1LA 2BERA 2DVGA 4QPGC 1W28A 1PX3A 4AR2A 1H6YA 2ZMLA 5I0UA 3SNMA 3GCXA 5JPNB 4R9AA 1Q8PA 1FPN1 4Y24A 2EIBA 3WD5A 5A3MA 1HV1A 2PHTA 1NE6A 4IEVA 1JHNA 1KEXA 5FY7A 2J7MA 3I2IA 2YUEA 3B7MA 4B8EA 3THTA 3UESA 1STMA 4AZZA 5DUXA 1DFQA 3VZLA 4ORFA 3VBUC 4XAAA 4GZ9A 2E9QA 1MZ5A 1W8TA 3HWJA 2JWPA 2DTYA 2P37A 3AVSA 3BGAA 1V6IA 5A6XA 3QACA 3AXDA 1HRI3 4LE3A 4GMP3 1ULPA 4JGZA 4PLOA 3SCGA 4O61A 3W9AA 1VRH1 1PMIA 3M3IA 1RL3A 2GH8A 2HBTA 5LRSA 4OHZA 1OA4A 1VBA3 2ZEYA 4HZFA 1HRI2 3OPTA 1LKNA 3ZSLA 3AP6A 4JRAA 2RR12 2XJRA 4Y20A 2MEV3 2VULA 2K0GA 2P1BA 4EROA 4CP9A 1CZTA 5AVPA 4YVWA 4AGGA 4QKNA 2Q5TA 4Q4X1 5IYYA 5KHKA 1OQ1A 4GIQA 2Y6JA 3EYPA 1R092 5K0UC 3VKOA 3I97A 4AHYA 3FLRA 4N90A 1BVP1 5FP9A 1UXZA 4RHV3 3FUQA 3B5LB 1U12A 5HI0A 2RM21 2JECA 2ZZJA 1MS4A 1D7PM 1PZ8A 3OPWA 4ISRA 1WCQA 3O1SA 5C9AC 1UU4A 4Q4V1 4RHV2 4EWEA 1PK6C 4BU2A 3BPZA 4UFJA 1BEV1 1QH6A 3VD4A 1VAVA 2ID4A 4CDQB 2B7YA 4RQPA 4P9LA 5GZFA 5EJ1B 1GOHA 4K8RB 2C4XA 4MGKE 2VOTA 4YLZA 4A3XA 5ANNA 1GP5A 3S5QA 4DRRA 2HWC2 2XVGA 1G9BA 2W92A 4D94A 4LIUA 2VUJA 4IERA 5CG8A 3RYKA 1CONA 1FV3A 1D2QA 4XC9A 1UKGA 1ASJ3 3IB3A 1RUD1 1PNGA 2FQPA 4XCAA 5DUVA 4INDA 4QPIB 3AMNA 4J25A 4MGZE 4JV4A 4A7KA 1VJ2A 5ACA1 3BU0A 4LLFA 4A41A 4G3YC 2ZX2A 2F4PA 1ST8A 4LO5B 4HVRA 4Y5SA 4EZHA 3ZXFA 1OF4A 3IIIA 3MF6A 4Y20B 4FFHA 5JOXA 2EICA 2GNBA 2IVIB 2KR2A 2QQWA 2WKKA 4CP9B 3MF9A 3ZX7A 2Y6LA 1MVQA 2XQRA 4XUTA 4I2OA 2G9GA 1GU3A 3WUDA 5FWJA 2X29A 1XE8A 3OGRA 1XYPA 3GBFA 3RMYA 3WW1A 4AHWA 3IMNA 3GF6A 2JG9A 3IDBB 3KHCA 1XU2A 1K45A 2BBAA 2D3SA 2XXZA 3LB9A 1POV3 2WO3A 4NWVA 5A70A 4TTGA 5CEHA 3B9CA 4LK6A 4PBPA 1VMHA 4NWWA 2WIIB 1C4RA 5IAVA 3VZNA 3RNSA 4K6BA 3OD4A 2X53S 4AVTA 5JZGA 1CAXA 1UF2C 2NPIA 1LJ7A 1MS9A 3KS7A 2J1EA 5G04L 4DXSA 1W03A 2AYHA 2FBEA 2YG0A 2DFCA 3M3QA 1RHI3 1TZOA 1NQDA 1RGSA 2BZDA 4NHYA 1LHWA 1UCXA 4JGYC 2FDHA 2X05A 2QDNA 4KWKA 4EQVA 1QXJA 2DVAA 1ZZ9A 3ACLA 5FZCA 4B4QA 1RUJ3 1J1TA 4TSVA 3UKTA 3VBFA 1RHI2 5FK7A 2JD9A 5E89A 1UYZA 1RUG3 3BPSA 1PK6A 2A6WA 3K46A 4XUOA 4QHZA 4D6SA 4COYA 1QHDA 1RUJ2 4NIHA 3VBUB 5IVJA 5A7NA 4QQHA 1W0OA 3WUCA 3B3QE 2VBPA 1RUG2 2VQUA 5IFTA 2ZX1A 1AF9A 3U78A 4TYSA 1URXA 2JG8A 1F4HA 1Y9GA 1AYN1 2DCKA 4Q1PA 4KNCA 1AR63 1UWWA 1K5MA 3POYA 5BNNA 1HB2A 1LOFA 2R16A 1WMFA 4ISQA 5FIXA 1U5IA 4WM7C 3I54A 1LOBA 2YFUA 5JLVA 3AFGA 3ZN6A 3DPRC 1YLLA 2A6XA 3AKPA 3OTFA 5BNPC 1NCQC 4YFWA 3VHNA 4BDVB 1CX1A 2VBBA 4HKOA 1KJLA 3K4AA 1HB3A 5AC92 2VD7A 1CAXB 3AP7A 3RZGA 3KCCA 2QQOA 2WAAA 1QJZA 1F5JA 3ECQA 4PQ9A 1GWMA 3L2YA 1ZM1A 3VDAA 4L11A 3WEZA 5K0UB 2W46A 4QD2A 2A70A 5DMYA 1PM4A 3P3NA 3VBOC 2OX0A 3M3OA 3RI8A 1GR3A 2OIIA 2QCSB 2YYOA 5H9QA 5JVVA 4BH9A 4N43C 4CA9A 3CHXA 1ZRCA 1N3PA 5C9AB 5A3UA 4E4ZA 1PZ9A 4Q8KA 4BISA 4HMZA 1PK6B 2PLV1 4R4XA 3WF1A 4HETA 4JVAA 4KH9A 3V65A 1YQ5A 1L3JA 4HKLA 3C7EA 4BYYA 3APBA 3ORJA 5F8PA 3ST7A 3U75A 3SLIA 4XAEA 3BTXA 1DLLA 2IXJA 2XL9A 2EXHA 3WY6A 3ZFEC 2BW8A 3OSDA 4PIZA 1JZ7A 4E4DX 5KHIA 4PIXA 3MBWA 1WLDA 1JBCA 5DDJ1 2NLRA 5ABJC 2RDNA 3N9PA 3O0XA 3UT0A 2VZPA 2OVUA 3WG2A 2X5IA 4YM1A 3IT8A 3KM5A 4AGVA 1V70A 4DB5A 4KWJA 3ZN6B 3JCIA 3G6JB 3PU3A 3LPGA 2WWUA 4LBOA 3BN6A 1DIWA 3S6PA 4OUSA 5L9VA 1N1VA 2RVAA 4AVVA 4X6QB 1T6GC 5DZEA 4OHYA 1GSLA 3U4SA 3TEZA 5KR7A 3EQEA 5TSWA 3ZSEA 4AFCA 3UKNA 2BNMA 1TME3 3H42B 5CKMA 2YGLA 5FO9B 1A3KA 1SFPA 4I0BA 2JDPA 5A3NA 1QJX3 2XL7A 2PN5A 4WM7A 4CSWA 2R043 2J1AA 1W8HA 1ZRRA 3HT2A 4D6RA 5EP9A 3KT1A 1W05A 4HBNA 3SCHA 4CCOA 1PO11 5FPVA 3RJ2X 1TME2 4W50A 2VG9A 1ULEA 5T50A 3O1UA 2IXKA 1QJX2 1NCQA 2D6MA 1RJ8A 1JUIA 2BJSA 3AMQA 2R042 3GXUA 3R0RA 4QXKA 4CDXA 3NAPA 4QKDA 2A6YA 2PQQA 1QOTA 1E5HA 4YZ4A 4G9SB 3MYXA 3ZVXA 2YC2A 1GP6A 5F2SA 1W90A 2GZWA 4FT8A 4FTEA 4IE0A 2RMU3 3D4KA 1REEA 2B46X 4JDNA 2GH2A 3W21A 1LR5A 3BCWA 3PMSA 4JGYB 3ZXLA 2ZAAA 1SFNA 2ZGKA 1OQDA 3H3LA 2Q8EA 3THCA 1AR81 3I59A 2VGDA 2VZUA 3ZYIB 3VDDC 4YGCA 4N43A 2RMU2 1TMF3 5AFEA 5IVFA 3ACHA 3H50A 4FCAA 5FZHA 3IAQA 5T5LA 1LGNA 3J7NA 2X5IB 3D0SA 3U14A 2Y34A 1PIV1 3KF3A 3ZN5A 2XGXA 3HAGA 2DU0A 2Y26A 4Q4W2 1HJGA 1TVGA 1TMF2 2VXRA 4CCKA 3RG0A 5C7GA 2EXIA 3JB4C 4CCMA 4R9BA 1X8MA 3VBRC 1NZCA 4XJAA 5DAVA 2QQIA 4BOWA 1W3XA 4FAGA 4XXPA 3HOBA 1NLQA 5ABJA 1LHNA 1S0EA 5IWFA 1ZA7A 4UBGA 2PA7A 4WM7B 4QPYA 5DG2A 4MO3M 4GAZA 3H3UA 2P5BA 4A7ZA 5L7OC 2WO2A 2CTVA 3AP5A 1BYHA 3SEEA 4XF4A 4DFSA 4CU6A 1PM7A 1QNYA 3NJXA 5JSPA 2NMOA 3AZXA 3C3VA 3DPRB 1OF3A 2PHXA 4NN0A 4NOTA 4XW3A 1H4GA 5BNPB 5HPOA 1S0BA 1NCQB 2DBNA 4H55A 4F83A 3I2OA 1NAEA 2VMGA 1MS3A 3LFMA 3OYWB 1A8MA 1WBLA 3WF4A 5GZDA 4FQZA 4M4PA 3EB7A 2OPKA 2E51A 5FZ0A 3R6SA 3U10A 2FCUA 1WGPA 3QH6A 5DG1A 4B4RA 1H6XA 2IZWA 1VLNA 1XYNA 1YCIA 4JDOA 5J37A 2XH6A 4AVBA 4IV1A 2D6KA 3K3OA 3VBOB 4UYBA 1VB4A 3N7LA 4N43B 5A3OA 4P9XA 3HN3A 4XILA 4ZU7A 4BQ2A 1WCDJ 1PX4A 2VQTA 1S2BA 2ZOEB 3QOPA 4LUKA 4ES8A 3I4IA 1PVC3 4BXSV 3WDVA 1ND3A 3VZOA 3TBDA 5CYYA 4IETA 4OMDA 2JB8A 1POQA 3JUUA 4D8MA 1NY72 2XKPA 1A8DA 3I7DA 4Y5Z0 5A6ZA 4NAMA 5CISA 1PVC2 1OFSA 4IQPA 3ZFEB 3RWKX 2FDIA 4NRPA 4FP2A 5FZEA 3K77A 1LECA 3AKRA 2PTMA 5ABJB 5F37A 4BB3A 4ARXA 1VBA1 2VZOA 3MEPA 3WQBA 2W9XA 3O5SA 3LEGA 2KM2A 4KU8A 2FDJA 2D43A 2MEV1 4LO6B 4H3WA 2BYVE 5DPNA 3WQ1A 1UPIA 1VMJA 3T0BA 3CU7A 1PHMA 1SDWA 2VC9A 4N53A 1ZNPA 1LODA 4YW5A 3BB6A 4RHV1 1UY0A 2E7QA 4CP0A 2GNTA 2HWD1 1C5HA 4GH4C 1QY4A 2C9KA 4IV1B 1FMD3 1OUSA 3KGZA 4X6RB 3LSEA 2AACA 3WDWA 5J1XA 2ZGMA 1MR5A 2ILMA 2YPDA 5T5JA 1C3HA 1NQJA 1GICA 4I3PA 1W0NA 5FPUA 4CU8A 3ELNA 1A6CA 5JIAA 1NLRA 4FPHA 5FYZA 1VPHA 1GOGA 3AKTA 4NVPA 4QX3A 5FZ8A 2B8MA 4AF9A 1CGPA 4YRDA 2JJ6A 1EYBA 1W9WA 3DN7A 5LASA 4LEJA 1UX6A 3NJYA 4P9GA 3PHMA 4AQ6A 4Y26A 1ZRFA 4MGYE 3PUIA 5KXBA 1ASJ1 2XJQA 4HONA 4XFBA 1G9AA 3INAA 1WLWA 3VDDB 2Y38A 1W8FA 2Y60A 2WNUA 2BEOA 3A23A 1U5XA 1UY1A 2ADDA 4FOYA 4C0HA 5HBAA 5A6QA 1UY2A 2R32A 5FZIA 1OA3A 5B2GB 5FP4A 1HJFA 2WAOA 2OUHA 3POSA 4E8CA 4WM8C 3ILFA 3NQHA 4ZZ8A 2BPA2 2VCCA 4XZUG 2Y6FA 1NLSA 3LD8A 1MS8A 5GLVA 4AYUA 4QU1A 2VNOA 3NJZA 3T4HB 4A4AA 3MZHA 2IFRA 1EV11 2NYYA 2MNGA 3VBRB 4BK4A 4E9KA 4XQ4A 1US2A 3FMGA 1POV1 2ZXQA 1HDKA 3AKSA 2RS13 5IW0A 1CAUA 2WLPA 3GJBA 3RGBA 5L7OB 2BVBA 4WVWA 3MIEA 1K3IA 3POEA 4DUWA 1QNWA 3CF6E 4Y22A 4Z2WA 3VZJA 3T0DA 3SMHA 3FL7A 1DGWX 5IVVA 3UGHA 1WLCA 2RS12 2CHHA 5IATA 1RXGA 2HH9A 3OUHA 2K2SA 1CAVB 4ZONA 2ZGSA 5HCHA 2ZJCA 4LT5A 1RUOA 3NNMA 4AWDA 2PQSA 5C8CC 2XJSA 3CIHA 1SACA 4GH4A 1IZ3A 1ENXA 2OA2A 3GNEA 1Q8VA 4AI3A 2WRAA 5KHJA 1IG3A 1OD3A 4QB6A 1GZWB 2GU9A 5CU1A 2JEMA 3TN92 3POJA 5FZ1A 3LEKA 1WD3A 2J42A 4CXYA 3CNAA 2LALA 3IIAA 4XFGA 3D82A 3WV6A 3FLTA 1XSQA 3H7JA 3WCRA 1AR61 4XBNA 2NQYA 2JKBA 2PHWA 1H9WA 4MSVA 3WP3A 3WW4A 3ZFFA 1RIRA 4FI9A 3AM2A 2BWAA 2J1SA 3BVCA 1QQP3 1R083 5C70A 1HRV3 2XVLA 4DY3A 2JDKA 4QQ2A 1OOPA 3WLUA 1XE7A 4FQ4A 3USUA 1MEC2 2QBXA 2WT2A 1S0GA 1H4HA 2YU1A 1SQ4A 1AXKA 1X82A 4Y22B 3ME2A 4WM8A 1KRIA 1HRV2 1YHFA 5LBCA 1DZTA 3LCPA 3HBKA 1V00A 5JXHA 2WSUA 5FYUA 2ET7A 2RG4A 1RUE3 4PI0A 3FC0A 5H9PA 3WW3A 5SV8A 4R8HA 4CEWA 5LW9A 4HLTA 4KWLA 4B3NA 3ZSKA 1ZBE1 1UL9A 4ATFA 4PI2A 4GH4B 4YM3A 3UKVA 2A71A 2GC0A 1RUE2 2XBO3 4LOSA 1O8PA 3M3CA 3M3EA 3WP4A 2DUOA 3WQ7A 3BIEA 4Y5TA 3UV9A 2DBIA 1RUF3 2Q1FA 1H2LA 1JYIA 2ZCWA 3PUHA 4Z82A 2XBO2 3LIHA 1SLCA 2R063 2VTFA 4A45A 4R52A 5A7WA 3GCWA 2LS6A 3M8LA 3TOJA 1CPNA 1RUF2 3RZJA 2ERFA 3JQWA 2JDYA 4FPFA 4PF1A 1GANA 3T2OA 1PNFA 1W0PA 1EPZA 1SLTA 3SH4A 1OA2A 3GM8A 3RZLA 5FLIA 2R062 4LBJA 3ZYBA 1UY3A 3BODA 3MO4A 3SC7X 4LNVA 3IZOA 1JXNA 4D7TA 4JQTA 4I01A 4PDWC 4IEZA 1IS5A 2QTWB 2VNGA 4Z92B 5FPBA 3VBSC 2V73A 2VPVA 2W1UA 4LBNA 1MZ6A 1ZREA 4RS5C 4WVVA 4GWJA 1V9U3 5F2WA 4QAWA 4IV3A 2FCTA 3USUB 3BU7A 1F5FA 2RS53 2CV6A 2W68A 4WM8B 3OBTA 1ULCA 3FBYA 3P6BA 4OYUA 3LAGA 4B4PA 3FHIB 5BNOC 5JMOA 2VZRA 2Z2SB 1W6NB 3I2HA 4BZ4A 1V9U2 4GWNA 1QJX1 2WDBA 2DCZA 2RS52 4ES9A 1F35A 3NV3A 3ZIXA 1CJDA 1CPMA 1X8EA 3ALQA 3JD73 3NW4A 3VB9A 4QDRA 2ZS6B 3Q8BA 3THPA 4V2WA 3M1HA 4A6OA 1PO23 2P17A 1GBGA 4URAA 4YW3A 1UOJA 5JIUA 3WNLA 2HWB3 5FMBA 1UZYA 4XFCA 1IHMA 3JD72 1OLQA 2A3WA 4XFHA 3VKMA 4OCTA 1IKPA 1O91A 2A6ZA 2QQKA 3GDBA 3PTRB 4QX2A 5CA6A 1PGSA 2Z5WA 2ZGLA 5K9YA 5A7WB 3Q8CA 2HWB2 2Z4FA 3U4XA 3FE5A 4ZZ5A 5C8CB 1UY4A 2C9AA 1BBT1 3MFAA 3ZFGC 3ZXDA 1HB1A 3LA3A 3LEMA 4L99A 5IK7A 5C5UA 1TMF1 4YW6A 3CO2A 2OQ6A 3ROUA 4YZ2A 3AXEA 2EIEA 2P6CA 5FAXA 5LBBA 3RVHA 5FO8B 1GP4A 4AI2A 1QJY3 3TB0A 4DEVA 1RUNA 5DUWA 1MACA 5FMDA 4UT5A 3ILNA 5FUNA 1W9TA 4FPEA 3C7FA 2JE8A 3TEXA 2YV8A 1LCLA 5HXVA 3ZXKA 4P00B 5A7PA 3ITQA 1VBC2 4LUMA 1SEFA 1QJY2 5HV4A 4F8AA 1RUI3 1US3A 4HPKB 3I2FA 2O0OA 5F5AA 1FAYA 4BK5A 3T0AA 2ZGNA 4D7SA 2BGPA 4XFIA 2A3YA 5FREA 4DINB 4RS5A 2ZX4A 2ZHMA 2E7TA 5CKNA 1RUI2 3SKVA 3BALA 3IPVA 1LHVA 1VIWB 1YC61 4P5YA 2HEWF 2A75A 3DYOA 2NM1A 2UU8A 5BNOA 1W9SA 1WW4A 3AVRA 3A0KA 4LHNA 4XVHA 4CDQA 1H9PA 1AX0A 1SCSA 4QX8A 3T30A 1JU4A 3WHUA 2Y0OA 1DCSA 4KGQA 5FJKA 1O3QA 5F3GA 3KSCA 3CEWA 5GJ6A 4CCNA 1AR91 2Y0IA 1AL23 1I5PA 2ZGUA 4NPLA 3WINE 5FDBA 1LESA 4PLNA 3P3PA 4S2DA 5I0RA 4XBQA 5F6LB 4EV0A 2RR13 4CTEA 5EPAA 4QPIA 3AMHA 1UOBA 1ZZBA 2Y33A 5C3RA 4KU7A 3PJYA 5C6CA 1AL22 4OUEA 3UGFA 4QDSA 4KBZA 3NSTA 1S0DA 3KVAA 1R093 4MZUA 4P9WA 3GGLA 1MS0A 5FYBA 1LRHA 3TEWA 5A3TA 3V0AA 1NX9A 4PDWB 4QXHA 1AR72 2VW0A 3TNPB 5FZGA 1CR7A 2VAUA 3VLBB 1XSRA 2Z69A 3D5OA 4MHUA 1NT0A 4BMBA 4NHXA 4RS5B 1BKZA 4QX7A 4ATEA 2O8OA 3KF5A 1FNZA 5J48A 1X33A 2CGNA 3ASIA 4W6WA 2HWE1 3IPVB 4FPKA 1I6XA 1LOCA 1R1A2 4HN0A 4JCKA 5FBJA 5BNOB 1ENRA 2XMLA 3SH3A 2AZ5A 4MX3A 4AVAA 4BJ0A 1L7LA 1ODMA 2HWC3 5IAXA 1W2UA 4K1ZA 4QMAA 1OPOA 1EPWA 4LJHA 4NUBA 5KC6A 1FMD1 2J1RA 2XHKA 3C2UA 4AFBA 1UMIA 2QQMA 2DCJA 4AQTA 4Z8BA 5F5CA 5A3LA 2WS93 3NWKA 3T1LA 3VZKA 3AZVA 2G19A 5EZWA 4QPGA 1NCRC 2UWCA 1H8VA 2GNMA 2YBKA 4P9JA 5EIYB 2YFZA 2BGCA 2H6CA 3B94A 4IGQA 2D44A 4BQXA 1DGLA 3WG4A 2H0BA 2WS92 3POFA 4OI0A 1AXYA 1I9RA 1YUDA 1HQWA 3OEBA 1OH4A 3A0NA 4Q27A 5A1AA 4YFZA 4XQWA 3VBUA 4JKMA 3ZFGB 2G9FA 1JU3A 5LA2A 3DYMA 4M4RA 4OHXA 5JOZA 3V0AB 1NXMA 3LOBA 3H8UA 1YXWA 5LA0A 1JW6A 4OHWA 1IS4A 1WA6X 4F7ZA 3ZXEA 5FZKA 3A4UA 5A3WA 2Q1MA 1PMHX 4FOQA 4KGGA 3UK9A 4AE2A 5F3CA 1D0GA 2YXSA 3N9NA 2VZ3A 2PHDA 3LA2A 1XNDA 1OXCA 1IPKA 1MZEA 1TE1B 5JOYA 1DZRA 5FTTC 4K7JA 4DO0A 5FY4A 2V5YA 2VY0A 2QUOA 2NP0A 1H8TC 1X9TA 3LKJA 4OI4A 4Q4Y3 5I8TA 5JSRA 3NNGA 5FY1A 2O14A 5K0UA 2W95A 2BOJA 1DZQA 2MHFA 2ATFA 1VP6A 2DV9A 4C0BA 4QPGB 4OQ8A 1RVF3 3AZWA 5HCFA 4NHLA 4LMFA 2IC1A 5A7QA 4Q4Y2 1RINA 3H8OA 1C1FA 5C9AA 1DQ4A 4AVCA 2E32A 2NMNA 4K21A 4ZU5A 3WVJA 1GWKA 2VNRA 4DXRA 1XJAA 1GZ9A 2WZR1 1ZBA3 1RVF2 5CZKA 3FUOA 3R4SA 4PHZA 1VBE3 4YGEA 1ND2C 1QJEA 2UYAA 4M3CF 5KXDA 1Q43A 2WYFA 2HWF1 3KV9A 4MUVA 4L9BA 4R9CA 3NL1A 5T54A 4XUNA 1QJU3 3H8RA 1ZBA2 3LOIA 3W58A 4L2NA 5D8AC 1E5RA 1HXS3 2QJVA 5FR3A 5IVCA 2R073 1VBE2 2IVJA 3AFKA 4IEQA 1ULGA 2E6VA 4XMIA 4XHXA 3B69A 5F3IA 5FPAA 5HCBA 1CJPA 5BXXA 3RI9A 2DVDA 1QOSA 1AXZA 1LOAA 2PAKA 4JDMA 4NIIA 3X29B 4BIOA 1QJU2 5AC93 5J36A 1S2EA 2YC4A 3RFRA 1HXS2 2K46A 2R072 4LKSA 1WCSA 2W91A 4QU2A 1QQP1 1R081 5DXDA 1KGYA 5IVYA 1JZ4A 5F9TA 2RJKA 1R64A 1U0AA 2J1UA 4G4FA 1F4AA 2EAAA 4XF3A 5F3EA 3CL1A 4JKKA 4LHLA 3IDEA 4YNIA 3GJAA 3MUY1 3OBRA 5JXJA 5C3QA 3S0MA 4LQRA 4EWDA 5C8WA 1RUC3 4TLFA 1YYNA 3ZYGA 5LATA 2CWSA 2AENA 1RUE1 1M06G 2N7GA 3LDRA 3MW4A 4YVSC 1K5JA 4XCBA 2XLFA 1UZ0A 1QXRA 3GHMA 1W99A 3KV4A 3WQ0A 1PGW1 2LUWA 4Q0VA 5KWRA 1RUC2 1D0HA 2GSYA 4P02B 2W94A 2ZHLA 3N3HA 4LBLA 4Q29A 2E63A 3FFZA 3OB8A 5D1IA 1OT5A 1KS5A 3FJSA 1W6MB 3KV6A 4O7XA 1ULDA 4YW4A 5F7UA 2O8QA 4EYUA 1OLRA 3M2MA 3DKWA 4JGYA 4KI5M 1XNTA 2VVEA 3DF0A 4DXTA 5IHRA 4MXVA 4XF1A 4A42A 1VBD1 2R061 4TLGA 4E8DA 4Q0UA 4XYXA 2BDRA 2VBDA 4NIGA 3I3DA 2W47A 3KZ4C 5FPXA 1LENA 5GM0A 4YG6A 4OUMA 4EN9B 4XZPA 4M3CB 2HBUA 5I8YA 4AK3A 3H8XA 4DOUA 1OURA 3ENRA 4QGMA 1UYXA 3WNNA 3ZR6A 1ND2A 2ZEZA 1JZ6A 1VR3A 2HYKA 2QVSB 1KFUL 2G9ZA 2SLIA 3H1WA 4LKEA 4MG2A 2V72A 2VCBA 2A6VA 3RRDA 3WCSA 5HXMA 4CVUA 5C4WC 2ZHNA 4YG0A 4ZHNA 4D7YA 5A80A 3THDA 5E88A 4DZGA 4HXCA 2RS51 3AMPA 1J83A 1RMU3 3U0ZA 3ON7A 1L7RA 4LO8A 1C8M1 3DUIA 5DZGA 3NV2A 4IEOA 4HK9A 1FT9A 3PVNA 5GZEA 3DPRA 4BQ3A 2JKXA 5BNPA 5CB7A 4FSJA 1RMU2 1E57A 3EMRA 5C3OA 4UW6A 3HT1A 4AQSA 4ASKA 3OYWA 5E16A 1KFXL 4N7UA 5LBFA 3ZKYA 4CP1A 5IFPA 3N4MA 3LF7A 3WW2A 1Y3TA 1PO21 3RWNA 3ZLIA 4J6GA 2PHLA 4Y1XA 5CFCC 5GZCA 1H8TB 1UU5A 4LOTA 1JOPA 1WW5A 2HWB1 1DQ1A 4K1YA 1WZXA 5FMOL 4OMCA 3VBOA 1YI9A 2YB7A 3S5AA 5JOWA 5IK4A 1SG3A 1IPJA 4Q4W3 3N7KA 3KVBA 4KBBA 5E6HA 3JBG2 1Q5OA 2QQJA 3LGRA 1BK0A 4B29A 4FPJA 4ZS3A 5JR7B 2DWRA 2SBAA 1W06A 1QH7A 2WLQA 2YBPA 3K3NA 4IGPA 4OZOA 1JI6A 1GNYA 1OQEA 1ZA4A 4RR3C 4C91A 1NE4A 5FXWA 3P5BA 2D40A 3NKGA 4MVTA 5LRRA 4Q5OA 2DVBA 1ND2B 2AREA 5DABA 4UOJA 2WWSA 4QPWA 1EP0A 3ZFEA 4MYEA 3MHZA 3MPBA 4XXAA 1D4M3 3KLSA 3W20A 2GMMA 2DF7A 5FZ3A 1QJY1 4I02A 4Q1RA 3MIGA 4XJ8A 1N3QA 3POIA 1LB2A 1COV3 4XOGA 4AEDC 1LAJA 1D4M2 1XE0A 4JHTA 4K9SA 3U07A 3BOWA 4RFRB 3JU9A 1COV2 1LNSA 4CCLA 5JXGA 3IDAA 3MDPA 5FLJA 4LBQD 1RUH3 1UOGA 4LR4A 3DL3A 1OD5A 2C6SA 3OGJA 4QHOA 4XTPA 5KXCA 3BI3A 2RS33 5FYSA 1S4CA 2RJ2A 2XJVA 3FWEA 4P9IA 3GBGA 2R49A 4Y4RA 3O1TA 4I09A 3DKQA 3O1RA 1RUH2 2JDAA 4W8JA 1OUXA 4TZDA 2D7FA 2W08A 1H1IA 2RS32 4IESA 4YVSB 3OCPA 1W39A 1VRBA 4MOAA 1I5ZA 1LGBA 2IXCA 3PDQA 5FBZA 1SLAA 3RMXA 3WF0A 4B1MA 1TNFA 4DIQA 3PMEA 4EE2A 1UXXX 1CQ9A 1NXD1 2I45A 4M0NA 1PGL2 3KCYA 4MGSA 1TNRA 1RITA 1YI7A 2BGOA 3ES1A 1PZ7A 3NNLA 4URTA 2WFF2 3VBHC 1FPN3 1HQNA 5CFDC 3BUCA 1H1MA 4XFFA 5FZ6A 1Z0HA 4X8NA 5CBLA 3N36A 3BKZA 1HRI1 3PUQA 4GMP1 3OG2A 5H9SA 2JE7A 4KWUA 2RR11 2ENRA 2RDSA 3R4DB 2IXHA 1FPN2 3ACFA 4UI9L 2EIGA 5A7OA 3HVDA 4IW3A 1GYKA 3VDDA 3C7GA 4XJWA 3NMBA 4NRQA 3NRUA 2AUYA 2W3JA 5ANQA 4YW1A 4FFIA 1O5UA 3L9JT 3BYWA 4DRVA 1R091 1J58A 3OGSA 1J3RA 3L2HA 2BRTA 2CAVA 4UFLA 1TG7A 2BOIA 1YQ2A 2B4KA 4CDUC 4IL7A 2KXLA 1VRH3 3T2QA 2JE9A 1BMV2 1Y9MA 1ZZ7A 1ACCA 3POGA 5BUVA 5C4WB 1AZDA 3MICA 1XNKA 2JDMA 5FYTA 3VBRA 4LO4B 2UWAA 1VALA 4EN0A 1LGCA 4YSFA 1T2XA 3MLKA 2EALA 1G86A 4Y1YA 1VRH2 2BQPA 5FKCA 1JTZX 4I30A 4AEDA 4B7EA 5L7OA 2R0HA 4FVVA 1RXFA 4NRMA 1UD1A 2VMIA 4P5HA 3KQRA 2HWC1 2Q8DA 3ZMOA 2NZ9A 2CGPA 5EWSA 2OPWA 1CAVA 2WT0A 3WNOA 4Q4X2 2WS91 2GC1A 2V09A 2VUAA 2PAMA 4P9YA 3HMYA 4Y1ZA 2PYTA 3ETQA 3HN1A 2XOMA 3VHRA 5LA1A 3ZOIA 3PTYA 3RYRA 1O8SA 4CUBA 4HSJA 4BQ1A 1IS3A 1BEV3 1V6JA 4JX0A 2RM22 4L92A 3M4FA 5L36A 1GZWA 3AL5A 2WNOA 4Q26A 4LA3A 4ZY9A 1DLCA 1EUUA 1X50A 3DCQA 4NROA 4XDQA 5C3PA 3DXUA 1BEV2 1ZX5A 1W8UA 1REDA 2CDOA 2QQNA 2QQUA 4RR3B 2XQXA 2E31A 5ISLA 5CFDA 1DQ6A 1CX4A 1RUD3 2ET1A 4PT6A 4CEYC 5F5IA 4WZCA 5A3PA 3AYDA 5FYYA 5F39A 3VV1A 1WCKA 2VOVA 2J1TA 5FYIA 1SLBA 3WNMA 4BQ5A 3V56A 5JCTA 1RUD2 3JB8A 4ZS2A 1CIYA 1IKQA 3NO8A 3VL9A 3EBRA 3O14A 4AEDB 2HLEA 2X10A 3PL0A 2XVKA 2D6PA 4QKBA 1AJOA 4WZFA 3VKNA 3WG3A 4EN6B 1XNCA 1KDMA 3HNYM 4BLJA 1REFA 3OPZA 1OVPA 3FN9A 1OLME 2R0FA 3KT7A 4FPYA 1HX6A 3C7HA 4Q4Y1 1W8OA 5DQ0A 2FCVA 3T4VA 1RHI1 1NOVA 1W2OA 1LEDA 2ARAA 3FLPA 5DUUA 4CRQA 4R4ZA 5KBFA 1HLCA 4OHVA 5C71A 2BFUL 4WVMB 3WG1A 3TN93 1KQRA 3OUJA 4YYOA 2WN3A 1G9CA 1RUJ1 3AC0A 3BIWE 3HNBM 4TWTA 5T55A 1I1EA 1JH5A 1N1TA 1Q8QA 2OZ6A 1RUG1 1XPWA 4GWIA 4LIVA 3OD0A 1O3SA 4K8FA 3B93A 1JOBA 1ZBA1 5D2AA 1C57A 1WW7A 2H6BA 4MXWA 5FK8A 4KG0A 3I49A 1YRZA 1CESA 3FZ3A 2A7AA 1X36A 2HJIA 4W4ZA 3E6CC 3VBHB 5D21A 5CFDB 1J3QA 1V6LA 4IE4A 1QJU1 2TBVA 1AYM3 3ZSMA 2RDQA 1SBDA 4H14A 4LORA 1C1LA 2B5HA 3HQXA 3MIHA 5LA9A 3VD7A 5FP7A 2UY8A 4M0HA 1DGWA 1MEC3 2QE3A 3SKJE 3DGTA 2FHRA 4OVEA 3H9AA 4YZ1A 5IK8A 1V6NA 4JKLA 5AC91 2XUMA 1AYM2 1MQTC 2YZ4A 3Q8AA 3U11A 4OQ9A 2EIDA 5IT6A 1GNHA 1PMJX 3CJXA 4A7YA 2W39A 4DMIA 1W6QB 3KB5A 4GB33 1UMHA 3ZPYA 5APAA 5SV5A 4A2UA 4NIAA 5JMCA 4CDUB 2LW8A 1QU0A 3CJIC 4CEYA 4ONUA 1W6NA 2D97A 4UFMA 3GZAA 3WZ1A 4DQAA 1AYN2 4BQWA 4HG6B 4GB32 4UAPA 4D0QA 1DYKA 3BTYA 2DFBA 3VHOA 3SISA 3O0WA 3Q9OA 4L0PA 3VD3A 3JQXA 2XKOA 5A1FA 1LU1A 2F4LA 4E2GA 1SDDB 5JI9A 1DYPA 1DGRN 2JDUA 1DYOA 1NA1C 1YJKA 4MGTA 3NNJA 2ADEA 1QKQA 2VM9A 4FPLA 1D4VB 1DF0A 1GQGA 2F17A 1JOJA 2W1SA 5B4NA 4MXWB 4NPMA 4PF5A 1ZVFA 4UW3A 4S2FA 3KD4A 5FFOC 4XACA 4IE5A 1SCRA 2WN2A 4WVZA 1AL0G 2W0XA 4XEZA 5C8CA 2YGMA 4JC1A 4YZ3A 1JUHA 4RSUA 4AQ2A 2X09A 4UWDA 1HN1A 2FMYA 1GUIA 1AJKA 3I2GA 3RDIA 2D6NA 1KXGA 2E53A 3FX3A 4YW7A 1WWYA 1RC6A 1W2AX 2B45X 4LHSA 1JYWA 4LE4A 3MIBA 3WNPA 1IGOA 2PLV2 4SLIA 1HN0A 4XF9A 1Y43B 3RJRA 1IOAA 4ZKTB 2GMPA 2B39A 2VMDA 3C7OA 1TME1 3D8CA 3PURA 4CEYB 1S55A 3AX4A 2FD8A 4QB2A 1ULFA 3SEPA 2CU5A 1XB9A 1RMU1 1C8NA 4UFHA 3FHAA 3A21A 4HPKA 2R041 5DDJ2 1LOGA 2A5ZA 1CVNA 2VZVA 2B9UA 3IAPA 4OFGA 1YFYA 2CNAA 1C28A 1MPXA 1UX7A 3K51A 4DEQA 3AB0A 3E6DA 5A32B 1A78A 5E8AA 2YU2A 1R1ZA 2JD4A 2C0ZA 3K48A 3LSDA 4CUAA 4YPJA 3RZHA 2JENA 2BTVC 2PHRA 2TNFA 4IUGA 5DZFA 4CU7A 2OZJA 2RMU1 5FPLA 1PO13 4E2SA 2HKXA 1S0JA 4XUQA 2D93A 3MIDA 1O3RA 4P14A 2QQPA 4QM8A 4J1WA 4Q4W1 3TWIA 1MVEA 1DQ5A 1JYCA 1PO12 1O4ZA 2K9ZA 4PQQA 3K75B 4NE9A 1NA1A 2W1QA 3ZO0B 1GNZA 3GZEA 4COUA 4BLIA 1IQDC 1JN2P 1GZCA 3ATGA 3PUAA 3FFQA 1JYVA 3VUOA 2DVFA 1VBC3 4XIKA 1VBB3 4JGZC 2W2IA 4D69A 4CPBD 1AR83 1YQ6A 2B9VA 4Y4YA 1O6UA 2WZEA 4IE6A 3ES4A 3ZYFA 3W5NA 4BCUA 1FATA 1D4M1 1QGLA 3J4UH 3PNAA 3ZYPA 4XBLA 1V6KA 1VBB2 1E5IA 2FZ1A 4RA0A 3K4ZA 2ZAHA 2ES3A 1AR82 4XQDA 3SCFA 2WYSA 3ZIWA 2WBKA 2W5FA 2ZX3A 4PDWA 1WD4A 4YVWC 3ZKUA 1MQTB 2YY1A 4QQLA 3VBSA 4AI0A 2R1DA 3BTAA 3O0VA 2W52A 2C24A 3NVCA 4UFKA 3U1XA 3WDYA 1H1AA 2KD7A 3ZYRA 2ZMKA 4ET7A 4YARA 4FOVA 5FZOB 1RUH1 3CJIB 3IN9A 1OHFA 1EAH3 3DEMA 4K20A 2XG3A 5IJRA 5FV3A 4S2HA 4ASLA 1DDLA 1OLMA 1WMDA 1OH3A 3AK0A 4LBQA 5KXEA 5C5TA 4RQPC 2R7EB 1H0BA 4BHPA 5I0SA 5FP8A 4AGRA 1EAH2 3O1MA 3MGUA 4CXWA 3VKLA 1NY71 2YPJA 2WWJA 4C1WA 2BNOA 1S0IA 1NA1B 4LKFA 2CGOA 5CG9A 1PVC1 4YWAA 1W6PA 4NMIA 2YBSA 1DQ2A 2I74A 2QQLA 5FLHA 2ZZQA 2JX9A 3T3YA 3WOGA 3FBMA 2BV4A 3WHTA 2JDHA 2ZKNA 4LO7A 2VCMA 3POWA 5CKQA 2JIGA 4XURA 5FOBB 1IPSA 3ILRA 1WKYA 1AR73 3ZFGA 2DU1A 2GMEA 2J1VA 5FJHA 1G8WA 2XJUA 2VNVA 3OY8A 1W6OB 3M70A 5I93A 1WMEA 4HK8A 2VW2A 3H1MA 1BMV1 1JHJA 1JS9A 1R1A3 3VBSB 1J84A 4FXKB 1BJQA 1TQ5A 2HEYF 2VCAA 3EXUA 3LWCA 4META 4P08A 5GLWA 2WR9A 3KV5A 2DTWA 3PIJA 3RS6A 2P3JA 4E4HA 5LZ6A 1AHSA 3K2OA 4QX0A 3V0BA 1HV0A 2JG9C 1CZVA 4QWNA 4CDWC 1RJ7A 5I0DA 3OJBA 3USSA 3ZDVA 1DP0A 4CUCA 2VU9A 3LE0A 4JRLA 5A33B 1W8WA 3MLJA 3OBZA 3WSOA 2QDRA 3WF3A 3G7DA 4ZXEA 3KQ4B 4QGNA 1W9FA 3UJQA 2D6OX 4LBQB 2OS2A 3AZZA 5JZGC 1VBA2 1ENSA 1WA4A 1JZ5A 4MV2A 1UQXA 4QX1A 3Q8FA 2MEV2 4DS0A 3PVOA 1UU6A 2A73B 2DCTA 2EXKA 3E6BA 1UKRA 5EHDA 1CD3G 2HWD3 5L73A 1W6PB 3AMMA 2BP6A 4N7IA 5FXZA 4B7KA 4FP3A 2R30A 1FYUA 3KHBA 5FPZA 1O3TA 3AKQA 3VBFC 1QWRA 5FXVA 3J8F3 4XE9A 1JYXA 2ZGQA 3H3ZA 4XJZA 2HWD2 1JODA 1M4WA 2OT7A 4GQ7A 1IQAA 1SFYA 5LB6A 3J7MA 3K4DA 4CCDA 2ZTNA 3OY8B 4FPOB 1SPPA 1KD7A 1UOFA 1ZZ8A 1XXNA 3J8F2 3LDKA 3WNXA 4QXCA 2WUHA 4BMEA 1W2NA 1XNBA 2PXJA 2JG8C 3I3MA 3VDCA 4AFAA 5GLUA 3WDUA 4AFDA 2PFWA 5BNNC 1K5MC 1OKQA 5EJ3A 5CNAA 4COVA 1LOFC 4E4SA 1UNBA 3WX5A 1H2NA 2YROA 2VW1A 2VZSA 1WBFA 3O12A 3QBQA 4JGZB 4JAAA 4NHMA 5JSOA 1LHOA 2ZX0A 2ZGPA 3V0BB 1VMFA 2UURA 3N7JA 3OGGA 4N8MA 1W3VA 2D5HA 1ULOA 2E26A 1KJRA 1GQHA 3KCXA 2AH2A 2EXJA 4XABA 1XRUA 2P2KA 3GZTB 4V2VA 2ZHKA 3E5XA 1V0AA 3OUIA 2ZEWA 3OOXA 4GMP0 1ASJ2 1X9PA 3QLQA 4XMAA 1CN1A 3ZMNA 5JDBA 2RS11 1ODNA 2GP5A 1QF3A 4LLOA 4YVWB 5FY0A 2F6BA 2R1BA 1F2NA 1CAWA 2WSVA 1LEMA 2DYCA 2WZ8A 1EV13 2D98A 4LHKA 5JI7A 1VE0A 3HEIA 4CDWA 1U5YA 3D0JA 1UZWA 2WQZC 2Y64A 1SLIA 2WABA 5FUPA 2HYXA 5J09A 4Q0SA 4XUPA 1EV12 4HKWA 3ZXJA 2FMDA 3OGVA 3TN91 1UYYA 3O1PA 4IEPA 1A34A 1BCXA 1AX1A 2VMHA 4RQPB 1Y9QA 2UWBA 1PVXA 1B09A 2C1FA 1EY2A 1N3OA 1W6MA 1YJLA 3IBMA 1UW8A 2XLGA 1QXPA 1SBFA 1SPPB 4HVOA 4K40A 3SH5A 2XR4A 4PCRA 3HR9A 1GKBA 1W8ZA 1NCRA 4IGOA 2VTXA 1YQCA 3S57A 1OKOA 1Y4WA 1YIFA 3D6EA 3I2DA 2WZPP 1XOYA 4AHZA 2BBVA 1UIKA 1AYM1 2WNVC 1CWPA 3R05A 2X5IC 3N9MA 2ORZA 2VE1A 1SLLA 3HBZA 4M3CA 2G1MA 5ERLA 5FZMA 5I0TA 1JMUB 1MEC1 5T5OA 4BPZA 4I0WB 3JZVA 2DUQA 1HRV1 2VMFA 2X8KA 3R4UA 3VHPA 2GC2A 3WP5A 4CUGA 4EN7B 4ZU4A 3T1MA 1K12A 4COWA 3ZXGA 1LU2A 1APNA 2YDEA 1CAWB 1GV9A 2XWJB 2CAUA 1IG0A 4GB31 5FYCA 1LOEA 3LFIA 5I8SA 5LY2A 2XDVA 2YC0A 3AZYA 4AEKA 1JYTA 4QXBA 1OSGA 2JG9B 1BK1A 1J3PA 1UN1A 4Q8LA 4CDWB 3S7EA 1AR62 3POBA 5JXIA 3VD9A 5FZFA 2XLAA 3LDBA 3RSJA 3SHRA 3WR0A 3I3QA 4OZXA 1F15A 2A1XA 3J7LA 4GJZA 1SMVA 4LBMA 4QDQA 4V1PA 4D6QA 5BY5A 4CDXC 3NAPC 3IWZA 1N1SA 4LPLA 3W59A 3ZDSA 2WC2A 2XBO1 1GQPA 1POV0 4GJYA 4NAOA 1H8TA 2QZ3A 5EV7A 5JZGB 1UPSA 1QIQA 3F2ZA 4W6YA 4QM9A 1Z7S3 2DUPA 5FYHA 4BE3A 1RUF1 3E1F1 5KHGA 1OFNA 3PJQA 1ZBE3 2IFWA 1UO9A 1NCRB 3NNFA 4TN7A 4XJ9A 1HQLA 4CYDA 4CU9A 2VO5A 2WQ8A 4NR1A 2V4AA 1OI6A 5LY1A 1F8VA 1SHWB 3QD6A 1Z7S2 3URFA 3VBFB 1DG6A 5FY5A 4JQRA 1ZBE2 3TYJA 2VVFA 2DURA 5T52A 3E5QA 2GP3A 3LIGA 4IDZA 5C3SA 4XJUA 4ZXKA 4MGIE 3H7YA 4MLOA 4DXZA 1N47A 3AP4A 3MV11 3B01A 2VOWA 4HANA 4U36A 1ZRDA 1QJFA 2LRPA 2FDKA 2JG8B 5D8AA 4AL9A 2IUWA 1V9U1 2QFEA 3QCWA 4IE7A 5BNNB 1K5MB 3WT3A 3VZMA 1NKGA 1QDOA 3T2PA 1QEXA 3CQOA 2WNVA 4R9DA 4OI1A 1NZIA 4OLLA 1SZBA 4MADA 2HEVF 4S2GA 4X8PA 4H7MA 3HPNA 4MGQA 1L7QA 1UZVA 4NO4A 5IVEA 2RV9A 5C33A 1RTVA 2AC1A 4FFGA 2YMZA 4QHBA 3JD71 4F3JA 2WO1A 5BNQA 1XC6A 5DN2A 4KL1A 1FNYA 4AI8A 2DDUA 2GC3A 2RDRA 4NHKA 3N35A 2G4IA 4AEMA 3JBG3 1B35C 1FOD3 1MZFA 4YG3A 5EFUA 1NYWA 5FZ9A 3TEYA 4C8DA 5FCCA 4XTMA 1G9DA 3KGLA 4PIYA 2EVXA 5DAQA 4MHRA 1YIPA 4IV1C 4XDPA 2UY9A 1H2KA 2Z42A 5JR2A 4YVSA 1FOD2 2VZ1A 1LULA 3RPQA 2QKDA 3BOPA 1D2SA 2ZMNA 5FY9A 1ND3C 2XWBB 5F5QA 2VQAA 4YGDA 2TUNA 2EA7A 2RHPA 1RB8G 2ARBA 3EO6A 3LA7A 4NJ4A 3I2JA 3N9LA 3PU8A 4UW5A 4N9IA 3U37A 4QT6A 3HNMA 3DV8A 2V5DA 1VBC1 3DYPA 1BBT3 1VBB1 1WCUA 5D8AB 2XUEA 2WINB 1Q3EA 3TAYA 2GN3A 5LWBA 1S0FA 2GDFA 2Q8OA 4HVQA 1UMZA 2WNVB 4O9GA 4XPVA 2VOKA 4GA9A 4U2AA 4PJYA 5FRAA 2WL1A 1BBT2 4CPBA 3IDCB 2VZTA 1ONAA 1Z78A 1RUI1 3BTZA 3HQRA 3W5MA 2VJXA 1FI2A 2GNDA 3ZYJB 4XF0A 4OI2A 2QQVA 4W65A 5C4WA 3CKHA 5T5PA 2YHJA 3WDXA 4N53C 3LPFA 1QDCA 4BQ4A 3EHKA 1YFWA 4EZ4A 4HOOA 1GLHA 2VXJA 3OF1A 1BHGA 2Q1ZB 4XFAA 1DBNA 1XQNA 1GWLA 1WLTA 1BVVA 1XBFA 1EAH1 4LITA 5DAWA 2WFF3 5CADA 4L8QA 4EWAA 5FMCA 2VVDA 4DUXA 4MH0E 1OPMA 1ZYBA 2Y8KA 3GYDA 4PLMA 2ZEXA 4CDXB 1ENQA 2QZ2A 3N7MA 3NAPB 3ACIA 1ZZCA 4FOWA 5CIRA 4YM0A 4COZA 1JYNA 5CFCA 4BM8A 4E2QA 4I0AA 1ALYA 2VH9A 3N9QA 2V4VA 1TEIA 4AXOA 1B35A 4FO9A 3ZSJA 2RE9A 1AL21 3CZJA 5J98B 3GALA 2GAUA 2OKXA 1SBEA 2VZQA 5T3NA 4LKDA 2FDGA 5FZ4A 3I59B 2ARCA 3VGIA 2QNKA 3P1IA 2WNUC 4UBHA 4BQYA 4LK7A 2WFPA 5E1RA 4E27A 1AR71 2XHNA 2XB6C 3CZUA 3RYPA 1AR93 4SBVA 2Q8CA 5G05L 2JICA 3HJRA 2P4EA 4RR3A 2TEPA 3WF2A 4AI9A 3AYCA 2JDNA 1DHKB 5JAXA 4FTSA 2BVVA 1UYPA 5H9RA 4AAXA 4CCEA 5LCWL 4AVSA 4CXXA 4A44A 1UZZA 2E7AA 2OUJA 1R1A1 3CLPA 3WP6A 4AG4A 5JWPA 1QMJA 4FTBA 1X7NA 1AR92 4QQPA 4QQOA 1YQ8A 2VTXJ 4A3ZA 4H2AA 3WNKA 3O1VA 2WQ4A 3MW2A 4OULA 2VMEA 4JZRA 4Y3OA 2Y6KA 3UL2A 1UAIA 4GWMA 1V6OA 4RL7A 5EJZB 5LEKA 1YNAA 3DXTA 3O7OA 5DAXA 2Q30A 4Q4X3 2VUCA 3MIFA 2EAKA 4XHBA 1YEWA 3GHNA 5AFBA 4DNYA 2I2SA 1S0CA 2HWE3 1O59A 2LROA 2RM23 4Z2AA 3I8TA 1Y7BA 4JHZA 4TXWA 1YFUA 3VL8A 3Q8EA 5CFCB 3H0OA 4YW2A 4ITCA 4WVMA 1B35B 1Q8SA 4Q2FA 5A7SA 2WA3A 4Q4V3 2KA3A 5GLTA 1DQ0A 2VMCA 1K42A 2HWE2 2AEZA 4GULA 3WXPA 4Z1VA 1KS4A 5IK5A 3SQOA 1F31A 5I91A 4IEWA 4Y1VA 2FDFA 3J8F1 1KDKA 3ZM8A 1OBNA 1T6BX 2D3RA 2ZGRA 4Q4V2 4LTAA 5F32A 3PVEA 3V64A 5CAZA 1O5LA 3I2KA 3IM0A 1FMD2 1ND3B 3A7QA 4B1LA 1HKDA 2JDZA 2Y6HA 3VBHA 1MS1A 2ETEA 2O1QA 4AHXA 4DUVA 4YZ5A 4UFIA 1KITA 5J7MA 5J3UA 1AX2A 1OMIA 4BIFA 2BNNA 2IXIA 3J26N 4QGLA 5ACA3 3RZMA 2ZACA 2Q0AA 5CVRA 2XJTA 1VB2A 3ZFFC 5EXOA 1JZ8A 4QB1A 4K3UA 1GOFA 4BXFA 3E97A 5FKBA 2VOXA 2JIJA 2ARXA 2E33A 4BA6A 4IEXA 3M7AA 5L9RA 5ACA2 2B42B 2P3KA 3H1YA 3AJYA 1EUTA 1OOPC 3MLLA 1W6QA 3F95A 4J1XA 4RYDA 3VD5A 3MFCA 3B02A 4Y1UA 3I3EA 4FFFA 1BXHA 1F9KA 4CDUA 5BYNA 3B9IA 4FAHA 2D3PA 1JZ2A 4QX5A 3J9SA 2IXLA 4FPCA 4LA2A 4XIOA 2ZABA 5GALA 4CEWC 4N53B 4EN8B 5FY8A 5FP3A 3UGGA 1RVF1 1XU1A 5FO7B 3VDBA 4LBKA 4XETA 4AAPA 4I3GA 5FMOS 4LULA 1GMMA 2OYZA 4A6SA 3AYAA 5FZAA 2CYFA 4M00A 1GZTA 2D6LX 2A3XA 4HL0A 5FWEA 4CCCA 4L97A 4ARYA 2EF6A 1VBE1 2W87A 1XNAA 3MW3A 5GZGA 2C26A 2VUDA 2P6HA 1FXZA 5IVBA 2JXAA 4BWOA 3GBWA 4H7LA 4Y33A 3SXWA 3AYEA 2PMWB 2WA4A 1HXS1 2AGSA 4JTNA 4RN5A 5EYXA 2Q4SA 2R071 5IUQA 1O4YA 2WZR3 2LM3A 1V6MA 1HB4A 2XONA 2D5FA 4AEJA 2WNUB 2HWF3 5JUVA 1C5IA 3PUSA 3KMHA 4FXGB 3PLQA 2WZR2 3KT4A 3RQ0A 1N1YA 2AR6A 1AYN3 3VN4A 4AFMA 1YWKA 4IV3C 1W2TA 3SITA 4KMQA 1G6NA 4ASMB 2HWF2 4GKXA 1HIXA 4UXAA 3IKWA 5F6KA 4KG8A 3NKTA 2PHUA 5FQ0A 1Q8OA 2DCYA 2VL4A 3UJOA 1RUC1 5FZ7A 3LZZA 4XDOA 2BUKA 4JTOA 2I07B 5A32A 2CDPA 1CAUB 1MS5A 4UF0A 3E5UA 4NPRA 3S7IA 1NUKA 3KWVA 4KQ7A 1E5SA 3ZR5A 5F1RA 3UNPA 1QQP2 1R082 3VKFC 3B00A 3I3BA 1H2MA 2ZA9A 4M01A 3ABZA 4DY5A 4AOCA 4HSLA
chains in the Genus database with same CATH topology
1AUYA 1Z7S1 5LEJA 1YFXA 2GALA 2GN7A 4GALA 4AI1A 2CY6A 2PLV3 5FOJB 3S30A 1S1AA 1QOOA 4IXLA 3ZXAC 4WBBA 1PGW2 2P3IA 4HN1A 3AP9A 3MPPG 2PHFA 1VBD3 3TNQA 2NN8A 5K8SA 1DU3D 5DDJ3 5GLZA 2WNEA 3T2TA 1ZZ6A 4CZSA 1LHUA 2WJSA 4O9EA 2PAEA 2H0VA 2ZBJA 5FQ0B 1FX5A 1VBD2 2C5DA 3ZFFB 1G9FA 1CIWA 5HCAA 3QH7A 4W6XA 1MQTA 2LTNA 5K7PA 2IWGB 3MI8A 4C1XA 2RJLA 1LTEA 1NG0A 1AVBA 1OOPB 4GXLA 3NV4A 4RD7A 5BPXA 5LK7B 4YM2A 1C8M3 3CJIA 4FBFA 1H30A 2CL2A 3JBG1 2PELA 1FOD1 1UIJA 2Z79A 4CEWB 1I3HA 1U5ZA 1S2KA 5L19A 1GFF2 4CDQC 3AJZA 1IS6A 4Q0PA 1C8M2 5LK5A 2FZ2A 2ZGOA 4RGAA 4WV8A 2VQ0A 1BQPA 2BWCA 1XYOA 1WUVA 4C90A 4UW4A 4YGBA 5JPMB 1HW5A 4M3CE 3ZN4A 4CP2A 5KHHA 1O7FA 1PO22 2R6QA 1BZWA 4QPIC 3WDTA 1YO8A 4GKYA 3GZUC 2XPJA 1PIV3 2UYBA 5BV6A 2OW4A 1W6OA 3HIFA 4FPGA 4EJRA 2WT1A 1COV1 1Q56A 1FV2A 2CWMA 4HT1T 5EYYA 4D3WA 1PIV2 4RFT0 1WW6A 1O4TA 4PBOA 4IV3B 5KC5A 3TRSB 4Z07A 4RGGA 3HD8B 1VAKA 4DPNA 5A33A 4Q0QA 2VECA 1DGRA 2P34A 2RS31 4N9HA 2ZPXA 4IEYA 2ZKLA 3EJKA 3RZZA 5AVAA 2XJPA 1PGL1 3NV1A 5J96B 4IEUA 4AW7A 1G7YA 2MPFA 2WFF1 1J59A 2BFUS 5GKAC 1VAMA 2ZGTA 3PVBB 4HFSA 1J1LA 2DVGA 4QPGC 2ZMLA 5I0UA 3SNMA 5JPNB 4R9AA 1Q8PA 1FPN1 4Y24A 3WD5A 5A3MA 1HV1A 2PHTA 1NE6A 4IEVA 1JHNA 4B8EA 2YUEA 3B7MA 3THTA 5DUXA 1DFQA 3VZLA 4ORFA 3VBUC 2E9QA 1MZ5A 3HWJA 2DTYA 2P37A 1V6IA 3QACA 3AXDA 1HRI3 4LE3A 4GMP3 4JGZA 4PLOA 3SCGA 3W9AA 1VRH1 1PMIA 3M3IA 1RL3A 2GH8A 5LRSA 4OHZA 1OA4A 1VBA3 4HZFA 1HRI2 1LKNA 3ZSLA 3AP6A 4JRAA 2RR12 2XJRA 4Y20A 2MEV3 2VULA 2K0GA 4EROA 5AVPA 4YVWA 4AGGA 2Q5TA 4Q4X1 5KHKA 1OQ1A 4GIQA 1R092 5K0UC 3VKOA 4AHYA 3FLRA 4N90A 1BVP1 4RHV3 3FUQA 3B5LB 1U12A 5HI0A 2RM21 2JECA 2ZZJA 1MS4A 1PZ8A 4ISRA 5C9AC 1UU4A 4Q4V1 4RHV2 4EWEA 1PK6C 3BPZA 1BEV1 1QH6A 1VAVA 4CDQB 2B7YA 4RQPA 4P9LA 5GZFA 4MGKE 4YLZA 4A3XA 4DRRA 2HWC2 2XVGA 1G9BA 4D94A 2VUJA 4IERA 5CG8A 3RYKA 1CONA 1FV3A 1D2QA 1UKGA 1ASJ3 1RUD1 1PNGA 2FQPA 5DUVA 4INDA 4QPIB 3AMNA 4MGZE 4JV4A 4A7KA 1VJ2A 5ACA1 4LLFA 4G3YC 2ZX2A 2F4PA 4LO5B 4HVRA 3ZXFA 3MF6A 4Y20B 5JOXA 2GNBA 2WKKA 3MF9A 3ZX7A 1MVQA 4I2OA 2G9GA 3WUDA 2X29A 1XE8A 1XYPA 3GBFA 3RMYA 3WW1A 4AHWA 3IMNA 3GF6A 2JG9A 3IDBB 1XU2A 3LB9A 2D3SA 4NWVA 1POV3 3B9CA 4PBPA 4NWWA 2WIIB 1C4RA 3VZNA 3RNSA 4K6BA 3OD4A 2X53S 4AVTA 5JZGA 1CAXA 1UF2C 2NPIA 1LJ7A 1MS9A 3KS7A 2AYHA 2FBEA 2DFCA 3M3QA 1RHI3 1NQDA 1RGSA 1LHWA 1UCXA 4JGYC 2QDNA 4KWKA 1QXJA 2DVAA 1ZZ9A 3ACLA 4B4QA 1RUJ3 1J1TA 4TSVA 3UKTA 3VBFA 1RHI2 5E89A 1RUG3 1PK6A 2A6WA 4COYA 1QHDA 1RUJ2 3VBUB 4QQHA 1W0OA 3WUCA 3B3QE 1RUG2 2ZX1A 1AF9A 4TYSA 1URXA 2JG8A 1AYN1 2DCKA 4Q1PA 4KNCA 1AR63 5BNNA 1K5MA 3POYA 1LOFA 2R16A 1WMFA 4ISQA 1U5IA 4WM7C 3I54A 1LOBA 5JLVA 3AFGA 3ZN6A 3DPRC 1YLLA 2A6XA 3AKPA 3OTFA 5BNPC 1NCQC 4YFWA 3VHNA 4HKOA 1KJLA 5AC92 1CAXB 3AP7A 3KCCA 1QJZA 1F5JA 3ECQA 4PQ9A 3L2YA 1ZM1A 5K0UB 4L11A 4QD2A 2A70A 3P3NA 3VBOC 3M3OA 3RI8A 1GR3A 2OIIA 2QCSB 2YYOA 5H9QA 5JVVA 4BH9A 4N43C 1ZRCA 1N3PA 5C9AB 4E4ZA 1PZ9A 4Q8KA 4HMZA 1PK6B 2PLV1 4R4XA 4HETA 4JVAA 4KH9A 3V65A 4HKLA 1L3JA 4BYYA 3APBA 3ST7A 3SLIA 1DLLA 2IXJA 2XL9A 2EXHA 3WY6A 3ZFEC 2BW8A 4PIZA 4E4DX 5KHIA 4PIXA 1WLDA 1JBCA 5DDJ1 2NLRA 5ABJC 3O0XA 2OVUA 3WG2A 2X5IA 4YM1A 3IT8A 3KM5A 4AGVA 1V70A 4DB5A 4KWJA 3ZN6B 3JCIA 3G6JB 4LBOA 1DIWA 3S6PA 4OUSA 1N1VA 4AVVA 4X6QB 1T6GC 5DZEA 4OHYA 1GSLA 3EQEA 5TSWA 3ZSEA 4AFCA 3UKNA 2BNMA 1TME3 2YGLA 5FO9B 1A3KA 4I0BA 1QJX3 2XL7A 2PN5A 4WM7A 2R043 3HT2A 1ZRRA 3KT1A 4HBNA 3SCHA 1PO11 3RJ2X 1TME2 2VG9A 1ULEA 5T50A 2IXKA 1QJX2 1NCQA 2D6MA 1RJ8A 1JUIA 3AMQA 2R042 3R0RA 4QXKA 4CDXA 3NAPA 2A6YA 2PQQA 1QOTA 4YZ4A 4G9SB 3MYXA 3ZVXA 2GZWA 4FT8A 4FTEA 2RMU3 3D4KA 1REEA 2B46X 4JDNA 2GH2A 1LR5A 3BCWA 3PMSA 4JGYB 2ZAAA 1SFNA 2ZGKA 1OQDA 3ZYIB 3ZXLA 1AR81 3I59A 2VGDA 3VDDC 4YGCA 4N43A 2RMU2 1TMF3 5AFEA 3H50A 4FCAA 5T5LA 1LGNA 2X5IB 3D0SA 1PIV1 3ZN5A 2XGXA 3HAGA 2DU0A 2Y26A 4Q4W2 1TMF2 2VXRA 3RG0A 2EXIA 3JB4C 4R9BA 1X8MA 3VBRC 1NZCA 4XJAA 4FAGA 4BOWA 5ABJA 4XXPA 1LHNA 1S0EA 4UBGA 2PA7A 4WM7B 4QPYA 5DG2A 4A7ZA 3H3UA 5L7OC 4DFSA 2CTVA 3AP5A 1BYHA 4XF4A 1PM7A 1QNYA 5JSPA 2NMOA 3AZXA 3C3VA 3DPRB 4NN0A 2PHXA 4NOTA 4XW3A 4BHPA 1H4GA 5BNPB 1S0BA 1NCQB 4H55A 4F83A 2VMGA 1MS3A 3OYWB 1A8MA 1WBLA 5GZDA 4FQZA 2OPKA 2E51A 3U10A 3R6SA 1WGPA 3QH6A 5DG1A 4B4RA 2IZWA 1VLNA 1XYNA 1YCIA 4JDOA 5J37A 2XH6A 4AVBA 4IV1A 2D6KA 3VBOB 1VB4A 3N7LA 4N43B 4P9XA 4XILA 4ZU7A 1WCDJ 3QOPA 2ZOEB 1S2BA 4LUKA 4ES8A 3I4IA 1PVC3 3WDVA 1ND3A 3VZOA 3TBDA 4IETA 3JUUA 1NY72 2XKPA 1A8DA 3I7DA 4Y5Z0 1PVC2 1OFSA 4IQPA 3ZFEB 4FP2A 1LECA 3AKRA 2PTMA 5ABJB 1VBA1 3MEPA 3O5SA 2KM2A 4KU8A 2D43A 2MEV1 4LO6B 4H3WA 2BYVE 3WQ1A 1UPIA 3CU7A 1PHMA 1SDWA 4N53A 1ZNPA 1LODA 4YW5A 3BB6A 4RHV1 2E7QA 4CP0A 2GNTA 2HWD1 1C5HA 4GH4C 1QY4A 4IV1B 1FMD3 3KGZA 4X6RB 3LSEA 3WDWA 2ZGMA 1MR5A 2ILMA 5T5JA 1C3HA 1NQJA 1GICA 4I3PA 3ELNA 1A6CA 5JIAA 1NLRA 4FPHA 3AKTA 4NVPA 4AF9A 1CGPA 2B8MA 4YRDA 2JJ6A 1EYBA 3DN7A 4LEJA 1UX6A 4P9GA 3PHMA 4AQ6A 4Y26A 1ZRFA 4MGYE 5KXBA 1ASJ1 2XJQA 4XFBA 1G9AA 3INAA 1WLWA 3VDDB 2Y38A 2WNUA 2BEOA 4FOYA 1U5XA 4C0HA 5HBAA 2R32A 1OA3A 5B2GB 2OUHA 3POSA 2BPA2 4WM8C 3ILFA 1NLSA 1MS8A 5GLVA 4AYUA 2VNOA 3NJZA 3MZHA 2IFRA 1EV11 2NYYA 2MNGA 3VBRB 4E9KA 4XQ4A 3FMGA 1POV1 1HDKA 3AKSA 2RS13 1CAUA 2WLPA 5L7OB 2BVBA 4WVWA 3MIEA 1QNWA 3CF6E 4Y22A 4Z2WA 3VZJA 3SMHA 1DGWX 1WLCA 2RS12 2K2SA 1CAVB 2ZGSA 4LT5A 2ZJCA 1RUOA 4AWDA 5C8CC 2XJSA 1SACA 4GH4A 1IZ3A 1ENXA 2OA2A 3GNEA 1Q8VA 4AI3A 5KHJA 1GZWB 2GU9A 5CU1A 2JEMA 3TN92 1WD3A 3CNAA 2LALA 3IIAA 4XFGA 3D82A 3WV6A 3FLTA 3H7JA 3WCRA 1AR61 4XBNA 2NQYA 2JKBA 2PHWA 1H9WA 4MSVA 3WP3A 3WW4A 3ZFFA 1RIRA 3AM2A 2BWAA 1QQP3 1R083 1HRV3 2XVLA 4DY3A 4QQ2A 1OOPA 3WLUA 1XE7A 4FQ4A 3USUA 1MEC2 2WT2A 1S0GA 1H4HA 1SQ4A 1AXKA 1X82A 4Y22B 3ME2A 4WM8A 1KRIA 1HRV2 1YHFA 1DZTA 3LCPA 1V00A 2WSUA 2ET7A 3WW3A 1RUE3 3FC0A 5H9PA 5SV8A 4R8HA 4CEWA 4HLTA 4KWLA 4B3NA 3ZSKA 1ZBE1 1UL9A 4ATFA 4GH4B 4YM3A 3UKVA 2A71A 2GC0A 1RUE2 2XBO3 3M3CA 3M3EA 3WP4A 2DUOA 3WQ7A 3UV9A 1RUF3 1H2LA 1JYIA 2ZCWA 4Z82A 2XBO2 1SLCA 2R063 4R52A 3M8LA 3TOJA 1CPNA 1RUF2 2ERFA 3JQWA 4FPFA 1GANA 1PNFA 1W0PA 1EPZA 1SLTA 3SH4A 1OA2A 5FLIA 2R062 4LBJA 3BODA 4LNVA 1JXNA 4D7TA 4I01A 4PDWC 4IEZA 1IS5A 2VNGA 4Z92B 3VBSC 2V73A 2VPVA 4LBNA 1MZ6A 1ZREA 4RS5C 4WVVA 3USUB 1V9U3 4IV3A 3BU7A 1F5FA 2RS53 2CV6A 2W68A 4WM8B 3OBTA 1ULCA 3FBYA 5BNOC 3LAGA 4B4PA 3FHIB 2Z2SB 1W6NB 4BZ4A 1V9U2 4GWNA 1QJX1 2DCZA 2RS52 4ES9A 3NV3A 3ZIXA 1CJDA 1CPMA 1X8EA 3ALQA 3JD73 3NW4A 2ZS6B 3THPA 3M1HA 1PO23 2P17A 1GBGA 4YW3A 5JIUA 2HWB3 1UZYA 4XFCA 1IHMA 3JD72 1OLQA 2A3WA 4XFHA 3VKMA 1IKPA 1O91A 2A6ZA 5CA6A 1PGSA 2Z5WA 2ZGLA 5K9YA 2HWB2 3U4XA 3FE5A 5C8CB 2C9AA 1BBT1 3MFAA 3ZFGC 3ZXDA 3LA3A 4L99A 5IK7A 1TMF1 3CO2A 3ROUA 4YZ2A 3AXEA 5FAXA 5FO8B 4AI2A 1QJY3 3TB0A 1RUNA 5DUWA 1MACA 3ILNA 4FPEA 2YV8A 1LCLA 5HXVA 3ZXKA 1VBC2 4LUMA 1SEFA 1QJY2 4F8AA 1RUI3 4HPKB 2O0OA 1FAYA 2ZGNA 4D7SA 4XFIA 2A3YA 5FREA 4DINB 4RS5A 2ZX4A 2ZHMA 2E7TA 1RUI2 3BALA 3IPVA 1LHVA 1VIWB 2HEWF 2A75A 5BNOA 2NM1A 2UU8A 1WW4A 3A0KA 4LHNA 4CDQA 1H9PA 1AX0A 1SCSA 3WHUA 2Y0OA 4KGQA 1O3QA 3KSCA 3CEWA 5GJ6A 1AR91 2Y0IA 1AL23 2ZGUA 3WINE 5FDBA 1LESA 4PLNA 3P3PA 4S2DA 5I0RA 4XBQA 5F6LB 4EV0A 2RR13 4CTEA 4QPIA 3AMHA 1ZZBA 4KU7A 3PJYA 5C6CA 1AL22 3NSTA 1S0DA 1R093 4MZUA 4P9WA 1MS0A 1LRHA 3V0AA 4PDWB 3TNPB 1AR72 2VW0A 1CR7A 3VLBB 4BMBA 2Z69A 3D5OA 4RS5B 1BKZA 4ATEA 2O8OA 1FNZA 5J48A 1X33A 2CGNA 3ASIA 4W6WA 2HWE1 3IPVB 4FPKA 1I6XA 1LOCA 1R1A2 4HN0A 4JCKA 5BNOB 1ENRA 3SH3A 2AZ5A 4MX3A 4AVAA 2HWC3 1W2UA 4K1ZA 4QMAA 1OPOA 1EPWA 5KC6A 1FMD1 2XHKA 3C2UA 4AFBA 5A3LA 4AQTA 2DCJA 4Z8BA 2WS93 3NWKA 3T1LA 3VZKA 3AZVA 5EZWA 4QPGA 1NCRC 2UWCA 1H8VA 2GNMA 4P9JA 3B94A 2BGCA 2H6CA 2D44A 1DGLA 3WG4A 2WS92 2H0BA 4OI0A 1AXYA 1I9RA 1HQWA 1YUDA 3A0NA 4Q27A 4YFZA 4XQWA 3VBUA 3ZFGB 2G9FA 4OHXA 5JOZA 3V0AB 1NXMA 3LOBA 3H8UA 1YXWA 1JW6A 4OHWA 1IS4A 4F7ZA 3ZXEA 3A4UA 2Q1MA 3UK9A 4FOQA 4KGGA 4AE2A 1D0GA 2YXSA 2PHDA 3LA2A 1XNDA 1IPKA 1MZEA 1TE1B 5JOYA 1DZRA 5FTTC 4K7JA 2V5YA 2VY0A 2QUOA 2NP0A 1H8TC 3LKJA 4OI4A 4Q4Y3 5I8TA 5JSRA 5K0UA 1DZQA 2MHFA 2ATFA 1VP6A 2DV9A 4C0BA 4QPGB 1RVF3 3AZWA 5HCFA 4NHLA 2IC1A 4Q4Y2 1RINA 1C1FA 5C9AA 1DQ4A 4AVCA 4K21A 2NMNA 4ZU5A 3WVJA 2VNRA 1GZ9A 2WZR1 1ZBA3 1RVF2 3FUOA 3R4SA 1VBE3 4YGEA 1ND2C 2UYAA 4M3CF 5KXDA 1Q43A 2HWF1 4MUVA 4L9BA 4R9CA 3NL1A 5T54A 1QJU3 1ZBA2 3LOIA 3W58A 4L2NA 5D8AC 1HXS3 2QJVA 2R073 1VBE2 3AFKA 4IEQA 4XMIA 1ULGA 2E6VA 4XHXA 5HCBA 3B69A 5BXXA 1CJPA 3RI9A 2DVDA 1QOSA 2PAKA 1AXZA 1LOAA 4JDMA 3X29B 4BIOA 5AC93 1QJU2 5J36A 1HXS2 2R072 1WCSA 4QU2A 1QQP1 1R081 5DXDA 5F9TA 2RJKA 1U0AA 4G4FA 2EAAA 4XF3A 3CL1A 4LHLA 3IDEA 4YNIA 3OBRA 3S0MA 4EWDA 5C8WA 1RUC3 4TLFA 1YYNA 3ZYGA 2CWSA 2AENA 1RUE1 1M06G 2N7GA 3MW4A 4YVSC 2XLFA 1QXRA 3GHMA 3WQ0A 1PGW1 2LUWA 4Q0VA 5KWRA 1RUC2 1D0HA 2GSYA 2ZHLA 3N3HA 4LBLA 4Q29A 2E63A 3FFZA 5D1IA 1KS5A 3FJSA 1W6MB 4YW4A 1ULDA 2O8QA 1OLRA 3M2MA 3DKWA 4JGYA 2VVEA 3DF0A 4MXVA 4XF1A 1VBD1 2R061 4Q0UA 4XYXA 3KZ4C 5FPXA 1LENA 5GM0A 4YG6A 4OUMA 4EN9B 4XZPA 4M3CB 5I8YA 4AK3A 4DOUA 3ENRA 4QGMA 1ND2A 1VR3A 2HYKA 2QVSB 1KFUL 2SLIA 3H1WA 3RRDA 2A6VA 3WCSA 5C4WC 2ZHNA 4YG0A 4D7YA 5E88A 4DZGA 2RS51 3AMPA 1RMU3 3U0ZA 4LO8A 1C8M1 3DUIA 5DZGA 3NV2A 4IEOA 4HK9A 1FT9A 3PVNA 5GZEA 3DPRA 5BNPA 5CB7A 4FSJA 1RMU2 1E57A 4UW6A 3HT1A 4AQSA 3OYWA 5E16A 1KFXL 4N7UA 4CP1A 3N4MA 3WW2A 1Y3TA 1PO21 3RWNA 4J6GA 2PHLA 4Y1XA 5CFCC 5GZCA 1H8TB 1UU5A 1WW5A 4K1YA 2HWB1 1DQ1A 5FMOL 3VBOA 1YI9A 5JOWA 5IK4A 4Q4W3 1IPJA 3N7KA 4KBBA 3JBG2 1Q5OA 3LGRA 4B29A 4FPJA 5JR7B 2DWRA 2SBAA 2WLQA 1QH7A 1OQEA 1ZA4A 4RR3C 4C91A 1NE4A 2D40A 3NKGA 4MVTA 5LRRA 2DVBA 1ND2B 2AREA 2WWSA 1EP0A 3ZFEA 4MYEA 3MPBA 4XXAA 1D4M3 3KLSA 2GMMA 2DF7A 1QJY1 4I02A 4Q1RA 3MIGA 4XJ8A 1N3QA 1LB2A 1COV3 4XOGA 4AEDC 1D4M2 4K9SA 3U07A 3BOWA 3JU9A 1COV2 3MDPA 5FLJA 4LBQD 1RUH3 4LR4A 3DL3A 1OD5A 3OGJA 4XTPA 5KXCA 2RS33 2XJVA 3FWEA 4P9IA 3GBGA 2R49A 4I09A 1RUH2 4TZDA 2D7FA 2W08A 1H1IA 2RS32 4IESA 4YVSB 3OCPA 1W39A 1I5ZA 1LGBA 2IXCA 5FBZA 3RMXA 1SLAA 1TNFA 3PMEA 1CQ9A 1NXD1 2I45A 4M0NA 1PGL2 3KCYA 1TNRA 1RITA 1YI7A 3ES1A 4URTA 1PZ7A 4FTSA 2WFF2 3VBHC 1FPN3 1HQNA 5CFDC 1H1MA 4XFFA 1Z0HA 4X8NA 5CBLA 3N36A 1HRI1 5H9SA 4GMP1 2JE7A 2RR11 2ENRA 3R4DB 2IXHA 1FPN2 3VDDA 2EIGA 1GYKA 4XJWA 2AUYA 4YW1A 1O5UA 3L9JT 4DRVA 1R091 1J58A 1J3RA 3L2HA 2CAVA 4CDUC 4IL7A 2KXLA 1VRH3 2JE9A 1BMV2 1ZZ7A 5C4WB 5BUVA 1AZDA 3MICA 1XNKA 3VBRA 4EN0A 4YSFA 4LO4B 2UWAA 1VALA 1LGCA 3MLKA 2EALA 1G86A 4Y1YA 1VRH2 2BQPA 1JTZX 4I30A