4AEDB

Crystal structure of human enterovirus 71
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
245
structure length
236
Chain Sequence
SDRVAQLTIGNSTITTQEAANIIVGYGEWPSYCSDDDATAVDKPTRPDVSVNRFYTLDTKLWEKSSKGWYWKFPDVLTETGVFGQNAQFHYLYRSGFCIHVQCNASKFHQGALLVAILPEYVIGTSHPPYKQTQPGADGFELQHPYVLDAGIPISQLTVCPHQWINLRTNNCATIIVPYMNTLPFDSALNHCNFGLLVVPISPLDFDQGATPVIPITITLAPMCSEFAGLRQAVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Crystal Structure of Human Enterovirus 71.
pubmed doi rcsb
molecule tags Virus
total genus 41
structure length 236
sequence length 245
ec nomenclature
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4aedB00
2X5IA 2HWB3 4CDXB 1GFF2 4FTEA 4GB33 3NAPA 1AYM3 1BBT2 1PO21 1QJY2 4EJRA 1HRV3 4RS5C 4GMP0 5L7OA 4WM7B 1AL23 4RQPA 3VBRA 1R082 5ABJA 1PVC2 1AUYA 1V9U2 1AYN3 1VBC3 4CEYA 4FSJA 1RUI3 2RR12 3JBG1 4Q4V3 1VBD1 4Q4W3 4YVWA 5BNPC 3VBFA 1HXS2 4Q4Y2 1PIV3 1QJU1 1RUE1 2WS92 1TMF2 4CEWB 2ZTNA 5C4WC 4JGYC 2R071 1ND2B 1QJX1 1ZBA3 4Q4X2 2RS33 2BPA2 2RS53 5C9AB 1HX6A 1PGW2 1NG0A 1RHI3 2XBO1 1FMD1 1PO11 2X5IB 1IHMA 1Z7S1 2RM22 1RMU1 3M8LA 3NAPB 1ASJ1 1PGL2 2MEV1 4QPGB 2RMU3 1RUC2 2HWC1 1AR62 1VRH1 2HWD3 2R061 3J8F1 1OHFA 1COV1 1AR83 1FOD1 1R1A1 5L7OB 4RS5A 3VBRB 5CFDC 1CJDA 5ABJB 4RHV1 1RUJ1 4N53A 1EV11 4CEYB 1ZBE1 5CFCA 1HRI1 3VBHA 4RQPC 2WFF1 4YVWB 3VBFB 1QJZA 5BNPA 2HWF3 1QQP1 5A32A 1TME1 3ZFGC 1BBT3 1F2NA 1QJY3 1WCDJ 3JBG2 5C4WA 1VBD2 4IV1C 1NCRB 1RUH3 4JGYA 1RUD2 1QJU2 3JD71 3VBUC 2R072 1R083 1FPN2 1BEV1 1PVC3 1VB2A 1V9U3 2HWB1 4RR3A 2RR13 3ZFFC 4GB31 1X36A 1HXS3 2XBO2 1FMD2 1PO12 2RS12 2WS93 1ND3C 1VBE1 5FOJB 1MQTC 1TMF3 4FTSA 1RMU2 4GMP3 2HWE1 2MEV2 2R043 2PLV1 4RS5B 4Z92B 1D4M3 4Q4X3 1VBB1 4LLFA 2Y26A 1VRH2 4NWWA 1POV3 5CFDA 2ZAHA 2R062 3J8F2 3VBHB 1COV2 1FOD2 4AEDC 1AYN1 1R1A2 4YVSA 1SMVA 2WWSA 1RUI1 2RM23 5BNPB 4RHV2 4Q4V1 4N53C 4Q4W1 1RUF2 5A32B 1EV12 5CFCC 1EAH3 3VBHC 1NA1C 1RUC3 5DDJ1 1ZBE2 1HRI2 1POV0 1VBA1 3ZFGA 2WFF2 5C4WB 1AR63 4JGYB 4CDQA 4GH4C 3VBSC 2VQ0A 1QQP2 4IV1A 1ZBA1 1H8TC 5C8CC 1TME2 2RS31 1MEC3 3VBUA 3IDEA 1AR91 1R091 1RHI1 3ZFEC 4IV3C 3JD72 1RVF2 1AR73 5J98B 3S6PA 3ZFFA 2RMU1 3CJIC 1BEV2 1VB4A 4Y5Z0 1HQNA 4RR3C 1ND3A 1MQTA 1C8M1 3HAGA 3JBG3 1NCQC 1RUD3 5ACA3 1QJU3 1VAKA 5CFDB 1VBE2 5A33A 1CD3G 5BNNC 2HWE2 4PDWC 2R073 2WLPA 4YVSB 1FPN3 2PLV2 1B35C 1PO22 1RUG1 4RQPB 4AEDA 1VBB2 4SBVA 3VDDC 1W39A 2HWF1 4QPIA 4YVSC 3DPRA 2XBO3 1FMD3 3ZFGB 1PO13 2RS13 1AYN2 1NA1A 5FMOL 4CDWC 4CDQB 2BUKA 4Q4V2 1NY71 4IV1B 1RUH1 4GH4A 3VBSA 4JGZC 2MEV3 5AC91 5BNOC 3VBUB 5DDJ2 2GSYA 4RFT0 1H8TA 5C8CA 1VBA2 2ZZQA 4N43A 4CDQC 1VRH3 2QQPA 1R081 2R063 3ZFEA 2FZ1A 1RUE2 3TN91 1ZBA2 1FOD3 4IV3A 2TBVA 3JB8A 3ZFFB 2RR11 5GKAC 1AR92 4RHV3 2WZR1 5FMOS 1R092 1QJX2 1RHI2 4BCUA 1RUF3 3FBMA 3CJIA 1ND3B 1ZBE3 1MQTB 1C8NA 1HRI3 2WFF3 4GMP1 2BBVA 1OOPC 2R041 2RMU2 4Q4Y3 5K0UC 1QQP3 1AYM1 1D4M1 1NCQA 1DDLA 4FTBA 1Z7S2 1ASJ2 5D8AC 4CEWA 1C8M2 5BNNA 1HRV1 2BFUL 4PDWA 4AEDB 1BMV1 2HWC2 3JD73 1B35A 1RVF3 1AL21 4N53B 1E57A 3DPRB 3VDDA 5CFCB 1EAH1 1NA1B 5JZGA 1BEV3 1VBC1 1RUG2 4CDWA 1AR61 4GH4B 3VBSB 1RUJ2 4QPIC 4CDUA 2HWF2 1PIV1 3DPRC 1H8TB 5C8CB 1K5MC 4JGZA 4N43B 5BNOA 3VBOC 4QPGA 1MEC1 2BFUS 5LK7B 1VBE3 3ZFEB 1NY72 4CDXC 2HWE3 1RUH2 4IV3B 5AC92 2PLV3 4N43C 1AR71 1PO23 3LOBA 2RS51 1VBB3 1OPOA 3CJIB 4WM8A 3TN92 4RR3B 4WM7C 2WZR2 1OOPA 1NCQB 2FZ2A 1RUD1 5ACA1 5K0UA 5DDJ3 2HWD1 2HWB2 1VBA3 5BNNB 4PDWB 4GB32 1VBD3 2R042 5D8AA 1AR81 1B35B 1FPN1 1RUE3 1AYM2 1D4M2 1NCRA 3VDDB 4CEWC 5JZGB 1AR93 1R093 1QJX3 1ND2C 1HRV2 4CDWB 1BMV2 2RS11 4CDUB 1AL22 5C9AC 5JZGC 4JGZB 5BNOB 3JB4C 1EAH2 2DF7A 1K5MA 1BBT1 2IZWA 2X5IC 1VBC2 1M06G 3VBOA 1Z7S3 1QJY1 1RUI2 4CDUC 1RMU3 4Q4W2 1ASJ3 3NAPC 1C8M3 1PIV2 4CDXA 4QPGC 1MEC2 2HWC3 1X33A 4WM8B 4NWVA 1RUF1 1PVC1 3J8F3 1COV3 1V9U1 2RS32 1AR72 1R1A3 5L7OC 1RUG3 2RS52 1OOPB 3VBRC 5ABJC 1RUJ3 4WM8C 1HXS1 4WM7A 4Q4Y1 5K0UB 4Y4YA 1EV13 2WS91 4CEYC 1TMF1 4YVWC 5D8AB 3VBFC 1NOVA 5ACA2 5A33B 5AC93 4Q4X1 1TME3 1RVF1 2HWD2 3ZXAC 1POV1 1PGW1 1AR82 1NCRC 1ND2A 3TN93 1F8VA 2XPJA 2RM21 4QPIB 1PGL1 1K5MB 2WZR3 1AL0G 5C9AA 1RUC1 1RB8G 1A6CA 3VBOB 5J96B 2GH8A
chains in the Genus database with same CATH superfamily
1UY4A 1X8MA 3RWNA 5L73A 2LM3A 3N4MA 4H55A 2KXLA 4QHZA 3WY6A 4CDXB 1GFF2 4FTEA 1A8DA 3D6EA 4MGTA 3NAPA 4XAEA 3OPTA 1QXRA 2D93A 4BISA 3PUHA 3Q9OA 4XBNA 2C0ZA 3WW1A 3KV4A 4BU2A 1JBCA 4PF1A 1S55A 3WQ0A 2OYZA 4MVTA 3AP7A 3P6BA 4YRDA 2D43A 3FWEA 4NAOA 1YXWA 2UY9A 2WNOA 5FZ3A 5L7OA 3U0ZA 3U07A 1K42A 3WP3A 3VBRA 2ZBJA 3GBGA 4OCTA 1R082 5DN2A 2HBUA 4IERA 2WYSA 4AF9A 1PVC2 5ABJA 4NVPA 5EWSA 4FPCA 2VZRA 4D3WA 4YM3A 1MS5A 1SLIA 4B7EA 3GYDA 4BQ5A 1AYN3 2RDQA 3PU8A 5FZ0A 4CEYA 4QDQA 3FZ3A 4FPKA 1OLME 3R6SA 4COYA 2RR12 1D0GA 5FMBA 4IEPA 5A3OA 3JBG1 2ZHMA 4AHXA 1VRBA 4META 4Q4W3 4A6OA 4NIGA 2RV9A 3GZEA 3LPGA 5FWEA 2E9QA 3NKGA 3ZLIA 3RJRA 1UPSA 1BCXA 4HLTA 5C4WC 1S2EA 1SEFA 1ND2B 2PHTA 4XUQA 2VCCA 4QM8A 1YEWA 3IIIA 5FBJA 1ZBA3 4UW3A 4Q4X2 1N47A 2RS33 2BZDA 3S30A 1DYPA 3ZKUA 2WINB 5FXZA 3BPSA 5C9AB 1NT0A 3JUUA 4YW4A 1JZ2A 3NV2A 1RHI3 2CV6A 2G1MA 2QVSB 3TEYA 2XBO1 1FMD1 4K1ZA 4JRLA 4YW7A 2VECA 5KC5A 1IHMA 1XE7A 3RZJA 1GZTA 2R30A 3NAPB 1ASJ1 3RI9A 3THCA 4MLOA 2MEV1 5BYNA 1YC61 4QPGB 1ALYA 1I3HA 4D0QA 1W8OA 3AJZA 3IT8A 1YQ2A 2GH2A 4LKSA 1OF4A 1H1AA 4FOWA 2WN3A 4AI8A 4BMEA 1OLQA 4I3PA 2EXKA 1IG3A 1GV9A 4B4PA 4QU1A 3K3OA 1AXKA 4IEOA 5FLJA 2JX9A 3THPA 4ISRA 1YJKA 1MVQA 1Q8PA 3DXTA 4EYUA 3ZN5A 5F5QA 5IK7A 3SISA 1H0BA 5L7OB 4RS5A 3VBRB 1TVGA 2AREA 2I74A 2X10A 2ZX3A 5ABJB 1OF3A 5CG9A 2VQAA 1W3VA 1AJKA 3GNEA 4N53A 3DECA 3WHTA 2J42A 4QQHA 1W3XA 4XETA 4CEYB 5LY2A 5CFCA 1HRI1 4M0HA 1G9CA 2A3WA 2ZZJA 4CU8A 4AFDA 1WMXA 1JHJA 2ZABA 3D3AA 1Q8QA 2HWF3 1OA2A 4JHZA 1TME1 3ETQA 4LO4B 1DU3D 3L2HA 4Q26A 1XYPA 1QJY3 5JR2A 3AVSA 1VBD2 3AL5A 4M0NA 3ACLA 1NCRB 2VNOA 4Y20A 2J1UA 1YFWA 5F5IA 3VBUC 1LEDA 2CDPA 3T2PA 4XUTA 1PX3A 1AVBA 5FKCA 2JE9A 5FQ0A 3OBZA 1CAVB 1C57A 4QGNA 1BQPA 1X8EA 3CF6E 3ILRA 3KMHA 1VB2A 4LMFA 4R4ZA 5DAWA 4JQTA 5FPBA 3S5QA 5L9VA 5FYCA 1RTVA 1JYCA 2HWB1 2WLQA 2Y64A 1PM4A 4COUA 2XL9A 3ZFFC 1KFXL 3ZPOA 4NMIA 3ZDVA 2WS93 2ZACA 2RDRA 1MS3A 2XLGA 1VBE1 1MQTC 3MFCA 1PZ9A 1RMU2 4GMP3 1UYXA 2HWE1 2ZGKA 5CISA 1ULGA 2YBSA 4FAGA 4YW3A 2PQQA 4RS5B 4BK5A 1FXZA 3ACHA 4Z92B 1D4M3 3BTAA 4A6SA 3B3QE 5FREA 1LHOA 2B7YA 1VRH2 4I2OA 3KV5A 2OXBA 4K9SA 4AVTA 1HW5A 1OT5A 4QXKA 4FFFA 1F4HA 2AENA 1XB9A 1OLMA 4DINB 4JCKA 2YROA 4IL7A 4NOTA 4QX2A 4AEDC 4B4RA 1R1A2 4YVSA 1W03A 2DYCA 2GDFA 5FPVA 3CBNA 3T1LA 2RM23 4R9DA 4NE9A 1Z0HA 4N53C 3P3PA 4AQ2A 3ILNA 4OFGA 1JUIA 3DN7A 1EV12 2DVFA 5CFCC 5L9BA 3ZKYA 4DXSA 1ZBE2 4K8RB 5LBCA 1MR5A 3H8RA 3N3HA 2H6BA 2OPKA 5FKBA 2WFF2 4BJ0A 3WNOA 3VKNA 4GJZA 2K2SA 2QQIA 3JXSA 4R9CA 4Y20B 4QX3A 1FI2A 2EALA 2WNUA 2ZA9A 4MXVA 2XDVA 4YWAA 3WP6A 4PLNA 5C33A 2YC4A 4HKLA 1GYKA 1MEC3 5HPOA 2ORZA 4E8DA 4Q0SA 1A3KA 1W9WA 5LZ6A 3QACA 1OA4A 2Q4SA 2Z5WA 4CU9A 1DGRN 3NV4A 2A5ZA 5LBFA 4D7YA 3ALQA 1HB3A 2OW4A 3SKVA 1WD3A 1GP5A 3KZ4C 4M4RA 1U5XA 5FJHA 4JC1A 5E16A 3LFMA 3OJBA 4W50A 4CCMA 4PI0A 2EXJA 1W8TA 1LKNA 2RMU1 3KB5A 1VE0A 4D7TA 3U78A 4OI0A 3MLKA 1W8FA 2ZPXA 4YZ2A 3AZVA 3Q8AA 4Z07A 5FP8A 4B3NA 4C90A 2PAMA 4OI1A 1FAYA 3JBG3 1PHMA 1DLCA 4IDZA 5DPNA 1NCQC 1OPMA 1RUD3 1SLCA 5GJ6A 5ACA3 1I6XA 1ZZBA 4A7ZA 1FYUA 3X29B 2NMOA 2YYOA 5A33A 5A7PA 3NQHA 1KD7A 1A8MA 3C2UA 3H3ZA 3TBDA 1F15A 1S0JA 5JPMB 3CLPA 4YVSB 4QB1A 1FPN3 5E1RA 4BQ4A 4ZXKA 4F8AA 2Q1FA 2DCKA 2WQ8A 1JYVA 4QQLA 5IAVA 3S7IA 2WDBA 3PMSA 2BVBA 4QB2A 3WLUA 1TNRA 3M1HA 1H6XA 1S4CA 2GMEA 2H0BA 2XBO3 1FMD3 1W0PA 2LROA 2WWUA 1V6LA 4YVSC 1NA1A 2VXRA 5FMOL 4KG0A 5HV4A 2BUKA 2CTVA 3S0MA 3HBZA 2LS6A 3W21A 1LOEA 2WNUB 2WBKA 3AYDA 3IDBB 4Z82A 3VBSA 4M00A 1DQ0A 2MEV3 4L11A 5FPLA 5AC91 5LEKA 1H8TA 1QOOA 1VBA2 2VBPA 1QJFA 1H4HA 4XJAA 5CU1A 5FIXA 1TNFA 3HNMA 4WBBA 3SQOA 3E1F1 4R8HA 2QQPA 4XDPA 2JDUA 5FYTA 1RJ8A 3HBKA 1IPJA 1SCSA 3TN91 2FDIA 4ASLA 1KITA 3VZKA 1SZBA 3LD8A 3T3YA 2DBNA 2CAUA 4YM2A 1SHWB 3PNAA 1Q3EA 4PIYA 2WZR1 5FMOS 1R092 5I8SA 3L2YA 3O1VA 2XMLA 4AFBA 3CZJA 2JKBA 2D5FA 3J7LA 4Q27A 4Y22A 3G7DA 1LENA 1C8NA 1HRI3 2ILMA 3HNYM 2OUJA 1F35A 5LCWL 2QDNA 5LRSA 3KWVA 2BBVA 2E6VA 3OYWA 4IE7A 4FFIA 4XBLA 4NUBA 4NR1A 4Q4Y3 3OSDA 1ODNA 1UU4A 3AYEA 3BCWA 1UZWA 1VAMA 2CAVA 4HKOA 1KFUL 1ULCA 1ASJ2 1QY4A 4CEWA 2NM1A 3OF1A 2BFUL 4PDWA 3MPBA 1IPSA 2PHRA 3Q8CA 2FD8A 3H3LA 1B35A 2C9AA 2IXHA 3ZYFA 4BIFA 1MZFA 1H9WA 2AC1A 2ADEA 1E5HA 4ZS3A 2J1AA 3AB0A 4DY3A 1LR5A 3VDDA 3AKTA 2DDUA 1NA1B 1UKRA 1XJAA 3K46A 2Y6GA 3AX4A 2KA3A 4UW6A 5L36A 3UESA 1YIPA 3UT0A 4AL9A 2WNEA 1UCXA 5LWBA 3DUIA 1QNYA 1T2XA 1MS1A 1Y7BA 4CDWA 1YJLA 1JYNA 1OQ1A 4H7MA 5IVJA 3VBSB 4LHNA 4X8PA 1JOBA 3FN9A 1BLZA 4C1XA 1WGPA 1PIV1 3BI3A 1H8TB 2NP0A 1K5MC 5BPXA 4GXLA 1PK6B 1JZ8A 4XABA 2XHKA 3CMGA 4EN0A 4QXHA 5BNOA 3FBYA 5KHJA 3MW4A 4ITCA 1JYWA 1WA6X 2BFUS 2ZMNA 1VBE3 1UKGA 2WR9A 3ZXKA 1QGLA 5FMDA 4AHYA 2HWE3 3T09A 3USSA 5T54A 3OPZA 1CQ9A 4AQTA 3N35A 3N9OA 3VKOA 2B9VA 1VALA 5LBEA 3LOBA 2E32A 2RS51 1BJQA 1Y43B 3WG4A 2EXIA 4BMBA 2DCYA 1XNCA 4LTAA 2BNMA 3E6BA 3P5BA 4QHOA 3ZN6A 5JXJA 1LTEA 1OSGA 4Y22B 4MSVA 3GHNA 4LBMA 1GWLA 4I3GA 4Z2WA 5HBAA 1UYYA 1H6YA 1N1TA 4C1WA 4EZHA 4YZ1A 2ZGPA 4LKDA 3OYWB 4FBFA 5FP9A 5M0TA 1YWKA 4LXLA 1OUSA 4WM7C 3O5SA 3RWKX 4D8MA 1G9FA 4KGQA 4RFRB 1DGRA 3O1UA 3WQ7A 3AKQA 1JW6A 3MZHA 2HWB2 4PI2A 3PIGA 4NRPA 2BTVC 2YBKA 1N1YA 2VUJA 2ZOEB 4PDWB 1REFA 5FRAA 3TAYA 2O1QA 1RXFA 1CX4A 2R042 2XLAA 1B35B 2WUHA 5D8AA 1AF9A 4QAWA 1RUE3 1AYM2 1OQDA 1O3TA 3VZOA 2DU0A 1CVNA 1PMIA 2LRPA 3VDDB 1VIWB 1WCSA 5LBBA 2R49A 5A3TA 3NJZA 3OUIA 4CEWC 3I2OA 3B01A 4HFSA 3KCYA 1LB2A 1GKBA 3IM0A 3HPNA 1J84A 3SH4A 2PHWA 1W05A 2VU9A 5BXXA 2RS11 3WQBA 2JDAA 4CDWB 5FZAA 5F39A 1DGLA 1XSRA 4JDNA 2YXSA 4R9BA 4MYEA 5CNAA 1W0OA 5FYYA 1W2NA 4CP0A 1LU1A 3NVCA 2YU2A 5BNOB 1EAH2 5I0RA 2DF7A 3HN3A 2IZWA 3J7HA 1VBC2 3BGAA 3ZXDA 2FQPA 4HBNA 1RJ7A 3SNMA 1ZRCA 1LCLA 4JVAA 1GSLA 4AE2A 2HWC3 1REEA 2V72A 3GXUA 1WCQA 3ZN6B 4AVCA 2CGPA 1QHDA 2HKXA 3N9LA 1X33A 2QQOA 3LWCA 3OD0A 1CIWA 1CPMA 1RUF1 3OGJA 3C7FA 1PVC1 3GBFA 4DUVA 2GC2A 1UN1A 4IEVA 1AR72 2FDJA 3C8XA 3TWIA 4GJYA 4CE8A 2D6OX 4TN7A 3T0AA 4CZSA 3I3QA 4W6XA 2OKXA 5CBLA 1NYWA 1OD3A 2QBXA 2EIGA 2J7MA 3DEMA 3RZHA 4LIVA 1WA4A 3MGUA 4NRQA 4Y4YA 4MXWA 2GNBA 5CEHA 4DOUA 3H50A 3VB9A 2VNVA 3RMYA 1MZ5A 5T55A 3H7YA 2JIJA 5D8AB 1UMZA 2AEYA 1NOVA 1AHSA 4PLMA 3A4UA 2XKPA 1QMJA 1XBFA 2V73A 5FO7B 4DUWA 1ZM1A 2UWAA 5KBFA 2ZEZA 3D0JA 5AC93 1QXJA 2QNKA 1O4TA 2VVDA 2YUEA 4Q4X1 1Y9MA 5KHKA 1ZZ8A 3RMXA 2HWD2 1POV1 4FPEA 4YGEA 4LO7A 3CNAA 4XAAA 3T1MA 1UXXX 3M4FA 4K3UA 4AW7A 3OCPA 5E89A 2VVFA 1ENQA 1K12A 4AZZA 3TN93 4F3JA 1E5IA 2EVXA 2XPJA 2TNFA 2I45A 2WZPP 1ZVFA 1XYNA 2Z42A 4YZ4A 4KWUA 2NQYA 4QPIB 5CB7A 5C70A 1RUNA 2KM2A 5AFBA 4COWA 4CCOA 2WZR3 5FO9B 1A6CA 2W2IA 5FY8A 2GH8A 1RITA 4PJYA 5EP9A 1G9BA 2X5IA 4OLLA 3HQRA 4NROA 1UYPA 2VMGA 5DAXA 4CXWA 2XJTA 2VUCA 2ZEXA 5FK7A 4IEXA 5TSWA 2VBBA 1ENSA 4LHLA 2JDHA 1F5JA 2VCAA 1PX4A 2YC2A 4OMCA 1W2UA 1BBT2 1PO21 2WABA 4BLJA 1C5IA 3CEWA 3BVCA 3GJBA 4E4DX 2P37A 1C4RA 5HXVA 3VZJA 5HCBA 4AI3A 1XE0A 4FPYA 3LSDA 1JYTA 3ROUA 1D2SA 2W92A 1BYHA 4YGCA 4OHXA 4EJRA 1O59A 3ZYIB 3K3NA 4HSLA 4AFAA 3MF9A 4KWJA 3AMQA 3SEPA 3TB0A 1PVXA 4RQPA 4MXWB 3WD5A 1Q8VA 1CAXA 4HKWA 3AKPA 2GN7A 2WT1A 1AUYA 1GP4A 1LHNA 2Q30A 4MH0E 4XOGA 3W5NA 1V9U2 1IPKA 5FUIA 3LA7A 1EPWA 3I2GA 3E6CC 4JKLA 2OZJA 1OH3A 1VBD1 2QQWA 4JHTA 4Q4V3 4Y5TA 3VBFA 1HXS2 5BNPC 5JUVA 5E8AA 1PIV3 3GALA 3CU7A 4MOAA 3UV9A 1G9DA 1NLRA 1IS4A 4GKXA 4DEQA 1H1IA 3P1IA 1QDOA 1TMF2 1NE4A 2ZTNA 3WNPA 4D6QA 5DABA 1WUVA 3DV8A 1HLCA 1HN1A 5JSRA 2WKKA 5C6CA 1QJX1 1CESA 2NPIA 5I0UA 1J83A 1WKYA 2ZHNA 1UNBA 1DYOA 2BPA2 1ULOA 4NHLA 1A34A 2DU1A 3AJYA 2EF6A 4Q0PA 2RS53 4Z2AA 1F31A 1HX6A 1PGW2 1NG0A 4YPJA 1OBNA 3IAQA 3IDAA 1REDA 2QQJA 1ZZ6A 4I0WB 1J58A 1HDKA 4YW5A 2X5IB 3HOBA 4RA0A 1VMHA 3KM5A 4DFSA 1ENRA 1RMU1 4OHVA 3A0NA 3A7QA 3M8LA 4GAZA 4LEJA 2V4AA 1GOGA 2YU1A 1IG0A 4IQPA 4OHYA 3DF0A 2XUEA 4AI0A 4E9KA 3PIJA 1Q8OA 1RUC2 1V0AA 4R52A 5GLWA 3VHNA 1DG6A 2QDRA 1O3RA 2GNTA 3FLTA 2O14A 1VRH1 4J1XA 4W6YA 5FZKA 4FQ4A 3URFA 4BHPA 5IK8A 1JN2P 5T50A 3ELNA 4QWNA 5KHHA 1CN1A 1R1A1 4AEMA 4GWJA 4FPJA 2PHXA 3I2JA 4BXFA 1CJDA 1CAXB 5CFDC 4A44A 4P08A 4AGGA 1H8VA 3W58A 3ES4A 1EV11 4FO9A 4NPLA 4A7KA 5C3QA 3BN6A 3J4UH 5CKNA 1ZBE1 4IE5A 1S0FA 4AI1A 3ORJA 1YI7A 4P5YA 4IEQA 4RQPC 2WFF1 3LEGA 4DB5A 3VBFB 4GKYA 1LEMA 5EIYB 3FFQA 1QJZA 3VD7A 2XXZA 3C7EA 4FP3A 5J1XA 2ZGRA 4KG8A 4HG6B 1FT9A 1UOGA 2EIEA 3MHZA 4LULA 3M3QA 5CYYA 4KNCA 3ZYJB 3WF0A 2X29A 4F7ZA 1DQ2A 5C4WA 2BOJA 1RUH3 3WVJA 2AH2A 3O1PA 2OS2A 1XXNA 4FP2A 3W59A 1W9YA 5FOBB 3ON7A 2FCVA 4WVMA 3B9CA 4KWKA 1KJRA 3H8OA 2PELA 2Y38A 2BQPA 4EWAA 1R083 2BP6A 3S7EA 2YB7A 1PVC3 4HONA 4E4SA 1QKQA 4P5HA 4CU7A 5GLUA 5IFPA 3MO4A 5LA0A 4XYXA 5FZDA 4BOWA 1WZXA 1JUHA 2JD9A 3RVHA 3E6DA 4M3CF 2RR13 2DCZA 4GB31 2Y60A 1X36A 4RR3A 2E51A 2B42B 3HQUA 1DHKB 4AR2A 2RS12 2CY6A 2BGCA 4UFJA 5JXHA 5FJKA 3HN1A 3ZYHA 4FTSA 3AKSA 4XACA 3LEIA 3KCXA 4KBZA 4XC9A 5JIAA 3I2HA 1HQWA 4ONUA 5EXOA 1V00A 2ZGUA 2P3IA 5FZCA 3MF6A 5EJ1B 2VH9A 4Q4X3 2VY0A 1UAIA 5FP4A 4AVVA 4LLFA 4QM9A 2Y26A 4HN1A 4NWWA 1POV3 1W9SA 3POFA 2ZAHA 3KD4A 4L2NA 2R062 4N9IA 4P9JA 3J8F2 4D94A 2L9LA 3H1MA 1COV2 2PHUA 2FDFA 1FOD2 2FHRA 2OIIA 2AEZA 1SMVA 2NYYA 4XTPA 1RUI1 2GC1A 4RHV2 4G3YC 1QEXA 1RUF2 2I07B 3U37A 5F3EA 3TEWA 1RIRA 4YW2A 2FDHA 3WOGA 3KF3A 1DQ4A 5FPZA 1SFPA 2IXJA 3POBA 4QKNA 1POV0 1PGSA 1VBA1 5FLHA 4E27A 3NNMA 5C4WB 4GH4C 1H2KA 1K5JA 3OGRA 4A41A 2J1EA 2ZCWA 1UZ0A 2Z69A 1QQP2 1YI9A 4WVMB 3UJQA 2JECA 5C5TA 5C8CC 2ARAA 3KVAA 5HCHA 3QH7A 3VBUA 2UY8A 2OX0A 2E31A 4AVAA 4ZHNA 2XKOA 1R091 2B46X 1LOBA 1APNA 4AI9A 2J1RA 1BKZA 2WL1A 3B00A 4IV3C 4YGBA 1GOFA 1A78A 2P4EA 4YG3A 1XNTA 4Y5SA 1DZQA 1G86A 1LHWA 3BIEA 3LB9A 1C1FA 3J26N 3S6PA 2UYBA 2PAEA 4BQ3A 2DUQA 4LO8A 4V2VA 2Y6KA 4HK9A 3ZFFA 3EBRA 4EZ4A 3RSJA 3LSEA 4IETA 3RYPA 1QOSA 4ORFA 4Y5Z0 5A7WA 3VD4A 1HQNA 4XIOA 4BQ2A 3BTZA 3HMYA 4BK4A 4RR3C 1UY3A 4QKFA 5FZEA 2P6HA 1MQTA 5FK8A 3POIA 5CKQA 2VW0A 1H30A 4WV8A 2VMFA 2XGXA 2XUMA 4CUGA 2O8QA 4QMAA 3E97A 3SCFA 4AQSA 4IGOA 4XFHA 4XUNA 1OLRA 2W94A 5A6ZA 1CJPA 2BBAA 2Y6HA 3JQWA 2JENA 2W91A 4QX5A 1MZEA 5FZ7A 2ERFA 2RDSA 2ZKLA 3GBWA 1UOBA 1UIKA 1W9FA 3N9NA 5IW0A 2WLPA 4UYBA 2JEMA 4GULA 1OH4A 2D6NA 3WNXA 4O65A 4GA9A 1LAJA 2GMMA 1PO22 4L8QA 1JH5A 4AEDA 5K7PA 4RL7A 1XOYA 3KHCA 4CSWA 2JG9C 2QE3A 4CUBA 2QTWB 2IFRA 4EN6B 3LKJA 4Y1ZA 1AYN2 3H8UA 1DZTA 1V6OA 2FDKA 3HIFA 1KEXA 4FFGA 2DBIA 2ES3A 2VO5A 4KH9A 4LA2A 1FV2A 2DVBA 3MV01 4UW5A 4JGZC 5FXXA 1UOFA 4CP1A 1LESA 3OOXA 3D4KA 5HCFA 5IUQA 1UX7A 2VW2A 3EXUA 4Y1VA 2GSYA 2PYTA 4RFT0 3VBUB 4C0HA 2QKDA 4HOOA 3FLRA 4N43A 3HD8B 4XFFA 4I01A 4JTNA 3PUIA 1VRH3 2YPJA 1EPZA 5K4LA 4XQWA 3LDRA 2FMDA 1KRIA 2G4IA 4K20A 1ZBA2 1ZRRA 4JQRA 1YCIA 1G9AA 5J7MA 2TBVA 2PA7A 3JB8A 3ZFFB 3KF5A 1WW4A 1AR92 4H3WA 4QQPA 5A7WB 1QJX2 1RHI2 3ZYRA 3OB8A 1J3RA 2J1TA 4JAAA 4MGZE 3ZXLA 2WT2A 5FZHA 4L0PA 1H9PA 1XNKA 5EZWA 3MIHA 1ZBE3 1MQTB 2BEOA 2WFF3 5FXVA 4LO6B 1OOPC 5FZGA 1ZRIA 3WXPA 2Q8CA 3PVNA 5A1AA 1OUXA 2R041 1O4ZA 3ACIA 2E63A 1U5ZA 1AYM1 1DGWX 1OXCA 1NCQA 3KLSA 3AZYA 1UZZA 4LPLA 1DDLA 4LBKA 4XDQA 2W9XA 2QQKA 2Z4FA 4XCBA 1C8M2 4BA6A 2VG9A 3N9PA 3AYCA 4OUMA 4AEDB 4AFCA 2PAKA 2QFEA 2XJRA 3A21A 3IN9A 1D2QA 4N90A 4PCRA 3ZXGA 4UBHA 4TWTA 4N53B 1E57A 1V6JA 1KS4A 4JRAA 5CFCB 4LQRA 4CCDA 1EAH1 1YO8A 3FHAA 2PHLA 4EN7B 1V6KA 4N7IA 4ZXEA 3KGZA 1DFQA 3A0KA 5FP7A 1VBC1 1W06A 2VTFA 4LUMA 2HEWF 1AR61 5FZ9A 2WN2A 3VD9A 3K2OA 4O9EA 2ZKNA 4CDUA 1MZ6A 5FY4A 4KQ7A 3ZPYA 2BNNA 2HWF2 2ZX2A 4N43B 4COZA 4L9BA 2ATFA 2XJUA 5FYBA 4AHWA 3AYAA 3NJXA 5LK7B 1PNFA 1FNZA 3OEBA 4OZOA 3N7LA 2RJKA 1CGPA 1NY72 3N9QA 3AP6A 5FDBA 5GZCA 1MS9A 4HMZA 4QX8A 4Y26A 2C24A 3PLQA 2W95A 1DQ5A 1NZIA 1QIQA 2GMPA 1O8SA 2XG3A 4GWMA 4N43C 1AR71 5FQ0B 4LT5A 3SEEA 3PJYA 4Y3OA 5J36A 1OPOA 3WUCA 3ZIXA 4FPGA 3POYA 1SDDB 3IKWA 4TYSA 3VDAA 3IZOA 3LA3A 1WW6A 4S2DA 2WA4A 5D21A 2VZSA 5FMCA 1YLLA 5IVCA 5A1LA 3POEA 2A75A 5I8YA 3ZMOA 1NCQB 1SBFA 2FZ2A 3LF7A 1JHNA 3U14A 3WF2A 2HWD1 1VBA3 4QKBA 3T30A 1LGCA 4EN8B 1U0AA 4GB32 4AHZA 3U10A 3HQXA 3SHRA 3TNPB 3RZLA 4CCCA 1X50A 2ENRA 1D4M2 2XWBB 5IVYA 3FHIB 4ARXA 3AP9A 3DXUA 2A6YA 3LOIA 4BB3A 3MBWA 4XJZA 2LW8A 1ACCA 1R093 3ME2A 4HPKA 1HRV2 3O1RA 4U2AA 4UW4A 1UU5A 2A71A 2H6CA 1WCUA 4HVQA 3K4DA 5HI0A 2W5FA 4K7JA 5FZOA 5JIUA 4CDUB 3D5OA 1AL22 1CR7A 1Y9GA 3WSOA 4AAXA 1V6NA 3RRDA 1ZREA 2ET1A 3MYXA 4XBQA 3JB4C 3IBMA 3GHMA 3RZKA 4C0BA 1K5MA 1BBT1 5IJRA 2DCJA 3EO6A 5B4XA 5HXMA 1M06G 3KT4A 5CVRA 1RUI2 2QQNA 4LE3A 2B9UA 1UMIA 4CDUC 1JMUB 2R1BA 3H3UA 1ASJ3 1W6NA 3FLPA 3LIHA 3NL1A 5A3MA 1EYBA 4NPRA 4QX0A 5JVVA 1BHGA 4LBNA 3S5AA 1MEC2 3KQ4B 1EP0A 4Z1VA 5DXDA 1UOJA 3TRSB 5JMOA 4EN9B 4QDRA 1N1SA 4XXPA 2I2SA 3OPWA 3VZNA 5ERLA 2VZUA 4BDVB 4FOQA 1SLTA 3OG2A 1V9U1 1YHFA 1KDMA 1Q5OA 4XF1A 4Y1YA 2ZS6B 3ZO0B 3BKZA 5SV8A 2WNVC 3I2DA 3WX5A 3M3EA 2Y6JA 1HXS1 4WM7A 2XB6C 5LB6A 5EYYA 2VMCA 3CQOA 4NIAA 3MLJA 1TMF1 3SMHA 3VL9A 1GUIA 1GWMA 2CSGA 4YGDA 4YVWC 5FPXA 5KXDA 3AL6A 3GZAA 2A73B 4FOYA 3APBA 3PUQA 4OQ9A 5ACA2 5A33B 4ZU5A 1AX2A 1Q43A 3LZZA 1TME3 4UFKA 1RVF1 2C4XA 3CJXA 1OA3A 4LITA 4HPKB 1PGW1 4LBQA 4FPFA 3V0AA 2ARXA 4PHZA 1AR82 3FHQA 4IEYA 1UO9A 4Q5OA 5DAPA 1LOCA 5FZOB 1AXZA 4JX0A 1UW8A 2JXAA 2VCBA 5FYZA 1J1LA 1WBFA 2ZJCA 3GM8A 1YFUA 5I0SA 1SDWA 1ULDA 2XOMA 3LPFA 2CGNA 3I3EA 2XJSA 4CXXA 5JAXA 4XFAA 1K5MB 1NUKA 1OFNA 4EV0A 1P8JA 3L9JT 1RUC1 3QCWA 2CU5A 2XHNA 1Y4WA 2Q0AA 3TOJA 1SLBA 3V0BA 4JDMA 4AFMA 2BJSA 1W6NB 2AGSA 2HWB3 2GN3A 4KWLA 5F3GA 2TEPA 1S0GA 2UU8A 5EPAA 3ZSMA 1DIWA 3EYPA 1OURA 4OZXA 1LU2A 1AYM3 2QQUA 1ZZCA 5A3NA 1CONA 5A70A 3BIWE 5EV7A 3UJOA 4DXZA 1LECA 4Q8KA 4XQ4A 2P3JA 4XF0A 5AVAA 3SC7X 3MW2A 1JZ5A 5KC6A 5FZBA 2JE7A 4WM7B 1LNSA 4MGIE 5LRRA 2GAUA 2VBDA 3SCGA 2XR4A 4J25A 3POGA 4B4QA 1F4AA 3VUOA 5A80A 1HJGA 2Y8KA 3KQRA 5J3UA 5FTTC 1DQ1A 3AXEA 1VBC3 1IOAA 4QPWA 1J59A 4FSJA 1T6GC 3BU0A 3WG3A 1UY1A 5T5OA 3BOWA 2OPWA 2VZVA 2VQTA 3HT1A 4I30A 4OULA 4Q0UA 3MLLA 4Q4Y2 1EY2A 2PXJA 3UK9A 5C3PA 4CPBA 2C9KA 5F37A 4HVRA 1I5PA 3IDCB 4LBQB 3V0AB 2F17A 4CEWB 3FUOA 5C5UA 1WBLA 1PZ8A 1W6MA 4JGYC 2FCTA 1OKOA 4ET7A 1QF3A 3THTA 5A3LA 3WG1A 3CHXA 4GD4A 4JV4A 1DGWA 4QHBA 4ZKTB 3U4SA 2ADDA 3AZXA 2P5BA 3B7MA 2DCTA 2ZAAA 3OGVA 3JU9A 3NNJA 2RJLA 2ARBA 4HVOA 3PVOA 4IGQA 1UY2A 1AJOA 4LOSA 4XEZA 3V0BB 4O7XA 5ISLA 3M70A 2EAKA 1MACA 1Z7S1 3WCRA 3MIBA 2G9GA 2Q1MA 4Y1XA 3TNQA 3ITQA 1AZDA 4AAPA 5FZ4A 1PGL2 1HJFA 1S2BA 2RMU3 4DMIA 3C7OA 3LCPA 3F2ZA 5EJ3A 2YGLA 4ARYA 2RJ2A 4XXAA 4O61A 5FV3A 4ZZ5A 1AR62 2VMDA 5H9PA 4D7SA 1O3QA 2HWD3 1MS0A 5EHDA 2XH6A 5FYMA 4DZGA 2R061 2EXHA 1ZA4A 2B39A 3J8F1 4FI9A 1COV1 3R0RA 1FOD1 1ZZ7A 5HV0A 2OQ6A 2VNRA 2VZOA 3JCIA 3ZDSA 3PU3A 4CP2A 1TE1B 2VUDA 3NV1A 3VL8A 5JXGA 3LDKA 3R4SA 3ZM8A 4RHV1 4C8DA 3ILFA 1RUJ1 3E5QA 2BNOA 2SBAA 2ZGSA 3MV11 4QKDA 3VD5A 4AGRA 1FATA 1RGSA 3T0BA 3VBHA 5GLVA 2VTXJ 2YBPA 5LA1A 2Y6LA 2ZGQA 4UFMA 3WQ1A 3ACFA 1HIXA 5T5JA 3H1YA 5BNPA 1QQP1 3I49A 2D6LX 5A32A 4XFIA 1C28A 3ZFGC 1BBT3 4JTOA 4CU6A 2K9ZA 1W6MB 2W1QA 2JD4A 1GZ9A 3PJQA 1F2NA 1XQNA 4QT6A 3RFRA 3E5UA 5IT6A 1WCDJ 3BPZA 3KGLA 3MIDA 4IV1C 2JG8C 3O1MA 4LE4A 2KD7A 3MIFA 1QJU2 1UQXA 5E6HA 5LA9A 3EB7A 5SV5A 2YHJA 5F8PA 1ZNPA 2R6QA 3W20A 2YC0A 4UF0A 4CCEA 1NXMA 5J09A 2P2KA 5E88A 4IEZA 4B8EA 4CXYA 2R072 1IKQA 2FCUA 5KHGA 3AM2A 2BW8A 3OGGA 1LGNA 5F1RA 2B5HA 4DO0A 1FV3A 1V9U3 5LATA 1KDKA 3R4UA 3ZIWA 4ZPIA 3SXWA 3BU7A 5CADA 1ST8A 1US3A 5D2AA 4MGSA 1JODA 1HXS3 3EQEA 5DAVA 5IVEA 1JOJA 1PO12 4MGQA 4ZU4A 2HYKA 1ND3C 1NAEA 1XNBA 1TMF3 4QU2A 2R0FA 2BDRA 3WW2A 4HSJA 1JU4A 1OMIA 3DCQA 4LORA 3HNBM 1T6BX 3HEIA 5FFOC 2XJPA 4O9GA 3ZXFA 1I1EA 5KXEA 3FC0A 2ORXA 3UKVA 1LHVA 5FY5A 2DURA 3KV6A 4GQ7A 3ZXJA 3N9MA 1M4WA 2VZQA 4QQOA 4NIIA 1MS8A 5CFDA 3WF1A 2FDGA 3VBHB 1HQLA 4DIQA 2WSVA 4EWEA 1H2LA 1N3PA 1AYN1 2UYAA 3VHPA 2BOIA 5BNQA 2WWSA 1JZ6A 4LR4A 5BNPB 1UF2C 1UMHA 4Q4W1 2Q8OA 1WD4A 1WLDA 5A32B 1QOTA 3T2OA 3RZGA 1GR3A 4MO3M 2GNMA 4HXCA 3VBHC 1RUC3 3I2IA 4IESA 1UZVA 2W0XA 4YG6A 1XYOA 1G8WA 4Z8BA 4K8FA 4PQ9A 1VPHA 5EJZB 1W6PA 3PUAA 1XNDA 3AP4A 4XHBA 4CDQA 1J3PA 4SLIA 1X82A 1KQRA 2VQ0A 5FZLA 1LHUA 4UWDA 1W99A 1D7PM 1ODMA 3VHOA 3M3OA 1ZBA1 2A6XA 5A3PA 4HK8A 1YQ8A 2RS31 1S0BA 1VJ2A 2XLFA 2WYFA 3IDEA 2AR6A 1AR91 3ZFEC 1RHI1 5JR7B 3B69A 3I3MA 4ZY9A 2DUPA 3KT1A 4ASMB 2D5HA 3JD72 3O1OA 1I9RA 4PQQA 4CCNA 1RVF2 2DVDA 5F2SA 1VAVA 5J98B 3MIGA 3WNNA 4E8CA 2VQUA 3WF3A 4R4XA 3OTFA 3DKQA 4NIDA 2MNGA 1QXPA 2J1SA 3POJA 3M7AA 3CJIC 1AX1A 1BEV2 5A6QA 4S2FA 1WW7A 4J6GA 4RGAA 1GU3A 2ZGTA 4A45A 4DXTA 5ANNA 4LKEA 1C8M1 3HAGA 4XFGA 2KR2A 2JJ6A 5JDBA 2XJQA 2UWCA 3Q8BA 2W47A 4Q29A 1SBEA 1GOHA 2DVGA 5CFDB 3OUJA 4CCLA 5HCAA 5BNNC 2VOWA 1K3IA 3C7HA 5I0DA 1WLTA 2BGOA 2PLV2 3VZMA 4RQPB 4B7KA 1NLSA 1VBB2 2XVKA 3OD4A 3KV9A 4LHSA 4A2UA 4AEKA 4Q1RA 3B93A 4SBVA 4QXBA 5I8TA 3NJYA 2HWF1 2PQSA 3FUQA 3NRUA 1SFYA 2OA2A 3DPRA 1W6PB 1O4YA 2RS13 4IEWA 2B45X 4TSVA 1XU1A 2CHHA 3JQXA 4N7UA 4CDQB 3B9IA 3SITA 4LHKA 5FAXA 3B5LB 5FUNA 4XF3A 4Q4V2 1NY71 3ETPA 1QDCA 4GH4A 2Y6FA 4W65A 1MVEA 3BTXA 3MIEA 4BQWA 5FY9A 2Y0IA 3LDBA 4U36A 1UPIA 5DDJ2 5C8CA 4ES9A 5J48A 3ES1A 5JOWA 4DRRA 2IWGB 4CDQC 2P3KA 3MUY1 2IVIB 4KU7A 2R063 5F5CA 5FZ6A 1BVP1 4M01A 2E53A 2FZ1A 2ZGMA 1O5UA 3W9AA 4EE2A 2ZEYA 1FOD3 4IV3A 1W0NA 4BYYA 1X7NA 1WLCA 4NHKA 2UURA 3NMBA 2EIBA 4DXRA 5GKAC 2PMWB 4RHV3 3NNFA 4X6RB 5IWFA 4BCUA 1BVVA 1RUF3 1GNYA 1YQ6A 4L92A 3DL3A 4BQ1A 2JDNA 2PFWA 5JSPA 1URXA 1SLAA 3BALA 4PIXA 5F3IA 4HN0A 4S2GA 1ZA7A 3OUHA 2VOVA 3FFZA 4GMP1 2OUHA 4UOJA 1ULFA 4GALA 1SLLA 1OFSA 3VHRA 1S0EA 2J1VA 4ATFA 1IKPA 5JOZA 5K0UC 1QQP3 3QH6A 3WUDA 1IS5A 1D4M1 4AXOA 5C8WA 4GWIA 2D3SA 1Z7S2 4RYDA 4INDA 5DZGA 2ZMKA 5EQUA 1BZWA 4LK6A 1HRV1 4Q0QA 1ULPA 1Z78A 4KMQA 5T3NA 2D98A 4LJHA 4FPOB 1AL21 5T5PA 3T0DA 1ZYBA 2BV4A 3KT7A 2JG9A 3DPRB 3H0OA 3K77A 3OGSA 4WVWA 2BYVE 5IYYA 5JZGA 1STMA 3R4DB 1LOFA 5C7GA 1AXYA 2VL4A 2HEYF 3PHMA 1RUG2 3PTYA 2VD7A 4DUXA 1V6IA 1W8UA 3B02A 4GH4B 4TXWA 5IATA 1RUJ2 3AK0A 5GZGA 2A70A 1ENXA 3DPRC 2OQ7A 5H9SA 5C8CB 2A3XA 4IE6A 4JGZA 4BQYA 3VBOC 3ZYGA 4QPGA 1MEC1 1GWKA 1YIFA 2JKXA 2XVGA 3KS7A 4MGKE 1G7YA 3H7JA 4D69A 1GQHA 4H7LA 4LNVA 4AEJA 1QNWA 5BV6A 2A3YA 3ZXEA 5F6KA 1RUH2 4CDXC 4D6SA 4IV3B 4OUEA 3AMPA 3FL7A 2JB4A 3AMMA 3UYJA 1PO23 4N8MA 1TG7A 2GC3A 1W6QA 2QJVA 4XZPA 4Y24A 4H14A 4YFWA 1LOGA 2VPVA 3J7NA 4KL1A 4XPVA 3NNLA 4QX7A 3RDIA 5KHIA 1E5RA 4WM8A 4FXGB 4XMIA 3LEKA 2AZ5A 4YG0A 1L7RA 4RR3B 2D3PA 5T52A 4A7YA 4QXCA 2NN8A 2X53S 2VNGA 2JDYA 1NX9A 1LOAA 1OOPA 1GMMA 2WAAA 1YFYA 3DYMA 4XUPA 4BWOA 3HJRA 3HR9A 1QJEA 1RUD1 2CGOA 3UKNA 5ACA1 2VULA 3CO2A 2LALA 4M4PA 2D40A 4Q1PA 5A6XA 1IZ3A 1O6UA 3GCXA 4BPZA 2B4KA 2HJIA 2YY1A 5FYVA 1V6MA 2Z79A 1L7LA 2OZ6A 3D0SA 2LTNA 3PVEA 5ANQA 1W2TA 1VBD3 1XC6A 1O5LA 1AR81 5D1IA 1FPN1 3RYRA 3MICA 2E26A 3PL0A 5DAQA 4IE0A 1NCRA 1NQJA 1X9TA 1Q8SA 4A42A 1PMJX 2JG9B 3Q8FA 4I0AA 4MV2A 4QGLA 5JZGB 4XURA 1AR93 1YQCA 1ONAA 1S0DA 3MPPG 1QJX3 5APAA 4ZS2A 1ND2C 2QQLA 1PMHX 3NSTA 5FCCA 5B2GB 4YZ5A 2W1SA 4XJWA 1BMV2 1CAVA 3H1WA 2BGPA 2Q8DA 2BWAA 1HB1A 2YPDA 2EIDA 1WLWA 3WV6A 5C9AC 5JZGC 4JGZB 2D6MA 1JYIA 2IXKA 1LOFC 3CIHA 3IPVA 3RG0A 3CZUA 3UETA 1ZX5A 3M3CA 1CX1A 1VR3A 5EFUA 1RMU3 4Q4W2 3IWZA 3NAPC 3BOPA 1C8M3 4TLFA 4IUGA 4JKKA 1IQAA 4QPGC 4AOCA 1UU6A 5DG1A 1W6QB 2BU9A 2D97A 3BYWA 3J7MA 1S0CA 3UGGA 5JMCA 5JXIA 1W04A 2B8MA 2VW1A 1DZRA 1JTZX 4NHYA 2GU9A 4XIKA 4WM8B 2HYXA 2DWRA 3UNPA 4XMAA 4KI5M 4XFBA 1D0HA 2RS32 1R1A3 5FUPA 4BM8A 5L7OC 1OVSA 2ET7A 1OOPB 4FVVA 2V5DA 3RYKA 2P34A 3VBRC 1C3HA 2NLRA 2VMIA 2YMZA 5ABJC 2AACA 4WM8C 4LKFA 4OYUA 2FBEA 4Q4Y1 4CVUA 4E2QA 5C3SA 1EV13 2V4VA 3SH5A 1JXNA 4KGGA 2N7GA 1NZCA 2VOTA 4CEYC 4M3CE 4CP9A 3ZYBA 3LQCA 1H1MA 3LAGA 4AVSA 4COVA 1VMFA 2C1FA 2VC9A 2WSUA 3ZR6A 1WW5A 4IGPA 3NWKA 3RZMA 5K9YA 4HANA 4QQ2A 4RSUA 3ZXAC 2QQMA 3C7GA 5FY0A 4EQVA 1RL3A 5A7SA 5FZIA 1QH7A 2TUNA 4I0BA 1NCRC 3O0XA 2Y33A 1F8VA 2GC0A 3USUA 3RZZA 4B1LA 4TZDA 3O0WA 4DS0A 2DUOA 2WT0A 3POWA 4OHZA 3IPVB 4XFCA 1PGL1 3KCCA 5FBZA 5KXBA 1AL0G 4DRVA 2G9ZA 3WT3A 2IXIA 3AMHA 5CKMA 5G04L 5J96B 4YLZA 3K75B 5L19A 1SCRA 3WDTA 1DCSA 4UBGA 2JDZA 5FZMA 4LIUA 3CKHA 1OI6A 4W4ZA 5JSOA 1QU0A 5FY7A 2F6BA 1JZ7A 4D6RA 4GB33 4EROA 4A3XA 5FPAA 1F9KA 1CPNA 2YDEA 3IB3A 4XJUA 1UXZA 1AX0A 1IGOA 4LLOA 1QJY2 2X05A 1UWWA 1S0IA 2BVVA 1OVPA 3FX3A 3MI8A 3OY8A 3VDCA 3WP5A 4XE9A 3EMRA 1HRV3 4F83A 2QZ3A 5I91A 4RS5C 3J9SA 1R1ZA 3AP5A 4AVBA 4UT5A 4TTGA 4GMP0 2A1XA 3GCWA 3I3DA 1AL23 3WDWA 3WP4A 1XE8A 5IVFA 2WQZC 2SLIA 2XVLA 2WNVA 1RUOA 3UGHA 4UFHA 4CP9B 2D7FA 2QQVA 4MHUA 2VTXA 3VLBB 5FZ1A 5IK5A 2YGMA 2ZHLA 3MEPA 2UWBA 2DFCA 4E2GA 5C3OA 1RUI3 4YNIA 4YVWA 2P6CA 2HH9A 4ES8A 5DZFA 1KJLA 3ZSKA 1UYZA 1QJU1 1RUE1 2WS92 3ZSLA 2ZGLA 5IHRA 2H0VA 3PVBB 3K4ZA 4MHRA 5FPUA 4NPMA 4BQXA 2RG4A 3WG2A 3EHKA 3MUZ1 2CL2A 1RXGA 1I5ZA 2R071 3ZN4A 4XCAA 3LEMA 4XTMA 4X8NA 3USUB 3A23A 1NE6A 3I59A 1UZYA 2BRTA 4ZZ8A 4MUVA 3E5XA 1W9TA 5KR7A 1WMFA 3RS6A 4JKMA 3LA2A 3WW4A 4CCKA 4DNYA 2DVAA 4LK7A 1PO11 2WAOA 4ASKA 3VN4A 1OD5A 2W87A 5LA2A 2RM22 1YFXA 3SLIA 2OVUA 4RGGA 2JWPA 4FCAA 4CUCA 5IK4A 2WRAA 1U5YA 4XJ8A 5JCTA 2YZ4A 1NQDA 5A7NA 1CWPA 4RGKA 1FX5A 2HWC1 2WO2A 2LUWA 3T08A 3OY8B 2VMHA 2EICA 3WINE 3S57A 3KSCA 2WO7A 3PURA 1F5FA 1LODA 2QZ2A 5JOXA 1OHFA 1LJ7A 2W1UA 3N7JA 5CZKA 4DEVA 4FPLA 1AR83 3PDQA 5DUUA 1WCKA 5JLVA 2HEVF 4C91A 5C71A 1CZTA 2WNVB 3WDYA 4NIHA 2XQXA 2X8KA 4TLGA 4S2HA 4M3CA 3B94A 5LW9A 1G6NA 1GANA 4P9XA 4XQDA 1HKDA 5JI7A 5FO8B 2Y34A 4YVWB 3KVBA 1QWRA 2QUOA 1BK0A 1HN0A 3WNMA 2O0OA 2X09A 2DTWA 3OBTA 5DG2A 3T2TA 5JOYA 4AK3A 5J37A 1PK6A 2WFPA 2BWCA 4NRMA 3U4XA 2W46A 3JBG2 1W8HA 3KHBA 3I59B 1GQGA 4QGMA 1WMEA 2WNUC 2ZGNA 4JGYA 2ZXQA 3LGRA 1RUD2 5LEJA 3RGBA 3V56A 1HV0A 3JD71 4NAMA 5GZEA 4OVEA 2RE9A 5H9QA 2XJVA 2AUYA 1XU2A 4P02B 2W3JA 4AWDA 3FE5A 4OI4A 5GLZA 1FPN2 4YSFA 1BEV1 4P00B 2ZMLA 3AZWA 1H2NA 1L7QA 4FOVA 3JZVA 3DKWA 2VZPA 2EA7A 2CWSA 4IE4A 3AMNA 3RJ2X 3BUCA 3SCHA 3IMMA 2ZX1A 1CAWA 2XBO2 1FMD2 1EUUA 5GZFA 1O91A 1CIYA 2OT7A 2E7QA 5K8SA 3ABZA 5FOJB 2DFBA 2VZTA 4OHWA 1LULA 4E2SA 2K0GA 2W39A 3TYJA 2IXLA 3HWJA 3UGFA 2MEV2 2R043 4I02A 2PLV1 2F4PA 2RHPA 3M2MA 3RPQA 1H4GA 2PHDA 2Y0OA 4JDOA 4UI9L 1VBB1 5GM0A 4M3CB 2D44A 5FZFA 5LY1A 2VJXA 2WZEA 2CYFA 4XILA 3ACGA 1BK1A 5KXCA 2VR4A 3V65A 2PHFA 1JZ4A 4P9YA 1WMDA 1SPPA 3QOPA 1N3QA 4Q4V1 2ZHKA 3O7OA 3PMEA 2HBTA 4XDOA 1EAH3 1W6OA 3ZR5A 1NA1C 3WDVA 5DDJ1 3I8TA 4Y4RA 4CCJA 2ID4A 5FZ8A 5A6YA 1HRI2 4P9WA 5F2WA 5DMYA 1Y9QA 1FNYA 1WWYA 1AR63 3N7KA 4UAPA 3ZFGA 4JGYB 1UY0A 3I54A 3VBSC 2MPFA 3WR0A 1O8PA 1C5HA 5FYUA 1EUTA 2WZ8A 4IV1A 1H8TC 2JG8A 3BB6A 5GLTA 4YYOA 3UKTA 1PK6C 1TME2 2XL7A 3AC0A 2CNAA 3FMGA 1DQ6A 3AVRA 5AVPA 3O1SA 1SBDA 2WIIB 4L99A 5CIRA 4OUSA 3NKTA 3H8XA 3I2KA 2RDNA 5DUVA 2YFZA 4W8JA 4LOTA 3I7DA 5F5AA 4FPHA 1AR73 3O14A 1QH6A 1U12A 1CAWB 5JWPA 1JI6A 2JB8A 2IVJA 3I3BA 4YZ3A 1W2AX 3H42B 1CZVA 3OEAA 1DYKA 1VB4A 1PM7A 2WA3A 5FYSA 5LK5A 3WEZA 3K4AA 1YQ5A 2P17A 5IAXA 1ND3A 4CUAA 3T2QA 2IXCA 3ZX7A 4B29A 2HLEA 4A4AA 4H2AA 2VE1A 4G9SB 3PUSA 5IVBA 2JDPA 1QJU3 4Q2FA 4K6BA 1VP6A 1VAKA 4PIZA 1VBE2 5DUXA 4FAHA 2E33A 4BXSV 2MHFA 1IS6A 1CD3G 2HWE2 4PDWC 5A1FA 1IS3A 2R073 3GGLA 3VZLA 2WO1A 1SPPB 2WQ4A 3SH3A 1B35C 3LE0A 4GZ9A 4WVVA 1MPXA 2ETEA 3T4VA 1RUG1 3RI8A 3AZZA 1XPWA 1BXHA 1PZ7A 5FR3A 3NNGA 3VDDC 5A3UA 4QX1A 1CAUA 1W6OB 5T5LA 1VMJA 1W39A 1OKQA 4QPIA 3QD6A 1IQDC 2J22A 3ZFGB 1B09A 1GZCA 1PO13 2C6SA 4AI2A 4CDWC 5BUVA 2R0HA 1GZWA 3WNKA 5IFTA 3VGIA 2YG0A 4YW1A 4AQ6A 3IMNA 4IV1B 4OMDA 2JG8B 1RUH1 2FMYA 1GLHA 1RYYA 2VOXA 1JZ3A 1RINA 3QBQA 5BNOC 2R16A 4XJ9A 2NZ9A 2VZ1A 4PBOA 1KGYA 2ZZQA 4K21A 4Q0VA 3D8CA 3F95A 4YM0A 5JI9A 2W1WA 1H2MA 5FWJA 4L97A 1R081 3BTYA 4MX3A 3ZFEA 1RUE2 4CRQA 1XNAA 1HV1A 5IVVA 3ASIA 4NN0A 4FXKB 3EJKA 4HL0A 2W08A 4V1PA 2YFUA 3A22A 3C3VA 2RR11 3AKRA 1MS4A 1O3SA 1GNHA 3FBMA 3VKFC 2EAAA 4MG2A 1GP6A 3AFGA 1ND3B 3CJIA 3ST7A 4BLIA 4UXAA 1XRUA 2BERA 1LRHA 4IXLA 4N9HA 4CYDA 1SG3A 1ZRFA 1VLNA 1JOPA 2VUAA 3INAA 1J1TA 1TZOA 2WO3A 2RMU2 2V09A 5FYIA 2WJSA 4K1YA 3OBRA 3VKLA 4FTBA 2R7EB 3D82A 2C26A 3ECQA 5D8AC 5I0TA 5BNNA 1W8NA 4FQZA 4P14A 2O8OA 3THDA 3MFAA 3WDUA 3TEZA 2W68A 1BMV1 1CZSA 1GBGA 1DLLA 1W2OA 2HWC2 3JD73 4EWDA 1Y3TA 3ZSJA 3POSA 1RVF3 1CAUB 2ZEWA 5FYHA 1PNGA 3UL2A 4LBLA 1W8WA 1U5IA 4PBPA 2IUWA 2XONA 4P9LA 5H9RA 1YRZA 3O1TA 2A7AA 2C5DA 1R64A 4ISQA 1BEV3 1GZWB 2K46A 2VXJA 3O12A 4WZCA 3ZYPA 5G05L 1NXD1 4NJ4A 2VVEA 3CDZB 4QD2A 3U1XA 1LGBA 1NLQA 1V70A 2G19A 2ARCA 2ZX4A 4QPIC 4A3ZA 3AFKA 2VM9A 5DZEA 2R32A 2F4LA 4Q8LA 3G6JB 3WHUA 4NHMA 4P9IA 3WDXA 4XHXA 3DYOA 4K40A 4NHXA 1ULEA 3ZFEB 4DPNA 2Q8EA 3AXDA 5F32A 4KBBA 1TEIA 3VV1A 4DY5A 5AC92 4UF0B 2YV8A 2PLV3 1DP0A 3SKJE 3U75A 2D6PA 2GALA 2GZWA 5A3WA 3FJSA 1VBB3 2AYHA 3K51A 3WW3A 3NJVA 2WC2A 4LO5B 3NW4A 2G9FA 3Q8EA 5FXWA 4B1MA 4AGVA 3CJIB 2WWJA 4GIQA 3RNSA 2JICA 3TN92 3LIGA 5CAZA 2VAUA 1S2KA 2E7AA 1DF0A 3NO8A 4XZUG 2VMEA 2D6KA 3QLQA 2IFWA 4CTEA 1JS9A 4BE3A 4IEUA 1S1AA 1HB4A 3T4HB 2WZR2 5BY5A 3N7MA 4URAA 3H9AA 3LFIA 5F7UA 4LBQD 3I4IA 4RN5A 5K0UA 5DDJ3 3ATGA 4BIOA 3N36A 4BZ4A 1Q56A 3M3IA 4PT6A 5BNNB 4QDSA 5LASA 1N1VA 4V2WA 1SFNA 1C1LA 1E5SA 2XQRA 5B4NA 2GP3A 1HB2A 4MADA 4P9GA 3GF6A 4XF9A 2DTYA 4Y1UA 1UL9A 4WVZA 1RC6A 5A7QA 1L3JA 2JDMA 3GZUC 4W6WA 4HT1T 1W8ZA 2CDOA 2P3YA 4LUKA 2PTMA 5F9TA 4G4FA 5F3CA 1OQEA 1TQ5A 4HZFA 3DGTA 4FT8A 2IC1A 1UD1A 4XF4A 5A7OA 4UFLA 4JZRA 4AYUA 4LBJA 3ZSEA 3ENRA 4YM1A 5GALA 2Q1ZB 4ZU7A 3GDBA 4KU8A 4X6QB 5KWRA 1UIJA 3GJAA 4NO4A 5JPNB 3CL1A 2X5IC 4J1WA 3VBOA 1W90A 3HT2A 1Z7S3 1QJY1 2A6VA 3IAPA 2RVAA 3TEXA 1YYNA 3DYPA 5GZDA 4CA9A 1PIV2 1JU3A 3I2FA 3WCSA 4CDXA 5I93A 1JYXA 4E4HA 4YFZA 2GP5A 1GQPA 3MDPA 4ATEA 4FFHA 4OI2A 4QB6A 2W52A 1UX6A 3VDBA 3O0VA 3ZMNA 4YARA 4NWVA 3GZTB 3IIAA 1DBNA 3P3NA 3W5MA 3MW3A 3J8F3 4LA3A 5DQ0A 2Z2SB 4YW6A 1COV3 2A6WA 1GICA 4GWNA 3WZ1A 4OQ8A 4PF5A 4HETA 1RUG3 5F6LB 2VZ3A 4CPBD 2RS52 1X9PA 1YNAA 2R1DA 1J3QA 4WZFA 2A6ZA 3HVDA 4UFIA 1RUJ3 2VGDA 1KXGA 3V64A 3ZVXA 3WNLA 5K0UB 2ZX0A 1ZRDA 2WS91 4R9AA 1O7FA 4MZUA 4URTA 3VD3A 1POQA 2JDKA 4Y33A 3RQ0A 2XWJB 1D4VB 2P1BA 2Q5TA 1US2A 4ZONA 3PTRB 5AFEA 1GNZA 5C3RA 3VBFC 4E4ZA 2V5YA 5EYXA 2VOKA 3R05A 5FLIA 5CG8A 2JE8A 3VKMA 3K48A 3WF4A 1K45A 5DUWA 3I97A 4PLOA 2GNDA 2QCSB 2ZGOA 2DV9A 4RD7A 3OBAA 2JIGA 1XSQA 1OC1A 1SACA 5L9RA 1ND2A 1W28A 4XVHA 4LBOA 4IW3A 5FP3A 2NMNA 3NV3A 3U11A 4AG4A 1N3OA 2RM21 2E7TA 4I09A 4DQAA 5FY1A 4BH9A 5CA6A 1ZZ9A 1SQ4A 2D3RA 2VCMA 4MGYE 3ZOIA 2PN5A 5C9AA 1YUDA 1RB8G 1NKGA 4QPYA 3VBOB 4XUOA 2CWMA 3BODA 1KS5A 4XW3A
chains in the Genus database with same CATH topology
3RWNA 1X8MA 5L73A 2LM3A 3N4MA 4H55A 2KXLA 3WY6A 4CDXB 1GFF2 4FTEA 1A8DA 3D6EA 3NAPA 1QXRA 2D93A 3Q9OA 4XBNA 2C0ZA 3WW1A 1JBCA 1S55A 3WQ0A 2OYZA 4MVTA 3AP7A 4YRDA 2D43A 3FWEA 1YXWA 2UY9A 5L7OA 3U0ZA 3U07A 3WP3A 3VBRA 2ZBJA 3GBGA 4AQ6A 1R082 4AF9A 4IERA 5ABJA 1PVC2 4NVPA 5EWSA 4FPCA 4D3WA 4YM3A 1MS5A 1SLIA 4B7EA 3GYDA 1AYN3 4CEYA 3FZ3A 4FPKA 3R6SA 4COYA 2RR12 1D0GA 4AHXA 4IEPA 3JBG1 2ZHMA 4Q4W3 4META 2E9QA 3NKGA 3RJRA 1UPSA 1BCXA 4HLTA 5C4WC 1SEFA 1ND2B 2PHTA 4QM8A 1ZBA3 4UW3A 4Q4X2 1N47A 2RS33 3S30A 1DYPA 2WINB 5C9AB 4YW4A 3JUUA 3NV2A 1RHI3 2CV6A 2QVSB 2XBO1 1FMD1 4K1ZA 4JRLA 2VECA 5KC5A 1IHMA 1XE7A 2R30A 3NAPB 1ASJ1 3RI9A 4MLOA 2MEV1 5BYNA 4QPGB 1ALYA 1I3HA 3IT8A 3AJZA 2GH2A 1H1AA 4FOWA 4AI8A 4BMEA 1OLQA 4I3PA 2EXKA 1GV9A 4B4PA 5FLJA 3THPA 1AXKA 4IEOA 2JX9A 4ISRA 1YJKA 1MVQA 1Q8PA 3ZN5A 5F5QA 5IK7A 3SISA 1H0BA 5L7OB 4RS5A 3VBRB 2AREA 2I74A 2ZX3A 5ABJB 5CG9A 2VQAA 1AJKA 3GNEA 4N53A 3WHTA 4QQHA 4XETA 4CEYB 5CFCA 1HRI1 4M0HA 1G9CA 2A3WA 2ZZJA 4AFDA 2ZABA 1Q8QA 2HWF3 1OA2A 1TME1 3ETQA 4LO4B 1DU3D 3L2HA 4Q26A 1XYPA 1QJY3 4M0NA 1VBD2 3ACLA 1NCRB 2VNOA 4Y20A 1YFWA 3VBUC 1LEDA 1AVBA 2JE9A 5FQ0A 1CAVB 1C57A 4QGNA 1BQPA 1X8EA 3CF6E 3ILRA 3KMHA 1VB2A 4R4ZA 1O3TA 1RTVA 1JYCA 2HWB1 2WLQA 4COUA 2XL9A 3ZFFC 1KFXL 2WS93 2ZACA 1MS3A 2XLGA 1VBE1 1MQTC 3MFCA 1PZ9A 1RMU2 4GMP3 2HWE1 2ZGKA 1ULGA 4FAGA 4YW3A 2PQQA 4RS5B 1FXZA 4Z92B 1D4M3 3BTAA 3B3QE 5FREA 1LHOA 2B7YA 1VRH2 4I2OA 4K9SA 4AVTA 1HW5A 4QXKA 2AENA 4DINB 4JCKA 2YROA 4IL7A 4NOTA 4AEDC 4B4RA 1R1A2 4YVSA 2DYCA 2GDFA 3T1LA 2RM23 4R9DA 1Z0HA 4N53C 3P3PA 4AQ2A 3ILNA 4OFGA 1JUIA 3DN7A 1EV12 2DVFA 5CFCC 1ZBE2 1MR5A 3N3HA 2H6BA 2OPKA 2WFF2 3VKNA 2K2SA 4R9CA 4Y20B 1FI2A 2EALA 2WNUA 2ZA9A 4MXVA 3WP6A 4PLNA 5C33A 4HKLA 1GYKA 1MEC3 4Q0SA 1A3KA 3QACA 1OA4A 2Q4SA 2Z5WA 4D7YA 1DGRN 3NV4A 2A5ZA 3ALQA 2OW4A 1WD3A 3KZ4C 1U5XA 4JC1A 5E16A 3OJBA 2EXJA 3KB5A 1LKNA 2RMU1 4D7TA 4OI0A 3MLKA 2ZPXA 4YZ2A 3AZVA 4Z07A 4C90A 4B3NA 2PAMA 4OI1A 1FAYA 3JBG3 1PHMA 1NCQC 1OPMA 1RUD3 1SLCA 5GJ6A 5ACA3 1I6XA 1ZZBA 4A7ZA 1FYUA 3X29B 2NMOA 2YYOA 5A33A 1KD7A 1A8MA 3C2UA 3H3ZA 3TBDA 1S0JA 5JPMB 3CLPA 4YVSB 1FPN3 5E1RA 4ZXKA 4F8AA 2DCKA 4QQLA 3S7IA 3PMSA 2BVBA 3WLUA 1TNRA 3M1HA 2H0BA 2GMEA 4YVSC 2XBO3 1FMD3 1W0PA 1V6LA 1NA1A 2VXRA 5FMOL 4KG0A 2BUKA 2CTVA 3S0MA 3HBZA 1LOEA 2WNUB 3AYDA 3IDBB 4Z82A 3VBSA 4M00A 1DQ0A 2MEV3 4L11A 5AC91 5LEKA 1H8TA 1QOOA 1VBA2 4XJAA 1H4HA 5CU1A 1TNFA 4WBBA 4R8HA 2QQPA 1RJ8A 1IPJA 1SCSA 3TN91 4ASLA 1KITA 3VZKA 2CAUA 4YM2A 3PNAA 1Q3EA 4PIYA 2WZR1 5FMOS 1R092 5I8SA 3L2YA 4AFBA 2JKBA 2D5FA 4Q27A 4Y22A 3G7DA 1LENA 1C8NA 1HRI3 2ILMA 2OUJA 2QDNA 5LRSA 2BBVA 2E6VA 3OYWA 4XBLA 4NR1A 4Q4Y3 1UU4A 3AYEA 3BCWA 4HKOA 1VAMA 2CAVA 1KFUL 1ULCA 1ASJ2 1QY4A 4CEWA 2NM1A 3OF1A 2BFUL 4PDWA 3MPBA 2PHRA 1B35A 2IXHA 2C9AA 4BIFA 1MZFA 1H9WA 3AB0A 4DY3A 1LR5A 3VDDA 3AKTA 1NA1B 1UKRA 4UW6A 5L36A 3AX4A 2KA3A 1YIPA 2WNEA 1UCXA 3DUIA 1QNYA 1Y7BA 1MS1A 4CDWA 1YJLA 1OQ1A 4H7MA 3VBSB 4LHNA 4X8PA 4C1XA 1WGPA 1PIV1 1H8TB 1K5MC 5BPXA 4GXLA 1PK6B 5BNOA 2XHKA 4EN0A 5KHJA 3FBYA 3MW4A 4ITCA 2BFUS 2ZMNA 1VBE3 1UKGA 3ZXKA 1QGLA 4AHYA 2HWE3 3USSA 5T54A 3OPZA 1CQ9A 4AQTA 3N35A 3VKOA 1VALA 3LOBA 2RS51 1BJQA 1Y43B 3WG4A 2EXIA 4BMBA 2DCYA 1XNCA 4LTAA 2BNMA 3E6BA 3ZN6A 1LTEA 1OSGA 4Y22B 4MSVA 3GHNA 4LBMA 4I3GA 4Z2WA 5HBAA 4C1WA 1N1TA 4YZ1A 2ZGPA 3OYWB 4FBFA 1YWKA 4WM7C 3O5SA 1G9FA 4KGQA 1DGRA 3WQ7A 3AKQA 1JW6A 3MZHA 2HWB2 2BTVC 2ZOEB 1N1YA 2VUJA 4PDWB 1REFA 5FRAA 3TAYA 2O1QA 2R042 1CX4A 5D8AA 2XLAA 1B35B 1AF9A 1RUE3 1AYM2 1OQDA 3VZOA 2DU0A 1CVNA 1PMIA 3VDDB 4CEWC 1VIWB 1WCSA 2R49A 3NJZA 3B01A 4HFSA 3KCYA 1LB2A 1GKBA 3IM0A 3SH4A 2PHWA 2VU9A 4CDWB 5BXXA 2RS11 1DGLA 4JDNA 2YXSA 4R9BA 4MYEA 5CNAA 1W0OA 4CP0A 1LU1A 3NVCA 5BNOB 5I0RA 1EAH2 2DF7A 2IZWA 1VBC2 3ZXDA 2FQPA 4HBNA 1RJ7A 3SNMA 1ZRCA 1LCLA 4JVAA 1GSLA 4AE2A 2HWC3 1REEA 3ZN6B 2CGPA 4AVCA 1QHDA 2HKXA 1X33A 3LWCA 3OD0A 1CIWA 1CPMA 1RUF1 3OGJA 1PVC1 3GBFA 2GC2A 1UN1A 4IEVA 1AR72 3TWIA 2D6OX 4CZSA 4W6XA 5CBLA 1NYWA 2EIGA 1WA4A 3MGUA 4Y4YA 4MXWA 2GNBA 4DOUA 3H50A 3RMYA 1MZ5A 5T55A 3H7YA 5D8AB 1UMZA 1NOVA 1AHSA 4PLMA 3A4UA 2XKPA 1QMJA 2V73A 5FO7B 5KBFA 1ZM1A 2UWAA 3D0JA 5AC93 1QXJA 2QNKA 1O4TA 2VVDA 2YUEA 4Q4X1 5KHKA 1ZZ8A 3RMXA 2HWD2 1POV1 4FPEA 4YGEA 4LO7A 3CNAA 3T1MA 4AW7A 3M4FA 4K3UA 3OCPA 5E89A 2VVFA 1ENQA 3TN93 4F3JA 2XPJA 2EVXA 2TNFA 2I45A 2WZPP 1ZVFA 1XYNA 2Z42A 4YZ4A 2NQYA 4QPIB 5CB7A 1RUNA 2KM2A 5AFBA 4COWA 2WZR3 5FO9B 1A6CA 2GH8A 1RITA 4PJYA 1G9BA 2X5IA 4OLLA 2VMGA 2XJTA 4IEXA 5TSWA 1ENSA 4LHLA 1F5JA 1W2UA 1BBT2 1PO21 4BLJA 1C5IA 3CEWA 4E4DX 2P37A 1C4RA 5HXVA 3VZJA 5HCBA 4AI3A 4FPYA 3LSDA 3ROUA 1D2SA 1BYHA 4YGCA 4OHXA 4EJRA 3ZYIB 4HSLA 4AFAA 3MF9A 4KWJA 3AMQA 3TB0A 1PVXA 4RQPA 4MXWB 3WD5A 1Q8VA 1CAXA 4HKWA 3AKPA 2GN7A 2WT1A 1AUYA 1LHNA 2Q30A 4MH0E 4XOGA 1V9U2 1IPKA 3LA7A 1EPWA 3E6CC 2OZJA 4Q4V3 1VBD1 5BNPC 3VBFA 1HXS2 5E8AA 1PIV3 3GALA 3CU7A 1G9DA 3UV9A 1NLRA 1IS4A 4GKXA 1H1IA 1QDOA 1TMF2 1NE4A 2ZTNA 1WUVA 3DV8A 1HLCA 5JSRA 2WKKA 5C6CA 1QJX1 1CESA 2NPIA 5I0UA 2ZHNA 2BPA2 4NHLA 2DU1A 3AJYA 2EF6A 4Q0PA 2RS53 1F31A 1HX6A 1PGW2 1NG0A 1REDA 4I0WB 1ZZ6A 4YW5A 1J58A 1HDKA 2X5IB 4RA0A 3KM5A 4DFSA 1ENRA 1RMU1 4OHVA 3A0NA 3M8LA 4LEJA 4IQPA 4OHYA 3DF0A 4AI0A 4E9KA 1Q8OA 1RUC2 4R52A 5GLWA 3VHNA 1DG6A 2QDRA 1O3RA 2GNTA 3FLTA 4J1XA 1VRH1 4W6YA 4FQ4A 3URFA 4BHPA 5IK8A 1JN2P 5T50A 3ELNA 5KHHA 1CN1A 1R1A1 4AEMA 4FPJA 2PHXA 5CFDC 1CJDA 1CAXB 4AGGA 1H8VA 3W58A 3ES4A 1EV11 4FO9A 4A7KA 3J4UH 1ZBE1 1S0FA 4AI1A 1YI7A 4IEQA 4RQPC 2WFF1 4DB5A 3VBFB 4GKYA 1LEMA 3FFQA 1QJZA 4FP3A 2ZGRA 4KG8A 1FT9A 4LULA 3M3QA 4KNCA 3ZYJB 2X29A 4F7ZA 1DQ2A 5C4WA 1RUH3 3WVJA 2AH2A 1XXNA 4FP2A 3W59A 5FOBB 4WVMA 3B9CA 4KWKA 1KJRA 2PELA 2Y38A 2BQPA 4EWAA 1R083 3S7EA 4E4SA 1PVC3 1QKQA 4P5HA 5GLUA 4XYXA 4BOWA 1JUHA 3E6DA 4M3CF 2RR13 2DCZA 4GB31 4RR3A 1X36A 2E51A 2B42B 1DHKB 2RS12 2CY6A 2BGCA 3HN1A 4FTSA 3AKSA 3KCXA 5JIAA 1HQWA 4ONUA 5EXOA 1V00A 2ZGUA 2P3IA 3MF6A 2VH9A 4Q4X3 2VY0A 1UAIA 4AVVA 4LLFA 4QM9A 2Y26A 4HN1A 4NWWA 1POV3 4L2NA 2ZAHA 3KD4A 4N9IA 2R062 4P9JA 3J8F2 4D94A 3H1MA 1COV2 2PHUA 1FOD2 2FHRA 2OIIA 1SMVA 2NYYA 4XTPA 1RUI1 2GC1A 4RHV2 4G3YC 1RUF2 2I07B 1RIRA 4YW2A 3WOGA 5FPZA 1DQ4A 2IXJA 1POV0 1PGSA 1VBA1 5FLHA 5C4WB 4GH4C 1H2KA 2ZCWA 2Z69A 1QQP2 1YI9A 4WVMB 3UJQA 2JECA 5C8CC 3QH7A 3VBUA 2UY8A 4AVAA 2XKOA 1R091 2B46X 1LOBA 1APNA 1BKZA 2WL1A 3B00A 4IV3C 4YGBA 4YG3A 1A78A 1DZQA 1G86A 1LHWA 3LB9A 1C1FA 3J26N 3S6PA 2UYBA 2PAEA 2DUQA 4LO8A 4HK9A 3ZFFA 3EBRA 3RSJA 3LSEA 4IETA 3RYPA 1QOSA 4ORFA 4Y5Z0 1HQNA 4XIOA 3HMYA 4RR3C 1MQTA 2VW0A 1H30A 4WV8A 2XGXA 2XUMA 2O8QA 4QMAA 3E97A 3SCFA 4AQSA 4XFHA 1OLRA 1CJPA 3JQWA 2JENA 4QX5A 1MZEA 2ERFA 3GBWA 2ZKLA 1UIKA 3WNXA 2WLPA 2JEMA 4GULA 2D6NA 4GA9A 2GMMA 1PO22 4L8QA 1JH5A 4AEDA 5K7PA 4RL7A 2JG9C 2QE3A 2IFRA 4EN6B 3LKJA 4Y1ZA 1AYN2 3H8UA 1DZTA 1V6OA 3HIFA 2ES3A 4KH9A 4LA2A 1FV2A 2DVBA 4UW5A 4JGZC 4CP1A 1LESA 5IUQA 3D4KA 5HCFA 3VBUB 2NP0A 2VW2A 3EXUA 4Y1VA 2GSYA 2PYTA 4RFT0 4C0HA 2QKDA 3FLRA 4N43A 3HD8B 4XFFA 4I01A 4JTNA 1VRH3 2YPJA 1EPZA 4XQWA 2FMDA 1KRIA 2G4IA 4K20A 1ZBA2 1ZRRA 4JQRA 1YCIA 1G9AA 5J7MA 2TBVA 2PA7A 3JB8A 3ZFFB 1WW4A 1AR92 4H3WA 4QQPA 1QJX2 1RHI2 3ZYRA 1J3RA 4JAAA 4MGZE 3ZXLA 2WT2A 1H9PA 1XNKA 5EZWA 3MIHA 1ZBE3 1MQTB 2BEOA 2WFF3 4LO6B 1OOPC 3WXPA 3PVNA 2R041 1O4ZA 2E63A 1U5ZA 1AYM1 1DGWX 1NCQA 3KLSA 3AZYA 1UZZA 1DDLA 4LBKA 4XDQA 1C8M2 4BA6A 2VG9A 3AYCA 4OUMA 4AEDB 4AFCA 2PAKA 2QFEA 2XJRA 4N90A 3IN9A 1D2QA 3ZXGA 4PCRA 4UBHA 4TWTA 4N53B 1E57A 1V6JA 1KS4A 4JRAA 5CFCB 1EAH1 1YO8A 2PHLA 4EN7B 1V6KA 4N7IA 3KGZA 1DFQA 3A0KA 1VBC1 4LUMA 1AR61 2HEWF 4O9EA 2ZKNA 4CDUA 1MZ6A 4KQ7A 3ZPYA 2BNNA 2HWF2 2ZX2A 4N43B 4COZA 4L9BA 2ATFA 2XJUA 4AHWA 3AYAA 5LK7B 1PNFA 1FNZA 3N7LA 2RJKA 1CGPA 1NY72 5FDBA 3AP6A 5GZCA 1MS9A 4HMZA 4Y26A 3PLQA 1DQ5A 2GMPA 2XG3A 4GWMA 4N43C 4LT5A 1AR71 5FQ0B 3PJYA 5J36A 1OPOA 3WUCA 3ZIXA 4FPGA 3POYA 3IKWA 4TYSA 3LA3A 1WW6A 4S2DA 2WA4A 1YLLA 2A75A 5I8YA 3ZMOA 1NCQB 1SBFA 2FZ2A 1JHNA 2HWD1 1VBA3 1LGCA 4EN8B 1U0AA 4GB32 4AHZA 3U10A 3HQXA 3SHRA 3TNPB 1X50A 2ENRA 2XWBB 1D4M2 3FHIB 3AP9A 2A6YA 3LOIA 4XJZA 1R093 3ME2A 4HPKA 1HRV2 4U2AA 4UW4A 1UU5A 2A71A 2H6CA 4HVQA 5HI0A 4K7JA 5JIUA 4CDUB 3D5OA 1AL22 1CR7A 1V6NA 3RRDA 1ZREA 2ET1A 3MYXA 4XBQA 3JB4C 3IBMA 3GHMA 4C0BA 1K5MA 1BBT1 2DCJA 3EO6A 1M06G 3KT4A 5CVRA 1RUI2 4LE3A 4CDUC 2B9UA 2R1BA 3H3UA 1ASJ3 1W6NA 3FLPA 3NL1A 5A3MA 1EYBA 4NPRA 5JVVA 4LBNA 1MEC2 1EP0A 4Z1VA 5DXDA 3TRSB 4EN9B 1N1SA 4XXPA 2I2SA 3VZNA 4FOQA 1SLTA 1V9U1 1YHFA 1KDMA 1Q5OA 4XF1A 4Y1YA 2ZS6B 3ZO0B 5SV8A 2WNVC 3I2DA 3WX5A 3M3EA 1HXS1 4WM7A 2XB6C 5EYYA 3MLJA 1TMF1 3SMHA 3VL9A 5FPXA 5KXDA 4YGDA 4YVWC 3GZAA 2A73B 4FOYA 3APBA 5ACA2 5A33B 4ZU5A 1AX2A 1Q43A 3LZZA 1TME3 1RVF1 3CJXA 1OA3A 4HPKB 1PGW1 4LBQA 4FPFA 3V0AA 2ARXA 1AR82 4IEYA 1LOCA 1AXZA 1UW8A 2JXAA 1J1LA 1WBFA 2ZJCA 1YFUA 5I0SA 1SDWA 1ULDA 2CGNA 2XJSA 5JAXA 4XFAA 1K5MB 1OFNA 4EV0A 3L9JT 1RUC1 3QCWA 2Q0AA 3TOJA 1SLBA 3V0BA 4JDMA 4AFMA 1W6NB 2AGSA 2HWB3 2GN3A 4KWLA 2TEPA 1S0GA 2UU8A 3ZSMA 1DIWA 4OZXA 1LU2A 1AYM3 1ZZCA 1CONA 3BIWE 5EV7A 3UJOA 4DXZA 1LECA 4Q8KA 4XQ4A 2P3JA 4XF0A 5AVAA 3MW2A 5KC6A 2JE7A 4WM7B 4MGIE 5LRRA 2GAUA 3SCGA 4B4QA 3VUOA 3KQRA 5J3UA 5FTTC 1DQ1A 3AXEA 1VBC3 1IOAA 1J59A 4FSJA 1T6GC 3WG3A 5T5OA 3BOWA 4OULA 4I30A 3HT1A 4Q0UA 3MLLA 4Q4Y2 1EY2A 3UK9A 4HVRA 3IDCB 4LBQB 3V0AB 4CEWB 3FUOA 1WBLA 1PZ8A 1W6MA 4JGYC 1QF3A 3THTA 5A3LA 3WG1A 4JV4A 1DGWA 4QHBA 4ZKTB 3AZXA 3B7MA 2DCTA 2ZAAA 3JU9A 2RJLA 2ARBA 4HVOA 3PVOA 3V0BB 1AJOA 4XEZA 3M70A 2EAKA 1MACA 1Z7S1 3WCRA 3MIBA 2G9GA 2Q1MA 4Y1XA 3TNQA 1AZDA 1PGL2 1S2BA 2RMU3 4DMIA 3LCPA 5EJ3A 2YGLA 4XXAA 1AR62 5H9PA 4D7SA 1O3QA 2HWD3 1MS0A 2XH6A 4DZGA 2R061 2EXHA 1ZA4A 2B39A 3J8F1 1COV1 3R0RA 1FOD1 1ZZ7A 2VNRA 3JCIA 3ZDSA 4CP2A 1TE1B 3NV1A 3VL8A 3R4SA 4RHV1 3ILFA 1RUJ1 3E5QA 2BNOA 2SBAA 2ZGSA 4AGRA 1FATA 1RGSA 3VBHA 5GLVA 2ZGQA 3WQ1A 1HIXA 5T5JA 3H1YA 5BNPA 1QQP1 2D6LX 5A32A 4XFIA 1C28A 3ZFGC 1BBT3 4JTOA 2K9ZA 1W6MB 2JD4A 1GZ9A 3PJQA 1F2NA 1XQNA 4QT6A 3E5UA 5IT6A 1WCDJ 3BPZA 3KGLA 3MIDA 4IV1C 2JG8C 4LE4A 3MIFA 1QJU2 5SV5A 2YHJA 1ZNPA 2R6QA 2YC0A 5J09A 1NXMA 2P2KA 5E88A 4IEZA 4B8EA 2R072 1IKQA 5KHGA 3AM2A 2BW8A 3OGGA 1LGNA 5F1RA 2B5HA 1FV3A 1V9U3 3ZIWA 1KDKA 3R4UA 3BU7A 5CADA 1HXS3 3EQEA 1JOJA 1PO12 4ZU4A 2HYKA 1ND3C 3WW2A 1XNBA 1TMF3 4QU2A 2R0FA 4HSJA 1OMIA 5FFOC 2XJPA 4O9GA 3ZXFA 1I1EA 5KXEA 3FC0A 3UKVA 1LHVA 2DURA 3ZXJA 4GQ7A 1M4WA