4AEMA

Structural and biochemical characterization of a novel carbohydrate binding module of endoglucanase cel5a from eubacterium cellulosolvens
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
126
structure length
126
Chain Sequence
b'ADIVLFSGSKHVEFTDWGGTDWPSAYELQPPYQTMPFDLNKNFEIKVDYSGADIVLIFARWEHGSKPQIWAQISPYYVVDGTAVFTKEQIAKAYGSDDFSDLDYIGVKPLPSADGMTVTKIVASYT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE CEL5A
publication title Understanding How Non-Catalytic Carbohydrate Binding Modules Can Display Specificity for Xyloglucan
pubmed doi rcsb
source organism Eubacterium cellulosolvens
molecule tags Hydrolase
total genus 26
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18259 CBM65_1 Carbohydrate binding module 65 domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1070 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4aemA00
4AFMA 4AFDA 5AFEA 2YPJA 4AEMA 4BA6A 4AEKA
chains in the Genus database with same CATH superfamily
2VMGA 3O1PA 1SFPA 3ZSKA 1WLCA 4Y1UA 3VKLA 2WC2A 5DMYA 1I5ZA 4XUNA 4GIQA 2HWD3 5EHDA 4RN5A 3THDA 5FO7B 4Q4Y1 3H50A 5IWFA 5EJ1B 4F8AA 1YJKA 3PDQA 4JCKA 4Q4V1 1SBDA 4Q0QA 5FYVA 2ZGTA 4HMZA 4EWDA 1I3HA 1V70A 2ZS6B 4IEXA 4KNCA 1LNSA 2XJPA 4CEWA 5C9AB 1VBB3 4ZZ8A 2ZX0A 3HD8B 4IEPA 5DDJ3 3TB0A 2D3SA 2VOWA 2ZX3A 5AVAA 1APNA 3T3YA 4IEYA 4CCNA 3WP5A 2OX0A 4M3CE 5LA9A 3ZYJB 2YG0A 1H9WA 1Z0HA 1OQDA 1UY2A 4N43A 2K2SA 1EUTA 5JSOA 1JYXA 2YFZA 5CG9A 4HSLA 5A7QA 2FCUA 1ODNA 4FFFA 5E16A 4QX3A 3WD5A 1QHDA 1KFXL 2YY1A 3INAA 4BLJA 2WA4A 4GB32 1W6OB 4XURA 3IN9A 1V9U3 2KM2A 5C71A 4WVMB 4I0BA 3PMSA 4BMEA 4HLTA 4Y22A 2V73A 2D6NA 1K5MC 3N36A 4JDOA 4UXAA 2WZEA 4AI9A 4K6BA 3WW3A 3ZFEB 1R092 2DURA 2O8QA 3OCPA 4R4XA 1EPWA 4GMP0 2ZGNA 1VBC1 1AXZA 1YQ8A 1S0EA 3KVBA 1C3HA 4AK3A 5K0UA 4E2GA 1SMVA 1VRH1 4QWNA 4FFIA 3RZKA 1SDDB 5AVPA 1UXXX 1OHFA 1REFA 1XYOA 2VU9A 5FZMA 5A7NA 5HCFA 2GC3A 5FYIA 1E5IA 3ME2A 3J7HA 3DYOA 2HEYF 2XG3A 1AX0A 3P6BA 2YGLA 1STMA 3DN7A 2JWPA 4M01A 2WA3A 4KBZA 4COUA 4CCOA 5F1RA 4CVUA 1DLLA 1WGPA 4LUKA 5A32B 4ZHNA 2EA7A 3OUJA 1GNHA 3AJYA 4HKWA 4MUVA 5FZGA 5GLZA 4CP1A 3AZZA 5BYNA 1VLNA 1A78A 5JR7B 4CU8A 4B7EA 1DYKA 3H7JA 4KWLA 4XUPA 3I3MA 2BBVA 1G8WA 1O4TA 2WSVA 4ISQA 2R041 1OOPB 2VQ0A 1CAWB 1YIPA 2WNVA 3MGUA 5CADA 1R1A3 1HB1A 2BWAA 2EF6A 4WM7C 2A73B 2E53A 4MGYE 3N4MA 2VNVA 2ZHLA 1PM7A 5KC5A 4OUSA 3VDBA 1RUJ1 5JZGA 3VD9A 3ZXAC 4O7XA 1ULEA 3KF5A 1SLCA 4YGDA 1BQPA 1BLZA 1OVSA 4N8MA 2G19A 2KA3A 4FPGA 4V1PA 3MIFA 1CX1A 1EAH2 5J48A 5T55A 4Q0PA 1N47A 3M3QA 3M3IA 4AE2A 1V6LA 3ZDVA 4QU2A 3VKOA 4YVWA 4KL1A 3SEEA 1QOTA 1ENQA 3QH7A 1RUI3 4MSVA 1ACCA 1HLCA 1URXA 2A6VA 5DAPA 3G6JB 3I3DA 3LKJA 5F5QA 1AR63 1W0PA 4XQWA 3GHNA 4EN6B 3NMBA 5FYTA 5T3NA 4QKNA 4RGKA 1DLCA 3KSCA 2OZ6A 3ZIXA 1ZX5A 4EV0A 5CKNA 5FZ6A 4A3XA 4E2QA 1K3IA 2D6OX 3B00A 3T2TA 3VBSC 1LOFC 4CDUA 2E26A 3LDRA 4L97A 3VD7A 4BISA 4S2GA 4BIFA 1COV3 2DCYA 1HN1A 1P8JA 2XJRA 2Y6GA 5FWJA 4RA0A 4E2SA 3AX4A 4KH9A 3WLUA 4DY5A 1NCRC 1PO23 3LDBA 5FREA 4F7ZA 5KBFA 4IGOA 1NZCA 1PO13 2WN2A 2ZGSA 3JBG2 1IS3A 2W46A 4EROA 4HANA 5IK8A 4RQPB 4UFHA 1O3SA 3AKQA 4UW6A 3USSA 1WCUA 3CBNA 4AWDA 2W91A 3E97A 4ZS2A 2V5YA 3ZIWA 4C90A 1O7FA 3HR9A 4FPKA 5EIYB 1GOFA 3MF9A 3E5UA 1PM4A 1RMU1 4HFSA 2ET1A 5E8AA 4DMIA 4Q5OA 5LBEA 2R072 1Z7S2 3I3EA 5FP4A 3MV11 5C33A 5LWBA 1UX6A 1MZEA 1UMHA 3A4UA 3Q8BA 3TNPB 3VZKA 1ODMA 4YNIA 4BPZA 3FBMA 3LPGA 3POIA 1V9U1 1D2SA 3VZNA 1R083 3HWJA 1LEDA 2VCBA 3WDXA 3V0AA 1JYNA 3B93A 3POBA 2Q0AA 1QH6A 2K9ZA 4FP2A 2Q1MA 1DGWX 2ZGOA 1DHKB 5J96B 2JG9C 3LFMA 1WBLA 1AVBA 3EYPA 2ZHNA 4MGZE 4Q1RA 5F32A 4Q4X3 1DQ4A 3H1WA 2RMU1 3LA7A 5FPLA 3RI9A 4A42A 5BNPC 2J7MA 3WDWA 1HJGA 4WV8A 5C9AA 5HPOA 3TYJA 2C9KA 3ALQA 4TSVA 5LBCA 3ZXDA 1UQXA 1LCLA 4KU7A 2BFUS 1F4AA 3ES1A 3PVNA 4QB6A 1O8PA 2BGPA 2JEMA 2WUHA 3IBMA 3WP4A 2HJIA 2XPJA 5G04L 3DUIA 5JUVA 1NLRA 4XPVA 3POFA 4YZ5A 1RUC1 1NCQB 1FNYA 2JDYA 3J8F2 4IGPA 2A75A 1G9FA 2ZKNA 1ZZBA 2BGCA 2BYVE 4JX0A 5FPAA 4CU7A 1W9FA 4LBJA 3H3LA 5HCHA 1FOD3 3WOGA 4WVMA 1KEXA 1Q56A 1O5UA 4L2NA 5FPBA 3ZYGA 5JXGA 4L92A 4HK8A 3AP9A 4B1LA 5EYXA 3THTA 4JVAA 3HT2A 1J59A 1KITA 2JDUA 1UKRA 1AR93 1WMDA 1OD5A 2JB8A 2RS13 1UL9A 2XL7A 2ZZJA 4FCAA 4NHMA 2PHUA 5GLVA 3ZFEA 4K20A 4FSJA 2D6PA 1UKGA 2O0OA 1GP6A 3D8CA 4RGGA 3WUCA 4HK9A 1HXS2 5CFCC 5JDBA 1AL21 1LU1A 2WAOA 4XFFA 4FVVA 2C0ZA 1BVVA 2G4IA 2TUNA 4YW5A 4X6QB 3VBRB 5BXXA 4XHXA 1YI9A 4LO5B 3ASIA 2QQOA 1YFUA 3KS7A 3L9JT 1ASJ3 2YYOA 1CGPA 3W5NA 3WG1A 1JHNA 4Q2FA 4LBOA 4YPJA 3ZXKA 5AC91 5A32A 5A3PA 4MXWB 5FBZA 1IS5A 5J7MA 3C7GA 2VZSA 4TLFA 1XNBA 3ZN5A 1JN2P 5EZWA 1RUF2 1ZVFA 4XUQA 2OZJA 3LEIA 5GKAC 2WJSA 3ZM8A 2VULA 1ALYA 5F2WA 1S0JA 3AKRA 3LOBA 1ZBE2 1OOPA 3ZYBA 1UWWA 4YWAA 3ZFFB 4AEDC 3EXUA 4XFBA 4CEYB 1HQLA 3TN93 2ORZA 2UYAA 1YXWA 4GA9A 1SLLA 3LAGA 2XWBB 2VPVA 3QCWA 3OJBA 2AREA 4OI4A 3C7HA 3OF1A 3IMNA 3WP3A 2PLV2 4AI3A 2MHFA 1PZ8A 2VC9A 3BTAA 3DV8A 4QDSA 5CISA 1TMF3 2FBEA 2PHWA 3GNEA 5BNNC 5I93A 1BEV3 2ZTNA 4A6SA 1JMUB 1SQ4A 4M00A 2OKXA 1ENXA 4H3WA 4Y33A 5B4NA 5LB6A 1RTVA 3RGBA 5GZGA 5IK4A 4IEWA 3T0DA 2Y6HA 4XJWA 5IFTA 2PQSA 1NLQA 5F3CA 5FWEA 3K48A 3BTXA 3NL1A 2VZVA 2PAEA 3VDCA 4N53B 4D6RA 1J3RA 1HIXA 3MPPG 3POJA 3FHAA 1AYM3 2EXIA 4AVVA 1WW4A 2ERFA 3PUQA 1W6PB 1GYKA 2RJ2A 3O1OA 1R1ZA 1MS9A 4LORA 1QJX1 1ZZCA 5D8AB 5LASA 1YRZA 1S0DA 1VR3A 1S0BA 3HNMA 1QDOA 1F2NA 4Q4X1 3VN4A 2BERA 3OB8A 2EVXA 4RQPA 5A7SA 2PXJA 2GSYA 2RS33 2ARAA 5JWPA 1U5IA 1PVC1 1HDKA 3I2IA 1XPWA 2D93A 4KWKA 3WX5A 4BQXA 1HRI2 5A80A 5AFEA 4IXLA 5CKQA 3IAQA 3T4HB 1F4HA 4EQVA 2PHFA 3RRDA 3T1LA 5GLWA 4FPFA 2XONA 3GDBA 1XXNA 2D3PA 2FCTA 1KS4A 2G9FA 1CR7A 4A7YA 1MS1A 2EIGA 1RHI3 2WWJA 5ABJC 1KDMA 2WR9A 2WT1A 2W39A 4AR2A 2VOTA 1ZRRA 4XAEA 3ENRA 4TLGA 2B39A 3OPZA 1Y4WA 2GN7A 4JGZB 3T0AA 4NJ4A 2WZR2 3OTFA 4GH4C 4DZGA 3EJKA 4TYSA 2Y64A 1GSLA 1CZVA 4HXCA 5JMOA 1AR91 1X82A 2WDBA 3I4IA 1DDLA 2VG9A 4UW4A 1OFSA 2VOKA 2WKKA 2Y33A 4N7IA 4XIKA 5JVVA 4YZ2A 1BHGA 5A3MA 2DFCA 2QQVA 3PU8A 4YG6A 1JZ7A 4QQ2A 2JDMA 3CJIB 2ZCWA 3IKWA 1YFYA 1V6IA 4LJHA 2ARBA 4QX0A 3W9AA 4X6RB 1UIJA 1KFUL 1NE6A 1VBD3 2AEZA 5EJ3A 5B4XA 4B4RA 4ZU7A 1VB2A 2B46X 3VBHC 4FPLA 1XNTA 1NAEA 1ULPA 2V72A 4IESA 1HB3A 4RYDA 4CP0A 4COVA 5FQ0B 5JI9A 1NCQA 1QGLA 1E5RA 2UY9A 4NIGA 4I30A 3TRSB 2QFEA 1HQNA 1W3XA 2XLAA 3CO2A 3S57A 1RUG3 4PBPA 2YBSA 4PLNA 2B45X 4IV1C 5AFBA 4XXAA 5CKMA 4MGIE 1QJY3 3RQ0A 3ZN6B 5CVRA 1D4M2 2ADDA 4ASLA 3F95A 5FKCA 3U0ZA 2VW2A 2XUEA 3P1IA 5I0UA 2VZOA 2Q30A 2W47A 5JXHA 4HL0A 4QQHA 4QAWA 1I9RA 4ZONA 2WZ8A 1GMMA 3Q8AA 4IEQA 2HWE3 1WW7A 3VL8A 2WNUC 3TNQA 3ORJA 2ET7A 1WMEA 3VDDC 3BCWA 3VBRA 1NX9A 5T52A 3HPNA 2HEWF 4XYXA 4CDXC 1D7PM 2PTMA 4CCLA 3GBFA 1TMF1 1SBFA 1ZRDA 1TNRA 4HZFA 1Y43B 5KXCA 5GZEA 1ZZ9A 1KXGA 1OXCA 3AYEA 4MXWA 1LODA 2F6BA 4P9XA 4B1MA 3VKMA 2FDIA 2HWF2 3IIIA 3TBDA 2Y6KA 1LHNA 1OLME 2W3JA 4NAMA 1QNWA 2IVJA 5FMOS 4LE3A 1UAIA 2XHKA 4KGQA 1PGW2 4HVOA 4NWWA 1A34A 4E8CA 2XQXA 3CKHA 4GZ9A 3WNLA 1DU3D 3ZFFA 1EY2A 3RG0A 2CWMA 2VXRA 2BP6A 4XC9A 1AYN2 3MYXA 5GLUA 3NQHA 4CEYA 3BKZA 1F31A 2HYKA 4LO6B 3S5AA 2RDNA 4Y20B 2IXCA 2P34A 4QX7A 3OGGA 2BVBA 1ND3C 5FPXA 2QQMA 2RR12 2X53S 2RS52 4OZXA 3R6SA 4CDWA 4C1WA 3MUZ1 4AVBA 4AZZA 3J7NA 4FPEA 4HBNA 4OQ9A 3ZYHA 3H8OA 2P17A 2DU1A 2YBPA 4NRQA 4AQTA 1NE4A 2W52A 4JKMA 3TEWA 4D6SA 2Y0OA 1HV0A 2R49A 5IVVA 3C7OA 5C5UA 1VJ2A 5IW0A 1JW6A 2E33A 3IDAA 2R1BA 4OMCA 4QPIC 4CPBD 5L9RA 5JOZA 2A6XA 2WYSA 1CPMA 1FPN1 1N1VA 5LBFA 3NW4A 1WUVA 1O3TA 1AR71 1TZOA 4CPBA 1GZ9A 4AEMA 1ZBA1 5FV3A 3LIGA 4LIUA 1QJEA 2YPDA 1G9CA 3I3BA 4N53A 2RM22 3N9NA 4IQPA 4QB1A 2VMDA 2WNOA 4P9IA 3DCQA 5LBBA 3I49A 5HCAA 4UW3A 2DU0A 5F3GA 5DG1A 2YUEA 3NAPA 2HWC2 2JJ6A 2VVEA 1DGRA 3ZOIA 5D8AA 4A44A 3DXTA 1H1MA 2WIIB 3FUQA 3UT0A 3NNFA 2J1UA 2Z4FA 4M4PA 3PTYA 4EWEA 3JD71 1PIV2 1AR81 1QJU3 4XTPA 3TOJA 3FLPA 2VZTA 3Q8FA 4KI5M 1JYCA 2A7AA 2R32A 4JHTA 5KR7A 2YPJA 1FMD3 3ZXLA 4AG4A 2EAKA 5HCBA 4L11A 3ACHA 5SV8A 3ZPYA 2BPA2 1W8OA 4UW5A 2PHDA 3MPBA 4RHV1 5ACA3 1BYHA 5APAA 2OT7A 4LK6A 3WW2A 3FHQA 1DYOA 1UY4A 5L9BA 4PIYA 5J1XA 2CY6A 4Y4YA 4FQ4A 4GULA 2BVVA 4MYEA 3DKQA 3O0XA 4OHVA 2A3WA 2VNOA 4ZPIA 1KS5A 2YU2A 5FJKA 2E31A 1PK6B 4JGZA 3KHCA 3HBKA 1QJY1 2ZGKA 3LE0A 2I45A 3SCFA 4CRQA 1HRV3 1RITA 4CEWC 2W94A 3GZAA 3ZYRA 1WBFA 1Q8SA 2BNOA 4NUBA 4YM2A 3M3OA 3VGIA 3RYRA 3B02A 4OUMA 4LA3A 1RUD3 4IUGA 5FKBA 3V64A 1H2NA 4Q4Y2 3P3NA 4N43C 4JTOA 4Q4V2 3IZOA 3IDEA 3VHRA 5FYUA 4FQZA 1ULCA 3KV6A 5KC6A 1XQNA 3BODA 2ZGQA 1B35B 4HN1A 1BBT1 2UWBA 1VPHA 1NQDA 3LA3A 3NJYA 4ES8A 1LEMA 4CUBA 5FQ0A 5DG2A 3HMYA 4XEZA 3AFGA 4I0WB 4E4DX 4ZXEA 3ZFGB 5A6QA 2GNBA 5A1LA 3OGSA 4N9IA 1H1IA 2XJSA 3M3CA 2D97A 2HKXA 5FZCA 4UAPA 1PZ9A 1QF3A 1VMJA 2ZMKA 4HT1T 2IXLA 2W1WA 3BPSA 4Q0VA 4XMAA 4YRDA 3S5QA 5DUWA 4BMBA 4CUAA 4K8RB 1DYPA 2D98A 4FOWA 5FLHA 5K0UC 2VMEA 5I91A 2WO2A 1XE8A 3M1HA 4BB3A 5JIAA 2PAMA 5A6YA 4LK7A 2Z69A 2Q8EA 4E8DA 4V2WA 5FAXA 1CIWA 1LOAA 2AZ5A 1IS6A 1REEA 2IZWA 1I1EA 2GU9A 4K40A 5C3OA 2B8MA 5FP8A 1NT0A 3N35A 1W6MB 4DXZA 2AYHA 1S1AA 3NKTA 1VBC2 3EB7A 4LBMA 4OHZA 3PJYA 3VBUB 3WG2A 1S2BA 1VBE3 2W2IA 5FDBA 1V0AA 1VRH2 2OQ7A 4LPLA 1GQGA 3HT1A 5IFPA 2WWUA 4AVCA 2QDNA 1S2EA 4H2AA 4GKXA 3BTYA 4EE2A 5H9PA 2D3RA 3QH6A 5CEHA 4ASKA 1IZ3A 1CJDA 1TME2 4IERA 3MO4A 2WNVC 3AVRA 2B7YA 5EFUA 1RJ8A 3S30A 4CSWA 1DIWA 1DZQA 3D6EA 2VE1A 2R061 4GJZA 4AAPA 3VL9A 5HV0A 1W3VA 1EP0A 1XRUA 4Q8LA 3I2DA 4R9CA 4Y20A 5JZGC 1SG3A 3K75B 3N9PA 1OBNA 1I5PA 1MQTC 3VD5A 1PGL1 1OVPA 1QQP3 2ZEXA 1RB8G 4LBQB 2C24A 2NMOA 4QKFA 2WQ8A 3SCHA 4I3PA 1OKOA 4JDNA 3SC7X 2ZEZA 1QJU1 3FZ3A 1DG6A 3A0NA 4N9HA 4YARA 3NNLA 3RZMA 1D2QA 1PX4A 1H8TB 2DYCA 2WS93 4YVWC 2JICA 3RZJA 1VBA3 1RUJ2 5FY0A 1UMIA 2X10A 5LEJA 1RUE2 2HEVF 4V2VA 5GALA 3AYDA 1O3QA 1ZZ6A 3A21A 1OF4A 2CWSA 1LECA 4EWAA 1KGYA 1HV1A 2MNGA 1NY71 2VMFA 3CL1A 2JKXA 3VHOA 1POQA 5LA0A 3OSDA 4CDUC 1G9AA 4NPLA 3H9AA 3OYWB 5LY2A 1M06G 4NO4A 5C3RA 4CCMA 2XKOA 4LITA 2QZ2A 4UF0B 4EZHA 1ENSA 3LOIA 2XLFA 2W95A 1H1AA 2EXJA 1K5JA 2XBO3 5CZKA 3WQ1A 3LSDA 3JQXA 1YQCA 2CSGA 3GGLA 5EV7A 5CBLA 4QM9A 1T6GC 4RR3B 2VTXJ 3VZLA 3P3PA 1UOGA 2ILMA 1ULOA 2ZA9A 2DBNA 1DP0A 3LSEA 5JCTA 1QMJA 5CB7A 1XC6A 3C3VA 5FZ1A 2BRTA 3K46A 1JZ4A 1C8M1 1K5MB 4SBVA 3RYKA 5A1AA 3RPQA 2E63A 4Y26A 2H0VA 2J1VA 1WKYA 4Z2AA 3DYMA 3HIFA 3MUY1 4DXTA 2MEV2 4GMP1 4YLZA 2QQWA 4GB33 2DFBA 4LT5A 1LGNA 2ZMNA 3ILRA 3GBGA 1AZDA 4RS5A 2WLQA 3H8UA 4FO9A 2BBAA 2LUWA 4QQLA 4I0AA 1RMU2 2H6BA 3MLJA 4QGNA 3VHPA 4WM8C 4JZRA 4BA6A 5FZIA 5JOXA 1OT5A 3WXPA 4XILA 1PK6A 3R0RA 3AMQA 4FOYA 4BXSV 1GZTA 2CAUA 2JE7A 4LE4A 4BXFA 1R093 1LHVA 3NV3A 1C1FA 3HQRA 5FZKA 4N7UA 2G9GA 5C9AC 3G7DA 3AP5A 1AJKA 4BE3A 4QX5A 5C7GA 1GOHA 1IS4A 3VBOB 4M4RA 4F3JA 1SACA 2E9QA 3N9QA 4XFCA 1PHMA 1GP4A 4IEZA 5JAXA 5IT6A 1FXZA 2CAVA 1HJFA 1QJZA 2A5ZA 2A6ZA 3BALA 1IQDC 3WNNA 3DPRA 2O14A 5DUUA 3IT8A 5C3PA 3R4SA 4NWVA 3WY6A 2XUMA 5LK7B 1AX2A 1LKNA 2LM3A 3V0BB 1X9PA 4P02B 1B35A 2AUYA 2RMU2 2XJTA 1VBE1 1YUDA 4LKSA 1BMV1 1E5SA 3HNBM 3WG3A 3ZSEA 3OBZA 1JU4A 3JXSA 1KJLA 2GALA 4J6GA 3BU0A 4CP2A 5A3LA 3ZVXA 4XIOA 3ETPA 4IEOA 4WVWA 3RJRA 3HQUA 2LROA 2OPWA 3ST7A 4IE5A 4XABA 3H1YA 5KHHA 1VP6A 2LS6A 4XJZA 5GZCA 2VUJA 2JDZA 4YW3A 2XDVA 4ET7A 5C4WB 1RUC2 3LIHA 1DQ0A 3R4UA 2JKBA 2CU5A 2GP3A 3HN1A 3O1MA 2I07B 1VRBA 1JZ8A 4UFJA 1UCXA 3NNJA 4NPMA 4XZUG 1NOVA 3ES4A 4IEUA 1QEXA 2VW0A 1QQP1 1EV11 2OIIA 2XKPA 3KF3A 4Q4W1 4LULA 1CX4A 3N7KA 1N1SA 2QKDA 1OUXA 1W6MA 5FP9A 4DB5A 1AJOA 5BV6A 3DF0A 4QHZA 4QPGB 1Q8VA 4R52A 1FV3A 1RVF2 1EAH3 4BWOA 1HX6A 3A7QA 3PU3A 4JDMA 1AL22 3FFZA 4QDQA 5CA6A 1X33A 4LOSA 3BIEA 4QX2A 2Q4SA 1UY3A 1S0CA 2ZABA 4MH0E 3POWA 1NXMA 3D0SA 1HW5A 1LGBA 3J7MA 1OOPC 1XNAA 1L3JA 2D6KA 3BN6A 2HBUA 3GXUA 3W20A 3KWVA 5AC92 3T1MA 2HWD1 5A7WB 1QOSA 4IV3B 4KG8A 5F3IA 3MW4A 1H0BA 1CPNA 4N90A 1YC61 2PYTA 4M0HA 5GJ6A 4M3CF 4XF4A 2BOIA 5BNOB 3WW4A 5F6KA 5FMCA 1MS4A 2XBO1 3IDBB 3K3OA 3AM2A 3UJOA 1VBB1 3JBG3 4QQOA 2X29A 4NHYA 3R4DB 5DDJ1 5BNQA 1DF0A 4LBQA 3O0VA 3SNMA 2BUKA 5JMCA 4AI1A 3B94A 3N7JA 3LQCA 2ZAHA 2ZACA 1QXJA 4O65A 1AHSA 1J83A 3PURA 1OF3A 3H0OA 3IB3A 1H8TA 3Q9OA 4YW1A 1MS0A 5A7OA 1IKPA 4B7KA 1GV9A 1Z7S3 2XR4A 5LA2A 4W65A 2FCVA 5D21A 4JKLA 1W6NB 4Z82A 1FI2A 4XZPA 4ZU4A 3ACFA 1JYIA 1UU4A 4OHWA 3DKWA 2ZXQA 4GB31 1QWRA 5FYBA 3WQ0A 2X8KA 5FZBA 1MACA 2W1SA 4BCUA 4J1WA 5T5LA 2BNMA 2Q5TA 3T0BA 2BDRA 4UF0A 4BYYA 3PMEA 1X50A 3B9IA 4BQWA 3THCA 4P5HA 2AACA 4RQPC 5A3NA 1W9YA 5IHRA 5FZEA 1A3KA 4IW3A 2NMNA 4RR3A 3UKNA 1K45A 3SKVA 2YHJA 4AYUA 1KD7A 2IUWA 4PI2A 5IK5A 1NKGA 2OPKA 4A6OA 5L7OC 5BY5A 2V4VA 3ACIA 2VVFA 4YVSB 1QJX2 1SZBA 1OQ1A 4LXLA 3X29B 4ARYA 5LY1A 1US3A 2C6SA 4CXWA 1W6OA 3J8F3 4G3YC 4PCRA 5CFCB 1A8DA 3MW3A 4NHKA 1PVC2 1RXFA 2B4KA 2WRAA 4CDQB 4R9DA 2JD9A 1G9DA 4GJYA 3WV6A 3N9LA 1NLSA 1DQ2A 5F5AA 1R1A1 4DO0A 5I0TA 4MOAA 2NLRA 3FHIB 1DGRN 2QVSB 2BW8A 4AEJA 3B5LB 5FYYA 4Y3OA 4COZA 3H1MA 4IL7A 1W2OA 2V4AA 2OXBA 4ZKTB 3AZYA 1HXS3 2C26A 3UGHA 1FX5A 4DXSA 3VBOA 2UU8A 5FZ3A 1NXD1 4AHYA 4GWIA 2WT2A 3GHMA 2EALA 3PVBB 1G7YA 2JG8B 3LA2A 1PNGA 5K9YA 1AR92 2YZ4A 4X8PA 3NO8A 3POEA 4AEDB 5C6CA 5DAWA 2W92A 1NCQC 5HV4A 4S2DA 1W8HA 3V0BA 3WF2A 4CUCA 3U4SA 1RUH2 2IC1A 1RUI1 2ZEYA 2RG4A 3FJSA 1BK1A 2ZKLA 5FZOB 4TZDA 3RNSA 1RUF3 3AXDA 3MV01 4HPKB 1AR61 3WNPA 4CYDA 5HBAA 2VQUA 1UF2C 1CAWA 4LNVA 2WFF2 4QM8A 4HG6B 2DTYA 5KHKA 5CFDB 3W5MA 4LLOA 4QU1A 1R64A 3LEKA 5BNNB 5C4WA 3UKTA 5C8CB 2QQJA 1COV1 1BJQA 4LHSA 5FZFA 1XYNA 1GKBA 2D5HA 4LQRA 4AFDA 5K8SA 3OY8B 3NV4A 1PO21 1LGCA 1W6QB 4K9SA 5FXWA 1PO11 3SH4A 3VBRC 3JCIA 5FY5A 2PLV3 4YSFA 1CZTA 3WQBA 1QY4A 3JZVA 1IG0A 3KQRA 1RIRA 1ZA4A 4L0PA 3N9OA 4QGLA 4META 4D7TA 2PA7A 5FK8A 3VDAA 5A1FA 4QPGA 4P9LA 1W03A 5FY1A 3SLIA 3GCWA 2GMEA 1F8VA 5BUVA 3VD3A 1Z7S1 4NRMA 4D7SA 4CCJA 5JIUA 1LOEA 2ARCA 2FDJA 4XMIA 4WZCA 2ZX4A 4AVAA 2TNFA 1C8NA 3U14A 1GZWB 5JPMB 2F4PA 2FDGA 4QPYA 1R081 1ENRA 2DWRA 1TMF2 3ZFFC 1YHFA 1VMHA 3BUCA 2R0HA 4TWTA 4AOCA 1MS3A 3AMPA 5A7WA 4IV3A 3T4VA 3BB6A 5A3TA 5HI0A 5FZ8A 2BWCA 2B5HA 4GAZA 2GMMA 5JPNB 1J3PA 1MVEA 2P1BA 1V6OA 2W9XA 3RYPA 3WT3A 4CDWC 3FL7A 4E27A 5BNOA 2ZHMA 1FNZA 2GP5A 3CJXA 4IETA 4JAAA 4Y1VA 4Z92B 3I7DA 3ON7A 2Q8DA 4HVRA 1C5HA 1FATA 4Q1PA 5IAVA 2JE9A 3KLSA 4NE9A 3KMHA 4XBLA 4K7JA 1BZWA 3H8RA 2VCMA 5DZGA 4JQRA 4AFAA 4UFMA 4Q27A 5E1RA 1US2A 3MI8A 4ZU5A 3H7YA 4FFGA 3VZJA 2ZPXA 3JU9A 3I59B 4XXPA 5F7UA 3VD4A 3BOWA 1W6NA 4AEKA 4R9AA 5A7PA 2VUDA 1LULA 1H4GA 3E5QA 2PFWA 5FZ4A 4NVPA 1FOD1 4IE6A 4OUEA 2FDFA 4OFGA 1W0NA 2XQRA 2G1MA 2BOJA 3M7AA 3QACA 3QD6A 4K1YA 1EYBA 1TEIA 3WNXA 3T2PA 1O4ZA 3AMHA 4IE7A 3WF1A 2RS11 2WZR3 3OG2A 1FPN2 3NAPC 3VBHB 3WP6A 1I6XA 4DNYA 4D94A 1AR72 4Y1YA 5D8AC 5KWRA 1ZBA2 4EN8B 4IE0A 3OBAA 1MEC2 5IAXA 4O61A 2X09A 1HXS1 4PLOA 2FDHA 1CJPA 4DRVA 4B4QA 5KHGA 3B7MA 4A45A 1J1TA 1PGSA 2QTWB 2Y6JA 3USUB 3NWKA 3HQXA 1ASJ1 3LEMA 3OUIA 3HJRA 4MGKE 4YVSA 1UD1A 3URFA 2QUOA 2PHRA 4BQ2A 2A1XA 2HWB3 5DPNA 4AFBA 4BM8A 2JDNA 1LOCA 1NG0A 2W1QA 3AZXA 5JXJA 3JD72 2DBIA 3UK9A 1AR82 1ND2C 4NN0A 1CESA 1U5YA 3EMRA 3NNGA 3ELNA 5DAVA 4XETA 1IPJA 1RUF1 1UOJA 5FY4A 4MGTA 4GWJA 5J3UA 1OLRA 2BQPA 2VZUA 1NZIA 1HQWA 3AYAA 3CU7A 4JGZC 4CDQA 4EN9B 4PT6A 2WINB 4RHV2 3WVJA 3C7EA 2W87A 4CDXB 1D4M3 3J4UH 3Q8EA 3TN91 1ONAA 3Q8CA 4DS0A 4URAA 1MPXA 4UFIA 3KGLA 4D8MA 2VCAA 3LCPA 1D4VB 3UKVA 4P5YA 1F9KA 1XSQA 1CVNA 3KCCA 1NA1B 2Y8KA 4QXKA 4AGRA 1QJY2 2DCTA 2JG8A 2G9ZA 1BEV1 3WDYA 2WAAA 2RJKA 2BFUL 2J1EA 4AEDA 2H0BA 1X7NA 1Q8QA 5JR2A 1O59A 1XU1A 4NIHA 2W68A 1UX7A 4JRLA 4XBQA 5FYSA 2HWF3 5FZOA 5GZDA 2ZEWA 2AEYA 3QLQA 3VLBB 4B8EA 4CCCA 1U0AA 3VUOA 1QDCA 3FMGA 4HPKA 1H6XA 3KHBA 4LR4A 3I2GA 2J1RA 2DVAA 4OLLA 1DZTA 3T2QA 4EJRA 2W1UA 4FI9A 1CAVB 5FLJA 2MPFA 5CFDA 2PELA 1BBT2 3M70A 1AYM1 1JOPA 1AYN3 4ISRA 1L7RA 5C8CA 1U5ZA 4QB2A 4FTBA 5FZ0A 2JENA 3L2YA 2DCKA 5SV5A 5C5TA 2J1AA 3OY8A 2BJSA 5KXBA 4BJ0A 4JQTA 2RR13 2RS53 4A41A 2VZQA 4YW6A 3MIBA 2ZBJA 2VZPA 3OEAA 4D7YA 4XAAA 4A2UA 4R4ZA 3ITQA 3E5XA 4LBNA 2RS31 4NIDA 3PUIA 4B29A 1PGL2 1N3PA 1ZZ8A 2E51A 1WLDA 4XQDA 5FMBA 1L7QA 1PMJX 4LKDA 2AENA 1UYYA 4XDPA 1SLAA 5T54A 5IUQA 4LHLA 3H8XA 4BLIA 5FO8B 1CIYA 4JRAA 1O4YA 1POV3 1RHI1 4HKOA 4JTNA 3WNKA 1N1YA 2ETEA 4YZ3A 3VV1A 4XE9A 1QOOA 3RZHA 3LZZA 2RM23 3O5SA 2HLEA 3U1XA 3U37A 4PHZA 1W6PA 3UJQA 5CU1A 1C5IA 4PDWC 1A8MA 2WZR1 1PZ7A 4M3CB 4OYUA 1ZYBA 5C3QA 2HWC3 1RYYA 1V6KA 2Q1ZB 4CCKA 4FPOB 3K4ZA 4ZY9A 1WCKA 3W21A 4ASMB 1PIV3 2DDUA 1MS8A 2R062 1Z78A 2VQTA 1VBD1 2XOMA 2X5IB 3LB9A 2GN3A 3MF6A 4OULA 4W8JA 3LD8A 3UGFA 2ADEA 2VBBA 5FYCA 2AH2A 5T50A 3PHMA 3A0KA 1OD3A 1YEWA 3I59A 2IWGB 4XF3A 2IXHA 4D0QA 4JGYB 2QE3A 2XWJB 2HWB1 1O91A 3RDIA 3VBFB 4CEWB 1UPSA 1AX1A 1J1LA 3UYJA 3JUUA 4OCTA 2VOVA 5FTTC 1UIKA 2NPIA 5I0DA 1WLTA 5EYYA 1RUG1 1CD3G 3PVEA 4PJYA 5IJRA 2RJLA 4DQAA 1B09A 2K46A 1LESA 2WO1A 3M4FA 2JDKA 4NROA 2D6LX 3RI8A 3GZEA 3UV9A 1JYVA 3SCGA 3VBHA 1C28A 1OLQA 4LOTA 3ZXGA 1W8TA 3WHTA 3POGA 2JDHA 4FAHA 3GM8A 2L9LA 1NY72 2D40A 4L99A 5JSPA 2HWE1 3CJIA 1OH4A 5JI7A 2V09A 2RDRA 1LJ7A 4MZUA 1XNDA 2Q8OA 4BQYA 5IATA 2NZ9A 3O1TA 3USUA 1YQ6A 1IPSA 4G9SB 1SBEA 4PIZA 4Q4V3 1X8MA 4H55A 5I8SA 3ZMOA 3BTZA 2VNRA 5FOBB 2WYFA 4QDRA 2UWAA 3KV4A 2QQUA 4H14A 3U75A 5A6XA 4FTSA 2D43A 2A3XA 4RS5C 4BDVB 2HWF1 3VZMA 5I8TA 1XU2A 2YMZA 4DEQA 3IM0A 5IK7A 4PQ9A 1C8M2 4ORFA 3RWKX 3IAPA 4CZSA 1F35A 1PK6C 1PNFA 2VAUA 4MX3A 3NJXA 4XQ4A 1PGW1 3JB4C 4MADA 3SKJE 2K0GA 3ZN6A 3ZPOA 1UNBA 4CDXA 5C8WA 1EUUA 5F37A 1DGLA 4FBFA 2IXKA 4GXLA 3TEZA 4LIVA 3W59A 4NIIA 3T08A 4OI1A 4MHRA 2RR11 2RS51 3DPRC 4LKEA 1JOJA 3DL3A 1NA1A 2XMLA 3DECA 5C70A 2TBVA 3C7FA 2CYFA 1RGSA 3OBRA 4P14A 3I2OA 1Q8OA 3KQ4B 5FXXA 1UXZA 1NQJA 1VBC3 4FP3A 2CNAA 1XJAA 3BVCA 3KGZA 1VRH3 3KT7A 3O12A 2GNDA 3HOBA 3WSOA 1OPOA 1W8WA 2D44A 4OHXA 1IG3A 1H6YA 5FBJA 4E4HA 1OMIA 1MQTB 1VE0A 4W6XA 2VQAA 2C5DA 3WCRA 1BVP1 1TME3 3AK0A 4UFKA 1LRHA 1LOGA 2KXLA 4U36A 3ZO0B 2YU1A 1D0GA 2FD8A 1O6UA 3RZZA 1X36A 3SH5A 2DCJA 4W50A 5A3OA 2P3JA 4LA2A 2VMHA 3AKPA 3DXUA 4XJAA 2WQ4A 3RFRA 4DFSA 1W8FA 5EP9A 2DV9A 4KQ7A 2JDPA 2WWSA 3AXEA 4HVQA 1W9WA 4YVWB 1UO9A 3MW2A 3NKGA 1POV0 5I0SA 4PF5A 2BTVC 5ANNA 2R042 2HWC1 1MZ5A 4GWMA 5JSRA 2VMIA 4NOTA 1O3RA 4Y5Z0 4W6YA 2WNEA 3RZLA 3CQOA 4XF1A 1PIV1 4CDUB 1FMD1 3OOXA 5G05L 1IOAA 1MR5A 1YIFA 4COYA 2JIGA 1LHOA 2QQIA 5ACA1 1RUJ3 1RUE3 4IGQA 3U78A 1EV12 2BV4A 3N9MA 3P5BA 2IFWA 4Q4W2 1VMFA 5F5CA 2PHXA 2UWCA 1GNZA 5F39A 4BQ1A 1H30A 4FXGB 3CMGA 2ATFA 4Q0UA 5FFOC 4C0HA 5B2GB 4IE4A 4KWUA 2C9AA 2HH9A 2VMCA 3K51A 1GQPA 4TTGA 5A3WA 2R0FA 3MEPA 4M3CA 1HRV1 3WCSA 1Q5OA 1SCRA 4DY3A 4LMFA 4F83A 1CONA 2VD7A 1QJFA 2IXIA 2PAKA 1Y9QA 2UURA 3K4AA 3KV5A 2GC2A 4NR1A 1XNKA 3KZ4C 2HWD2 1RUD1 1Y9MA 2VVDA 3B3QE 1YFXA 3V0AB 2BZDA 5LEKA 1GWKA 3PL0A 1XE7A 5FPVA 2VBPA 4HONA 4A7KA 4C0BA 4WM8B 1H8TC 2X5IA 1UY0A 3RS6A 4FPYA 3I54A 4CUGA 1M4WA 1D0HA 1TNFA 4QQPA 2YXSA 1F5JA 3D4KA 2XBO2 3WEZA 1VBB2 2OS2A 4JGYA 5DDJ2 3VBFA 2J1TA 2R6QA 3FX3A 2MEV3 3MBWA 3OGJA 1PMIA 1XE0A 3I2FA 3CIHA 2VNGA 4K1ZA 3U10A 3E6CC 1RMU3 3S6PA 4DUVA 4QX1A 3GALA 1IPKA 5LZ6A 1RINA 1W2NA 2Y34A 1ZRFA 3GYDA 5KHJA 1AUYA 1W9SA 3CZJA 1ZA7A 1W0OA 2VY0A 2DVFA 2J42A 4FPJA 5DZFA 2P5BA 5EQUA 1V9U2 2SBAA 1GU3A 3T2OA 4AF9A 2YROA 1MS5A 3O1UA 3ILNA 4RR3C 4YM0A 4XUOA 1FAYA 1W8ZA 2D5FA 3N7LA 2WFPA 4I3GA 1EPZA 1G9BA 1LR5A 3B69A 4OMDA 1GOGA 5HXMA 2GC0A 4WZFA 2UY8A 1VB4A 1V6NA 3EBRA 4E4ZA 4GD4A 2Y6FA 3PIJA 2GH2A 4CP9B 4LO4B 2ES3A 4WM7B 1TQ5A 4BK4A 3F2ZA 2ZOEB 2RMU3 2ZGPA 4Z1VA 3A23A 4YW7A 4AQ6A 1N1TA 3ZFGA 4AGGA 2CL2A 1S0FA 2CV6A 5IVBA 1RXGA 2EIDA 3RMYA 1UOBA 5L9VA 1YWKA 2XJUA 3D82A 1GQHA 2PHLA 4UT5A 5FJHA 5H9RA 3U07A 1UYPA 1WMXA 2ZZQA 3POSA 1TME1 2GNMA 3SQOA 3ZFEC 3S7EA 2A3YA 4OHYA 4NPRA 3PUSA 1KJRA 2WSUA 2Y38A 1RUC3 2EICA 2EAAA 1GLHA 1ZM1A 1WW6A 3MFCA 4RL7A 4XW3A 4UOJA 4BH9A 1OH3A 3VBOC 4KMQA 4Y24A 2P37A 2YFUA 4COWA 5I8YA 2GAUA 2JECA 1HKDA 1QH7A 4QXHA 2VXJA 5FUPA 3HEIA 2JD4A 5FMDA 4ATEA 1R1A2 3SEPA 5J37A 3ZXFA 1S0GA 1UU5A 2P3YA 3HBZA 1XYPA 4URTA 3VBSB 5FPZA 1DQ6A 3QOPA 2B9UA 1ZREA 2E7TA 3VBUA 4CE8A 4BQ3A 2CGPA 2I74A 3GJAA 1RVF3 2WS91 1JODA 3UGGA 5C3SA 1VBA1 2Z5WA 1AL23 3MLKA 2CGOA 1NCRB 5DUVA 1W39A 3WDUA 2J22A 5T5OA 2GC1A 4LBKA 1RUE1 3AMNA 4Y5SA 5LRRA 3WW1A 4AAXA 5FOJB 1MQTA 4LHNA 3RZGA 4Q29A 4O9GA 1F5FA 4J25A 1WLWA 3MZHA 1LTEA 2DVDA 1XNCA 2VGDA 1WMFA 4ZZ5A 5C4WC 4Y4RA 3JQWA 3K3NA 3UESA 5AC93 2FDKA 1OC1A 1SPPB 4AW7A 4GKYA 5FR3A 1RUI2 1YJLA 4LBQD 1NYWA 4XUTA 1AR62 2CGNA 4AHWA 4BZ4A 1C57A 3SITA 1WD4A 1JTZX 5ERLA 4I09A 4QGMA 5LA1A 2PMWB 4FPHA 3ABZA 4D3WA 4QPGC 1COV2 1GBGA 3GZTB 3ATGA 3PNAA 2PN5A 5TSWA 3WDVA 2R073 2EIEA 4L8QA 1PO22 1WA4A 1WW5A 2JG9B 3A22A 2VJXA 4FFHA 1ZZ7A 1PO12 2VH9A 2OA2A 4G4FA 4K3UA 1YI7A 4QPWA 2DF7A 3S7IA 1H8VA 4NHXA 4HETA 2GNTA 1PMHX 2F17A 2ZGLA 5BNPB 3SISA 3AC0A 3O1VA 5T5JA 2QQPA 4AQSA 2VOXA 4KG0A 2MEV1 3THPA 3KVAA 4QMAA 4R8HA 1IHMA 2NN8A 3OYWA 2OYZA 5A3UA 4IV3C 2VTFA 1J58A 2ZJCA 2ID4A 4MGSA 5L7OB 3EHKA 3TEYA 1R091 4IDZA 5BNOC 3H42B 2WBKA 2GMPA 5FP7A 4XFIA 5E6HA 1UW8A 4LLFA 1W99A 1R082 4NIAA 2RDQA 1XB9A 2EXKA 1QXPA 4OQ8A 4ONUA 4C8DA 2JDAA 1YFWA 5KXEA 3AP4A 5FYHA 5T5PA 3GJBA 1K5MA 2EIBA 1ZRIA 1H2LA 2JE8A 3I8TA 4WM8A 3QBQA 5A6ZA 3APBA 4YGEA 1QJX3 5ANQA 5FZLA 4Q4X2 4GALA 4MXVA 4HKLA 1C1LA 5FLIA 2ZX2A 1SDWA 4J1XA 3OGRA 5FUNA 4ZXKA 5FPUA 4BHPA 2FMDA 3AZWA 3ETQA 1JZ6A 3CF6E 2BU9A 1JBCA 1IQAA 1PVC3 2QCSB 5CIRA 5IVYA 4Y1ZA 3I2HA 1V6JA 2LTNA 1JH5A 1QIQA 3LEGA 4QKBA 4RGAA 5DAQA 2X05A 5L36A 3UNPA 1WD3A 1UZWA 2E7AA 5F3EA 3ZXEA 4BIOA 5JOYA 1GANA 3HN3A 1GWMA 4Z07A 4AFMA 2FHRA 1L7LA 4EN7B 1FOD2 1JU3A 4NHLA 2NYYA 3ACGA 1Y9GA 3BU7A 3DGTA 5IVCA 2XXZA 2A6YA 4BU2A 5I0RA 1N3OA 2HBTA 2WQZC 2RVAA 2P6HA 2YDEA 3VB9A 2Y26A 1JUIA 2RS12 2QQLA 4YZ1A 1W8NA 2R16A 3IDCB 4YVSC 4CP9A 3AKTA 2DCZA 4CA9A 5M0TA 4WM7A 1LENA 5FY8A 1EAH1 1VAKA 3ACLA 5DN2A 3AB0A 5LATA 1T2XA 5FY7A 4XF0A 1RVF1 4CCDA 1RUH3 2E7QA 1W28A 1BK0A 4QXCA 4YGCA 2VUAA 1WZXA 3LFIA 4I02A 1T6BX 1GUIA 5CAZA 1FV2A 3ZLIA 3DEMA 4CDQC 4INDA 1ASJ2 1UN1A 2V5DA 3J7LA 3WR0A 1U5XA 1ZBE3 5IVFA 1E5HA 3MICA 4UI9L 1U12A 1BCXA 2WFF3 4MVTA 4KBBA 2WLPA 1DZRA 1DBNA 1RL3A 2O8OA 3WQ7A 5F8PA 4E4SA 3D3AA 3E6DA 4P9JA 1WCQA 4QX8A 1C4RA 4Q0SA 1W8UA 5FZ7A 4A4AA 1DQ1A 3LF7A 4BQ4A 2RDSA 3RWNA 4AQ2A 3PTRB 4H7MA 3JBG1 1V00A 4XCAA 1UMZA 2JG8C 5A70A 3MIEA 3TN92 4P9WA 2W0XA 1J3QA 1VALA 1SLBA 3ZSMA 1WA6X 3KT1A 3VBSA 1LOFA 4D6QA 4MGQA 1KDKA 1QKQA 1GZCA 1W04A 1S55A 5GM0A 2YC0A 2R071 2RV9A 3WNOA 3H3UA 3CNAA 1NCRA 4XJ8A 4CDWB 2QQKA 1DQ5A 3WF4A 2P2KA 3KCXA 4XTMA 2LW8A 3WINE 5GLTA 4CXXA 3RJ2X 2VM9A 3E6BA 1TVGA 3PUHA 3NV1A 2EXHA 2ZMLA 3NJVA 2VCCA 1BEV2 4CTEA 4CEYC 4ES9A 5CFDC 4W6WA 1TE1B 3AL5A 4RFT0 4YYOA 4YFWA 3IPVB 2B42B 5C8CC 1SPPA 3MHZA 3POYA 3KB5A 3ZKUA 4HOOA 3KV9A 2GH8A 1CWPA 1GR3A 2VL4A 3NJZA 3RMXA 2OUJA 3V56A 3M2MA 4LKFA 5KXDA 3WG4A 1BKZA 3ZMNA 3OEBA 1YQ5A 4XACA 5ABJB 1JXNA 4QXBA 5FZHA 3ZX7A 4EN0A 2QBXA 1JZ5A 2J1SA 5FYMA 3T09A 1AYM2 2YV8A 3PJQA 1RJ7A 4FXKB 2LRPA 5FXZA 1H2MA 1HRI3 4GH4B 4Y5TA 2DTWA 2XGXA 2WL1A 5FYZA 4DIQA 2C4XA 2OQ6A 3NAPB 1H9PA 2JG9A 2JIJA 3EO6A 1QU0A 4NAOA 4CU6A 2A71A 2ENRA 3S0MA 3J8F1 4N53C 3AYCA 1JZ2A 3ZKYA 5BNPA 2OVUA 2RS32 3MLLA 3AMMA 2D7FA 2ZGMA 1A6CA 3BOPA 3PLQA 2VECA 2CDPA 2Z42A 3FLRA 5LK5A 3O14A 3I97A 4C91A 4QKDA 5L7OA 1HB2A 3LGRA 1FPN3 3RSJA 1AR73 3PVOA 4ITCA 2W08A 3UL2A 4BQ5A 1RHI2 1WCDJ 5FO9B 1ZBA3 5CG8A 5D1IA 1MEC3 4U2AA 1SLIA 1RUOA 1ND2B 2DUPA 4XHBA 2O1QA 4JHZA 1OA3A 4QHOA 5HXVA 3SXWA 2P3IA 3N7MA 3ILFA 3CLPA 4IV1B 4XJ9A 5FUIA 3HNYM 4Z8BA 3O0WA 3WF3A 4MV2A 2JB4A 3U4XA 1O8SA 4JKKA 2GDFA 2VBDA 1ULDA 1UPIA 5CFCA 1CAUB 4ARXA 1S2KA 1OA4A 1RUH1 5K4LA 3JD73 1CQ9A 5H9QA 1AR83 2YB7A 3RVHA 1OURA 2WNUB 2ZGRA 3KCYA 4P00B 3J9SA 2R1DA 1CAXB 1VBD2 3VDDB 2DUOA 4XDOA 3C2UA 5LCWL 3R05A 4LBLA 4AFCA 1H2KA 1ZBE1 4X8NA 5EXOA 1YLLA 3WUDA 1VAVA 3TWIA 4I01A 4RHV3 2NM1A 2WFF1 4PF1A 1F15A 2FMYA 2XH6A 2HWB2 3BGAA 1OPMA 4Q26A 2P4EA 1WWYA 1JUHA 2FZ1A 5IVEA 5FY9A 1QXRA 3CJIC 4MLOA 2YC2A 5FZDA 4XVHA 4LUMA 1RUG2 1G86A 2XHNA 2Q8CA 4TXWA 4DPNA 1UZ0A 4FT8A 1AF9A 2PLV1 4KGGA 1OKQA 5LW9A 2CTVA 1OLMA 4FOVA 3FN9A 3GZUC 3H3ZA 4SLIA 1W05A 4UWDA 3FBYA 1MZ6A 4Z2WA 4D69A 5FRAA 4R9BA 1LB2A 2HWE2 4OZOA 3SHRA 4AI0A 1ND3B 2XJVA 3HVDA 3W58A 4PLMA 2QZ3A 2IXJA 1O5LA 4UBGA 5A33B 1SCSA 5CYYA 1UYXA 3WNMA 1PVXA 1Y7BA 1UOFA 2R30A 3BPZA 1DGWA 2H6CA 4KU8A 3N3HA 5FIXA 3ZDSA 4S2FA 3OD4A 1ULGA 1REDA 5BNNA 4FAGA 2ZGUA 1BBT3 4MG2A 1H4HA 4QT6A 4QPIB 3EQEA 1XOYA 2WO3A 2ZAAA 5GZFA 1J84A 5BPXA 1BXHA 3GF6A 4AHZA 1AXYA 3AJZA 1W6QA 4WVVA 2ZX1A 2W5FA 2HYXA 4XFGA 5ISLA 1SHWB 5H9SA 3FFQA 5CNAA 1CN1A 4YM3A 1NA1C 1SFYA 3CHXA 4W4ZA 1IGOA 4O9EA 4RFRB 3AP7A 3ZYFA 2VUCA 4XJUA 2JX9A 4AXOA 5DAXA 1E57A 1Q3EA 3I2KA 5F2SA 3I2JA 4Y1XA 4AGVA 4EYUA 1UZZA 4NRPA 1LAJA 1HRI1 4YGBA 5EWSA 1JHJA 4XF9A 3AVSA 1GNYA 4PDWB 4QHBA 2I2SA 3WF0A 1LHWA 1W06A 5J98B 4JC1A 1N3QA 2DVBA 1PX3A 5FCCA 3KT4A 4PQQA 1GZWA 2A70A 4UFLA 1QNYA 1OFNA 1GWLA 1W9TA 2QQNA 3BIWE 3I3QA 2C1FA 2PQQA 3ZR5A 1AXKA 2XB6C 1OI6A 3VKFC 3ZSLA 4LTAA 2CHHA 5F6LB 1LU2A 3IPVA 3O1SA 2N7GA 2VZ3A 2DVGA 2OUHA 2QNKA 3D0JA 3MDPA 3NVCA 3OPTA 2YC4A 2XVGA 5JOWA 1UZVA 1YO8A 4C1XA 2VR4A 3GBWA 1AL0G 4MHUA 2IVIB 1MZFA 1UZYA 1GICA 4A3ZA 5K7PA 1UY1A 4YW4A 4P9YA 3WHUA 5ABJA 1X9TA 1MEC1 4AL9A 3AL6A 3O1RA 5FZ9A 2XLGA 3ECQA 4YM1A 1W2UA 4YG3A 2XVKA 4K8FA 2R063 1OUSA 1X8EA 2Y0IA 3K77A 3ZYPA 3FE5A 4GH4A 2BEOA 4BOWA 4IEVA 3U11A 3TEXA 4GQ7A 1GFF2 3V65A 4P9GA 2NP0A 1W90A 3OUHA 4AVTA 5DZEA 2VW1A 1GP5A 1JYWA 4DUXA 3MFAA 1QJU2 3MIHA 2XVLA 2R7EB 5L19A 1FMD2 5FP3A 2QJVA 3LWCA 4YG0A 4B4PA 1S0IA 3AZVA 4N43B 5EPAA 2XJQA 3FC0A 4RSUA 5E88A 1IKQA 5ACA2 1XBFA 3MIGA 4B3NA 1RC6A 4DUWA 1D4M1 3OBTA 4L9BA 3B9CA 1YQ2A 3O7OA 3AP6A 4ZS3A 1ZRCA 3CEWA 4RD7A 3FLTA 3ZYIB 3BI3A 2TEPA 4WBBA 4UYBA 3VKNA 1ND2A 4RS5B 4CXYA 4Y22B 3ROUA 1TG7A 5EJZB 2WO7A 4Q4Y3 4UBHA 3ZN4A 4DINB 1SEFA 2X5IC 4IV1A 1JYTA 1UYZA 1CZSA 2SLIA 4HSJA 4AI8A 1FT9A 4YFZA 1HRV2 4TN7A 3DYPA 2E32A 2KR2A 2WABA 2P6CA 4M0NA 4JGYC 4XCBA 4DOUA 5K0UB 3VBFC 1SLTA 1KQRA 4KWJA 2FZ2A 1DCSA 1HN0A 3NSTA 1YNAA 4XFHA 5J09A 4HN0A 4S2HA 1CAUA 1RUD2 4YZ4A 3NRUA 2QDRA 1JS9A 2Z79A 2VTXA 3BYWA 3HAGA 2WNUA 2BGOA 1W2AX 4JV4A 2Y6LA 1CAXA 3VDDA 3IWZA 1Q43A 3DPRB 4FOQA 4WVZA 1C8M3 4DRRA 2GZWA 3ZXJA 3AFKA 5IVJA 3VZOA 4BK5A 2WT0A 4K21A 5KHIA 2F4LA 1RUNA 1JOBA 1UU6A 4PIXA 2BNNA 1AYN1 1LOBA 3FUOA 3VHNA 2VO5A 2XL9A 5IYYA 4DEVA 5DQ0A 4I2OA 1VIWB 5FK7A 4GMP3 3LPFA 2CDOA 1LHUA 3IMMA 1JZ3A 3UETA 1S4CA 5JXIA 1KRIA 3M3EA 4LO8A 3CZUA 4AI2A 4MO3M 4XOGA 3LDKA 1JI6A 2FQPA 2WNVB 2WN3A 2Q1FA 2Y60A 5E89A 3AKSA 3OPWA 2IFRA 5DABA 4CCEA 4CU9A 3D5OA 3SH3A 1DFQA 1B35C 3CDZB 4LO7A 1YYNA 2JXAA 3WZ1A 3ZFGC 5JZGB 1SFNA 2B9VA 3IIAA 1Q8PA 1OQEA 1OSGA 2VZRA 1ND3A 3B01A 3K2OA 3OGVA 4H7LA 4AHXA 5JLVA 3JB8A 4FTEA 1G6NA 1ULFA 1POV1 3L2HA 3OD0A 4NMIA 1WCSA 4OVEA 5A33A 3TAYA 4E9KA 4OI0A 1V6MA 4ATFA 1CAVA 2AGSA 4A7ZA 3K4DA 1OA2A 2WZPP 2RM21 2AR6A 2A6WA 1VBE2 3FWEA 2ARXA 4PBOA 1BMV2 1MVQA 2RE9A 4XFAA 3GCXA 3ZR6A 1Y3TA 2OW4A 5L73A 4Q8KA 3C8XA 4QPIA 2ZHKA 3M8LA 1VAMA 5DXDA 5J36A 4LEJA 2R043 3KD4A 4DXRA 5F9TA 5FZAA 5F5IA 3NV2A 2AC1A 5D2AA 5FXVA 3VBUC 1HB4A 3ZSJA 4PI0A 4AVSA 1ST8A 2P3KA 2KD7A 2LALA 4QD2A 3NNMA 3T30A 3MIDA 4PDWA 1QQP2 2NQYA 1W2TA 2E6VA 3KM5A 1K12A 2UYBA 1EV13 4EZ4A 4OI2A 2VZ1A 1YCIA 2YGMA 4Q4W3 4P08A 4YW2A 5FMOL 2Z2SB 1FYUA 2RHPA 3SMHA 4XBNA 2ORXA 1K42A 3PIGA 1NUKA 2WS92 3PUAA 4FPCA 5LRSA 1VBA2 2DUQA 3WDTA 2PHTA 2YBKA 2D6MA 5DUXA 4XDQA 4LHKA 4GWNA 1ZNPA 3J26N 1XSRA 3E1F1
chains in the Genus database with same CATH topology
2VMGA 3ZSKA 1WLCA 4Y1UA 3VKLA 2WC2A 1I5ZA 4GIQA 2HWD3 5FO7B 4Q4Y1 3H50A 4F8AA 1YJKA 4JCKA 4Q4V1 1SBDA 4Q0QA 2ZGTA 4HMZA 4EWDA 1I3HA 1V70A 2ZS6B 4IEXA 4KNCA 2XJPA 4CEWA 5C9AB 1VBB3 2ZX0A 3HD8B 4IEPA 5DDJ3 3TB0A 2D3SA 2VOWA 2ZX3A 5AVAA 1APNA 4IEYA 3WP5A 4M3CE 3ZYJB 1H9WA 1Z0HA 1OQDA 4N43A 2K2SA 5JSOA 5CG9A 4HSLA 5E16A 3WD5A 1QHDA 1KFXL 2YY1A 3INAA 4BLJA 2WA4A 4GB32 1W6OB 3IN9A 1V9U3 2KM2A 4WVMB 4I0BA 3PMSA 4BMEA 4HLTA 4Y22A 2V73A 2D6NA 1K5MC 3N36A 4JDOA 4UXAA 4K6BA 3WW3A 3ZFEB 1R092 2DURA 2O8QA 3OCPA 4R4XA 1EPWA 4GMP0 2ZGNA 1VBC1 1AXZA 1S0EA 1C3HA 4AK3A 5K0UA 4E2GA 1SMVA 1VRH1 5AVPA 1OHFA 1REFA 1XYOA 2VU9A 5HCFA 2GC3A 3ME2A 2HEYF 2XG3A 1AX0A 2YGLA 3DN7A 4M01A 2WA3A 4COUA 5F1RA 1DLLA 1WGPA 4LUKA 5A32B 2EA7A 1GNHA 3AJYA 4HKWA 4MUVA 5GLZA 4CP1A 3AZZA 5BYNA 1VLNA 1A78A 5JR7B 4B7EA 1DYKA 3H7JA 4KWLA 2BBVA 1G8WA 1O4TA 2WSVA 4ISQA 2R041 1OOPB 2VQ0A 1CAWB 1YIPA 2WNVA 3MGUA 5CADA 1R1A3 2BWAA 2EF6A 4WM7C 2A73B 2E53A 4MGYE 3N4MA 2ZHLA 1PM7A 5KC5A 4OUSA 1RUJ1 5JZGA 3ZXAC 1ULEA 1SLCA 4YGDA 1BQPA 2KA3A 4FPGA 4V1PA 3MIFA 1EAH2 5J48A 5T55A 4Q0PA 1N47A 3M3QA 3M3IA 4AE2A 1V6LA 4QU2A 4YVWA 4KL1A 1QOTA 1ENQA 3QH7A 1RUI3 4MSVA 1HLCA 1URXA 2A6VA 3G6JB 3LKJA 5F5QA 1AR63 1W0PA 4XQWA 3GHNA 4EN6B 5T3NA 3KSCA 2OZ6A 3ZIXA 1ZX5A 4EV0A 4A3XA 4E2QA 2D6OX 3B00A 3T2TA 3VBSC 1LOFC 4CDUA 4L97A 4S2GA 4BIFA 1COV3 2DCYA 2XJRA 4RA0A 4E2SA 3AX4A 4KH9A 3WLUA 4DY5A 1NCRC 1PO23 5FREA 4F7ZA 5KBFA 1NZCA 1PO13 2ZGSA 3JBG2 1IS3A 4EROA 4HANA 5IK8A 4RQPB 3AKQA 4UW6A 3USSA 4AWDA 3E97A 4C90A 2V5YA 3ZIWA 1O7FA 3HR9A 4FPKA 3MF9A 3E5UA 1RMU1 4HFSA 2ET1A 5E8AA 4DMIA 2R072 1Z7S2 5C33A 1UX6A 1MZEA 3A4UA 3TNPB 3VZKA 4YNIA 4BPZA 3FBMA 3VZNA 1V9U1 1D2SA 1R083 3HWJA 1LEDA 3WDXA 3V0AA 3B93A 2Q0AA 1QH6A 2K9ZA 4FP2A 2Q1MA 1DGWX 2ZGOA 1DHKB 5J96B 2JG9C 1WBLA 1AVBA 2ZHNA 4MGZE 4Q1RA 4Q4X3 1DQ4A 3H1WA 2RMU1 3LA7A 3RI9A 5C9AA 5BNPC 3WDWA 4WV8A 3TYJA 3ALQA 4TSVA 3ZXDA 1LCLA 4KU7A 2BFUS 3ES1A 3PVNA 2JEMA 3IBMA 3WP4A 2HJIA 3DUIA 1NLRA 4XPVA 4YZ5A 1RUC1 1NCQB 1FNYA 3J8F2 2A75A 1G9FA 2ZKNA 1ZZBA 2BGCA 2BYVE 4LBJA 1FOD3 3WOGA 4WVMA 1Q56A 4L2NA 1O5UA 3ZYGA 4L92A 4HK8A 3AP9A 5EYXA 3THTA 4JVAA 3HT2A 1J59A 1KITA 1UKRA 1AR93 1WMDA 1OD5A 2RS13 2XL7A 1UL9A 2ZZJA 4FCAA 4NHMA 5GLVA 2PHUA 3ZFEA 4K20A 4FSJA 2D6PA 1UKGA 2O0OA 3D8CA 3WUCA 4RGGA 4HK9A 1HXS2 5CFCC 5JDBA 1AL21 1LU1A 4XFFA 4FVVA 2C0ZA 1BVVA 2G4IA 2TUNA 4YW5A 4X6QB 3VBRB 5BXXA 4XHXA 1YI9A 4LO5B 3ASIA 3L9JT 1YFUA 3KS7A 1ASJ3 2YYOA 1CGPA 3WG1A 1JHNA 4Q2FA 4LBOA 3ZXKA 5AC91 5A32A 4MXWB 5FBZA 1IS5A 5J7MA 4TLFA 1XNBA 3ZN5A 1JN2P 5EZWA 1RUF2 1ZVFA 2OZJA 5GKAC 2WJSA 2VULA 1ALYA 1S0JA 3AKRA 3LOBA 1ZBE2 1OOPA 3ZFFB 4AEDC 3EXUA 4XFBA 4CEYB 1HQLA 3TN93 2UYAA 1YXWA 4GA9A 1SLLA 3LAGA 2XWBB 2VPVA 3QCWA 3OJBA 2AREA 4OI4A 3OF1A 3IMNA 3WP3A 2PLV2 4AI3A 2MHFA 1PZ8A 3BTAA 3DV8A 1TMF3 2PHWA 2FBEA 3GNEA 5BNNC 5I93A 1BEV3 2ZTNA 1SQ4A 4M00A 1ENXA 4H3WA 1RTVA 5GZGA 5IK4A 4IEWA 4XJWA 3K48A 3NL1A 2PAEA 4N53B 1J3RA 1HIXA 3MPPG 1AYM3 2EXIA 4AVVA 1WW4A 2ERFA 1W6PB 1GYKA 1R1ZA 1MS9A 1QJX1 1ZZCA 5D8AB 1YRZA 1VR3A 1S0DA 1S0BA 1QDOA 1F2NA 4Q4X1 3VN4A 2EVXA 4RQPA 2GSYA 2RS33 5JWPA 1U5IA 1PVC1 1HDKA 2D93A 4KWKA 3WX5A 5AFEA 1HRI2 4IXLA 2PHFA 3RRDA 3T1LA 5GLWA 4FPFA 1XXNA 2D3PA 1KS4A 2G9FA 1CR7A 4A7YA 1MS1A 2EIGA 1RHI3 5ABJC 1KDMA 2WT1A 2W39A 1ZRRA 3ENRA 2B39A 3OPZA 2GN7A 4JGZB 2WZR2 3OTFA 4GH4C 4DZGA 3EJKA 4TYSA 1GSLA 1AR91 1X82A 3I4IA 1DDLA 2VG9A 4UW4A 1OFSA 2VOKA 2WKKA 4N7IA 4XIKA 5JVVA 4YZ2A 2DFCA 4YG6A 4QQ2A 3CJIB 2ZCWA 3IKWA 1YFYA 1V6IA 2ARBA 3W9AA 4X6RB 1UIJA 1KFUL 1NE6A 1VBD3 5EJ3A 4ZU7A 4B4RA 1VB2A 2B46X 3VBHC 4FPLA 4IESA 4CP0A 4COVA 5FQ0B 5JI9A 1NCQA 1QGLA 2UY9A 4I30A 3TRSB 2QFEA 1HQNA 2XLAA 3CO2A 1RUG3 4PBPA 4PLNA 2B45X 4IV1C 5AFBA 4XXAA 4MGIE 1QJY3 3RQ0A 3ZN6B 5CVRA 1D4M2 4ASLA 3U0ZA 2VW2A 5I0UA 2Q30A 4HL0A 4QQHA 1I9RA 4IEQA 2HWE3 1WW7A 3VL8A 2WNUC 3TNQA 2ET7A 1WMEA 3VDDC 3BCWA 3VBRA 5T52A 2HEWF 4XYXA 4CDXC 2PTMA 1ZRDA 3GBFA 1TMF1 1SBFA 1TNRA 4HZFA 1Y43B 5KXCA 5GZEA 1ZZ9A 1KXGA 3AYEA 4MXWA 1LODA 2F6BA 4P9XA 3VKMA 2HWF2 3TBDA 1LHNA 1QNWA 5FMOS 4LE3A 1UAIA 2XHKA 4KGQA 1PGW2 4HVOA 4NWWA 1DU3D 3ZFFA 1EY2A 3RG0A 2CWMA 2VXRA 5GLUA 4CEYA 1AYN2 3MYXA 1F31A 2HYKA 4LO6B 4Y20B 2IXCA 2P34A 3OGGA 2BVBA 1ND3C 5FPXA 2RR12 2X53S 2RS52 4OZXA 3R6SA 4CDWA 4C1WA 4AVBA 4HBNA 4FPEA 2P17A 2DU1A 4AQTA 1NE4A 2W52A 2Y0OA 1HV0A 2R49A 1VJ2A 1JW6A 2R1BA 4QPIC 5JOZA 2A6XA 1CPMA 1FPN1 1N1VA 3NW4A 1WUVA 1AR71 1GZ9A 4AEMA 1ZBA1 1G9CA 4N53A 2RM22 4IQPA 4P9IA 5HCAA 4UW3A 2DU0A 5DG1A 2YUEA 3NAPA 2JJ6A 2HWC2 2VVEA 1DGRA 5D8AA 1H1MA 2WIIB 3FUQA 4EWEA 3PTYA 3JD71 1PIV2 1AR81 1QJU3 4XTPA 3TOJA 3FLPA 1JYCA 2A7AA 2R32A 2YPJA 1FMD3 3ZXLA 4AG4A 2EAKA 5HCBA 4L11A 5SV8A 3ZPYA 2BPA2 4UW5A 2PHDA 3MPBA 4RHV1 5ACA3 1BYHA 3WW2A 4PIYA 2CY6A 4Y4YA 4FQ4A 4GULA 2BVVA 4MYEA 3O0XA 4OHVA 2A3WA 2VNOA 1KS5A 4JGZA 1PK6B 1QJY1 2ZGKA 2I45A 3SCFA 4CRQA 1HRV3 1RITA 4CEWC 3GZAA 3ZYRA 1WBFA 1Q8SA 2BNOA 4YM2A 3M3OA 3VGIA 3RYRA 3B02A 4OUMA 4LA3A 1RUD3 3V64A 1H2NA 4Q4Y2 3P3NA 4N43C 4JTOA 4Q4V2 3IDEA 3VHRA 4FQZA 1ULCA 5KC6A 1XQNA 3BODA 2ZGQA 1B35B 4HN1A 1BBT1 2UWBA 3LA3A 1NQDA 4ES8A 5JSPA 5FQ0A 1LEMA 5DG2A 3HMYA 4XEZA 3AFGA 4I0WB 4E4DX 3ZFGB 2GNBA 4N9IA 1H1IA 2XJSA 3M3CA 2D97A 2HKXA 1PZ9A 1QF3A 2ZMKA 4HT1T 2IXLA 4Q0VA 4XMAA 4YRDA 4BMBA 5DUWA 1DYPA 2D98A 4FOWA 5FLHA 5K0UC 5I91A 1XE8A 3M1HA 5JIAA 2PAMA 2Z69A 5FAXA 1CIWA 1LOAA 2AZ5A 1IS6A 1REEA 2IZWA 1I1EA 2GU9A 4K40A 2B8MA 3N35A 1W6MB 4DXZA 2AYHA 1S1AA 3NKTA 1VBC2 4OHZA 4LBMA 3PJYA 3VBUB 3WG2A 1S2BA 1VBE3 5FDBA 1VRH2 1GQGA 3HT1A 4AVCA 2QDNA 4GKXA 5H9PA 2D3RA 3QH6A 1IZ3A 1CJDA 1TME2 4IERA 2WNVC 2B7YA 5EFUA 1RJ8A 3S30A 1DIWA 1DZQA 3D6EA 2R061 3VL9A 1EP0A 1XRUA 4Q8LA 3I2DA 4R9CA 4Y20A 5JZGC 1MQTC 1PGL1 1QQP3 1RB8G 4LBQB 2NMOA 3SCHA 4I3PA 4JDNA 1QJU1 3FZ3A 1DG6A 3A0NA 4N9HA 4YARA 1D2QA 2DYCA 1H8TB 2WS93 4YVWC 2JICA 1VBA3 1RUJ2 5LEJA 1O3QA 1RUE2 2HEVF 5GALA 3AYDA 1ZZ6A 2CWSA 1LECA 4EWAA 1HV1A 2MNGA 1NY71 3CL1A 3VHOA 1G9AA 4CDUC 3H9AA 3OYWB 1M06G 4NO4A 2XKOA 2QZ2A 1ENSA 3LOIA 2XLFA 1H1AA 2EXJA 2XBO3 3WQ1A 3LSDA 3JQXA 5EV7A 5CBLA 4QM9A 1T6GC 4RR3B 3VZLA 3P3PA 2ILMA 2ZA9A 5JCTA 3LSEA 1QMJA 5CB7A 3C3VA 1C8M1 1K5MB 4SBVA 3RYKA 3RPQA 2E63A 4Y26A 2H0VA 3HIFA 2MEV2 4GMP1 4YLZA 4GB33 2DFBA 4LT5A 1LGNA 2ZMNA 3ILRA 3GBGA 1AZDA 4RS5A 2WLQA 3H8UA 4FO9A 2LUWA 4QQLA 4I0AA 1RMU2 2H6BA 3MLJA 4QGNA 3VHPA 4WM8C 4BA6A 5JOXA 3WXPA 4XILA 1PK6A 3R0RA 3AMQA 4FOYA 2CAUA 4LE4A 2JE7A 1R093 1LHVA 3NV3A 1C1FA 4N7UA 2G9GA 5C9AC 3G7DA 3AP5A 1AJKA 4BE3A 4QX5A 1IS4A 3VBOB 4F3JA 1SACA 2E9QA 4XFCA 1PHMA 4IEZA 5JAXA 5IT6A 1FXZA 2CAVA 2A6ZA 1QJZA 2A5ZA 3BALA 3DPRA 5DUUA 3IT8A 3R4SA 4NWVA 3WY6A 2XUMA 5LK7B 1AX2A 1LKNA 2LM3A 3V0BB 1B35A 2AUYA 2RMU2 2XJTA 1VBE1 1YUDA 1BMV1 3WG3A 3ZSEA 4J6GA 1KJLA 2GALA 4CP2A 5A3LA 3ZVXA 4XIOA 4IEOA 4WVWA 3RJRA 3ST7A 3H1YA 5KHHA 1VP6A 4XJZA 5GZCA 2VUJA 2JDZA 4YW3A 5C4WB 1RUC2 1DQ0A 3R4UA 2JKBA 3HN1A 2I07B 1UCXA 1NOVA 3ES4A 4IEUA 2VW0A 1QQP1 1EV11 2OIIA 2XKPA 4Q4W1 4LULA 1CX4A 3N7KA 1N1SA 2QKDA 1W6MA 4DB5A 1AJOA 5BV6A 3DF0A 4QPGB 1Q8VA 4R52A 1FV3A 1RVF2 1EAH3 4BWOA 1HX6A 4JDMA 1AL22 3FFZA 5CA6A 1X33A 2Q4SA 1S0CA 4MH0E 2ZABA 3POWA 1NXMA 3D0SA 1HW5A 1LGBA 1OOPC 1L3JA 2D6KA 5AC92 3T1MA 2HWD1 1QOSA 4IV3B 4KG8A 3MW4A 1H0BA 1CPNA 4N90A 2PYTA 4M0HA 5GJ6A 4M3CF 4XF4A 5BNOB 3WW4A 5F6KA 1MS4A 2XBO1 3IDBB 3AM2A 3UJOA 1VBB1 3JBG3 4QQOA 2X29A 5BNQA 3R4DB 5DDJ1 1DF0A 4LBQA 3O0VA 3SNMA 2BUKA 5JMCA 4AI1A 3B94A 3N7JA 2ZAHA 2ZACA 1QXJA 1AHSA 3H0OA 3Q9OA 1H8TA 4YW1A 4B7KA 1MS0A 1IKPA 1GV9A 1Z7S3 4W65A 1W6NB 4Z82A 1FI2A 4XZPA 4ZU4A 1JYIA 1UU4A 4OHWA 3DKWA 4GB31 3WQ0A 1QWRA 2X8KA 1MACA 4BCUA 4J1WA 5T5LA 2BNMA 2Q5TA 4BYYA 3PMEA 1X50A 3B9IA 4P5HA 4RQPC 1A3KA 4RR3A 2NMNA 3UKNA 2YHJA 4AYUA 1KD7A 5IK5A 2OPKA 5L7OC 5BY5A 2VVFA 4YVSB 1QJX2 1OQ1A 3X29B 1W6OA 3J8F3 4G3YC 4PCRA 5CFCB 1A8DA 3MW3A 4NHKA 1PVC2 4CDQB 4R9DA 1G9DA 3WV6A 1NLSA 1DQ2A 1R1A1 5I0TA 2NLRA 3FHIB 1DGRN 2QVSB 2BW8A 4AEJA 3B5LB 4COZA 3H1MA 4IL7A 4ZKTB 3AZYA 1HXS3 1FX5A 3VBOA 2UU8A 1NXD1 4AHYA 2WT2A 3GHMA 2EALA 3PVBB 1G7YA 2JG8B 3LA2A 1PNGA 5K9YA 1AR92 2YZ4A 4X8PA 3NO8A 4AEDB 5C6CA 1NCQC 4S2DA 3V0BA 1RUH2 2IC1A 1RUI1 3FJSA 1BK1A 2ZKLA 4TZDA 3RNSA 1RUF3 3AXDA 4HPKB 5HBAA 1AR61 4CYDA 1UF2C 1CAWA 4LNVA 2WFF2 4QM8A 2DTYA 5KHKA 5CFDB 4LLOA 5BNNB 5C4WA 3UKTA 5C8CB 1COV1 1BJQA 1XYNA 1GKBA 2D5HA 4AFDA 5K8SA 3OY8B 3NV4A 1PO21 1LGCA 1W6QB 4K9SA 3SH4A 1PO11 3VBRC 3JCIA 2PLV3 4YSFA 1QY4A 3JZVA 3KQRA 1RIRA 1ZA4A 4QGLA 4META 4D7TA 2PA7A 4QPGA 4P9LA 3SLIA 2GMEA 1F8VA 5BUVA 1Z7S1 4D7SA 5JIUA 1LOEA 4XMIA 4WZCA 2ZX4A 4AVAA 2TNFA 1C8NA 1GZWB 5JPMB 2F4PA 4QPYA 1R081 1ENRA 2DWRA 1TMF2 3ZFFC 1YHFA 2R0HA 4TWTA 1MS3A 3AMPA 4IV3A 3BB6A 5HI0A 2BWCA 2B5HA 2GMMA 5JPNB 1J3PA 1MVEA 3WT3A 1V6OA 3RYPA 4CDWC 4E27A 5BNOA 2ZHMA 1FNZA 4IETA 3CJXA 4JAAA 4Y1VA 4Z92B 3I7DA 4HVRA 1C5HA 1FATA 4Q1PA 2JE9A 3KLSA 4XBLA 3KMHA 4K7JA 1BZWA 5DZGA 4JQRA 4AFAA 4Q27A 5E1RA 4ZU5A 3MI8A 3H7YA 3VZJA 2ZPXA 3JU9A 3I59B 4XXPA 3BOWA 1W6NA 4AEKA 4R9AA 1LULA 1H4GA 3E5QA 2PFWA 4NVPA 1FOD1 4OFGA 3M7AA 3QACA 3QD6A 4K1YA 1EYBA 1TEIA 3WNXA 1O4ZA 3AMHA 2RS11 2WZR3 1FPN2 3NAPC 3VBHB 3WP6A 1I6XA 4DNYA 4D94A 1AR72 4Y1YA 5D8AC 5KWRA 1ZBA2 4EN8B 1MEC2 1HXS1 4PLOA 1CJPA 4DRVA 4B4QA 5KHGA 3B7MA 1J1TA 1PGSA 3USUB 3NWKA 3HQXA 1ASJ1 4MGKE 4YVSA 1UD1A 3URFA 2QUOA 2PHRA 2HWB3 4AFBA 4BM8A 1LOCA 1NG0A 3AZXA 3JD72 3UK9A 1AR82 1ND2C 4NN0A 1CESA 1U5YA 3ELNA 4XETA 1IPJA 1RUF1 5J3UA 1OLRA 2BQPA 3AYAA 3CU7A 1HQWA 4CDQA 4EN9B 4JGZC 2WINB 4RHV2 3WVJA 4CDXB 1D4M3 3J4UH 3TN91 1ONAA 4DS0A 3KGLA 3LCPA 1D4VB 3UKVA 1F9KA 1CVNA 3KCCA 1NA1B 4QXKA 4AGRA 1QJY2 2DCTA 2JG8A 1BEV1 3WDYA 2RJKA 2BFUL 4AEDA 2H0BA 1X7NA 1Q8QA 1XU1A 2W68A 4JRLA 4XBQA 2HWF3 5GZDA 4B8EA 3QLQA 3VLBB 1U0AA 3VUOA 1QDCA 3FMGA 4HPKA 4LR4A 2DVAA 4OLLA 1DZTA 4EJRA 1CAVB 5FLJA 2MPFA 5CFDA 2PELA 1BBT2 3M70A 1AYM1 1AYN3 4ISRA 5C8CA 1U5ZA 4FTBA 2JENA 3L2YA 2DCKA 5SV5A 3OY8A 5KXBA 2RR13 2RS53 3MIBA 2ZBJA 4D7YA 4A2UA 4R4ZA 3E5XA 4LBNA 2RS31 4B29A 1N3PA 1ZZ8A 2E51A 1WLDA 4XQDA 2AENA 1SLAA 5T54A 5IUQA 4LHLA 4BLIA 5FO8B 4JRAA 1O4YA 1POV3 1RHI1 4HKOA 4JTNA 1N1YA 2ETEA 4YZ3A 3VV1A 4XE9A 1QOOA 3LZZA 2RM23 3O5SA 1W6PA 3UJQA 5CU1A 1C5IA 4PDWC 1A8MA 2WZR1 1PZ7A 4M3CB 1ZYBA 2HWC3 1V6KA 2Q1ZB 4FPOB 1WCKA 4ASMB 1PIV3 1MS8A 2R062 1Z78A 4EN0A 1VBD1 4OULA 2X5IB 3LB9A 2GN3A 3MF6A 1O3SA 2AH2A 5T50A 3PHMA 3A0KA 5CG8A 3I59A 4XF3A 2IWGB 1PGL2 2IXHA 4JGYB 2QE3A 2XWJB 2HWB1 1O91A 3RDIA 3VBFB 4CEWB 1UPSA 1AX1A 1J1LA 3JUUA 2VOVA 5FTTC 1UIKA 2NPIA 1WLTA 5EYYA 1RUG1 1CD3G 3PVEA 4PJYA 2RJLA 4DQAA 1B09A 1LESA 3M4FA 3RI8A 2D6LX 3UV9A 3SCGA 3VBHA 1C28A 1OLQA 3ZXGA 3WHTA 4FAHA 1NY72 2D40A 4L99A 2HWE1 3CJIA 5JI7A 2V09A 2Q8OA 1LJ7A 4MZUA 1XNDA 2NZ9A 3USUA 4G9SB 4PIZA 1SBEA 4Q4V3 1X8MA 4H55A 5I8SA 3ZMOA 2VNRA 5FOBB 2UWAA 4H14A 4FTSA 2D43A 2A3XA 4RS5C 2HWF1 3VZMA 5I8TA 1XU2A 2YMZA 5IK7A 3IM0A 4PQ9A 1C8M2 4ORFA 4CZSA 1PNFA 1PK6C 4MX3A 4XQ4A 3ZN6A 1O3TA 1PGW1 3JB4C 2K0GA 4CDXA 5C8WA 1DGLA 4FBFA 2IXKA 4GXLA 3W59A 4OI1A 2RR11 2RS51 3DPRC 1JOJA 3DL3A 1NA1A 2TBVA 4P14A 2CYFA 1RGSA 3OBRA 1Q8OA 1NQJA 1VBC3 4FP3A 2CNAA 3KGZA 1VRH3 3KT7A 3O12A 2GNDA 1OPOA 2D44A 4OHXA 1OMIA 1MQTB 4W6XA 2VQAA 2C5DA 3WCRA 1BVP1 1TME3 3AK0A 1LRHA 1LOGA 2KXLA 4U36A 3ZO0B 1D0GA 3RZZA 1X36A 3SH5A 2DCJA 2P3JA 4LA2A 2VMHA 3AKPA 4XJAA 4DFSA 2WQ4A 4HVQA 2DV9A 4KQ7A 2WWSA 3AXEA 4YVWB 3MW2A 3NKGA 1POV0 5I0SA 4PF5A 2BTVC 2R042 2HWC1 1MZ5A 4GWMA 5JSRA 2VMIA 4NOTA 1O3RA 4Y5Z0 4W6YA 2WNEA 4XF1A 1PIV1 4CDUB 1FMD1 1IOAA 1MR5A 1YIFA 4COYA 1LHOA 5ACA1 1RUJ3 1RUE3 1EV12 2IFWA 4Q4W2 2PHXA 2UWCA 1GNZA 4BQ1A 1H30A 4FXGB 4Q0UA 2ATFA 5FFOC 4C0HA 5B2GB 2C9AA 3K51A 2R0FA 3MEPA 4M3CA 1HRV1 3WCSA 1Q5OA 1SCRA 4DY3A 4F83A 1CONA 2IXIA 2PAKA 1Y9QA 2UURA 4NR1A 2GC2A 1XNKA 3KZ4C 2HWD2 1RUD1 2VVDA 3B3QE 1YFXA 3V0AB 5LEKA 1XE7A 4A7KA 4C0BA 4WM8B 1H8TC 2X5IA 3RS6A 4FPYA 3I54A 1M4WA 1D0HA 1TNFA 4QQPA 2YXSA 1F5JA 3D4KA 2XBO2 1VBB2 4JGYA 5DDJ2 3VBFA 2R6QA 3FX3A 2MEV3 3OGJA 1PMIA 2VNGA 4K1ZA 3U10A 3E6CC 1RMU3 3S6PA 3GALA 1IPKA 1RINA 1ZRFA 3GYDA 5KHJA 1AUYA 1W0OA 2VY0A 2DVFA 4FPJA 5DZFA 3VKOA 4AF9A 5A3MA 1V9U2 2SBAA 4OI0A 2YROA 1MS5A 3ILNA 4RR3C 4YM0A 1FAYA 2D5FA 3N7LA 2WFPA 4I3GA 1EPZA 1G9BA 1LR5A 3B69A 2GC0A 4WZFA 2UY8A 1VB4A 1V6NA 3EBRA 4E4ZA 2GH2A 4LO4B 2ES3A 4WM7B 1TQ5A 2ZOEB 2RMU3 2ZGPA 4Z1VA 4AQ6A 1N1TA 3ZFGA 4AGGA 2CL2A 1S0FA 2CV6A 3RMYA 2XPJA 1YWKA 2XJUA 3D82A 1GQHA 2PHLA 5H9RA 3U07A 2ZZQA 3POSA 1TME1 2GNMA 3ZFEC 3S7EA 2A3YA 4OHYA 4NPRA 1KJRA 2WSUA 2Y38A 1RUC3 2EAAA 1GLHA 1ZM1A 1WW6A 3MFCA 4RL7A 4XW3A 4BH9A 3VBOC 4Y24A 4COWA 2P37A 5I8YA 2GAUA 2JECA 1HKDA 1QH7A 2JD4A 4ATEA 1R1A2 5J37A 3ZXFA 1S0GA 1UU5A 3HBZA 1XYPA 4URTA 3VBSB 5FPZA 1DQ6A 3QOPA 2B9UA 1ZREA 2E7TA 3VBUA 2CGPA 2I74A 1RVF3 2WS91 1VBA1 2Z5WA 1AL23 3MLKA 2CGOA 1NCRB 5DUVA 1W39A 3WDUA 5T5OA 2GC1A 4LBKA 1RUE1 3AMNA 5LRRA 3WW1A 5FOJB 1MQTA 4LHNA 3MZHA 4Q29A 4O9GA 1F5FA 1WLWA 1LTEA 2DVDA 1XNCA 2VGDA 1WMFA 5C4WC 3JQWA 5AC93 4AW7A 4GKYA 1RUI2 1YJLA 4LBQD 1NYWA 1AR62 2CGNA 4AHWA 4BZ4A 1C57A 3SITA 1WD4A 1JTZX 4I09A 4QGMA 4FPHA 4D3WA 4QPGC 1COV2 1GBGA 3GZTB 3ATGA 3PNAA 2PN5A 5TSWA 3WDVA 2R073 4L8QA 1PO22 1WA4A 1WW5A 2JG9B 1ZZ7A 1PO12 2VH9A 2OA2A 4G4FA 4K3UA 1YI7A 3S7IA 2DF7A 1H8VA 4HETA 2GNTA 2ZGLA 5BNPB 3SISA 5T5JA 2QQPA 4AQSA 2VOXA 4KG0A 2MEV1 3THPA 2OYZA 4QMAA 4R8HA 1IHMA 2NN8A 3OYWA 4IV3C 1J58A 2ZJCA 5L7OB 3EHKA 1R091 5BNOC 2GMPA 4XFIA 1UW8A 4LLFA 1R082 2EXKA 1QXPA 4ONUA 1YFWA 5KXEA 3AP4A 5T5PA 1K5MA 3I8TA 1H2LA 4WM8A 3QBQA 3APBA 4YGEA 1QJX3 4Q4X2 4GALA 4MXVA 4HKLA 1C1LA 5FLIA 2ZX2A 1SDWA 4J1XA 4ZXKA 4BHPA 2FMDA 3AZWA 3ETQA 3CF6E 1JBCA 1IQAA 1PVC3 2QCSB 5CIRA 4Y1ZA 1V6JA 2LTNA 1JH5A 4RGAA 5L36A 1WD3A 2E7AA 3ZXEA 5JOYA 1GANA 4Z07A 4AFMA 2FHRA 4EN7B 1FOD2 4NHLA 2NYYA 3BU7A 3DGTA 2A6YA 5I0RA 1N3OA 2WQZC 2YDEA 2Y26A 1JUIA 2RS12 4YZ1A 2R16A 3IDCB 4YVSC 3AKTA 2DCZA 4WM7A 1LENA 1EAH1