4AEMA

Structural and biochemical characterization of a novel carbohydrate binding module of endoglucanase cel5a from eubacterium cellulosolvens
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
126
structure length
126
Chain Sequence
ADIVLFSGSKHVEFTDWGGTDWPSAYELQPPYQTMPFDLNKNFEIKVDYSGADIVLIFARWEHGSKPQIWAQISPYYVVDGTAVFTKEQIAKAYGSDDFSDLDYIGVKPLPSADGMTVTKIVASYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE CEL5A
publication title Understanding How Non-Catalytic Carbohydrate Binding Modules Can Display Specificity for Xyloglucan
pubmed doi rcsb
source organism Eubacterium cellulosolvens
molecule tags Hydrolase
total genus 26
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18259 CBM65_1 Carbohydrate binding module 65 domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1070 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4aemA00
4AFMA 4AEMA 4AEKA 4AFDA 5AFEA 4BA6A 2YPJA
chains in the Genus database with same CATH superfamily
2EIDA 2D6PA 2EAAA 5F5QA 4UWDA 5CU1A 4K40A 3T09A 3UKVA 5H9PA 4I01A 2BNNA 5DZFA 5FZEA 1VAMA 5A7WA 2OX0A 1NCRA 2WABA 4P08A 1YFXA 1QJU1 4Y5SA 2BZDA 5FRAA 1WWYA 1M4WA 2DCJA 1V6NA 1UOJA 2ARXA 1RUH2 3L2YA 4XJZA 4EN8B 4LNVA 5GM0A 2VMEA 2WQZC 1SLCA 1POV0 4KMQA 5FZ8A 3GDBA 2HYXA 4AQ6A 3RZJA 2Y26A 1ZZ9A 4PCRA 3PVEA 2SLIA 3FLRA 3WW1A 4AQSA 4YW7A 1XNDA 1FPN1 1MPXA 1YQCA 2EIBA 4OHYA 2QDRA 1BKZA 4JGZA 1QQP2 4OZXA 4PQ9A 1JU4A 4FOVA 1EY2A 1R1A1 2PMWB 1W6QA 3MHZA 1PX4A 3ROUA 4TYSA 4UT5A 2HWC1 2RS53 1O6UA 3H9AA 2JDNA 2QVSB 1N1YA 4Q1PA 1QHDA 2XJRA 3E6DA 3AZWA 3LDKA 4A7KA 2RS32 4CDUB 4KG0A 4AI0A 4FO9A 1QDCA 4JTNA 1UL9A 2J1AA 1GP5A 2VW1A 3PVNA 5GZDA 3VB9A 3VL9A 3ZN4A 4BDVB 2C0ZA 4JDMA 4AHXA 1PX3A 2G9FA 2Y38A 5B4XA 2RS11 2XVLA 2QCSB 2OT7A 4N43B 3UT0A 2ADEA 4N7UA 5FP3A 1RUI2 3POSA 5IAXA 1FOD2 1H8VA 2NYYA 3HNMA 1HRI1 3CF6E 3POWA 4WM7C 5FUNA 2WFF1 1VMJA 2YPDA 3D4KA 3AB0A 4AOCA 1FNYA 1RUOA 4TLGA 4YM3A 4HL0A 4GMP3 1UO9A 2VZVA 4RYDA 1AR93 4YM1A 3PU8A 1N1TA 1F4AA 3KVBA 2AZ5A 1NQDA 4J1XA 1NKGA 2ES3A 3WP6A 4Q4V1 3DXTA 4QDSA 2EALA 4U2AA 1PM4A 4Q4X1 5FZIA 3D0SA 2VNGA 4QGMA 1W8NA 2VL4A 1ULOA 2P2KA 1HRV2 2PLV1 3OD0A 4JGYA 1CIYA 1WCQA 2VMIA 4KH9A 4XETA 2WDBA 2BW8A 3TWIA 2DFCA 2WA3A 1PHMA 4XUOA 2UY9A 1OC1A 3ASIA 4IV3B 3UYJA 4QM8A 5IT6A 1PK6B 1PO13 3G7DA 1G9FA 2IXIA 4HOOA 3QH6A 5IVCA 3GZTB 1POV1 1J58A 2GALA 1NG0A 1T2XA 4IEZA 2DDUA 1KGYA 1H8TC 1Y43B 4JKKA 3MEPA 1VB4A 5ABJB 3C7GA 2MNGA 2A73B 2Y60A 3PNAA 4QPIC 3VZJA 3OGJA 1JH5A 1X8EA 2BFUS 3MIHA 4MO3M 3VD5A 2GH8A 2JEMA 4AEMA 4CCJA 1H1AA 3MIEA 3NVCA 3USUA 3A21A 4TN7A 2Y8KA 1VPHA 4QX7A 3O0XA 3LD8A 4AVVA 3AM2A 2D43A 1I5PA 1WW7A 4UW5A 2IXLA 1JW6A 3UKTA 1W3VA 1XE8A 2IXKA 1K5MA 4IDZA 1KD7A 5BNOC 1OUSA 1JZ6A 1RUG1 3UETA 5FP9A 2XL9A 1V6IA 3RZLA 4M00A 1NY71 2E63A 1T6GC 1WW4A 3PTRB 1ZBE2 4NIDA 1OA3A 4AWDA 3S7EA 1QJY3 2P3KA 1KS4A 4CUCA 1NQJA 2VZOA 2D5HA 3BUCA 4H14A 3ZMNA 1FATA 5KHIA 4FPHA 2WLQA 2DUOA 2PFWA 3O5SA 1S0DA 4CDWB 2GP5A 2PA7A 5DN2A 5T5JA 5F3EA 1LU1A 2HH9A 3T2QA 2VW2A 3GYDA 4CUAA 5BV6A 5BY5A 1IG0A 3IAQA 4R9DA 4YM0A 5KHHA 4RA0A 4DY5A 2GNMA 2Y6GA 4C90A 3VBRA 3GZUC 1OOPA 1Q56A 1DBNA 2VZUA 1OD3A 3CJIA 2CL2A 5A6YA 4PI0A 4Q27A 1YYNA 2C5DA 3T08A 5IATA 3N35A 4OMDA 1PGSA 4URAA 4GULA 4LBQA 4NE9A 3LF7A 1N3PA 2RDNA 3MUZ1 5FP8A 4IEYA 5LA2A 1QJU2 1GZWB 2XBO3 2VQ0A 1U5ZA 1W8OA 1QJFA 5FK7A 3TAYA 4BH9A 5C5TA 1H0BA 1O8SA 2ZEXA 4L0PA 5LEJA 3HT2A 3AKPA 5BNPA 4I3GA 4MXVA 5FO9B 5GALA 1IPKA 4Z8BA 3K48A 3EHKA 4PLOA 4EN6B 5K4LA 3B9CA 4WV8A 1MS1A 1FPN2 5L7OA 3MV11 3NNFA 1J3PA 4QPYA 2VO5A 4CCEA 2CSGA 3ZIWA 5ERLA 2CY6A 4HN1A 1R1A2 2ET7A 5EQUA 2YMZA 3DKQA 3TBDA 2HWC2 2YGLA 2BBAA 3H1MA 5FY7A 3NNGA 5F7UA 1V6LA 2R1BA 4W4ZA 1JYWA 2WZPP 2WNUB 2YC2A 1UYZA 2XKPA 1W06A 5FMDA 2W0XA 4LKEA 4GMP0 5KBFA 4XIOA 1E57A 2JICA 1UZYA 4N53C 3AJYA 5A3OA 5KXEA 1VBB3 2WNVC 3ZPYA 3J8F2 3BN6A 4LBOA 2RS12 4DQAA 3E6BA 5FWJA 4KWJA 4OUSA 3BALA 3POJA 1NT0A 4LQRA 2VQTA 5C6CA 1HRI2 1CWPA 1JZ2A 1JTZX 1DGWA 4AAXA 2FDFA 2VVEA 4GXLA 4PDWA 2WFF2 3RJRA 5E6HA 1LGBA 1GQPA 3HWJA 4XFFA 5FYHA 2WO2A 3WF0A 3N9NA 1GNYA 1PO22 3IT8A 1CZSA 4LLOA 3VBOB 2C1FA 1V70A 3LIGA 3PUAA 1N1SA 2WNOA 3VZOA 2W2IA 1OUXA 5KC6A 1DQ5A 1HV1A 4YG3A 4Q4V2 3CKHA 4BIFA 3AVSA 3ZXDA 4MGZE 1MS3A 3TEYA 4QDQA 5GLWA 4AGGA 2C6SA 5HV0A 4K8RB 4FPEA 5C3OA 3I3MA 2PLV2 2VMDA 3M3QA 2V09A 3WNKA 4CPBA 4QU2A 2DVFA 4YVWB 2XGXA 3USSA 4AXOA 2PAKA 1E5RA 3NV4A 1GICA 2OUHA 3O12A 1AYM3 1KQRA 2FMYA 2GMMA 4CA9A 1DQ1A 2WUHA 4XJUA 2B5HA 1UXXX 2RS51 2VAUA 5LBEA 3WDWA 3WQ7A 1LCLA 4L97A 2D98A 2HWE3 3GF6A 4NWWA 1OVSA 5A3NA 1KITA 1S0GA 1VRH1 4RR3B 1W3XA 3ZFGC 1S4CA 5C3SA 5A32A 1FI2A 1LOEA 1FV3A 3K4AA 2OZJA 2BNMA 5CIRA 3RVHA 4HKOA 3VKOA 4W50A 3ZYRA 1NAEA 3PMSA 5JIAA 4NHKA 3DPRC 4Y22A 4XQ4A 1O3QA 2VOKA 1R083 2RJLA 1YQ2A 1H1MA 3MIFA 5C4WA 2IVJA 1CN1A 1VBA1 1WZXA 3SC7X 4BU2A 1G8WA 3DXUA 4HSJA 3C2UA 2J1VA 2JKXA 3IB3A 2VOVA 1IZ3A 4Z2AA 1RUJ2 4YVSC 1TE1B 4GMP1 1RJ8A 4XF9A 1ENQA 1QXRA 2BVBA 1QJZA 1NY72 1RUH3 1RUF3 4XDPA 4CUBA 4LIVA 1US3A 4SBVA 4LTAA 1H6XA 1NE6A 3OPTA 1QXPA 2BV4A 4YGDA 2AH2A 4JHTA 4YW2A 3RDIA 5FPBA 1V6JA 4AFAA 5EJ3A 4IV1B 2FCVA 1RUC3 2PQQA 2GSYA 1QQP3 1HXS1 1GWKA 3HVDA 2PHDA 4I02A 4P14A 1C4RA 5FBZA 4YRDA 1UYXA 3M7AA 3RFRA 3UKNA 4MGSA 4QB1A 2W46A 1LHNA 1LOAA 1QJEA 4HZFA 2VQUA 5T5OA 1WLTA 4BYYA 1PO11 4ASKA 1KFXL 1UOGA 2VUDA 4OULA 4KI5M 2R071 3WP4A 2RS33 1C5HA 1UYPA 2HWD1 1R1ZA 2ORZA 3IN9A 4QX5A 3VHOA 5JSOA 3ZN6A 4XJWA 3VKNA 4KNCA 3BTXA 3KVAA 1DGRA 1FXZA 4K1ZA 4PHZA 1AF9A 4TWTA 5DG1A 2ID4A 3WNMA 5CFCA 3TEXA 1UIKA 2JE7A 2UWBA 4MSVA 3HNYM 5CBLA 2FDIA 5LEKA 2WO1A 3DGTA 3V65A 1SLLA 3AL5A 1UXZA 4IUGA 3THTA 3U37A 2YZ4A 3ZXLA 5C8WA 5KXDA 3JD73 3WVJA 5A6QA 3FE5A 3HN1A 3M1HA 4RQPC 4M4PA 4R9CA 1YCIA 4Q4Y1 2R16A 4CZSA 2Y6HA 4QX0A 1YEWA 3GZAA 3A22A 1EV13 4L8QA 2GMPA 2YFUA 5T54A 3VBHB 5A1FA 5CADA 3VDBA 3VHNA 3O1TA 4GD4A 1COV1 5F32A 3X29B 4COZA 1QJY1 1RVF1 4RGGA 4ZXKA 4DRVA 1C57A 4URTA 5CAZA 3ZYGA 4XHXA 3SXWA 1BYHA 5A7WB 1NCRB 5FZ4A 2YC4A 4I0BA 4QM9A 2P3IA 3PURA 4J1WA 5JXIA 5JAXA 2WINB 1HQNA 4WVVA 5IK7A 5FMBA 4COVA 3OY8A 2TUNA 5FZ7A 1ZX5A 5L9VA 3LAGA 1UU5A 4QGNA 4W6WA 2CU5A 2NM1A 1K42A 4QXBA 4MX3A 5FR3A 3DCQA 5G05L 4C0HA 2W39A 4JGZB 4WZFA 5I8YA 3I49A 5JDBA 1VBC3 5IUQA 3ZYHA 3TNPB 1W6QB 3WQ0A 2ZMLA 2WQ4A 3E5XA 2P34A 1LGCA 5KWRA 2YU2A 3B94A 1ASJ1 5I93A 1W6OB 1NCQC 1WD4A 2VXJA 2XB6C 1E5HA 4QQPA 4DEQA 3IBMA 2A6VA 1DZQA 2FMDA 3MF9A 4S2HA 3CLPA 1SZBA 3P1IA 3UK9A 2G9GA 5C8CA 1ULDA 3KD4A 4RL7A 3M4FA 4P5YA 4RSUA 4DXRA 3JBG3 2JG9A 5D2AA 3C7FA 1PIV1 2B7YA 3MGUA 5IW0A 1ENRA 4YSFA 4NRMA 2X53S 1XSRA 1OQEA 2J1EA 1MZFA 1ZBE3 3U0ZA 2XUEA 2JDUA 2ZHMA 3A0KA 5FMOS 3RI8A 4JC1A 3P5BA 4Q5OA 1NOVA 4GH4A 1HN0A 1JYTA 2UY8A 4MH0E 1PVXA 4RS5C 2E51A 4FPJA 3S5AA 3MIGA 4IEVA 2Q5TA 1UZWA 4XJAA 1HB3A 1X9TA 5LASA 1DGRN 3SNMA 2IVIB 3GZEA 3D82A 3VUOA 1IQAA 4V1PA 3WSOA 1H9PA 5AC91 1IKQA 4IGOA 3GGLA 1GU3A 4Q26A 5FP7A 2E7AA 3VZMA 3W58A 2BEOA 1YIFA 3E6CC 1OH3A 4JGYB 2W94A 1JZ4A 4QB2A 4O61A 3VLBB 4HN0A 1VBA2 5AFBA 2VTXJ 4C0BA 4OI2A 1GANA 2ZXQA 3IDBB 3VBUA 5F6KA 2JE9A 4EN0A 1HKDA 2CV6A 3WOGA 2KM2A 4XJ9A 3O1UA 1CONA 4D6SA 3J4UH 4HFSA 1MS0A 1ACCA 4LBQD 5FZAA 1S2BA 1MZ6A 4EWAA 5E16A 1UU6A 4G3YC 4GB32 5CA6A 1TME1 5FZ9A 1FMD3 2I07B 2K2SA 1NUKA 2JG8C 4NOTA 4YW4A 4OQ9A 4EV0A 1R093 3H8RA 2OIIA 1HXS2 2WA4A 5FMOL 1H2LA 3USUB 4LBJA 4E2SA 5T5LA 1SFPA 1VBD1 1ONAA 1AYM1 1QGLA 3P6BA 3NKGA 4OFGA 3A23A 2E53A 3GBFA 3PIGA 5DG2A 5GKAC 5FZOA 4WBBA 2HWF3 1ZZ8A 2Y34A 1K5MB 2GH2A 3GBGA 5LBBA 4NIHA 4E8CA 2HWD2 4MXWA 4OUMA 4XPVA 1M06G 4BXSV 1LHVA 2VULA 4ASMB 3ACGA 1ZA4A 2Q0AA 1SQ4A 4NO4A 3FHQA 4BPZA 1K5JA 1V9U3 1OLME 1QJX2 3I8TA 1G7YA 3K3OA 4Y24A 1Y9MA 2VPVA 5E1RA 3CQOA 5JIUA 1W9WA 2K0GA 3HQXA 1DGLA 1YXWA 2PAMA 3BTYA 1Z78A 2FD8A 2DCTA 2FHRA 2WO7A 5CYYA 4RHV1 4BQWA 2WSVA 2YG0A 2D6KA 4Y1VA 1AX2A 1SLTA 4OUEA 2JE8A 1WA6X 3JZVA 2CGNA 4ORFA 4TXWA 5IK8A 5C9AC 3Q9OA 3KHBA 4OHXA 4Z2WA 3SEPA 3VBRB 3QH7A 4GZ9A 3WCRA 1H4HA 1OOPB 3DECA 3N4MA 1CX1A 3OYWA 2BOJA 4WM7A 2D3PA 3N7MA 3CJIB 4B4PA 1RVF2 4LULA 3WY6A 5C7GA 4KWKA 2WYSA 4LO4B 4QKBA 2ET1A 1GP4A 3K2OA 4SLIA 2JXAA 4AGVA 4LBQB 4UFKA 3SQOA 3B9IA 4CEWA 1SG3A 3OBAA 2Y64A 4XACA 2A3YA 3Q8AA 4ISRA 4DOUA 3ZYPA 4BQ5A 5ISLA 1SDDB 1LENA 2ZPXA 3ZXEA 4I30A 3ZFEC 2PTMA 5BNPB 3FBYA 4K9SA 4M3CA 1KXGA 2I2SA 4YZ4A 3LEIA 3TN93 1CJPA 5LBCA 4ASLA 4YLZA 3I3EA 2ZMKA 3U4XA 5L7OB 2RHPA 3BU7A 1WLWA 4XFGA 3WEZA 2X09A 3AFGA 1W9TA 2WN3A 2XUMA 1SPPA 1L7QA 4DY3A 2GDFA 4YZ2A 1ENXA 3OPWA 3OUIA 4PBOA 2ZJCA 2ZGLA 4AVAA 1VJ2A 4AW7A 1V6OA 4LKSA 3T3YA 5A1LA 4K20A 1ASJ2 5DUXA 3LDBA 4TTGA 1SACA 2A71A 1GQHA 1MEC1 5KXCA 1AR72 1H8TA 1WCSA 2BGCA 1W0PA 2BRTA 4QPIA 3POGA 3BYWA 5FLHA 2B45X 3I59A 4NROA 4BOWA 2V5YA 2VE1A 1RUJ3 3OEBA 4ZS2A 3WG3A 1PIV2 3RZMA 2Y33A 4BLJA 2QQNA 2W91A 3O1RA 5DAWA 3VHRA 1AL0G 5LA1A 3ZYIB 3AMPA 4NAOA 3T0AA 1ND3C 2YXSA 4O9GA 1RMU3 1W8TA 1Z7S1 1A8DA 2FCTA 2V4AA 2ZGRA 4OYUA 3TYJA 1HX6A 3JB8A 4AE2A 4ES9A 4PDWB 3VZNA 5ACA1 1AL21 1I6XA 2XKOA 3MW3A 3FHAA 2NPIA 5BNOA 3HAGA 1Q8PA 3I4IA 1AR61 2WJSA 5AC92 2VGDA 3UNPA 1WW5A 1OKOA 5C33A 5J37A 2W08A 3FC0A 4CP9A 4MG2A 1TVGA 1W04A 4HG6B 1AR82 2ENRA 2LTNA 1B09A 1MS8A 4KU7A 1U5XA 4MOAA 3E5UA 1XNBA 2AACA 4LPLA 5FYSA 3DEMA 4AFCA 4BZ4A 5K7PA 2D5FA 3LOIA 4NIAA 4AFBA 2XQRA 5BNNA 2BTVC 3G6JB 1HJGA 3O0VA 3W9AA 3NJYA 4FSJA 2PHRA 4XQDA 4QD2A 1CZVA 2VH9A 5C3RA 1O4ZA 2PHFA 3RGBA 4D3WA 4CU7A 4PIYA 1ULFA 2QQLA 2R043 4Q4W1 4CDQC 3C7HA 4FTSA 3U4SA 2B9UA 4FQ4A 5AFEA 2VMGA 3KSCA 3T4HB 1REDA 2RM23 3SH4A 1TME2 1LTEA 3AP4A 4LIUA 5GZGA 1RUE3 1PM7A 3B00A 4N90A 3H8OA 3BVCA 1UMHA 2HJIA 2RR12 2VOXA 3NAPC 4FPGA 2CAVA 4HVOA 5A32B 4NUBA 3SH5A 4BQ2A 5JOYA 2A6XA 1VBE3 5T52A 4LE4A 5CKQA 2Q8CA 3HOBA 1KJLA 1DZRA 4Y22B 2W9XA 2R0HA 2XJVA 3THDA 3EYPA 5C4WB 1ULPA 2NN8A 4QXCA 1NX9A 3AYCA 5DPNA 3LKJA 4E4SA 5EP9A 3BU0A 5FY5A 4B29A 4BQ1A 4DB5A 4H7LA 3OUHA 3NNMA 4LE3A 4XYXA 5J98B 5C3QA 2CDPA 4A2UA 4HVQA 2XPJA 4V2WA 1HB1A 4JV4A 3LB9A 1VLNA 1BBT1 2ARBA 2WWUA 4YFZA 1G6NA 1H2MA 1RUD1 1C1FA 3VKFC 4XXPA 3ACIA 4P9YA 4LHKA 3FUOA 2D6NA 1DIWA 1LOFC 1FX5A 3IIAA 1BQPA 3KCYA 4RHV2 5FPLA 2OYZA 4UAPA 2YBKA 3AMMA 5DQ0A 2YBPA 4JQTA 2QZ2A 5FPZA 1YIPA 3WQBA 4Q0VA 4N53A 4AQTA 1O59A 2PHLA 2WNVA 2IC1A 2RMU3 2RDQA 4M3CF 2GZWA 5HPOA 3IKWA 3IDAA 1GOFA 1W6OA 5DABA 1XYPA 2R7EB 1OT5A 2PHTA 1QNYA 1SFNA 5JR7B 1UZ0A 4K8FA 1H1IA 3ZN6B 1X50A 3WLUA 3M3OA 1XNTA 4JQRA 1QU0A 4QKFA 4CCMA 3TEZA 2PYTA 3DKWA 3FLPA 2MEV3 3URFA 1ZZCA 2JDPA 5CFCB 1GUIA 2CAUA 4QHOA 2YGMA 1W2AX 3WDXA 5A3UA 3BB6A 3LA7A 1TMF1 1EPWA 4QDRA 5K0UC 2R061 3BGAA 5LCWL 4UW3A 4IXLA 1C8M2 3K46A 2ILMA 4BK4A 1AXKA 1W2NA 2AGSA 2VMCA 1F31A 1W8FA 3PJQA 2VUJA 2R49A 4FTBA 4CEWC 4ARYA 2BP6A 2Q1FA 4P9XA 3T0DA 5FUPA 1N3OA 2WSUA 1CX4A 5IFTA 3AP5A 4BK5A 2WZR3 5FY9A 5J96B 4XF3A 1F5FA 5JPNB 1MEC2 3W59A 2CHHA 2AENA 1WCUA 1YQ5A 1DP0A 1W2OA 2D3RA 1U0AA 5I0UA 2K9ZA 1LHWA 3ZFGA 1BHGA 2WT1A 4XBNA 2DU0A 1LU2A 4P5HA 3HNBM 1JYIA 3AKSA 2ARAA 3PJYA 2KA3A 4QU1A 3S0MA 2EXKA 2ADDA 2G19A 2FZ1A 1LJ7A 2DF7A 3OY8B 1UKRA 1ZBA1 2WS93 3RNSA 2YC0A 3WT3A 5LRSA 1RGSA 3DPRA 5FIXA 5FO7B 4CCLA 1LHOA 1UF2C 4UBHA 1Z7S2 2C9KA 2TNFA 2HBTA 3LGRA 5D8AC 5FO8B 5EWSA 2VUAA 3WZ1A 5ACA2 5T3NA 2OPWA 2GNDA 1AL22 2ETEA 4M01A 3M3IA 3AKTA 4YG0A 5DAPA 4YVSA 5C5UA 2VVFA 1CPMA 3D8CA 4ET7A 2QQVA 1AR62 2VNRA 4M0HA 4B7EA 4W8JA 2CWMA 2O0OA 4MV2A 3MF6A 2VW0A 3PIJA 4C8DA 2JIJA 4AI1A 3S5QA 1TNFA 2X29A 3UJOA 5JPMB 5C8CB 5HCFA 2QQPA 3W20A 1ODNA 2OQ6A 4FT8A 1ULGA 5SV5A 2JG9B 2B4KA 2D6OX 1EUUA 4CCOA 1CIWA 1Y9GA 4DS0A 1UZVA 1WCKA 2WZ8A 4GALA 1PMIA 3H50A 4CP1A 3RI9A 1KEXA 4A42A 4GH4B 1W6NA 4YFWA 1RITA 3BCWA 4Q4W2 4XJ8A 4NVPA 3CHXA 1YHFA 3OD4A 3C7EA 5I0DA 1ALYA 4KGQA 1QOTA 3ME2A 1D2SA 3FWEA 4QXKA 2ZGMA 4GA9A 5T50A 3QACA 3RYKA 2FDGA 4CCDA 5BNNC 2YU1A 2MPFA 3ACFA 3VKLA 4ATFA 2HWB3 1AHSA 2GAUA 2Q30A 2XXZA 1RIRA 3VN4A 2AREA 3E5QA 4GKYA 2D97A 2BFUL 2Q8DA 3A7QA 1JUHA 2W1UA 5HCHA 3VBUB 2QJVA 2P6HA 2Z79A 3GCWA 4DUXA 2B46X 4RQPA 4Z92B 4X6RB 1JZ3A 4BISA 1UNBA 1RHI3 4CU8A 5I8TA 3GALA 4LITA 4ZHNA 3HQUA 1HIXA 1RUD2 5T5PA 1C8NA 2IFRA 3BIWE 1IS6A 1D4M3 3AMHA 3HQRA 5DDJ3 4A7ZA 4FXKB 5DAVA 1EAH3 4AI9A 5M0TA 1JYVA 5LK5A 1QF3A 1E5SA 4HKLA 1AX0A 4IEOA 5A6ZA 4JAAA 4KU8A 2VZ3A 1BEV1 3QD6A 4Y3OA 2J1RA 2BDRA 2DCKA 4QHBA 4QPGC 5CZKA 5FZOB 3RS6A 3RMXA 2R041 1CGPA 4FFGA 3RWNA 3F2ZA 4MXWB 3ZXJA 4F8AA 4FI9A 1SLAA 4EROA 2ZGSA 2XG3A 1W99A 1GQGA 3VBSC 5K9YA 1AYN3 2P3YA 4R4XA 3AP7A 1UWWA 2HEWF 3LEGA 4DINB 2ZGPA 3APBA 4DO0A 4BA6A 2WWSA 1NCQA 4Q0QA 5FFOC 2ZGKA 3LEKA 4RN5A 1L7RA 1TMF2 1SMVA 4MHRA 4RFRB 1KFUL 3KMHA 4B7KA 2E7TA 1JZ8A 1HQLA 4R4ZA 3ETPA 3ZSMA 3IAPA 1GLHA 3DV8A 2D6MA 1NXMA 2BOIA 4FPKA 1HQWA 2D40A 3K51A 4HANA 4N9IA 3I2IA 4EQVA 3UV9A 5FYBA 4MADA 3QOPA 3R6SA 3OYWB 4WM7B 3ZO0B 5DUUA 1MQTC 1RINA 2XJPA 4Q4X2 4A45A 2BWAA 4RS5A 3RJ2X 2XLGA 2YV8A 1STMA 4MZUA 4CEWB 1RL3A 3ZFFC 3OBRA 4XF4A 2OW4A 1LOBA 4C1XA 3PTYA 5HXVA 1OF4A 1X82A 1ZNPA 1HV0A 1UY1A 3POEA 1C3HA 4LLFA 1ZBA2 2W92A 4M3CB 4MGKE 4XTPA 1X36A 5FZMA 4AI8A 3O14A 1O4YA 4XHBA 5A3WA 2W95A 1UMZA 1APNA 3KZ4C 3LA3A 4L99A 3ZSKA 1XYOA 1DLCA 4LO7A 2J22A 1Q8QA 1JI6A 1WA4A 3ELNA 1JOBA 1POQA 2PQSA 5I8SA 3AZZA 2RR13 4BQ4A 1SPPB 1IS3A 2E33A 2ZGNA 5CKMA 3JXSA 4Y1YA 1WBFA 4I09A 5EJ1B 2VZRA 3TEWA 4I2OA 1PVC3 3EXUA 4IE7A 5D8AB 4D6RA 5C71A 3DYPA 4QX2A 1H8TB 4Q2FA 4A7YA 1WLDA 4QX8A 2G4IA 1RTVA 2G9ZA 1RXGA 3MZHA 4QPIB 3AXDA 1BK1A 2ZHKA 5FPVA 3I59B 1X9PA 1WBLA 1Q43A 2JG8A 2VVDA 2IXHA 3B69A 3WP5A 3I54A 1RUG2 3VD3A 5JZGC 5LW9A 3GM8A 1AR91 4LK6A 1GZCA 5A33A 5KR7A 4CDXC 5JSRA 4BHPA 4S2DA 2WT2A 4CU9A 3MIDA 3MLJA 5FJKA 1HDKA 2WZR1 3OSDA 3FBMA 3CO2A 2GU9A 4NPLA 5BNOB 1VAVA 2QQOA 5FYTA 4XC9A 1Y4WA 1XU1A 3U14A 1D0HA 2R0FA 4MLOA 1CQ9A 3LPFA 2YHJA 2VNOA 5F5CA 5J3UA 5GLTA 4PQQA 1LOGA 3FL7A 3ZVXA 4CP9B 2DBIA 3JU9A 5LK7B 1BXHA 1JU3A 3NV2A 4R52A 4XDQA 4BQ3A 3INAA 1S0JA 4JKMA 3TOJA 3ALQA 5FV3A 4EWEA 4LORA 3E97A 5A3LA 3LSEA 1K12A 2YBSA 3A0NA 3FHIB 2DWRA 1U5YA 2JDYA 3VZKA 2J1SA 3IWZA 4E2GA 5BNNB 4NHXA 3BI3A 1CAXA 4UF0A 2VZTA 2W52A 5C9AA 2P17A 3ZYBA 3POYA 1RUI3 2LROA 1W0OA 1FOD3 3LWCA 2ZBJA 5IHRA 5IVEA 3HEIA 3WW3A 3FFQA 3UL2A 1OVPA 2ZOEB 3AC0A 2QTWB 1Q8SA 2VZ1A 1MS5A 1RJ7A 1W0NA 3T2TA 3WF1A 1ND2C 4J25A 2Q8OA 5F37A 3T0BA 4OQ8A 1AVBA 3MDPA 4FP2A 3L9JT 2WZEA 5JSPA 4MUVA 5KHKA 2YY1A 4BIOA 4LXLA 5FP4A 4CSWA 1OHFA 4OHZA 4FBFA 5IJRA 3T1MA 5BUVA 1KRIA 1VMHA 5F9TA 3ZFEA 1YI7A 3CU7A 2DFBA 3RG0A 3ZSLA 4EJRA 4EE2A 4YGEA 4DNYA 4R9BA 3LOBA 1GWMA 5CB7A 1TZOA 1S0EA 2A5ZA 1ZYBA 5JXJA 1HRV3 1BMV1 2UYBA 1UY3A 3J9SA 3ORJA 4N7IA 3VD4A 4QMAA 1LRHA 3SMHA 4TSVA 3KF3A 4AVTA 2OS2A 1ODMA 2WNEA 3R4UA 4HK9A 3HPNA 4W65A 4ZU7A 1LOCA 4LHSA 2A75A 2Y6LA 4ZZ5A 4I0WB 2EA7A 1LR5A 2R1DA 4LUKA 4QPGB 4A4AA 3RZGA 2VMHA 4B1LA 1YLLA 4YGCA 3ZKUA 1CPNA 4QQHA 4D6QA 1W6PA 5F6LB 4CXWA 5A3PA 1IS5A 2ZGUA 4IEQA 2YUEA 2WN2A 4Y33A 4J6GA 3OB8A 4N53B 4CEYC 3H7YA 1XNCA 2OZ6A 1O5UA 1VMFA 2WNVB 3B7MA 3AKQA 4LBMA 4UFJA 2V72A 4UW6A 2XBO1 3CZJA 1ND3A 1RHI1 5F3GA 2GN3A 3NL1A 3AVRA 5SV8A 4BQXA 4UXAA 2IUWA 2QBXA 4H3WA 3KB5A 2DCZA 4K7JA 4R9AA 5FYZA 5I0TA 2X05A 4NRPA 1NA1C 1VALA 2Y6KA 4K1YA 4BMBA 3RYRA 5CFDC 1XPWA 4U36A 1ZVFA 2KXLA 4P9WA 5BXXA 3WDUA 2YB7A 5IAVA 5BPXA 2XHKA 3OBTA 1PNFA 4NPRA 1PMHX 3PUSA 4NWVA 4PJYA 4QXHA 4X8PA 5FCCA 3VD7A 1QH7A 3ZN5A 3HD8B 2XHNA 3Q8FA 2RS52 1XOYA 5AVPA 2BVVA 3KCCA 1CAWA 1YWKA 4Y20A 3WF3A 2LUWA 2DUPA 1Y7BA 4LR4A 1U5IA 1XC6A 3ABZA 3JQXA 4AEDC 4KWUA 4XMAA 1VRH2 1L7LA 4GWIA 3EJKA 2VBBA 2BBVA 4HETA 5JOZA 5ANQA 1B35C 1BLZA 1VBB1 3ECQA 4P02B 3NRUA 5A7SA 5FZGA 2RJ2A 4LJHA 5DAXA 2CTVA 2VMFA 4NN0A 5DUVA 4CDQA 1IS4A 1OPMA 2E6VA 3BOWA 2E26A 2X8KA 2O8OA 5I0RA 2PHWA 1FT9A 4D0QA 5JOWA 3N7KA 1ZRIA 3GHNA 1CZTA 5FXZA 4CCNA 4E4DX 3AFKA 3ZFGB 1SCRA 3RYPA 4CE8A 3WF4A 2PN5A 2ZX2A 3NAPA 4YW6A 1AX1A 1PGW1 4YW5A 1UCXA 5FYVA 2FBEA 4NHLA 3UGHA 2BJSA 4DUWA 4F7ZA 1QJU3 1JHNA 4CTEA 2J1TA 2VZQA 1AR92 2X5IC 4QQOA 5FZKA 3PLQA 2Q8EA 5EPAA 2PHXA 3DPRB 4XZPA 3KT4A 1O4TA 5GLZA 1UN1A 1C1LA 3CDZB 1Q3EA 2RVAA 3MFAA 1XBFA 3Q8CA 4HONA 2DYCA 2IXCA 5KHGA 2P5BA 4WM8C 4DXZA 2VECA 4YW3A 1FPN3 3GJBA 4YVSB 3ZR5A 4XOGA 4YZ1A 4COYA 3KV5A 1EP0A 2OA2A 1P8JA 1R1A3 4Z1VA 3I3QA 4XDOA 4EN9B 2EXJA 1UU4A 3AMQA 1BZWA 1ZZBA 2HWC3 3BPZA 1UZZA 1MS9A 1PO12 4V2VA 2F6BA 3JUUA 1IGOA 4FCAA 2R072 4QKNA 1F15A 1LOFA 5BYNA 2ZMNA 2HWE1 4AF9A 4LBNA 1V6MA 2QKDA 1DQ0A 3MIBA 2P1BA 3NNJA 2OKXA 3OF1A 1OD5A 3P3PA 5JMCA 4FFHA 5FZHA 4WVZA 1PZ8A 2C4XA 3J8F3 5IK4A 2RS13 5B2GB 1W6NB 4WVMA 1JOPA 3MUY1 3W21A 2TBVA 1HRI3 2P4EA 1R081 2WFF3 4K6BA 1JYCA 2YPJA 4AI3A 5FZ1A 3KV6A 4D8MA 1WMFA 4JVAA 5F3CA 3QLQA 3U07A 3FZ3A 4BCUA 2V5DA 1PO23 3WR0A 3AK0A 4D7TA 4H55A 1BCXA 4Q4Y2 2E31A 3B5LB 4YZ3A 4MVTA 4XE9A 1J1LA 1ST8A 4XFHA 5H9QA 1I9RA 1RUH1 1K3IA 1RUF1 3BOPA 4Q4V3 2O1QA 3HIFA 3JCIA 1XNKA 1COV2 1SLBA 1GMMA 4MGYE 4UYBA 5K0UA 1KDKA 1QJY2 2UURA 3SLIA 1AJKA 3ILNA 3ZPOA 5GLVA 2ZKLA 2JWPA 2PLV3 4XUQA 4MGIE 4HVRA 3PDQA 3M2MA 4PF5A 5CNAA 4RQPB 1RUC1 2Z69A 3OUJA 2XOMA 3FX3A 4CDUC 1LB2A 1N3QA 1QQP1 2PELA 2C26A 2VCCA 3KT7A 5L9RA 5H9RA 1W05A 1RB8G 2ZGTA 4O9EA 1SHWB 2WKKA 4YWAA 3PVBB 2E32A 1F35A 5EV7A 4FPLA 2R30A 4N43C 5J36A 1POV3 1OA2A 2A6YA 2L9LA 4YPJA 4YZ5A 1F4HA 3V0BA 3ACLA 1O3TA 4A3ZA 1DU3D 2RS31 5A7PA 1ZRCA 2KD7A 1OA4A 3THPA 4KQ7A 3ACHA 2XVGA 2WRAA 1F8VA 1YQ8A 3EO6A 5LY2A 2OXBA 1KJRA 2VQAA 2VXRA 1CVNA 5FXWA 1YRZA 5FLJA 2XBO2 2BQPA 1RUI1 5D8AA 3SEEA 2CDOA 3LEMA 2F4LA 3S57A 4LKFA 2OVUA 5FOBB 5J1XA 2EF6A 1A34A 2XWBB 1VB2A 3RZHA 2ZX3A 2ZTNA 3JD71 2JD9A 1VIWB 3CBNA 4LBLA 5A6XA 5KC5A 1NCQB 2BUKA 1HW5A 4I0AA 4COUA 5EFUA 4BXFA 1EV11 4Y4RA 2WYFA 2W5FA 2AEYA 4IV3C 5CEHA 1JZ7A 1GP6A 1GR3A 1PK6C 4GAZA 4BJ0A 4Y26A 1YI9A 4ISQA 1WMXA 5D21A 3I2JA 4HSLA 2UWAA 2VCMA 2DBNA 1NA1B 3FN9A 2QFEA 4H2AA 2JB8A 5HCAA 2C24A 5ANNA 3AJZA 4DFSA 1F9KA 4B8EA 2VCAA 5ABJC 4LMFA 2H6BA 4INDA 4QQLA 4LKDA 2D7FA 2R32A 5I91A 1VBB2 3O1OA 2P6CA 4P9LA 2VNVA 2EXIA 3KGZA 3KHCA 5FYIA 4CXXA 4RS5B 4CUGA 1ZA7A 3LPGA 3C8XA 5F2WA 5FQ0A 1H2NA 1H9WA 1BVVA 2QQUA 1XE7A 3WHUA 1GOGA 1VBC1 1AJOA 1PGW2 2AR6A 1IPJA 2ZKNA 3ZSJA 1G9DA 4OMCA 4EZHA 4PLNA 1G86A 3GBWA 2IFWA 1SCSA 2LM3A 3SKVA 1G9BA 3NJXA 5IVVA 2RDRA 3ZXKA 3V0AB 5J09A 1OKQA 2A3XA 4XIKA 4Q0PA 4AHZA 3LDRA 4XILA 1UX7A 2GC0A 3OOXA 3H3UA 2PHUA 4UFMA 2WWJA 3FJSA 3OTFA 1SBFA 1OURA 1W2TA 2AUYA 2JKBA 3JBG1 4AL9A 1LNSA 3MPPG 3OGSA 1TEIA 3T4VA 3WNXA 4B1MA 1DYPA 4HPKA 4CDWC 4ITCA 3UJQA 4GJYA 4IGPA 1VBD2 1ZBE1 1AYM2 1LHUA 5FZ0A 3MFCA 1GNHA 2BWCA 3OGVA 4K3UA 4QAWA 4XCBA 2JG8B 4CP0A 4M3CE 2HWE2 1JYNA 3AKRA 2Z5WA 1XU2A 5A33B 4Q8KA 1LEDA 5FTTC 1DGWX 2NMOA 4UFHA 2QUOA 2A3WA 2RJKA 4WVWA 3BKZA 4M0NA 3B02A 5JXGA 4HXCA 3ZKYA 4CCCA 4EYUA 2DVBA 3BPSA 2RV9A 5FMCA 5HCBA 2XJTA 4QPGA 4AVCA 5B4NA 1F5JA 5L73A 1ZM1A 3NV3A 4O7XA 4FFFA 2G1MA 1R082 3K3NA 4JTOA 2V73A 4IE5A 1GZ9A 1NZCA 1W6MA 3VBSA 3CJXA 1I3HA 2JECA 4RFT0 3Q8BA 5EYYA 4Y5Z0 2QQJA 5FZ6A 3PL0A 3ZYFA 5IWFA 4P9GA 1A8MA 4NJ4A 4XMIA 1RUF2 3IPVA 2AC1A 3NWKA 4XCAA 1U12A 3T2PA 4A6SA 1JBCA 2JDMA 4NR1A 1Q5OA 3IZOA 1FMD1 1J1TA 3H8XA 1OFNA 2EIEA 2WNUC 1CAXB 1RUC2 4NHMA 1R091 4UF0B 3FUQA 4GWMA 5C9AB 1O5LA 3I2DA 4UOJA 4ZU5A 1TNRA 2XR4A 4YYOA 4A3XA 3T2OA 4FVVA 4PIXA 1TQ5A 2DVDA 1MQTA 5F39A 2HEVF 2FZ2A 1H6YA 4Y4YA 2HWF1 2CWSA 3GNEA 3ON7A 4Y5TA 3C7OA 1MR5A 4AHYA 2DTWA 1VRH3 3ST7A 3RPQA 4MGQA 1LESA 1UYYA 4IERA 5EHDA 3ZFFA 2EXHA 2Z2SB 5I0SA 3DF0A 3ZFEB 3K77A 1G9AA 4X8NA 1V9U1 3CMGA 5LB6A 1UY0A 2JX9A 3J8F1 3VBOC 5F2SA 4BM8A 2VR4A 1J3QA 4AI2A 2GC3A 2O14A 1Y9QA 3PU3A 5A7OA 4AEJA 1RC6A 1X7NA 4FAGA 1IQDC 1VBA3 3WNOA 1A3KA 1PZ9A 1W9SA 3RMYA 1ULEA 2RDSA 4AEKA 3OEAA 3JD72 1O91A 3WDYA 1PO21 1OPOA 4YVWC 5FYCA 2ZAAA 3VBFA 2R6QA 5G04L 5FY8A 1EV12 1S0BA 5EJZB 1EYBA 1W6PB 4GB33 4IE0A 3ZXGA 4OVEA 1W8HA 5L9BA 3PVOA 3GXUA 2XJUA 4B3NA 5JVVA 4CP2A 1JOJA 1HXS3 5JZGA 2DURA 1IPSA 1I5ZA 4RR3C 2OPKA 4CDXA 5EXOA 4AVSA 2WQ8A 1ND3B 2PXJA 4XF1A 3WD5A 2BGPA 3NJVA 3R4DB 4XAEA 4XTMA 2B9VA 4UW4A 1DLLA 3WNLA 5JR2A 2ERFA 4RGAA 1UOBA 2R073 2XVKA 4FOQA 3TN91 2HWD3 5FPXA 4ZONA 3WG4A 1W2UA 4XAAA 2ZACA 4XFAA 4ARXA 3SISA 2P37A 3WG2A 4DMIA 1VBC2 2ZA9A 4LO8A 5TSWA 4D94A 1QJX3 2WLPA 3O1MA 1XSQA 2TEPA 5FYUA 1CAVA 1WMEA 4PIZA 5J7MA 2GNTA 4XBLA 1WKYA 2XJSA 1ZZ6A 3HT1A 3VKMA 5FKCA 3A4UA 1PNGA 1CAWB 4Y20B 3H42B 3I3BA 1CJDA 1W8ZA 3EBRA 3VD9A 2BU9A 3HN3A 4M4RA 4Z82A 3D0JA 5FLIA 2ZAHA 5FZCA 4ZXEA 4Y1ZA 2HKXA 3DL3A 3LIHA 4LHNA 1V6KA 4IV1C 5IVJA 1DFQA 1RUJ1 2VC9A 1H4GA 4E2QA 3JBG2 3O1SA 1NYWA 4Q4Y3 4ZS3A 3MPBA 3NQHA 4Q1RA 3O7OA 4CDQB 2XJQA 4CVUA 1UAIA 1COV3 3QBQA 2ZX0A 4HT1T 1H2KA 1RMU1 1RVF3 1A6CA 4LA3A 4LT5A 2B8MA 4Q0UA 3KLSA 1VP6A 2JJ6A 2QNKA 1ULCA 4QWNA 3NAPB 1ND2A 3R05A 4JRAA 1DG6A 4UFLA 3E1F1 2A1XA 5EYXA 1HLCA 1WCDJ 3LQCA 5LWBA 1IOAA 1C5IA 1J83A 1F2NA 2IZWA 1QEXA 1BBT2 3B3QE 3ZSEA 1Q8OA 2ZEZA 1OQDA 2J42A 4F83A 1ZRRA 1OLRA 1QOOA 4GQ7A 4KGGA 5JI7A 1AUYA 4L2NA 1CAUA 4L9BA 2YROA 5BNQA 3ES1A 3KQRA 3AYDA 4OZOA 1HB2A 1DZTA 4LUMA 2V4VA 3I2OA 1WUVA 2EICA 5IVBA 3AZYA 3H1WA 1O7FA 4HK8A 1DYOA 3CNAA 1LAJA 1MVEA 3J7HA 1ASJ3 2ZEWA 1GYKA 4IE6A 1R64A 3VBHC 1AR73 3PHMA 5DMYA 2QE3A 3ZIXA 2RM21 3V56A 1QWRA 1JZ5A 4KWLA 2W47A 3VDCA 5A70A 4FTEA 1FMD2 1GNZA 1RUE1 3D5OA 1NE4A 4CEYA 2ORXA 1PIV3 1R092 1NCRC 3VDAA 2JDKA 3N36A 5GZCA 4WVMB 1VBE1 5GLUA 5LA0A 3KQ4B 4FPYA 3AZVA 2BYVE 2D44A 4HMZA 3WCSA 2DTYA 4PBPA 4PT6A 4META 2N7GA 1UX6A 2CNAA 4NAMA 4DRRA 2R062 1SFYA 2DVAA 3IM0A 4XVHA 2QQWA 5FAXA 4AVBA 5CG8A 1DCSA 1VRBA 2CGOA 2HWF2 4DEVA 2EIGA 1NA1A 3FLTA 1QKQA 3OGRA 5DUWA 4HLTA 3H0OA 2I74A 4JGZC 1GKBA 5AC93 1UMIA 5LZ6A 3ATGA 1V9U2 5F8PA 4QGLA 2WT0A 5K0UB 4TZDA 4YARA 1VAKA 2DUQA 1AR83 4PF1A 5JWPA 3MO4A 5FPUA 4OI1A 5C3PA 2WFPA 2ZZQA 4CRQA 5L19A 4RD7A 3WHTA 1S2KA 4AEDA 2WC2A 4JCKA 3T1LA 5F5IA 3TRSB 1O8PA 2XONA 3M3EA 1KS5A 5LRRA 3VGIA 5IK5A 3JQWA 4EZ4A 2OUJA 4QB6A 1B35A 4XURA 1YUDA 5FXVA 2RMU1 4Y1XA 3K4DA 1PGL1 2XLFA 3S30A 4AZZA 2EVXA 4LA2A 1GSLA 5F3IA 5GZEA 5F5AA 3V0BB 4BLIA 3NMBA 3DYMA 2GN7A 3U10A 3V0AA 1XE0A 1GZTA 1TME3 1XB9A 2QQIA 4KG8A 2OQ7A 4OCTA 5EIYB 3N7JA 4BB3A 1TG7A 2NZ9A 4TLFA 3U1XA 4C1WA 5CFDA 2F17A 2ATFA 2Q1ZB 2MEV1 3IIIA 3U78A 2X5IA 3VDDA 3GCXA 3VBFC 1N47A 5EZWA 1VBD3 2GP3A 4JX0A 4Q0SA 1OI6A 5FDBA 3ZMOA 1CR7A 1ZREA 3WDTA 2NQYA 4ONUA 1FYUA 2F4PA 4WM8A 4W6YA 4XBQA 3TN92 2RE9A 4JGYC 1S0CA 4GIQA 3MBWA 1MACA 3I2HA 4FXGB 4NIIA 1DQ2A 1IHMA 4XQWA 4LO5B 4OI0A 3UESA 4FOWA 1JYXA 3ZM8A 3LE0A 1REEA 1ZRFA 4G4FA 2W1QA 5E88A 4AFMA 1JUIA 2J1UA 3RQ0A 4GKXA 1W8WA 1JMUB 1SDWA 2E7QA 2VZSA 3NSTA 3ES4A 4MYEA 4RHV3 1GFF2 3S6PA 3POFA 1T6BX 4A6OA 2NLRA 1IKPA 2B39A 4A41A 1Q8VA 3OGGA 4AR2A 5LY1A 1XQNA 1UIJA 1A78A 1URXA 1SBEA 1DYKA 2ZHLA 3OCPA 1PMJX 2D6LX 4GWNA 1VE0A 3TB0A 4XUPA 3ZDSA 1NLSA 2WS91 4QX1A 2P3JA 3IMMA 3P3NA 5JLVA 1RMU2 2IXJA 2W1WA 5FQ0B 5FZLA 4O65A 4DXSA 5JMOA 4GB31 3AXEA 2XWJB 3ZXFA 3OG2A 3WW4A 1K5MC 2VTFA 1V0AA 4JDOA 5CVRA 5FREA 4DXTA 2Q4SA 1RXFA 2VOWA 3RWKX 5CKNA 4LOSA 4MGTA 4XXAA 1MZ5A 1LECA 1XXNA 1UW8A 3WNPA 1C28A 1J3RA 4JRLA 4LBKA 5CG9A 3I3DA 2O8QA 4D69A 4DIQA 3WXPA 1S1AA 1X33A 1C8M3 1FNZA 1UY4A 2Q1MA 3ZDVA 4BQYA 1YNAA 5GZFA 5DXDA 3O1PA 3VZLA 4AHWA 2ZZJA 4OI4A 1YC61 2B42B 2VTXA 2GMEA 3I2KA 4CDUA 3EMRA 1QMJA 2JDHA 4KL1A 4HPKB 1H30A 2Z4FA 1BEV2 3MLLA 4OHVA 2ZGQA 3CL1A 1L3JA 3IDCB 1QJX1 2EAKA 5FK8A 5A1AA 3KT1A 3PUHA 4N43A 4AG4A 2A70A 5L36A 1MEC3 2R042 1NXD1 3VBRC 3M3CA 3TNQA 1OOPC 3ILFA 3KWVA 1X8MA 2BNOA 2RM22 2WAOA 2WIIB 1OXCA 3AYAA 3AZXA 1RYYA 3CJIC 2LRPA 4D7SA 1RUE2 5HV4A 3WINE 1G9CA 3RZKA 2QQMA 5F1RA 1OLQA 5A7QA 1WMDA 1S55A 2HWB1 1XYNA 2ZX1A 4XFCA 3BIEA 2NP0A 1VBE2 4LOTA 3ZX7A 4XFBA 3QCWA 1Z7S3 3ZYJB 2ZCWA 4IE4A 1HB4A 2XL7A 5BNPC 5ACA3 3SCGA 2FDKA 2Z42A 4I3PA 1AL23 2VUCA 1OQ1A 1W6MB 3VBSB 3WUCA 4JKLA 4CYDA 1WW6A 3NNLA 2ZEYA 3AP6A 3I2GA 1YFYA 4COWA 1NZIA 5L7OC 1CESA 5DAQA 1AR63 4LK7A 3HBKA 2LS6A 1QXJA 2WBKA 4NIGA 4IGQA 1ZZ7A 3WW2A 5JUVA 3IPVB 2H0BA 4UI9L 4XFIA 4IV3A 4WZCA 1PK6A 1JN2P 3DN7A 1D4M1 1PZ7A 4LEJA 5DDJ1 5FY4A 1WGPA 4ZZ8A 1EAH1 3K75B 1OLMA 2A6WA 4XZUG 3MI8A 4YW1A 5E8AA 5ABJA 5IVFA 4PLMA 3SITA 3HBZA 1YFUA 2ARCA 1QIQA 1Z0HA 5CISA 4CCKA 3U75A 5LBFA 2RMU2 3LSDA 1MQTB 2XQXA 4X6QB 3N9MA 1PGL2 4B4RA 3L2HA 4Q4W3 4Q8LA 1S0IA 3LA2A 5FJHA 4UFIA 2VG9A 3VL8A 3N3HA 3ILRA 1AR71 5E89A 4W6XA 5J48A 2Y0OA 4IEPA 5KHJA 5FYMA 4PDWC 2Y6FA 3ZFFB 4L11A 1D4VB 4S2GA 3H1YA 5AVAA 4ZKTB 1AYN1 1W90A 4F3JA 4B4QA 1LEMA 2MEV2 3SCHA 1W8UA 3ETQA 3MYXA 4E9KA 5FY1A 3MW2A 4DZGA 1QY4A 3ZR6A 1OFSA 1MS4A 2DVGA 4MHUA 5FKBA 4LO6B 4P9JA 4XEZA 3O1VA 1YQ6A 1Y3TA 3PUIA 2NMNA 4JDNA 1HJFA 3HR9A 3KGLA 4IL7A 5T55A 1S0FA 4Q29A 1UKGA 4NHYA 4NRQA 1LODA 3D6EA 4XUTA 1NLRA 4IW3A 3VDDC 1UQXA 1XRUA 3VBFB 4CDWA 3VHPA 5JOXA 3KS7A 4AK3A 1BBT3 5KXBA 1UOFA 1RUD3 3N9LA 2LW8A 5A80A 4FPOB 3R4SA 3WQ1A 3KV9A 3W5MA 4ZPIA 2BGOA 1LULA 1OF3A 2AEZA 2JENA 2WZR2 3K4ZA 1AR81 2BERA 4XUNA 1EPZA 1YJLA 5HBAA 1HN1A 5JI9A 2W3JA 3BODA 3LZZA 3GJAA 2H6CA 4DUVA 5A3MA 5JZGB 1BVP1 1GOHA 3KCXA 2VZPA 2VJXA 2E9QA 3WF2A 4CDXB 5FZBA 3B93A 3NO8A 4LHLA 2VBPA 2DCYA 3WNNA 3IDEA 1QNWA 3MLKA 3PMEA 2YDEA 3AX4A 3CZUA 4H7MA 4AFDA 1W03A 4GJZA 4IESA 3THCA 1GZWA 1J59A 4JZRA 3BTZA 2WS92 1I1EA 2QDNA 2WR9A 2JDZA 5DZGA 5C4WC 5JCTA 4C91A 5FZ3A 3WV6A 5APAA 4E8DA 3I7DA 2RR11 1OBNA 3RRDA 5FZDA 3PUQA 3WP3A 3JB4C 1CAVB 4BMEA 3MW4A 4ZY9A 2UU8A 2VU9A 4QHZA 5IVYA 4E27A 3B01A 4QPWA 2QZ3A 1D0GA 1SLIA 2Y6JA 3NV1A 4HKWA 4UBGA 4IEWA 1PVC1 3SHRA 1TMF3 3N7LA 3OJBA 2A6ZA 2R063 2JD4A 2VOTA 5FBJA 4E4HA 2VM9A 1RUNA 1DF0A 3ZXAC 3I97A 2VY0A 2LALA 1W28A 2CYFA 3Q8EA 2GC1A 2SBAA 1QH6A 5FPAA 2WNUA 4P00B 1DHKB 3J7NA 1UY2A 4QQ2A 2GNBA 3KF5A 2JB4A 4KBZA 3UGFA 3NJZA 1MZEA 3FMGA 5HXMA 1ENSA 1ZRDA 4Q4X3 3R0RA 4Y1UA 5FWEA 2W1SA 3KM5A 2W68A 1ND2B 2VCBA 2BPA2 1BMV2 1GBGA 3WDVA 4ZU4A 3D3AA 3J7MA 4EWDA 1JODA 2J7MA 3O0WA 4DPNA 1JS9A 3RSJA 2XMLA 1UD1A 1W9FA 3POBA 3AMNA 2HWB2 3VBOA 1ZBA3 5CFCC 4RGKA 3NKTA 4XF0A 2KR2A 2XLAA 4AAPA 4OHWA 1CAUB 1FV2A 2D3SA 4P9IA 5GJ6A 4CXYA 1N1VA 5FUIA 5FY0A 2YYOA 3C3VA 3WX5A 3AL6A 3FFZA 2ZGOA 3N9QA 4YVWA 4FOYA 1WLCA 3AYEA 5H9SA 1AXZA 4S2FA 2UYAA 1UPIA 4FQZA 4R8HA 4YM2A 1RHI2 4GWJA 5HI0A 5A7NA 3V64A 1FOD1 2D93A 4BWOA 4CPBD 3MV01 4AGRA 3CIHA 2FDJA 4OLLA 1DQ4A 4JHZA 4YNIA 1C8M1 1D4M2 4XABA 5DDJ2 3WG1A 4CEYB 1WD3A 2DU1A 1RUG3 1W39A 3H8UA 2JDAA 1EAH2 2W87A 5IFPA 4NMIA 2PAEA 4RR3A 1REFA 3UGGA 4Z07A 3SCFA 1SEFA 3LFMA 4ES8A 5JXHA 1QDOA 2A7AA 2QQKA 3AP9A 2FCUA 5A3TA 2IWGB 3DYOA 2AYHA 1NLQA 2RG4A 3MICA 1O3SA 3KV4A 1FAYA 4EN7B 1AZDA 4YGBA 1HRV1 3NW4A 1BJQA 4PI2A 4FPFA 5D1IA 2UWCA 2XDVA 5FYYA 1VR3A 5LATA 2FDHA 2GC2A 4FFIA 1GWLA 2I45A 4IEUA 5FOJB 1AYN2 4K21A 1YJKA 4G9SB 1KDMA 3IMNA 4N9HA 4E4ZA 1GV9A 3SKJE 1UPSA 2HYKA 3S7IA 1E5IA 3CEWA 1LKNA 3POIA 2YFZA 5K8SA 3ITQA 1D2QA 2Y0IA 4QT6A 3J26N 4YG6A 3N9PA 4AEDB 3EQEA 3GHMA 5C70A 1XJAA 1JHJA 4FP3A 5C8CC 5FZFA 1YO8A 2FQPA 4IV1A 3VV1A 1W9YA 2WO3A 1B35B 1DQ6A 1LGNA 2JG9C 3M8LA 1QOSA 1OMIA 3N9OA 2CGPA 3DUIA 2ZHNA 1CD3G 2VD7A 3EB7A 1SBDA 4QX3A 3U11A 1IG3A 4IQPA 2MHFA 2DV9A 4GH4C 2K46A 5DZEA 2ZX4A 4XW3A 3H3ZA 2HLEA 2X10A 2H0VA 3I2FA 5CFDB 3HMYA 4KBBA 3M70A 2JIGA 2X5IB 3WUDA 3VDDB 4D7YA 1BEV3 4NPMA 1YFWA 4QKDA 5IYYA 4IETA 2C9AA 2ZABA 5LA9A 1S2EA 4BE3A 3SH3A 3RZZA 1XNAA 2HBUA 1D7PM 3T30A 3ZOIA 2VBDA 1MVQA 2WAAA 2XH6A 2ZS6B 3H3LA 4WM8B 3ZLIA 4CU6A 4FAHA 3J7LA 3ENRA 1BK0A 4N8MA 4AQ2A 1V00A 1OH4A 4AYUA 1DDLA 3BTAA 4IEXA 4ATEA 3H7JA 1O3RA 3OBZA 3F95A 3OPZA 4A44A 1JXNA 3VBUC 4HBNA 5FXXA 3LCPA 1EUTA 2WL1A 1K45A 1AXYA 1J84A 3HJRA 1US2A 4FPCA 1OSGA 3VBHA 1PVC2 4L92A 2HEYF 3LFIA 3W5NA
chains in the Genus database with same CATH topology
2D6PA 2EAAA 5F5QA 5CU1A 4K40A 3UKVA 5H9PA 4I01A 2BNNA 5DZFA 1VAMA 1NCRA 1YFXA 1QJU1 5FRAA 1M4WA 2DCJA 1V6NA 2ARXA 1RUH2 3L2YA 4XJZA 4EN8B 4LNVA 5GM0A 2WQZC 1SLCA 1POV0 4AQ6A 2Y26A 1ZZ9A 4PCRA 3PVEA 2SLIA 3FLRA 3WW1A 4AQSA 1XNDA 1FPN1 4OHYA 2QDRA 1BKZA 4JGZA 1QQP2 4OZXA 4PQ9A 4FOVA 1EY2A 1R1A1 1W6QA 3ROUA 4TYSA 2HWC1 2RS53 3H9AA 2QVSB 1N1YA 4Q1PA 1QHDA 2XJRA 3E6DA 3AZWA 4A7KA 2RS32 4CDUB 4KG0A 4AI0A 4FO9A 1QDCA 4JTNA 1UL9A 3PVNA 2VW1A 5GZDA 3VL9A 3ZN4A 2C0ZA 4JDMA 4AHXA 2G9FA 2Y38A 2RS11 2XVLA 2QCSB 4N43B 4N7UA 1RUI2 3POSA 1FOD2 1H8VA 2NYYA 1HRI1 3CF6E 3POWA 4WM7C 2WFF1 3D4KA 3AB0A 1FNYA 1RUOA 4YM3A 4HL0A 4GMP3 1AR93 4YM1A 1N1TA 2AZ5A 1NQDA 4J1XA 2ES3A 3WP6A 4Q4V1 2EALA 4U2AA 4Q4X1 2VNGA 4QGMA 2P2KA 1HRV2 2PLV1 3OD0A 4JGYA 2VMIA 4KH9A 4XETA 2BW8A 3TWIA 2DFCA 2WA3A 1PHMA 2UY9A 4IV3B 3ASIA 5IT6A 4QM8A 1PK6B 1PO13 3G7DA 1G9FA 2IXIA 3QH6A 3GZTB 1POV1 1J58A 2GALA 1NG0A 4IEZA 1H8TC 1Y43B 3MEPA 1VB4A 5ABJB 2MNGA 2A73B 3PNAA 4QPIC 3VZJA 3OGJA 1JH5A 1X8EA 2BFUS 3MIHA 4AEMA 2GH8A 2JEMA 1H1AA 3MIEA 3NVCA 3USUA 3O0XA 4AVVA 3AM2A 2D43A 1WW7A 4UW5A 2IXLA 1JW6A 3UKTA 1XE8A 2IXKA 1K5MA 1KD7A 5BNOC 1RUG1 2XL9A 1V6IA 4M00A 1NY71 2E63A 1T6GC 1WW4A 1ZBE2 1OA3A 4AWDA 3S7EA 1QJY3 2P3KA 1KS4A 1NQJA 2D5HA 4H14A 3ZMNA 1FATA 5KHIA 4FPHA 2WLQA 2DUOA 2PFWA 3O5SA 1S0DA 4CDWB 2PA7A 5T5JA 1LU1A 2VW2A 3GYDA 5BV6A 5BY5A 5KHHA 4R9DA 4YM0A 4DY5A 4RA0A 2GNMA 4C90A 3VBRA 3GZUC 1OOPA 1Q56A 1DBNA 3CJIA 2CL2A 4Q27A 1YYNA 2C5DA 3N35A 1PGSA 4GULA 4LBQA 1N3PA 4IEYA 1QJU2 1GZWB 2XBO3 2VQ0A 1U5ZA 3TAYA 4BH9A 1H0BA 5LEJA 3HT2A 3AKPA 5BNPA 4I3GA 4MXVA 5FO9B 5GALA 1IPKA 4Z8BA 3K48A 3EHKA 4PLOA 4EN6B 3B9CA 4WV8A 1MS1A 1FPN2 5L7OA 1J3PA 4QPYA 3ZIWA 2CY6A 4HN1A 1R1A2 2ET7A 2YMZA 3TBDA 2HWC2 2YGLA 3H1MA 1V6LA 2R1BA 2WZPP 2WNUB 2XKPA 2W0XA 4GMP0 5KBFA 4XIOA 1E57A 2JICA 1UZYA 4N53C 3AJYA 5KXEA 1VBB3 2WNVC 3ZPYA 3J8F2 4LBOA 2RS12 4DQAA 3E6BA 4KWJA 4OUSA 3BALA 5C6CA 1HRI2 1JTZX 1DGWA 2VVEA 4GXLA 4PDWA 2WFF2 3RJRA 1LGBA 3HWJA 4XFFA 1PO22 3IT8A 4LLOA 3VBOB 2C1FA 1V70A 1N1SA 3VZOA 5KC6A 1DQ5A 1HV1A 4YG3A 4Q4V2 4BIFA 3ZXDA 4MGZE 1MS3A 5GLWA 4AGGA 4FPEA 2PLV2 3M3QA 2V09A 4QU2A 2DVFA 4YVWB 2XGXA 3USSA 4AXOA 2PAKA 3NV4A 3O12A 1GICA 2OUHA 1AYM3 1KQRA 2FMYA 2GMMA 1DQ1A 4XJUA 2B5HA 2RS51 3WDWA 3WQ7A 1LCLA 4L97A 2D98A 2HWE3 3GF6A 4NWWA 1KITA 1S0GA 1VRH1 4RR3B 3ZFGC 5A32A 1FI2A 1LOEA 1FV3A 2OZJA 2BNMA 5CIRA 4HKOA 3VKOA 3ZYRA 3PMSA 5JIAA 4NHKA 3DPRC 4Y22A 4XQ4A 1O3QA 2VOKA 1R083 2RJLA 5C4WA 1H1MA 3MIFA 1CN1A 1VBA1 1G8WA 4HSJA 3C2UA 2VOVA 1IZ3A 1RUJ2 4YVSC 1TE1B 4GMP1 1RJ8A 4XF9A 1ENQA 1QXRA 2BVBA 1QJZA 1NY72 1RUH3 1RUF3 4SBVA 4LTAA 1NE6A 4YGDA 4YW2A 1QXPA 2AH2A 3RDIA 1V6JA 4AFAA 5EJ3A 4IV1B 1RUC3 2PQQA 2GSYA 1QQP3 1HXS1 2PHDA 4I02A 4P14A 1C4RA 5FBZA 4YRDA 3M7AA 3UKNA 1LHNA 1LOAA 5T5OA 4HZFA 4BYYA 1WLTA 1PO11 1KFXL 4OULA 2R071 3WP4A 2RS33 1C5HA 3VHOA 2HWD1 1R1ZA 3IN9A 4QX5A 4D69A 5JSOA 3ZN6A 4XJWA 3VKNA 4KNCA 1DGRA 1FXZA 4K1ZA 1AF9A 4TWTA 5DG1A 5CFCA 1UIKA 2JE7A 2UWBA 4MSVA 5CBLA 5LEKA 3DGTA 3V65A 1SLLA 3ZXLA 5C8WA 5KXDA 3THTA 2YZ4A 3JD73 3WVJA 3FE5A 3HN1A 3M1HA 4RQPC 4R9CA 1YCIA 4Q4Y1 2R16A 4CZSA 5T54A 3GZAA 4L8QA 1EV13 3VBHB 2GMPA 5CADA 3VHNA 1COV1 4COZA 3X29B 1QJY1 1RVF1 4RGGA 4ZXKA 4DRVA 1C57A 4URTA 5CAZA 3ZYGA 4XHXA 3SXWA 1BYHA 1NCRB 4I0BA 4QM9A 2P3IA 4J1WA 5JAXA 2WINB 1HQNA 4WVVA 5IK7A 4COVA 3OY8A 2TUNA 1ZX5A 3LAGA 1UU5A 4QGNA 4W6WA 2NM1A 4MX3A 4C0HA 2W39A 4JGZB 4WZFA 5I8YA 5JDBA 1VBC3 5IUQA 3TNPB 1W6QB 3WQ0A 2ZMLA 2WQ4A 3E5XA 2P34A 1LGCA 5KWRA 3B94A 1ASJ1 5I93A 1W6OB 1NCQC 1WD4A 2XB6C 4QQPA 3IBMA 2A6VA 1DZQA 2FMDA 3MF9A 4S2HA 3CLPA 3UK9A 2G9GA 5C8CA 1ULDA 3KD4A 4RL7A 3M4FA 4RSUA 3JBG3 2JG9A 3MGUA 1PIV1 2B7YA 1ENRA 4YSFA 2X53S 1OQEA 1MZFA 1ZBE3 3U0ZA 2ZHMA 3A0KA 5FMOS 3RI8A 4JC1A 1NOVA 4GH4A 2UY8A 4MH0E 1PVXA 4RS5C 2E51A 4FPJA 3MIGA 4IEVA 2Q5TA 4XJAA 1DGRN 3SNMA 3D82A 1IQAA 4V1PA 1H9PA 5AC91 1IKQA 4Q26A 3W58A 2E7AA 3VZMA 2BEOA 1YIFA 3E6CC 4JGYB 3VLBB 4HN0A 1VBA2 5AFBA 4C0BA 4OI2A 1GANA 3IDBB 3VBUA 5F6KA 2JE9A 4EN0A 1HKDA 2CV6A 3WOGA 2KM2A 4XJ9A 1CONA 3J4UH 4HFSA 1MS0A 4LBQD 1S2BA 1MZ6A 4EWAA 5E16A 1UU6A 4G3YC 4GB32 5CA6A 1TME1 1FMD3 2I07B 2K2SA 2JG8C 4NOTA 4YW4A 4EV0A 1R093 2OIIA 1HXS2 2WA4A 5FMOL 1H2LA 3USUB 4LBJA 4E2SA 5T5LA 1VBD1 1ONAA 1AYM1 1QGLA 4OFGA 3NKGA 2E53A 3GBFA 5DG2A 5GKAC 4WBBA 1ZZ8A 2HWF3 3GBGA 1K5MB 2GH2A 2HWD2 4MXWA 4OUMA 4XPVA 1M06G 1LHVA 2VULA 4ASMB 1ZA4A 2Q0AA 1SQ4A 4NO4A 4BPZA 1V9U3 1QJX2 3I8TA 4Y24A 1G7YA 2VPVA 5E1RA 5JIUA 2K0GA 3HQXA 1DGLA 1YXWA 2PAMA 1Z78A 2DCTA 2FHRA 4RHV1 2WSVA 2D6KA 4Y1VA 1AX2A 1SLTA 3JZVA 2CGNA 4ORFA 5IK8A 5C9AC 3Q9OA 4OHXA 4Z2WA 3VBRB 3N4MA 3QH7A 3WCRA 1H4HA 1OOPB 3OYWA 4WM7A 2D3PA 3N7MA 3CJIB 4B4PA 1RVF2 4LULA 3WY6A 4KWKA 4LO4B 2ET1A 4SLIA 2JXAA 4AGVA 4LBQB 4CEWA 3B9IA 2A3YA 4ISRA 4DOUA 3ZYPA 1LENA 2ZPXA 3ZXEA 4I30A 3ZFEC 2PTMA 5BNPB 3FBYA 4K9SA 4M3CA 1KXGA 2I2SA 4YZ4A 3TN93 1CJPA 4ASLA 4YLZA 2ZMKA 3U4XA 5L7OB 2RHPA 3BU7A 1WLWA 4XFGA 3AFGA 2XUMA 4DY3A 2GDFA 4YZ2A 1ENXA 4AVAA 4PBOA 2ZJCA 2ZGLA 1VJ2A 4AW7A 1V6OA 4K20A 1ASJ2 5DUXA 1SACA 2A71A 1GQHA 1MEC1 5KXCA 1AR72 1H8TA 1WCSA 2BGCA 1W0PA 4QPIA 5FLHA 2B45X 3I59A 4BOWA 2V5YA 1RUJ3 3WG3A 1PIV2 4BLJA 3VHRA 1AL0G 3ZYIB 3AMPA 1ND3C 2YXSA 4O9GA 1RMU3 1Z7S1 2ZGRA 1A8DA 3TYJA 4ES9A 1HX6A 3JB8A 4AE2A 4PDWB 3VZNA 5ACA1 1AL21 1I6XA 2XKOA 3MW3A 2NPIA 5BNOA 3HAGA 1Q8PA 3I4IA 1AR61 2WJSA 5AC92 2VGDA 1WW5A 5C33A 5J37A 2W08A 3FC0A 1AR82 2ENRA 2LTNA 1B09A 1MS8A 4KU7A 1U5XA 3E5UA 1XNBA 4AFCA 5K7PA 4BZ4A 2D5FA 3LOIA 4AFBA 5BNNA 2BTVC 3G6JB 3O0VA 3W9AA 4FSJA 2PHRA 4XQDA 4QD2A 2VH9A 1O4ZA 2PHFA 4D3WA 4PIYA 1ULFA 2R043 4FTSA 4Q4W1 4CDQC 2B9UA 4FQ4A 5AFEA 2VMGA 3KSCA 1REDA 2RM23 3SH4A 1TME2 1LTEA 3AP4A 5GZGA 1RUE3 1PM7A 3B00A 4N90A 2HJIA 2RR12 2VOXA 4HVOA 3NAPC 4FPGA 2CAVA 5A32B 3SH5A 5JOYA 2A6XA 1VBE3 5T52A 4LE4A 1KJLA 1DZRA 4Y22B 2R0HA 2XJVA 5C4WB 2NN8A 3AYCA 3LKJA 4E4SA 4B29A 4BQ1A 4DB5A 4H7LA 4LE3A 4XYXA 5J98B 4HVQA 4A2UA 2XPJA 4JV4A 3LB9A 1VLNA 1BBT1 2ARBA 4YFZA 1G6NA 1H2MA 1RUD1 1C1FA 3VKFC 4XXPA 4P9YA 4LHKA 3FUOA 2D6NA 1DIWA 1LOFC 1FX5A 3IIAA 1BQPA 3KCYA 4RHV2 2OYZA 4A3XA 3AMMA 2QZ2A 5FPZA 1YIPA 4Q0VA 4N53A 4AQTA 2PHLA 2WNVA 2IC1A 2RMU3 4M3CF 2GZWA 3IKWA 1W6OA 1XYPA 2PHTA 1QNYA 1SFNA 5JR7B 4K8FA 1H1IA 3ZN6B 1X50A 3WLUA 3M3OA 4JQRA 1QU0A 2PYTA 3DKWA 3FLPA 2MEV3 3URFA 1ZZCA 5CFCB 2CAUA 2YGMA 3WDXA 3BB6A 3LA7A 1TMF1 1EPWA 5K0UC 2R061 4UW3A 4IXLA 1C8M2 2ILMA 1AXKA 2AGSA 1F31A 3PJQA 2VUJA 2R49A 4FTBA 4CEWC 4P9XA 1N3OA 2WSUA 1CX4A 3AP5A 2WZR3 5J96B 4XF3A 1F5FA 5JPNB 1MEC2 3W59A 2AENA 2D3RA 1U0AA 5I0UA 2K9ZA 1LHWA 3ZFGA 4XBNA 2WT1A 2DU0A 1LU2A 4P5HA 1JYIA 3AKSA 3PJYA 2KA3A 3S0MA 2EXKA 2FZ1A 1LJ7A 2DF7A 3OY8B 1UKRA 1ZBA1 2WS93 3RNSA 2YC0A 3WT3A 5LRSA 1RGSA 3DPRA 5FO7B 1LHOA 1UF2C 4UBHA 1Z7S2 2TNFA 5D8AC 3LGRA 5FO8B 5EWSA 2VUAA 3WZ1A 5ACA2 5T3NA 2GNDA 1AL22 2ETEA 4M01A 3M3IA 3AKTA 4YG0A 4YVSA 2VVFA 1CPMA 3D8CA 1AR62 2VNRA 4M0HA 4B7EA 2CWMA 2O0OA 4MV2A 3MF6A 2VW0A 4AI1A 3UJOA 1TNFA 2X29A 5JPMB 5C8CB 5HCFA 2QQPA 4FT8A 5SV5A 1ULGA 2JG9B 2D6OX 1CIWA 4DS0A 1WCKA 4GALA 1PMIA 3H50A 4CP1A 3RI9A 4GH4B 1W6NA 4YFWA 1RITA 3BCWA 4Q4W2 4XJ8A 4NVPA 1YHFA 3OD4A 1ALYA 4KGQA 1QOTA 3ME2A 1D2SA 3FWEA 4QXKA 2ZGMA 4GA9A 3QACA 3RYKA 5BNNC 2MPFA 3VKLA 4ATFA 2HWB3 1AHSA 2GAUA 2Q30A 1RIRA 3VN4A 2AREA 3E5QA 4GKYA 2D97A 2BFUL 1JUHA 3VBUB 2QJVA 2Z79A 4Z92B 2B46X 4RQPA 4X6RB 1RHI3 5I8TA 3GALA 1HIXA 1RUD2 5T5PA 1C8NA 2IFRA 3BIWE 1IS6A 1D4M3 3AMHA 5DDJ3 4A7ZA 4FXKB 1EAH3 5LK5A 1QF3A 4HKLA 1AX0A 4IEOA 4JAAA 4KU8A 1BEV1 3QD6A 2DCKA 4QHBA 4QPGC 3RS6A 3RMXA 2R041 1CGPA 3RWNA 4MXWB 3ZXJA 4F8AA 1SLAA 4EROA 2ZGSA 2XG3A 1GQGA 3VBSC 5K9YA 1AYN3 4R4XA 3AP7A 2HEWF 4DINB 2ZGPA 3APBA 4BA6A 2WWSA 1NCQA 4Q0QA 5FFOC 2ZGKA 1TMF2 1SMVA 1KFUL 3KMHA 4B7KA 2E7TA 1HQLA 4R4ZA 3ZSMA 1GLHA 3DV8A 2D6MA 1NXMA 4FPKA 1HQWA 2D40A 3K51A 4HANA 4N9IA 3UV9A 3QOPA 3R6SA 3OYWB 4WM7B 3ZO0B 5DUUA 1MQTC 1RINA 2XJPA 4Q4X2 2BWAA 4RS5A 3RJ2X 2XLGA 2YV8A 4MZUA 4CEWB 1RL3A 3ZFFC 3OBRA 4XF4A 2OW4A 1LOBA 4C1XA 3PTYA 5HXVA 1X82A 1ZNPA 1HV0A 4M3CB 4LLFA 1C3HA 4MGKE 1ZBA2 4XTPA 1X36A 4AI8A 3O14A 1O4YA 4XHBA 1UMZA 1APNA 3KZ4C 3LA3A 4L99A 3ZSKA 1XYOA 4LO7A 1Q8QA 1WA4A 5T50A 3ELNA 5I8SA 3AZZA 2RR13 1IS3A 2ZGNA 4Y1YA 1WBFA 4I09A 4I2OA 1PVC3 3EXUA 5D8AB 1H8TB 4Q2FA 4A7YA 1WLDA 2G4IA 1RTVA 3MZHA 4QPIB 3AXDA 1BK1A 2ZHKA 3I59B 1WBLA 1Q43A 2JG8A 2VVDA 2IXHA 3B69A 3WP5A 3I54A 1RUG2 5JZGC 1AR91 5A33A 1GZCA 4CDXC 5JSRA 4BHPA 4S2DA 2WT2A 3MIDA 3MLJA 1HDKA 2WZR1 3FBMA 3CO2A 2GU9A 5BNOB 1VAVA 1XU1A 1D0HA 2R0FA 4MLOA 1CQ9A 2YHJA 2VNOA 5J3UA 5GLTA 1LOGA 3ZVXA 3JU9A 5LK7B 1BXHA 3NV2A 4R52A 4XDQA 3INAA 1S0JA 3TOJA 3ALQA 4EWEA 3E97A 5A3LA 3LSEA 3A0NA 3FHIB 2DWRA 1U5YA 3VZKA 3IWZA 4E2GA 5BNNB 1CAXA 2W52A 5C9AA 2P17A 3POYA 1RUI3 1W0OA 1FOD3 3LWCA 2ZBJA 3WW3A 3FFQA 3UL2A 2ZOEB 1Q8SA 1MS5A 1RJ7A 3T2TA 1ND2C 2Q8OA 1AVBA 3MDPA 4FP2A 3L9JT 5JSPA 4MUVA 5KHKA 2YY1A 4BIOA 4FBFA 5BUVA 1OHFA 4OHZA 1KRIA 3T1MA 5F9TA 3ZFEA 1YI7A 3CU7A 2DFBA 3RG0A 3ZSLA 4EJRA 4YGEA 4DNYA 4R9BA 3LOBA 5CB7A 1S0EA 2A5ZA 1ZYBA 1HRV3 1BMV1 2UYBA 3J9SA 4N7IA 4QMAA 1LRHA 3SMHA 4TSVA 4AVTA 2WNEA 3R4UA 4W65A 4HK9A 4ZU7A 1LOCA 2A75A 4I0WB 2EA7A 1LR5A 2R1DA 4LUKA 4QPGB 2VMHA 1YLLA 4YGCA 1CPNA 4QQHA 1W6PA 5F6LB 1IS5A 2ZGUA 4IEQA 2YUEA 4J6GA 4N53B 4CEYC 3H7YA 1XNCA 2OZ6A 1O5UA 2WNVB 3B7MA 3AKQA 4LBMA 4UW6A 2XBO1 1ND3A 1RHI1 2GN3A 3NL1A 5SV8A 4UXAA 4H3WA 3KB5A 2DCZA 4K7JA 4R9AA 5I0TA 4BMBA 1NA1C 1VALA 4K1YA 3RYRA 4U36A 1ZVFA 2KXLA 4P9WA 5BXXA 3WDUA 5BPXA 2XHKA 3OBTA 1PNFA 4NPRA 4NWVA 4PJYA 4X8PA 5FCCA 1QH7A 3ZN5A 3HD8B 2RS52 5AVPA 2BVVA 3KCCA 1CAWA 1YWKA 4Y20A 2LUWA 2DUPA 1Y7BA 4LR4A 1U5IA 3JQXA 4AEDC 4XMAA 1VRH2 3EJKA 2BBVA 4HETA 5JOZA 1B35C 3ECQA 1VBB1 2CTVA 4NN0A 5DUVA 4CDQA 1IS4A 1OPMA 2E6VA 3BOWA 2X8KA 2O8OA 5I0RA 2PHWA 1FT9A 5JOWA 3N7KA 3GHNA 4E4DX 3AFKA 3ZFGB 1SCRA 3RYPA 2PN5A 2ZX2A 3NAPA 1AX1A 1PGW1 4YW5A 1UCXA 5CFDC 2FBEA 4NHLA 4F7ZA 1QJU3 1JHNA 4CTEA 1AR92 2X5IC 4QQOA 3PLQA 2PHXA 3DPRB 4XZPA 3KT4A 1O4TA 5GLZA 1UN1A 1C1LA 1Q3EA 3MFAA 2DYCA 2IXCA 5KHGA 4WM8C 4DXZA 2VECA 4YW3A 1FPN3 4YVSB 4YZ1A 4XOGA 4COYA 1EP0A 2OA2A 1R1A3 4Z1VA 4EN9B 2EXJA 1UU4A 3AMQA 1BZWA 1ZZBA 2HWC3 3BPZA 1UZZA 1MS9A 1PO12 2F6BA 3JUUA 1IGOA 4FCAA 2R072 1LOFA 5BYNA 2ZMNA 2HWE1 4AF9A 4LBNA 1V6MA 2QKDA 1DQ0A 3MIBA 3OF1A 1OD5A 3P3PA 5JMCA 4WVZA 1PZ8A 3J8F3 5IK4A 2RS13 5B2GB 1W6NB 4WVMA 2TBVA 1HRI3 1R081 2WFF3 4K6BA 1JYCA 2YPJA 4AI3A 1WMFA 4JVAA 3QLQA 3U07A 3FZ3A 4BCUA 1PO23 3WR0A 3AK0A 4D7TA 4H55A 1BCXA 4Q4Y2 3B5LB 4YZ3A 4MVTA 4XE9A 1J1LA 4XFHA 5H9QA 1I9RA 1RUH1 1RUF1 3BOPA 4Q4V3 2O1QA 3HIFA 3JCIA 1XNKA 1COV2 1SLBA 4MGYE 5K0UA 1KDKA 1QJY2 2UURA 3SLIA 1AJKA 3ILNA 5GLVA 2ZKLA 2PLV3 4MGIE 4HVRA 3M2MA 4PF5A 5CNAA 4RQPB 1RUC1 2Z69A 4CDUC 3FX3A 1LB2A 1N3QA 1QQP1 2PELA 3KT7A 5H9RA 1RB8G 2ZGTA 4O9EA 2WKKA 3PVBB 5EV7A 4FPLA 2R30A 4N43C 5J36A 1POV3 1OA2A 2A6YA 4YZ5A 3V0BA 3ACLA 1O3TA 1DU3D 2RS31 1ZRCA 1OA4A 3THPA 4KQ7A 2XVGA 1F8VA 3EO6A 1KJRA 2VQAA 2VXRA 1CVNA 1YRZA 5FLJA 2XBO2 2BQPA 1RUI1 5D8AA 2OVUA 5FOBB 2EF6A 2XWBB 1VB2A 2ZX3A 2ZTNA 3JD71 1VIWB 4LBLA 5KC5A 1NCQB 2BUKA 1HW5A 4I0AA 4COUA 5EFUA 1EV11 4IV3C 1GR3A 1PK6C 4Y26A 1YI9A 4ISQA 4HSLA 2UWAA 1NA1B 2QFEA 5HCAA 3AJZA 4DFSA 1F9KA 4B8EA 5ABJC 2H6BA 4INDA 4QQLA 2D7FA 2R32A 5I91A 1VBB2 4P9LA 2EXIA 3KGZA 4RS5B 5FQ0A 1H2NA 1H9WA 1BVVA 1XE7A 3WHUA 1VBC1 1AJOA 1PGW2 2AR6A 1IPJA 2ZKNA 3ZSJA 1G9DA 4PLNA 1G86A 3GBWA 2IFWA 1SCSA 2LM3A 1G9BA 3ZXKA 3V0AB 5J09A 1OKQA 2A3XA 4XIKA 4Q0PA 4AHZA 4XILA 2GC0A 3H3UA 2PHUA 3FJSA 3OTFA 1SBFA 3JBG1 2JKBA 2AUYA 3MPPG 1TEIA 3WNXA 1DYPA 4HPKA 4CDWC 4ITCA 3UJQA 1VBD2 1ZBE1 1AYM2 1LHUA 3MFCA 1GNHA 2BWCA 4K3UA 2JG8B 4CP0A 4M3CE 2HWE2 3AKRA 2Z5WA 1XU2A 5A33B 4Q8KA 1LEDA 5FTTC 1DGWX 2NMOA 2QUOA 2RJKA 2A3WA 4WVWA 4M0NA 3B02A 2DVBA 5HCBA 2XJTA 4QPGA 4AVCA 1F5JA 5L73A 1ZM1A 3NV3A 1R082 4JTOA 2V73A 1GZ9A 1NZCA 1W6MA 3VBSA 3CJXA 1I3HA 2JECA 4RFT0 5EYYA 4Y5Z0 4P9GA 1A8MA 4XMIA 1RUF2 3IPVA 3NWKA 1U12A 1JBCA 4NR1A 1Q5OA 1FMD1 1J1TA 1OFNA 2WNUC 1CAXB 1RUC2 4NHMA 1R091 3FUQA 4GWMA 5C9AB 1O5LA 3I2DA 4ZU5A 1TNRA 4YYOA 4FVVA 4PIXA 1TQ5A 2DVDA 1MQTA 2HEVF 2FZ2A 4Y4YA 2HWF1 2CWSA 3GNEA 4AHYA 1MR5A 2DTWA 1VRH3 3ST7A 3RPQA 1LESA 4IERA 3ZFFA 2EXHA 2Z2SB 5I0SA 3DF0A 3ZFEB 1G9AA 4X8NA 1V9U1 2JX9A 4BM8A 3J8F1 3VBOC 1J3QA 4AI2A 2GC3A 1Y9QA 4AEJA 4FAGA 1RC6A 1X7NA 1VBA3 1A3KA 1PZ9A 3RMYA 1ULEA 4AEKA 3JD72 1O91A 3WDYA 1PO21 1OPOA 4YVWC 3VBFA 2ZAAA 2R6QA 1EV12 1S0BA 1EYBA 1W6PB 4GB33 3ZXGA 4OVEA 3PVOA 2XJUA 4B3NA 5JVVA 4CP2A 1JOJA 1HXS3 5JZGA 2DURA 1I5ZA 4RR3C 2OPKA 4CDXA 5EXOA 4AVSA 1ND3B 4XF1A 3WD5A 3R4DB 4XTMA 4UW4A 1DLLA 2ERFA 4RGAA 2R073 2XVKA 4FOQA 3TN91 5FPXA 2HWD3 3WG4A 1W2UA 2ZACA 4XFAA 3SISA 2P37A 3WG2A 4DMIA 1VBC2 2ZA9A 4LO8A 5TSWA 4D94A 1QJX3 2WLPA 5J7MA 2TEPA 1CAVA 1WMEA 4PIZA 2GNTA 4XBLA 3HT1A 2XJSA 1ZZ6A 3VKMA 3A4UA 1PNGA 1CAWB 4Y20B 1CJDA 3EBRA 3VUOA 4Z82A 3D0JA 5FLIA 2ZAHA 4Y1ZA 2HKXA 3DL3A 4LHNA 1V6KA 4IV1C 1DFQA 1RUJ1 1H4GA 4E2QA 3JBG2 1NYWA 4Q4Y3 3MPBA 4Q1RA 3O7OA 4CDQB 2XJQA 1UAIA 1COV3 3QBQA 2ZX0A 4HT1T 1H2KA 1RMU1 1RVF3 1A6CA 4LA3A 4LT5A 2B8MA 4Q0UA 3KLSA 1VP6A 2JJ6A 2QNKA 1ULCA 3NAPB 1ND2A 3R05A 4JRAA 1DG6A 5EYXA 1HLCA 1WCDJ 1IOAA 1C5IA 1F2NA 2IZWA 3B3QE 1BBT2 3ZSEA 1Q8OA 1OQDA 4F83A 1ZRRA 1OLRA 1QOOA 4GQ7A 4KGGA 5JI7A 1AUYA 4L2NA 1CAUA 4L9BA 2YROA 5BNQA 3ES1A 3KQRA 3AYDA 1DZTA 4LUMA 1WUVA 3AZYA 3H1WA 1O7FA 4HK8A 3CNAA 1MVEA 1ASJ3 1GYKA 3VBHC 1AR73 3PHMA 2QE3A 3ZIXA 2RM21 3V56A 1QWRA 4FTEA 4KWLA 1FMD2 1GNZA 1RUE1 3D5OA 1NE4A 4CEYA 1PIV3 1R092 1NCRC 3N36A 5GZCA 4WVMB 1VBE1 5GLUA 4FPYA 3AZVA 2BYVE 2D44A 4HMZA 3WCSA 2DTYA 4PBPA 4META 2N7GA 1UX6A 2CNAA 4DRRA 2R062 1SFYA 2DVAA 3IM0A 4AVBA 5FAXA 5CG8A 2CGOA 2HWF2 2EIGA 1NA1A 3FLTA 1QKQA 5DUWA 4HLTA 3H0OA 2I74A 4JGZC 1GKBA 5AC93 3ATGA 1V9U2 4QGLA 2WT0A 5K0UB 4TZDA 4YARA 1VAKA 2DUQA 1AR83 5JWPA 4OI1A 2WFPA 2ZZQA