4AF0A

Crystal structure of cryptococcal inosine monophosphate dehydrogenase
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
522
structure length
395
Chain Sequence
TNPNAPPRPDSLLNPSDALKHLEEYPRGDGLSLQELMDSRKNGGLTYNDFLVLPGHINFPASDVSLQSKATKNIVLNTPFLSSPMDTVTEDRMAIALALHGGLGIIHHNCSAEEQAAMVRRVKKYENYPYASKVPESKQLYCGAAIGTRPGDKDRLKLLAEAGLDVVVLDSSQGNSVYQIEFIKWIKQTYPKIDVIAGNVVTREQAAQLIAAGADGLRIGMGSGSICITQEVMAVGRPQGTAVYAVAEFASRFGIPCIADGGIGNIGHIAKALALGASAVMMGGLLAGTTESPGEYFYHEGKRVKVYRGMGSIEAMEHTGLDNAATARYFSEADAVKVAQGVSGDVADKGSINKFVPYLFTGLQHSLQDAAIKSVSELHSCARSGSLRFELRTAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title De Novo GTP Biosynthesis is Critical for Virulence of the Fungal Pathogen Cryptococcus Neoformans
pubmed doi rcsb
source organism Cryptococcus neoformans
molecule tags Oxidoreductase
molecule keywords INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
total genus 123
structure length 395
sequence length 522
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2012-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4af0A00
4IOTA 3QFEA 4I9AA 3G24A 3PBUA 5FF3A 4S2BA 3C2FA 4WD0A 4M19A 4A21A 1AG1O 3NL3A 1O4UA 4RLIA 4UFKA 4ZQOA 4MZYA 4QJ1A 3NR0A 4MLJA 2YFNA 3UPBA 3M0ZA 3IIVA 5HULA 1G7VA 5CPOA 1THFD 4K6AA 3TSDA 5K2ZA 4EOUA 4R53A 5KZMA 1T0OA 3W2UA 4NNAA 4Y6GA 1I2NA 4WUIA 3G1DA 3CIWA 2YGYA 4FEZA 2FPYA 3LHTA 3W83A 3OA3A 4N2YA 1XI3A 3NOEA 3O63A 3TIMA 2V30A 4BF9A 3UWUA 3EEGA 1I2QA 2YFOA 3LLFA 3W7HA 2OJPA 3W70A 1FUYA 1DOSA 2V81A 4LV4A 3PB2A 1CX9A 1WQ5A 1TPWA 3NO5A 4HHPA 1ZAIA 2DP3A 1NFBA 1QDSA 1SU5A 3R12A 5C5YA 2BX7A 3WJSA 5A5WA 3C52A 4ADSA 1TPEA 3GDMA 3S1VA 3SGUA 2GUUA 3N9SA 1GVSA 1VCGA 3F4WA 1FCVA 2PURA 3IIZA 4O13A 2CWNA 3B06A 3W1UA 6ALDA 3W86A 2JK2A 3WK0A 3HG3A 1JVNA 2TRSA 1LP6A 1HTIA 4HSOA 4NUWA 3M6YA 3OVQA 4N4QA 1P5BA 1M5WA 1H63A 1JRBA 2G95A 3NL2A 3W2LA 1G4EA 2QJIA 3H54A 1YPIA 1F6KA 2E5CA 1PS9A 4Q33A 4RXFA 2H8XA 1NAL1 4WJEA 1SPQA 4QSHA 1HUVA 4JDYA 4QNWA 5CSSA 3P8IA 1JQVA 2JBMA 3FA5A 3QM3A 3G1FA 3TK7A 1OF8A 3TMLA 2X1RA 2NUWA 3CU2A 5MHBA 1OK6A 1G4TA 1N55A 2ZZ2A 4HSNA 1FCBA 3TDFA 3LRKA 2DORA 4O54A 4OV9A 3NPWA 3HO8A 1KBIA 1FDJA 1H7PA 4MJMA 5D2WA 5D2YA 2Y63A 1T99A 3P62A 1TPC1 3KRSA 3OVPA 3UWYA 3NQ2A 1T8XA 3LRLA 2RDUA 3DAQA 3EB2A 2OX1A 4MVAA 3NEVA 1A5BA 4NNCA 2WSYA 1O94A 1KM3A 4BWLA 3WJWA 4UCGA 1R2SA 1P0KA 1W54A 1JRCA 3EX6A 1ZENA 4QISA 1WXJA 4LUIA 1ZAHA 2ZA3A 4A2RA 3WK1A 5CG7A 2VELA 2VEPA 1EP3A 1VR6A 1XKYA 4GJ1A 3INPA 3STEA 4JTKA 3UNDA 3GDKA 4DF1A 1L6SA 2RH9A 5D02A 5BRBA 4LS0A 2CLMA 5IBXA 4ML9A 4R7JA 3NM3A 4QAIA 3W6YA 3FS2A 1VYRA 4E38A 4FXRA 3BV4A 3HJZA 5F1VA 4IPJA 1OVDA 3DFNA 3NQFA 3QRHA 4NT0A 3H53A 3HGOA 3UY8A 1DV7A 3N73A 2PE4A 4M7SA 3RF9A 2C1HA 4Y9AA 1VYPX 1OFOA 3D0CA 2AGKA 2B4GA 2G96A 1OK4A 2Y89A 2LLEA 3P80A 3G1XA 2A2IA 2J9YA 1K3UA 3I7QA 3OEXA 3FJ6A 4LU0A 3TSBA 1XBXA 4GE8A 1ZJIA 2Q3RA 2CLLA 2Y6ZA 4MZ8A 4N02A 5EPDA 2QF7A 3UZJA 2J9ZA 4NZFA 1XDLA 1LBLA 3B03A 3N34A 3P60A 3R13A 3BGGA 3B05A 4HPJA 3W2MA 3NGJA 1YTEA 4NX0A 1RZMA 3EX4A 4LS1A 3W7DA 4FIQA 3CEUA 3LCGA 4OE7A 4UFHA 3NL6A 4FX6M 3P7YA 5EMUA 1IXNA 4PC8A 4YXGA 5D2VA 4ZVJA 2XFWA 3FIGA 3W71A 3QH2A 1K8ZA 1GVFA 2NXHA 1SZNA 3NPXA 1XM3A 1ADOA 1FBAA 4IMCA 1ML1A 2W6RA 4CQAA 2NWSA 1WAUA 4LVFA 1IF2A 2FB3A 3TROA 5DELA 5CZ0A 5G2WA 1W3NA 2NV1A 4A29A 5HMSA 4YCPA 3W1MA 1H7RA 2GVGA 3W2JA 3TCEA 2Z1BA 1OF6A 4XBKA 1K03A 1B4KA 1TREA 1UCWA 4BWLC 4QM1A 1SZGA 1C9DA 2Z2UA 1XL9A 3R8RA 4FNPA 3VE7A 3L68A 1OX4A 5HJLA 4MKNA 3MO7A 3BW2A 2JGQA 4NNBA 5D37A 3GNDA 3P8JA 2NUYA 3R5EA 4GC4A 4HIBA 3M7WA 3ABRA 3NXFA 2H8ZA 3EX2A 1IXQA 1WV2A 2C19A 1OJXA 3GVGA 5TBOA 5DXYA 4O18A 3LCIA 4UFJA 5GVJA 1TPFA 1MEWA 2GVJA 1H51A 4RKAA 4TU1A 3SW6A 4RZ4A 3W85A 2ISSA 2RHGA 2QUUA 4O57A 1IIGA 3LBCA 4PODA 1KFCA 3UYCA 3GAYA 4UTJA 3GNNA 5D2TA 2NUXA 1ZALA 3FLUA 3GXTA 5AB3A 1B3OA 1C8VA 3LTPA 2ZRYA 3EWBX 2HS8A 3TV8A 3W73A 1KBJA 1EPXA 4GWEA 2ZZ1A 1JCLA 3HG2A 7TIMA 1XUUA 1A50A 4N9DA 1ICPA 1VPXA 4I7UA 5HWNA 2QCHA 1G7UA 3L2IA 4EWND 1I45A 3BW4A 1SUXA 4E2DA 1U5JA 2WO5A 3NQ8A 2W79A 3TC6A 2W0UA 3DI1A 2QCNA 3CC1A 3RLUA 3LI0A 5LGXA 1SSGA 3TXZA 3L65A 4GFSA 4RXGA 1QWGA 1W56A 2V9DA 5AOUA 5FEPA 3QPZA 1GPWA 1TPDA 3BARA 1QFEA 2Y7FA 3A21A 5I3IA 3BW3A 5FI8A 1S5VA 5I3JA 3USBA 1S5TA 2C3ZA 3SI9A 1UB3A 3N2XA 4UXDA 4JYDA 4UTIA 5AHEA 4O11A 1GYLA 4XUGA 3G8RA 3NZRA 5HINA 3R2GA 4CCCA 2Q8LA 4U28A 1IXOA 4GBUA 1VYSX 1EP1A 1R2RA 1H60A 3G1HA 2P10A 3VFLA 1Q3NA 3KVMA 1H50A 2QAFA 2BWGA 2RDTA 4NJGA 3PWAA 1L2UA 3CHVA 4RX0A 2TSYA 3MP3A 4AVFA 3F03K 4HN4A 3W7JA 1RPXA 1OHLA 3E02A 3PSVA 2CLIA 5E1QA 4HNTA 3ABSA 4CQ9A 3LV5A 5LNRA 1V7YA 1NSJA 1E51A 2CZDA 3ABQA 3T40A 3GYEA 3P81A 1HO4A 1KV8A 1RR2A 1VLWA 4OBTA 1LZOA 1KFJA 3NQMA 3PG8A 4XTIA 4KKXA 2HSAA 1GTHA 1VH7A 3KHJA 2GOUA 5F2IA 1WBJA 4M6PA 3T4CA 2WPBA 3Q37A 1JUBA 2O7QA 3T7VA 2QJHA 3NG3A 1U83A 2E1DA 5G1YA 3BG9A 2NX9A 4M6QA 2QDHA 4WOZA 4WXZA 1ZCOA 1XCFA 2XN2A 1TPB1 4QITA 2VFDA 5DN1A 4XBSA 2FB2A 3LHWA 3G1YA 1TPUA 1EUNA 1I2RA 3TU9A 3W23A 1BEUA 4UR7A 1UASA 3LI1A 4ZQMA 3STGA 5F2GA 1LRTA 5D03A 4U4MA 5AYXA 1W5MA 5LGZA 3QSTA 1AW1A 3CWNA 1TB3A 3Q58A 3VI2A 3EX3A 2ZA2A 1OFPA 3GR8A 4FF7A 3TMQA 1MO0A 3DFSA 2HMCA 5EY5A 2BZNA 2ZYFA 3UWVA 1W37A 1MSSA 3BO9A 3G1SA 5EL1A 4DPQA 5KZEA 4GRSA 1Q6OA 2QCCA 3B4UA 4WZHA 2G97A 2FJKA 4UFIA 1G6CA 3QQ0A 5ABTA 1YDNA 2B0MA 2VEMA 4GXMA 3W9ZA 1L9WA 3N9RA 1TJRA 3P5ZA 4CNOA 5K4ZA 3HPXA 3LCWA 4AWUA 3HQ1A 4IX2A 2FQIA 1VHNA 3IGXA 4NXSA 3UY7A 4N9EA 4FXSA 3LXCA 1KM5A 4LVDA 3HGRA 3M1ZA 2X1TA 1JCJA 3T78A 2YX0A 3KFTA 1KM0A 4UR8A 5K7JA 4JD4A 3W1LA 4TIMA 3DFOA 5J5RA 1KFLA 2A7RA 3W07A 1ZY9A 4O1DA 2R91A 1W3IA 2A6NA 3W7IA 3PY2A 3ELFA 4DQWA 3G1AA 4WOQA 5AYZA 2NXGA 3LERA 3PBVA 3S5OA 4LC8A 4MY8A 1PV8A 3QF0A 1EP2A 3P82A 1QCWA 4CLMA 3SZ8A 3L0KA 1FWTA 5U4NA 3W75A 3BGJA 3VE9A 4FO4A 3LTYA 1JULA 4XTDA 3BLIA 4JYFA 3MHUA 4DPPA 4NX5A 3EWYA 3SGZA 5DBUA 3NYZA 5CPLA 4UTLA 3TFCA 2Y85A 1GQNA 3CT7A 4Z08A 5G4EA 2CLFA 5HUPA 4K36A 3EWWA 1QPRA 1EB3A 4OWGA 3C2EA 5I3GA 3DFPA 3IVSA 4ORMA 4FHAA 5KINA 1XXXA 3NVTA 3QMTA 3S1WA 3O16A 1AL7A 4MYAA 1TV7A 4JX5A 3KAOA 2ABBA 2WV8A 1RQHA 4K37A 4O14A 3LCHA 1GTEA 1TMHA 4KFOA 4GUJA 2FDSA 4KWVA 3CIXA 4GUHA 4J9JA 3W1PA 1F6PA 3PR2A 3TSMA 2NX3A 1W5QA 2QCDB 4H4IA 3P84A 3YPIA 3I7RA 2F84A 3RFAA 3H55A 4LWWA 4PA8A 3HGJA 2XN1A 3P5YA 4ICNA 3O6CA 5FEWA 1S5WA 2ZRUA 1W1ZA 4FB7A 2ATSA 3UWZA 4B5NA 2X1UA 2I14A 1X8FA 3L5LA 3TKFA 4AWTA 1KLZA 1QPQA 1EA0A 4DXVA 5CZSA 5I3FA 5EA9A 4UTWA 4Q4KA 2YSWA 1LM1A 1KM2A 3JRKA 1BTMA 3PS7A 1OX6A 3GB6A 3G3DA 3M16A 2A4AA 3KVKA 1EWEA 2VFGA 4NJJA 2TYSA 4LVGA 4XQ6A 1VGAA 1G4PA 3G0XA 5KITA 4GUGA 1ZFJA 1TO3A 3M5ZA 1QOQA 3PB0A 1X7FA 2ZRWA 1IXPA 3A24A 3NL5A 5CGQA 3L0GA 1R46A 3EWXA 3S5ZA 1KV5A 2E6DA 4AHQA 4AWSA 5A8GA 4JDBA 1OFAA 3DKJA 4Z0JA 3LHYA 2F7FA 4YWIA 4WY0B 3TFXA 1LROA 3G8EA 2V5BA 2ZRXA 3IGUA 1YDOA 4Z1AA 2GVLA 3TXVA 3PAJA 3IVTA 3V1PA 4UIOA 1ZAJA 1F5ZA 5T26A 4KFNA 2VKZG 3W76A 3TW6A 5G1TA 4UNLA 1BWLA 1G67A 1KTCA 3RNDA 3KVLA 3K30A 2VEIA 2NWRA 4ADUA 1DKWA 4K7YA 1OYAA 1XFBA 2WQPA 4JTUA 4LVAA 3PC0A 4O52A 2HTMA 4JX6A 1ZNNA 4K8EA 1DL3A 1MXSA 2QCLA 2C13A 3W1XA 1SW3A 1RQEA 4AB4A 4IMGA 2CU0A 3UZ5A 4H3DA 2O7SA 1WOBA 3S8HA 3Q2DA 4JTSA 3LGEA 2OMAA 4X9SA 3AO0A 1SQ7A 3PBWA 5AFDA 1W5PA 2JKEA 4ONVA 5DY3A 3N2MA 4O19A 5H91A 3FKKA 3CQ0A 3HB9A 4O10A 3MHGA 3W88A 2WOQA 1YADA 3HGSA 1TRDA 4PL1A 4TMCA 3SSJA 1AW2A 5SWUA 4X22A 5FESA 3NPUA 1L6YA 1J2WA 2QCFA 2BSLA 2YCEA 2ZTKA 4GUFA 2QCEA 3C6CA 1HL2A 5LSMA 4XKYA 1W0MA 1LOLA 2BTMA 3CTLA 2P0OA 4YMZA 3MI6A 1LBMA 2B7QA 3LM7A 4YLWA 3TQVA 3O15A 2FPVA 3OBKA 1NVMA 3E96A 4PCFA 2V5LA 3MW7A 1TIMA 2NXIA 2R14A 3HG5A 3KOFA 4LRTA 3C4UA 2QEZA 3E49A 4HKPA 2YXGA 5BMXA 2NV2A 3M47A 4N9CA 5F4SA 3QW4B 5EKYA 1AW5A 3G0UA 2Q8ZA 4QNEA 4W9TA 3PULA 4JY9A 2H3DA 4A3UA 3MJYA 1TTPA 4O17A 4JS3A 4UTUA 2ISVA 2ZQ0A 3VCRA 3NAVA 3TJLA 4BR1A 1H61A 4Z1BA 3W1TA 3C3NA 3KX6A 4JIQA 4TMBA 2B7NA 3LBMA 3V75A 4UTWC 1FWRA 1VJIA 3P61A 1I4NA 3IGSA 1B57A 5CZJA 3VNDA 1UBSA 4HNNA 3O07A 3G0SA 1KW1A 5LNVA 3M41A 1JQXA 5D30A 4ZZ9A 4PFMA 3GAKA 1Z42A 4FNRA 3KRUA 3L21A 1NF0A 2FLIA 3S1UA 3CEPA 4QIUA 5IBXC 4O0KA 5AYYA 3MHFA 4MY1A 1V5XA 4JR5A 2E68A 5DCDA 2EF9A 1SO5A 5HNRA 2HS6A 4LV9A 1N7KA 3R89A 4DO4A 3C2OA 2DZVA 4JTLA 2CZEA 3C0JA 3S5YA 3LDVA 4IX0A 2X16A 5AC6A 1SSDA 4JTGA 3PM6A 3EXTA 1YTDA 3M44A 3U6WA 4DF0A 2VFEA 1B4EA 2GJLA 1AK5A 3QQ1A 1TPVA 2Y61A 4UTHA 2NLIA 2DZTA 2OT1A 5KZDA 1SO4A 4JTHA 4OGZA 3SIZA 3GXPA 1KFEA 2EKCA 4FNTA 3W2KA 2EGZA 1DQWA 3QPYA 4BI7A 1UUMA 2AQWA 1GEQA 3U8GA 4XZ9A 2CLEA 2E77A 3S42A 4DO6A 2FPTA 4MOZA 3NQCA 5LNUA 2Y62A 3W7KA 2ZDRA 1H7OA 3TH6A 1OX5A 3HF3A 3BLFA 1DHPA 2YDAA 3O1NA 4NJHA 4O12A 4R33A 4XKYB 3W87A 4WQ6A 3NQVA 3PUEA 1TQXA 2YPIA 2E5BA 3M43A 4LRSA 1OABA 4N9BA 1EEPA 3W7CA 2EPHA 3O05A 5J5DA 1LRNA 2GQ8A 3IIXA 3L5MA 5DCBA 2VEKA 1SO6A 3QC3A 1YYAA 4Y90A 1TYGA 2WNQA 4FIRA 3GDRA 1Q45A 3ABOA 2CLOA 3B0VC 4JYEA 1NEYA 1DBTA 2QCGA 5G5IA 3HOJA 3SJ3A 2V2HA 1K7EA 2QUTA 4O4VA 5HWMA 1KM6A 1OYBA 1OFQA 3A23A 3W2NA 1A53A 1FCQA 4OQVA 5DLCA 1JR1A 3EXSA 4ZMGA 1ME9A 4JTEA 1H1YA 4N6EA 2Q3OA 1D3HA 1WYIA 1LYXA 1TTJA 4LS2A 4H6KA 2DZWA 5D05A 3LCXA 1P1XA 1BWKA 3PF3A 2ATMA 3WFAA 1A5SA 2WSQA 4EVZA 5K4XA 3M5XA 5HQEA 2ZA1A 3EWZA 4O0ZA 1M7OA 2Y7EA 1P0NA 5E0KA 1SW0A 4IXHA 4RK8A 3MMTA 3MP4A 4DO5A 1RQBA 3LCFA 4NJKA 1QAPA 4CNNA 1I2OA 1NF7A 3I65A 3MI2A 4TO8A 2E6FA 3OIXA 1ME7A 3A22A 3CWOX 3HG4A 4MFDA 2J6XA 2X1SA 3CM4A 3LHUA 4C1KA 2A7NA 2A21A 1ALDA 4BFAA 5G2IA 3I68A 3JS3A 3A5VA 4L4LA 1FCUA 4N4PA 3EKLA 5HR6A 3QYQA 3W7RA 4MIMA 1DJNA 1IIHA 1W3TA 4I7VA 3GXNA 4WXYA 1I2PA 2J9XA 1Z48A 3MP5A 1QOPA 1JUKA 2A85A 4RR4A 1HFBA 4UTMA 4NU7A 3Q94A 4LTSA 1F76A 1LCOA 5F4WA 4C1LA 5AHLA 4JX4A 3TR2A 1H7XA 4IPIA 4MUZA 4BI6A 4PH6A 1X1ZA 2ZZ4A 3IEBA 1FDZA 4O8RA 3QMRA 2E5DA 5D32A 5AC7A 4EIVA 1WOAA 4UC5A 1ICQA 3F4NA 4OT7A 2NZLA 4ZQRA 1SZEA 2C16A 1FWSA 3B04A 3ZS4A 3STCA 3S1XA 3IVUA 3DHFA 4PTNA 4ZL1A 2C6QA 4YL2A 1PCKA 3W7NA 5EBUA 5LNWA 4CCDA 5BW6A 1UJPA 1WBHA 3DH7A 5FEZA 1XBYA 2OT0A 4P2VA 3TX9A 3UXDA 1TSIA 3WJYA 3MBFA 5K9DA 1O5KA 1VZWA 4MPQA 3QZEA 4NZJA 4POCA 3NQ7A 3UQNA 1YDVA 4JTTA 1PHQA 3F1QA 1SO3A 3G1VA 2JKPA 4IWWA 3W1RA 3TUUA 4TX9A 5CPMA 5E93A 2ISWA 3UD6A 1D3GA 3UXAA 2DJLA 1VHCA 1K02A 1EX5A 4OHQA 4CCEA 1CW2A 2ZZ7A 4OU1A 3EX1A 5BOOA 4DELA 1FXQA 1P4CA 2OCZA 4N6FA 1QR7A 4Z1CA 3LHVA 4LC6A 4E0CA 2WNZA 3W1QA 4O28A 3NQAA 3C2RA 1TV5A 5FF4A 5AHNA 4JTIA 1KM4A 2GJNA 1TV8A 3U2OA 3FYOA 3NNTA 3G3MA 1H7NA 2CLHA 3UWWA 1MEIA 1SFLA 3G18A 3BG5A 1OYCA 1GOXA 5C2XA 3DBPA 5F2MA 2CLKA 1PHWA 2OZ0A 3ATYA 5CPNA 1JCXA 3C8FA 2ALDA 4O1CA 4RCXA 3CB8A 1RV8A 4WY0A 3BG3A 3BVJA 3MYPA 3W7QA 1FQ0A 1GT8A 3TJXA 1JCNA 1AMKA 1YXDA 1YXYA 2CZ5A 1LTDA 5F2LA 3LTSA 4PEKA 2Y88A 2PRHA 5FF0A 2D73A 3GLCA 4A22A 1FY6A 1VRDA 2B7OA 1LLWA 1DJQA 3TAOA 3TAKA 4GNJA 5EYWA 1FX6A 2ABAA 1F05A 3GKAA 3HIJA 2YYTA 4DBDA 2X30A 2AAMA 3IV3A 3C56A 2I1OA 3MI3A 4M6VA 2E09A 4JIPA 2TPSA 3GK0A 4LUJA 1JJKA 3IIPA 2Y7DA 3TC7A 5LHFA 3NM1A 1PE1A 1XBZA 2H3BA 2A7PA 1LLZA 3GDLA 1KA9F 2C15A 2Z6IA 3EKZA 3W7MA 2KZHA 4BK9A 5CZTA 3S6DA 3MWAA 4JXCA 5K9XA 4ORIA 1Q6RA 3CPRA 4O4WA 2C14A 4EF8A 2GPTA 1N8FA 5BMWA 3SY5A 5IM51 3O8AA 3WJZA 3NQGA 3DFTA 3DI0A 4NJIA 5FEXA 2I9EA 3EWUA 2GQ9A 3ZR4A 3C61A 1GG1A 2J27A 1RD5A 2YR1A 3W1NA 2J88A 1QPNA 5KMYA 3M5VA 5D38A 2QDGA 1D9EA 3QW3A 2X2GA 3L67A 5AHFA 1EWDA 4UFLA 4YCOA 3QJAA 1UUOA 3NZ1A 5L6UA 3WK3A 1X1OA 4HNVA 1XC4A 4UNKA 4O1AA 4X2RA 1ONRA 4NXKA 4Y8FA 3NDOA 1OX4B 2QR6A 3WJXA 4LT9A 5LNSA 4RZ6A 5D04C 3W74A 4UMCA 4A2SA 1QO2A 1DQXA 3KRZA 3A9IA 2RFGA 5DBTA 2CW6A 3M9YA 1W8SA 2ZFAA 1K8YA 3T44A 3MBDA 1GJPA 2VOMA 1SR9A 3B0UX 1EUAA 3LCLA 1TJPA 2QCMA 3I6RA 3BPWA 4AF0A 3OG3A 2G5WA 4I7WA 1YLVA 1Z44A 3GDTA 1A5AA 1XUZA 4ZQPA 3GX9A 5BNKA 4JTFA 1OFRA 3B8DA 1G4SA 3DENA 1FWWA 1FDYA 4Q32A 1W5NA 2A5HA 3N3MA 1B9BA 4HPXA 3I7SA 3TQKA 5CSRA 4HT3A 2B7PA 2PC4A 3S9YA 1F2JA 2FTPA 5AHMA 2VFIA 4EF9A 3RK8A 1QMLA 1Q6QA 3L9CA 4ZQNA 4AHOA 1GG0A 4JTJA 4RZ5A 3O6DA 2ZZ6A 1TTIA 4MZ1A 4LOCA 1SW7A 3W7EA 3A5FA 4K38A 1LDCA 4BI5A 1ZHAA 1LBFA 1OFBA 3E12A 1KLYA 3EXRA 2ZZ3A 3BLEA 3W22A 2ZTJA 3LXBA 5C54A 3PUDA 3DHDA 1KM1A 1BKSA 3DKLA 3FYPA 1K7FA 2ZZ5A 2TMDA 2WJZA 4JICA 1Q6LA 1I8JA 8TIMA 1QPOA 3TW7A 1ICSA 3LXAA 2UV8G 1GZGA 2PCQA 1R2TA 3FJLA 2BLEA 2A0NA 1DVJA 3OVRA 1VCFA 1JCYA 3NQEA 2DZPA 4O53A 2WKJA 5CKSA 4O15A 1HO1A 2IQTA 3THQA 5KTLA 4DEFA 2GQAA 3CLMA 3TQ0A 1VQTA 4OV4A 1X6UA 4XWUA 1Z41A 4ADTA 5AC8A 3W84A 3ZWSA 2DU2A 2WSRA 3E9AA 5HWJA 5F1UA 3DU0A 5TIMA 3W7LA 4WY0F 2DZSA 4MJZA 3T55A 4K7VA 2VC6A 4GUIA 3W7PA 3O6YX 1MEHA 4MY9A 5D09A 4IMFA 1W5OA 1A5CA 1XDMA 2YW4A 4Y96A 3IIOA 2J24A 1GVOA 1H62A 3OHIA 5L9FA 3W3OA 4FNSA 3VKJA 4DBEA 4JGDA 1KTNA 1TQJA 4LNYA 2R94A 2QJGA 1GYNA 4JN6A 1F74A 2H6RA 3HBLA 3KXQA 1GVQA 1WDWA 1TRIA 5I3HA 4LVBA 3DXIA 3TNOA 4O16A 3NPVA 2V8ZA 3TE9A 1FXPA 1KTBA 4R34A 4IGHA 2V2DA 4LY8A 4WX2A 3THAA 2Y70A 3LB0A 5K3VA 3FKRA 3O06A 2EAWA 3WK2A 3STFA 2CZFA 2CFFA 4UTTA 2EHHA 2P1FA 4RV8A 1KFBA 3PBYA 3W72A 3LOTA 3MUXA 2C18A 4D2JA 5C6MA 2DZUA 4AHPA 1G69A 3GKFA 4S1FA 2QAPA 2VXNA 4Z1DA 2VFFA 1K7XA 1JUEA 1ME8A 3QSRA 4JY8A 2RKXA 4NVTA 3DFQA 3MYOA 1DORA 4O50A 5LZLA 1QNVA 4G1KA 1OFEA 2DZXA 4IXXA 5KSWA 1J4EA 3IRDA 5DXXA 3KVJA 2WNNA 3PSWA 1GWJA 4M7TA 4UMAA 3ZWTA 3GIYA 5K9CA 3QEZA 1JCMP 1M6JA 3S0CA 1H5YA 1S3HA 3FEMA 2XN0A 3P67A 4M5PA 1IGSA 1VCVA 1C29A 4TR9A 2ZCGA 3PUOA 3DZ1A 1LOSA 5G2HA 3B0PA 3G22A 2YYUA 4UTTC 4UFMA 1PCWA 4DF2A 4UMBA 4FX7A 2QCDA 1L6WA 2FFCA 1OG0A 2V82A 4AXKA 3ANYA 3W7GA 1WX0A 3P74A 1F7BA 3PG9A 5DY2A 1SFJA 2BXVA 5TQLA 1CI1A 6TIMA 1O5XA 2NX1A 1XBVA 4RJEA 3GR7A 3UPWA 1O95A 4KWWA 2JKAA 3C2VA 1SZFA 1TCDA 2QKFA 2PRLA 1MZHA 3HPSA 4UUIA 2VFHA 1VS1A 3W1AA 4AMAA 2E6AA 1Y0EA 1K8XA 5FF7A 1EIXA 4MLRA 4ALDA 4E2BA 1PL9A 4FNQA 2YW3A 1PVNA 3RLVA 4KFPA 3AJXA 4MFEA 3TA6A 5LKYA 3N19B 4S2CA 3FFSA 5U7SA 1J5TA 5HUOA 3FOKA 4HNUA 2YZRA 1YTKA 3JR2A 3S5NA 4IMEA 1AL8A 3DGRA 4NQ1A 2PRMA 4JEQA 3RMJA 3M5YA 2QUVA 4O1BA 4IJBA 2Z0IA 3LX9A 1VLIA 3N14A 5AHIA 2R8WA 4L4MA 4AF0B 3NQ6A 1RVGA 3HMJG 1KFKA 3UWQA 1F73A 4AH7A 3L0NA 4X3ZA 2ZRZA 2A6LA 3BK0A 1TPH1 3NQDA 4AAJA 3LLDA 4UTKA 4JNMA 2C0AA 3GZ3A 5I3KA 4PL2A 2ZBTA 2Y7GA 1LRQA 1R30A 3W7OA 4ZQCA 3LRMA 4IMDA 1W31A 3L5AA 4IUOA 4CQ8A 2DJXA 4IQLA 4AEOA 1VC4A 3L66A 4Z0SA 2V2CA 1TTQA 2V0TA 5LHEA 5AN7A 2JGYA 5F4XA 5D2XA 1M7PA 4FX8A 3PVFA 4QQ3A 1LORA 5H2ZA 4P61A 2FIQA 5D33A 4K8HA 5HR7A 1H1ZA 3NA8A 1YPFA 1WA3A 1H7WA 1HG3A 1O60A 3LV6A 3HPZA 3SFKA 1GVRA 2Z6JA 5DCEA 3QMSA 4K39A 2A1YA 2ZRVA 3RU6A 3SECA 1T96A 3ATZA 1R47A 3LHZA 1LOQA 1PIIA 5FF2A 4MYXA 5C55A 3ZFHA 4FNUA 3E0IA 5G4WA 2VENA 4LW7A 4CNPA 1QO5A 2E6YA 1OFDA 2RDWA 1YXCA 1FWNA 2H90A 3SR7A
chains in the Genus database with same CATH superfamily
5E5CA 4XD4A 2RJGA 3IJ9A 1MMFA 2NW0A 3NL3A 1ZRQA 4UFKA 2AQOA 2WVSA 3TVAA 4QJ1A 3EYPA 3SY1A 2ODOA 1AH3A 2DIEA 4B3ZA 1G7VA 5CPOA 4K6AA 3N11A 2GSJA 2F2HA 2GDUA 2HE5A 3BSHA 3UZWA 4DM1A 1NP0A 2YA0A 1E6QM 3STPA 3ERPA 3G1DA 4HK6A 1NDVA 4FEZA 5FOOA 4GIEA 1HKIA 4C6IA 2WYSA 3ZYZA 2XZ7A 1S2VA 4TTUA 2V30A 4ZOEA 3UWUA 3W7HA 1FUYA 1DOSA 3HPFA 4LV4A 3U48A 1TPWA 4OOUA 5M1TA 3QC0A 3GYCA 1MNSA 1SU5A 3R12A 5C5YA 2BX7A 4FR6A 3C52A 4ADSA 3S1VA 2QPUA 4W8BA 3F4WA 4O13A 3VZZA 2JK2A 3MT1A 2W4XA 1KCXA 3TN4A 3VMNA 4JPGA 5I3DA 2FZBA 3MZNA 3APYA 1NTHA 3W2LA 5HATA 3ZR5A 1HKVA 1XG4A 3H54A 1F6KA 3QR1A 4RE4A 5LIKX 3K1GA 1X98A 1EXPA 2XPKA 4WJEA 4JFSA 1JQVA 4JTCA 4V1YA 2JBMA 3QM3A 3G1FA 1EL3A 5CBIA 1UWIA 2ZX8A 3TK7A 2HNEA 4QHRA 4FF5A 2J7CA 5EMMA 4X9YA 3TMLA 2F6UA 2NUWA 1BAGA 3CU2A 3SCVA 3ZT6A 2ZZ2A 4ZSTA 4OV9A 1KBIA 1EF3A 4GCXA 3IAQA 4MJMA 5D2WA 3WBAA 2Y63A 1D8WA 3P62A 2F61A 4AIUA 3P2VA 4H9TA 7A3HA 2PCEA 5ABHA 4HCDA 3LRLA 5I6SA 5HNUA 2OKTA 4KGJA 1O94A 1KM3A 5A94A 1LLOA 2YXOA 4M3PA 4OJYA 1UJQA 4PULA 3ANUA 1LL4A 4KEUA 3DESA 1NOUA 4LUIA 3WK1A 3NSXA 1DJXA 1HN1A 2VX5A 3H2FA 3GDKA 1A5KC 2CLMA 1NOFA 4O8AA 3T05A 5IBXA 4R7JA 1UQZA 3V0UA 2ESCA 4FXRA 3IACA 3HJZA 1HNYA 2QJJA 5F1VA 5BWFA 4IPJA 1OVDA 3DYMA 3WZ0E 3USZA 3W01A 1GORA 3ZJKA 3RF9A 3V18A 1UWRA 1OFOA 3AUOA 1XRFA 4MJ4A 3G1XA 3NSMA 1UWQA 2XYLA 3PNZA 3EMCA 4XO7A 4QJ5B 3TOYA 2Q3RA 2Y6ZA 3WQCA 3ARYA 5EPDA 1A4MA 3GUGA 1NOWA 5LXXA 4IPNB 3I3EA 2J9ZA 2V69A 4C6KA 3GTXA 3UR2A 3IJIA 3ZMRA 4NX0A 3VCNA 3EOLA 3EX4A 4LS1A 3W7DA 3PHAA 4FIQA 4OE7A 4UFHA 2AKZA 1FWEC 4AD1A 3V0SA 3VNMA 3L4WA 1IXNA 4L4PA 1SJBA 2PDCA 4J35A 2XFWA 3FIGA 3QH2A 4Q8UA 4ECLA 1GVFA 4ATWA 3PBMA 2NXHA 3OTRA 4AY8A 3SAZA 1NWRA 4IMCA 5CXPA 2FYMA 4MF4A 1V77A 1WAUA 3K8KA 2FB3A 5DELA 5CZ0A 2EPMX 3LM3A 4I90A 5B80A 4IGNA 1UH4A 3WH7A 1TA3B 3W1MA 4R9XA 3TCEA 1JG9A 2Z1BA 1OF6A 2KAUC 4XBKA 4H9YA 2JEPA 4Q4SA 2Z2UA 2ISDA 1GKQA 4MKNA 1IEQA 2ZUVA 3SUSA 2JGQA 4DUOA 4NNBA 3MCOA 5D37A 3GNDA 3P8JA 3UG3A 2NUYA 3ABRA 5IXEA 4L64A 3NXFA 4LCQA 3U2CA 1VFTA 3QFWA 3RJYA 4GLEA 2VR4A 1JDDA 1TUFA 1ZJBA 5TBOA 3LCIA 4UFJA 3KBNA 4RKAA 3SW6A 4RZ4A 4NRRA 4QLLA 3RXZA 4O57A 4PODA 1HP4A 1Q7ZA 5D2TA 2ZC1A 2WHLA 1JZ4A 3B97A 1ZALA 3WBWA 1B3OA 2ZRYA 1LG2A 3GY1A 1KBJA 1EPXA 1C3FA 2V3GA 3ISIX 4DJDA 1GZ1A 2ZX9A 3IJ8A 1A50A 1HJXA 1G7UA 3L2IA 2F38A 1J18A 1SUXA 2X42A 4Q8OA 1E1CB 1CDGA 3RGTA 2W0UA 3DI1A 3RJXA 3GBDA 1NP2A 1XH0A 3W6MA 5B7YA 3C0LA 3RLUA 2NVAA 1LT7A 1BVNP 1LJYA 3F4VA 3S47A 1Z69A 1QWGA 1R5YA 1W56A 3EAUA 2V9DA 2ZUMA 3WX7A 2ZUNA 2BVWA 3MVIA 5FI8A 5I3JA 1UB3A 1U30A 1BYCA 3N2XA 4CQDA 3ZSSA 2FHFA 1R85A 3G8RA 3SADA 1WKYA 2Q8LA 2GGJA 1SJDA 4CVWA 3R4IA 3M0YA 3KVMA 1EC8A 3FXGA 4P8WA 4LGXA 3E1F1 2RDTA 2BY3A 4HN4A 3WLOA 1EDTA 1RPXA 3T6CA 3UBPC 2PWDA 2P8CA 1UZ1A 2FTWA 3QKEA 3M0LA 4V2XA 3L4YA 1KGWA 4YVXA 2FVMA 5LNRA 1V7YA 2KX9A 4JNYA 3E0LA 1E51A 4E2VA 3CO8A 4OBTA 1S2CA 3VIKA 4I6KA 2GVYA 3WD4A 1POKA 3O6AA 4HOWA 5FJIA 2GOUA 5F2IA 3GHUA 4M6PA 3B9NA 1MRQA 3T4CA 3WLQA 4GY7A 1KQZA 1TMQA 2HXTA 2V67A 2P50A 4AWEA 4Z42C 1UR4A 4RDVA 3B8WA 2C7FA 2V68A 1ZTVA 5HA7A 1VBHA 1XCFA 2XN2A 1F3TA 4XBSA 2AMXA 1OCJA 3CGTA 3LHWA 3G1YA 5GJPA 1I2RA 4WHBA 3W23A 3II1A 3WY1A 1BEUA 1OEPA 1TR1A 1UR1A 1EFZA 5AYXA 4WGHA 1F8IA 4LAZA 1OD0A 3EX3A 4PTDA 2VP8A 4M0XA 3OLDA 1MO0A 2YDQA 5EY5A 2ZYFA 3UWVA 3AAMA 1CEOA 3FN9A 4DPQA 2WZMA 3VNKA 3D3FA 1EGVA 1MYRA 2G97A 2FJKA 1G6CA 1SYTA 3O9NA 1RA5A 5D9PA 3DHPA 4GXMA 2IPFA 3W9ZA 1S39A 4DZ5A 4WDXA 4YYCA 1CLVA 2XGIA 4S3EA 5K4ZA 3LCWA 2V5JA 1L2QA 1UOZA 4AWUA 3B4YA 4Q4QA 1LWHA 2QW5A 4N9EA 1ZJHA 3LXCA 2WBGA 4QJ3B 4CN4A 1JCJA 1RJRA 4WEVX 4TQTA 1WZLA 1UBPC 3BMXA 5K7JA 1I1XA 4TIMA 3DFOA 3KOXA 1KFLA 4UQBA 1ZY9A 3WLJA 4IISA 3PY2A 4JKKA 5AYZA 1W9BM 2IPJA 1JZ7A 3PBVA 4EPEC 1TWZA 4MY8A 4X61A 4G9PA 1EP2A 1QCWA 3QHMA 1FWTA 4G2DA 5U4NA 3BGJA 1BQCA 1CPUA 4XTDA 2VCBA 2WMKA 5AECA 4NX5A 5CPLA 4I6VA 4Z08A 1A5OC 2YCJA 3CV7A 4ERAA 3JZEA 2X7WA 1QI4A 3DFPA 4ORMA 2I5IA 2PP3A 2EBNA 2PWUA 4MYAA 2JALA 4JX5A 3WKZA 1Q6EA 4MSSA 3A6OA 3KAOA 4L4OA 3RO8A 3OG2A 4GQ0A 1B3YA 1PZ3A 3LCHA 4KFOA 3QR0A 3HMCA 4LCRA 1UD5A 1QK0A 3CIXA 4GUHA 1UR3M 3W1PA 2F6XA 3WD1A 1DJYA 4GYKA 4R27A 3P84A 3ORWA 4GIAA 2VRJA 1Q13A 3RFAA 3H55A 1E43A 1FHLA 2WZIA 5FEWA 1F61A 3R0UA 2BXZA 4BQ4A 4XAFA 2ZRUA 1PKNA 1VFUA 2X1IA 1A5NC 4B5NA 2X1UA 2I14A 4HB7A 2G3JA 3A3WA 4AWTA 1DJHA 5JIWA 5BOEA 1Q8AA 3NURA 5REQA 1KM2A 4GVGA 2VX7A 2TAAA 3URBA 3TTOA 1OX6A 4US5D 3GB6A 3G3DA 1EWEA 2VFGA 1XS2A 1VGAA 3CBWA 1T8QA 5KITA 1BYDA 4GUGA 2ZXBA 5A1AA 4A3HA 3MMDA 1VPQA 1QOQA 3WLPA 3MUIA 1IXPA 2QQ6A 4U2ZA 1R46A 1KV5A 2E8YA 4M56A 1KXTA 4JDBA 3DKJA 4Z0JA 1CCWB 4YWIA 3LHYA 2F7FA 4WY0B 4P8XA 2EQDA 2V5BA 3Q65A 3LPOA 2C8NA 5EU9A 1YDOA 3EPOA 2GVLA 3TXVA 3VOFA 2CWXA 1LWJA 4NZ3A 3V1PA 1F5ZA 2HDJA 3W76A 4HPHA 3RNDA 3K30A 2NWRA 2EJ1A 4ADUA 3AHXA 4K7YA 1VJSA 1CT5A 4DJDD 1Q6DA 4JX6A 1OCBA 3CXOA 2CXEA 4M24A 1DL3A 1FHDA 2QCLA 1SW3A 3AIUA 1RQEA 3AMCA 2O9TA 1E0XA 3DFYA 3S8HA 4JTSA 4YTRA 1G1YA 1VF8A 4PCSA 1HQTA 1W5PA 2JKEA 3CT2A 3BWWA 4ONVA 4O19A 3A47A 4HNOA 4O10A 2X8RA 4IL0A 4QRNA 1X6NA 4PL1A 4Q4MA 1GPFA 1WXZA 1L6YA 2QCFA 2BSLA 1W32A 4GUFA 2IPGA 4DVOA 3H24A 1PIGA 2GK1A 2BTMA 4E6MA 2P0OA 1E56A 4UR9A 2FHCA 1M68A 2QV5A 1E9ZB 3WD2A 3EDKA 3ZT5A 2FPVA 1V51A 4HK7A 2YA2A 2VVNA 4LFYA 4LUTA 2QJNA 4GI6A 1RP9A 3OODA 2QV4A 1NQKA 3HG5A 3UWEA 1J0YA 4J3XA 3C4UA 3VGEA 4BF7A 3E49A 3ES7A 2IKHA 2YXGA 5BMXA 2PLMA 3OW1A 2XIQA 5AVHA 1DWHM 4QBXA 5EKYA 2ZADA 2VGGA 1UKSA 2Q8ZA 2E40A 5CQ1A 4UWMA 1WPCA 4ZSUA 1H3GA 1REQA 1CB2A 3MJYA 1RAKA 5T8GA 5LA2A 1BF6A 2ZQ0A 3KE0A 3BAWA 1C8XA 1YQ2A 2PTWA 3K5XA 4Z1BA 5JH1A 4KWSA 1H09A 1RJPA 4KGLA 4AUBA 5C7HA 3LBMA 1I60A 3QLLA 5CZJA 1QW9A 1UBSA 2YLLA 4S3BA 4HNNA 4PUMA 1QASA 4ZXOA 3BMWA 4IIGA 5HDRA 3R10A 2FLIA 2WCGA 3CEPA 3CZ8A 5IBXC 1JF5A 1V5XA 4JR5A 4LAMA 1EDGA 1UWTA 2EF9A 1N7KA 2ZX5A 6A3HA 3C2OA 3C0JA 2J74A 4NYUA 2P3EA 1EZ2A 4KQNA 3EXTA 1YTDA 3HM7A 3U0HA 3GTIA 4B92A 1AK5A 4IFKB 4F2BA 4UTHA 2OT1A 3VOJA 4OGZA 4NI3A 1X39A 4CUCA 4WVXA 3QPYA 1VFHA 3NUKA 1GEQA 3VXGA 3U8GA 5PTDA 4XZ9A 3WD0A 1P6BA 2J13A 1Q6CA 1DYSA 3W29A 1QU4A 3GG1A 1YPXA 1O5QA 3CZLA 4HU0A 5CCZA 1XLJA 1H7OA 3TH6A 1OX5A 3RG6A 4XKYB 3W87A 5DQPA 5A8PA 3KDNA 1OABA 2EPHA 1K6AA 2AL2B 5CLTA 1GEHA 1TYGA 1K9EA 2GSEA 3WH8A 3VX1A 1JF6A 3GDRA 4J3UA 4R85A 3SCTA 3FK4A 3B0VC 1UROA 2G50A 4JYEA 3E74A 2PDNA 1DBTA 2W3ZA 2V2HA 1K7EA 4MGGA 1E6ZA 4XVEA 1OYBA 1XYLA 3CV2A 1A53A 4OQVA 4GXWA 5DLCA 3KCOA 3UVIA 1VENA 2WHJA 4JTEA 4Q7IA 4PUKA 4H7ZA 2J4GA 4HK5A 3RPDA 2H9AA 4LAKA 1TTJA 1S2TA 2WHKA 3LCXA 5FJOA 5BXTA 2O9OA 2ATMA 4U3AA 4A6GA 2HK1A 3SRFA 5ABFB 5M2FX 1XGDA 3LD5A 1XR2A 4GQQA 1KKRA 3M5XA 4GGBA 5HQEA 2ZA1A 2X0YA 4Z2JA 1SW0A 4IXHA 3O3RA 3MMTA 5BWAA 3N4FA 3ONBA 3N04A 2GGHA 4NJKA 4CD8A 3KZPA 4DN1A 3AIQA 2VX4A 4TO8A 1V0KA 3KBMA 1VEOA 4I8YA 3KP0A 2EG6A 3CM4A 2DT2A 4KCWA 5AVNA 4BFAA 3I68A 1IEXA 1FCUA 2UY2A 2PDQA 4IIHA 3RRXA 4INFA 1XIFA 4ATLA 3WNOA 4F0LA 1PUDA 3MP5A 3N3TA 5IRPA 4RR4A 3ARXA 1HFBA 5E70A 3OQEA 4NU7A 1OCQA 4C1LA 4JX4A 4E8DA 3TR2A 4OECA 4U10A 3WQ8A 4AFYA 1WKEA 2OOFA 1IT7A 4BI6A 4H83A 3IEBA 1PDZA 3IAPA 2XVLA 4C7GA 4BKNA 3UJRA 3DG6A 4OT7A 1RPKA 1SZEA 3SQLA 2C16A 3B04A 3STCA 1R3SA 1TCMA 3DHFA 3VDBA 4YL2A 4D8LA 1Y5VA 1E1FA 2XJ7A 5EBUA 2HNHA 5BW6A 3UXDA 2OT0A 4HU3A 2JF6A 2Y1HA 4XAPA 3NZGA 3WJYA 3MBFA 5K9DA 3GFZA 3VD5A 1IWBA 3QZEA 3NQ7A 3UQNA 4JTTA 1PHQA 1RCOB 5ECVA 3AU6A 1XIBA 4QCEA 9RUBA 3GXIA 3D5HA 4DUXA 4C6CA 4HHMA 5E93A 3GH4A 2ISWA 5IDZA 3UXAA 2XIOA 2E8ZA 3HN3A 2X0SA 3AIWA 4CCEA 2ZZ7A 5BOOA 2OCZA 1HIZA 4O28A 2CERA 3RM9A 4D6HA 1TV5A 4JTIA 1KM4A 2GJNA 1EF2A 2XM2A 3CUFA 4IM4A 3VYLA 4JL2A 1ZBCA 1KR0A 1V93A 3DBPA 4JN8A 4PRTA 5F2MA 3BV7A 3PTQA 3RPMA 1EH9A 1W3JA 5KETA 2G3NA 5CPNA 3C8FA 3GVQA 3T08A 3BG3A 3BVJA 3MYPA 1FQ0A 1JCNA 2PLKA 3AC0A 3ARTA 3B8VA 2CZ5A 5F2LA 4F66A 1W9PA 2D73A 3GLCA 1FY6A 3ES8A 1LLWA 3UJSA 4P8UA 3TAKA 4GNJA 3DBNA 1TR9A 1W91A 2ABAA 3GD6A 1QJWA 2AL2A 2YYTA 1NFPA 1ZL1A 4LXFA 2X30A 2AAMA 3UJEA 3KBSA 1TVPA 4JIPA 4K1WA 3GK0A 3M46A 3E6EA 5H1WA 1PE1A 2H3BA 3MDWA 4H9UA 4JHOA 2Z6IA 3EKZA 3W7MA 2KZHA 1TWDA 1FOBA 4QDPA 4JXCA 3TWBA 4CEXC 2BGNE 4EF8A 4IF2A 2GPTA 4BJHA 1PZ2A 5BMWA 3WJZA 2PFHA 4NSBA 2HXUA 3DFTA 4Y7EA 1XLHA 4WIWA 2VJXA 2GQ9A 1GG1A 3ARPA 2J27A 5EB8A 4YHGA 2YR1A 3H7RA 1QPNA 3LMZA 2E9MA 1WKDA 4HZ6A 2PP1A 3URAA 4F2UA 2E4TA 2WLZA 1X1OA 4HGXA 3LS9A 3CHEA 4C6MA 2INZA 1OX4B 3ITCA 1FWHC 5LNSA 5D04C 3IJ6A 3E2QA 1BHGA 1WCGA 4QSFA 2O9PA 3A4JA 2RFGA 3IUHA 4TUFA 4S3KA 4AC7C 3E5BA 2ONEA 2W63A 3MBDA 3W82A 5CBJA 4H6EA 1J11A 3N15A 4JEJA 3SJNA 3I6RA 4E2OA 3OG3A 3OJGA 2WMHA 2UBPC 1A5AA 4ZQPA 4OOZA 5BNKA 3B8DA 4Y2WA 1G4SA 3DENA 5DMMA 2VO5A 4Q32A 5DFAA 1FKXA 4LUTB 4UOZA 3E3HA 4HPXA 1F2JA 4AC1X 2C79A 3UYIA 3MQTA 5AHMA 1VIZA 4EF9A 1R3QA 1DJGA 4FLSA 1HT6A 3GZAA 3RK8A 1OSEA 3UGRA 3I3DA 3L9CA 3VTRA 4JTJA 1TTIA 4MZ1A 1F6YA 3GBEA 4Q4PA 4ZFMA 4BI5A 4NP7A 2Z4GA 3AROA 3EXRA 1IR2A 3W22A 3LZ5A 3LXBA 1WZKA 2PDBA 3PUDA 4OVXA 5D9NA 3QHOA 3DKLA 1TE1A 1JAEA 1I8JA 1QPOA 3KZSA 1ICSA 4CD5A 4HJWA 5H8UA 2MANA 5ENLA 3FJLA 2CBVA 5CJNA 2DZPA 4O53A 2YDRA 4O15A 4IH3A 1HO1A 3THQA 5KTLA 2GQAA 3CLMA 4KF1A 1OC7A 3TQ0A 4L6DA 3ZWSA 3R94A 2DU2A 2WSRA 2DVXA 3E9AA 4DJED 5F1UA 3DU0A 2YLAA 4WY0F 2DZSA 1XLMA 1F4HA 1EEXA 3WDQA 2OEKA 1ISVA 1FP9A 3WBXA 1J9YA 5I0DA 3S9IA 3CAVA 4Y96A 3RR1A 3CUGA 4M82A 1DIDA 5L9FA 2VI0A 4FNSA 5BROA 4B90A 1TQJA 4EACA 3CZEA 2QJGA 3DC0A 1GVQA 4H9ZA 1GOWA 1FXPA 1PKMA 1E5JA 2GFTA 3LU2A 3POHA 3LB0A 5IFPA 2EAWA 2YA1A 3W25A 2P1FA 5I07A 3T07A 2BVYA 2GOKA 4QTGA 3W72A 1VRXA 2OO0A 2C18A 4D2JA 5C6MA 1Q2RA 2OPJA 3UGVA 1Z8AA 1G69A 3GKFA 4F79A 3KEHA 1POJA 1RHCA 2VXNA 3WH9A 4EXBA 2GL5A 2VFFA 4G7EA 4L6HA 1JUEA 1JNEA 3QSRA 3H2EA 4JY8A 2AQVA 3DFQA 3MYOA 3S9ZA 1M01A 4G1KA 1OFEA 2DZXA 3IRDA 3URNA 5DXXA 3V4BA 1GWJA 3FHAA 3AMLA 1RALA 5JH2A 1JCMP 4PUUA 1UD2A 3P67A 1IGSA 4GACA 1ISWA 2CYGA 4LPCA 5I09A 2ZCGA 2DSZA 3DZ1A 4AW7A 5G2HA 3GXMA 2OX4A 1E0UA 4F9DA 1F9CA 4HPNA 4DF2A 4FX7A 2OZ3A 3LG3A 2MUCA 2JFEX 1SMDA 4AXKA 1M1BA 3PG9A 5DY2A 5A8NA 1CI1A 4RJEA 2NX1A 4UQ9A 1O95A 4HU4A 4C65A 3C2VA 2PRLA 4MNLA 4JZ5A 3SRDA 4UUIA 4IIFA 2VFHA 5H8PA 3GUWA 4GCAA 3S2NA 2XISA 1KRMA 4FNQA 4EPKA 1PVNA 3WBYA 4KFPA 3WQFA 5CLWA 1X7IA 1MW0A 4GY0A 3QXBA 4LF1A 2YZRA 1AUSL 1YTKA 3L4VA 4PMUA 3PPGA 4NQ1A 1GQKA 3FSUA 4M1BA 2ZC8A 4O1BA 4IJBA 4QP0A 2I17A 4AD2A 3SGGA 2QPXA 4ERIA 3NQ6A 1A0CA 3HMJG 3UWQA 1F73A 1SMAA 2ZRZA 3MKKA 5C9WA 3NQDA 3LLDA 1I1WA 2C0AA 5I3KA 3EA3A 4CKQA 1R30A 4EXQA 2XM1A 4TX8A 3GTHA 2OLSA 4L1WA 3LRMA 4IMDA 1PKLA 1A47A 2DJXA 2CZVA 1SFSA 3H2CA 1W1YA 4AEOA 1VC4A 1F8MA 1TWWA 1TTQA 2V0TA 2JGYA 4ZO9A 2TODA 4FX8A 2O56A 1LORA 4P61A 1PAMA 4WCJA 3QTPA 1QI0A 2ACSA 4H41A 1UKPA 3CMJA 1EO5A 2FGLA 1MRAA 1O60A 3BLLA 4Z17A 5FL0A 2PODA 1J6PA 2EO7A 3BCFA 1T96A 1Z6KA 2ADAA 4HOZA 1DIOA 2WJDA 1UP3A 1OM0A 4H6QA 3SRKA 5C55A 1C91A 4FNUA 5RUBA 3VD9A 4Q7NA 3E0IA 4LQ1A 4FR1A 4CNPA 3V5FA 3WL1A 3WBEA 4J3ZA 4AZ7A 1WDPA 1C93A 2H90A 3HPAA 1N8IA 4LYPA 4I9AA 3LNMA 2IKIA 1JGIA 3B8IA 4M19A 4H00A 1O4UA 2YCIX 1GOMA 3DYPA 3ALFA 4MLJA 4IGSA 3M0ZA 2BODX 3OYXA 4AZ6A 1THFD 4R53A 3KTXA 3RLHA 3W2UA 4IIDA 3NVDA 4Y6GA 1V02E 4B5UA 1KWGA 1WE5A 2PWGA 3R11A 4QR6A 1C7SA 2FPYA 3K4WA 4IFOA 3N6QA 4IQDA 3OA3A 1NWUA 1TZ7A 4N2YA 3WDJA 3ARUA 4BF9A 3UERA 2YFOA 1RK5A 5AZ1A 4XO6A 3XISA 3PB2A 3RAOA 1XC6A 1NFBA 1PYMA 4IUGA 3ICJA 2WSKA 5CC6A 1IZJA 4NAEA 2PDWA 4U31A 1TPEA 1LWIA 3GDMA 3E5PA 4B5XA 1GVSA 3IIZA 1FCVA 3O7UA 6ALDA 2XIIA 2HVNA 3W86A 4Z2KA 4WJXA 8RUCA 1UD4A 3GIQA 3VGGA 3MANA 1JVNA 1PTDA 3V36A 4YIWA 3D3AA 3SCRA 4I9MA 4IQJA 1H63A 1JRBA 3A9BA 4HHLA 1PS9A 4DBUA 4FLQA 1GHRA 1US0A 1UP2A 4QSHA 4P7LA 5H8MA 5CSSA 3RUBL 4LB3A 3FA5A 5MHBA 1OK6A 1ZJAA 3P0WA 4PUWA 1FCBA 4O54A 2DORA 3NPWA 3HO8A 2OOGA 5CAKA 4GZ7A 1TPC1 3KRSA 3VNIA 3NQ2A 1CENA 3WCZA 3VOGA 3V35A 4MVAA 3NEVA 1A5BA 4NNCA 3UG4A 3DYOA 2XUCA 2W5FA 3M0HA 3FA4A 4BS0A 4UCGA 2VZVA 3APTA 4J3TA 1P0KA 1BTCA 1GZJA 3OBEA 3L12A 3OVGA 3R6IA 3WF4A 4H8UA 3MPGA 1W2VA 1WAWA 2W9MA 5CG7A 4ENLA 1UW9A 1EP3A 3OGVA 3VC5A 1US2A 3UNDA 2J7DA 5D02A 4LS0A 2VCAA 1XIJA 1RBAA 1YE6A 1KC7A 4AZIA 1XPGA 4ML9A 1I0DA 1XGEA 4QAIA 3W6YA 3W37A 2PBOA 2WKLA 3FS2A 4NG3A 3KOYA 3NQFA 1DTUA 3SCQA 3D0CA 3ZJ6A 4DWSC 3B8SA 2Y89A 2LLEA 3P80A 3WQVA 2J9YA 1K3UA 3I7QA 3ZXWA 1XBXA 4GINA 2Q02A 1VP5A 5ABGA 1WXYA 1ZJIA 4FZIA 2CLLA 4MZ8A 4IIBA 4GI9A 4MPKA 4GJIA 3UG8A 2QF7A 4GX8A 2Z28A 3HQPA 1XDLA 4O1EA 2PWHA 3WLNA 1UR9A 1QBBA 3K4DA 3W2MA 1YTEA 2WB5A 3LBOA 1RZMA 1T40A 3CEUA 3LCGA 1RY0A 4QGCA 1O66A 4PC8A 4S3FA 4YXGA 1FH8A 5D2VA 1K8ZA 4QEHA 5FJTA 1EO7A 4PSRA 1Q4NX 3NPXA 1XM3A 1FBAA 1I75A 1CLKA 2D0HA 2W6RA 4RPQA 4UQCA 4S3GA 1M41A 2NWSA 1IF2A 1KRCC 3PBGA 4J3SA 5AYBA 4YTUA 5G2WA 2NV1A 1CXHA 2ZWYA 4YCPA 1H7RA 1UA7A 2GVGA 3W2JA 2D2JA 5CAHA 4MHBA 3ZVIA 1SZGA 5A6BA 1YIXA 4FNPA 3RDKA 3MO7A 5FSDC 3BW2A 4DLFA 1Q66A 1S5MA 3HU7A 4ZXLA 4HIBA 3EX2A 1WV2A 4AXNA 3BXWA 2C19A 4BF5A 1Q7MA 3GVGA 2IQ0A 4DB7A 3XIMA 4H9MA 1HKMA 2GVJA 3W85A 1MW1A 2RHGA 4U2YA 3NIYA 5E9XA 1Z3NA 3GAYA 3VOIA 2W27A 4UTJA 2NUXA 1XIIA 3LY0A 5AB3A 2WMIB 1WZMA 5C0QA 3R43A 5FCZA 2VUNA 4GWEA 4Q8PA 2BDQA 1JCLA 1HGWA 3DC8A 4I7UA 5HWNA 1I45A 4IT1A 2WO5A 2GJXA 2W79A 3UXLA 4ICMA 4X2PA 3WH5A 3CC1A 5LGXA 3TXZA 3N25A 3L65A 4GFSA 2CKSA 4H1ZA 3WSUA 3FVDA 4Y9MA 3CUIA 1TPDA 1QFEA 3VNYA 5I3IA 3BW3A 4RDZA 1JPMA 4LYRA 3BOLA 1S5TA 4HA1A 3SI9A 1SJAA 1H41A 3N9KA 4YTTA 1E0TA 5HINA 3NZRA 3R2GA 4DWSD 2PS2A 1TIWA 1H60A 3G1HA 4S39A 1XP3A 2P10A 1Q3NA 4MKSA 2DQWA 2QAFA 3OZOA 1E71M 1L2UA 4RX0A 2DUAA 3W0KA 4I3GA 2TSYA 3TN5A 3MP3A 4AVFA 3F03K 4P7QA 1RY8A 1TKKA 5E1QA 1EX1A 1UPMB 3SN1A 3Q45A 3F5JA 2WJFA 3ABQA 3N2BA 1HO4A 4DWDA 5TAOA 1LZOA 1F07A 1VB9A 4XTIA 4AEFA 1VH7A 4WJ8A 3PFMA 4FLOA 1YBQA 1UYQA 1DP0A 2O0TA 2WPBA 4B5WA 3GC5A 3ZM8A 3GG7A 4LUSA 4H9XA 4FXJA 2NX9A 4WOZA 3IUIA 1N2VA 2DY3A 2NQLA 4B4FA 2FB2A 3WEOA 1TPUA 1NH6A 3W4RA 4ZQMA 1V6TA 2EPKX 5A2BA 2QIIA 5F2GA 5D03A 4J2PA 3BCDA 5A6MA 4Y9NA 4GZJA 5H6HA 3QSTA 1BXNA 1AW1A 2WXDM 4F40A 5M3WA 2NQJA 1JAKA 1OFPA 3KWSA 3GFXA 4FF7A 3TMQA 1PX8A 4WRHA 1S1PA 3C2YA 3CQHA 1MSSA 3BO9A 1UKTA 3KM8A 6REQB 2CIPA 5KZEA 1WUFA 2XINA 2QMKA 1J0ZA 3B4UA 2ALRA 4WZHA 1QT1A 5EMJA 3R8GA 4UFIA 3QQ0A 1W1B1 2B0MA 1L9WA 1KBBA 2OO6A 3W53A 3GNPA 4F2TA 3HPXA 1UOKA 1R3RA 2W62A 2AL1A 4E4FA 1VHNA 4NXSA 4FXSA 4LVDA 3T78A 1UZDA 1KFWA 3LN3A 3QKZA 1VFSA 1KM0A 4UR8A 3N18A 4JD4A 4BQ5A 2A7RA 3W07A 3JVAA 2A6NA 3ZZ1A 1ODUA 4I5RA 4DQWA 3LERA 4ZOAA 2IQDA 3B9AA 3L0KA 3W75A 2FZDA 1WDRA 1SGJA 3VKBA 4JYFA 3MHUA 1NDYA 4DPPA 7XIMA 3SGZA 1EHNA 3WMBA 4DAIA 3R8HA 4UNIA 3TFCA 2BXYA 4O1FA 2CLFA 1EB3A 2PU1A 3IVSA 4J5NA 4FHAA 3EDDA 1Z89A 5I77A 1YDYA 1NWTA 2AOSA 1W3LA 3AOFA 2CHRA 3EOEA 4K37A 1TMHA 2FDSA 4KWVA 3RX4A 1K6WA 4KCTA 1PB0A 5A6LA 4J9JA 3PR2A 4RPPA 3TSMA 2HVMA 2UWFA 3U3HA 1FHUA 5LIUX 1XYZA 8XIMA 1TZZA 3YPIA 3I7RA 2F84A 4F0RA 4PA8A 3HGJA 2BY1A 1XSIA 1QXLA 4CU7A 1W1ZA 4FB7A 2WJEA 3UWZA 2VMFA 3AXMA 2J7BA 3VCCA 2PPGA 1TMLA 1DJZA 4L9ZA 2OSWA 3NQBA 4S38A 1EA0A 2XSBA 3T0CA 1CBGA 4DXVA 3CWHA 5I3FA 4UTWA 2DT3A 1TWSA 3JRKA 4HTYA 4CD4A 1BTMA 3VNZA 4HMEA 1W1TA 1UA3A 5CBBA 4LBUA 4PUNA 1G4PA 4OKDA 5BYWA 2HQAA 1RBLA 3M5ZA 3S3GA 1MW2A 2VDGA 3A24A 3ITVA 1E3XA 3CV6A 2WVUA 3S5ZA 4W7WA 2E6DA 4JFWA 3W24A 4AZHA 3A3HA 1UC5A 4V28A 3TFXA 3G8EA 3QGVA 3RMEA 2HZGA 3IGUA 1UH2A 4KWUA 4KCUA 1QHZA 3UCCA 5HNNA 3B8TA 1ZAJA 4FPSA 2VKZG 5HMDA 1IEWA 2J8TA 4PMQA 4G6CA 3KL0A 3KVLA 3QGKC 1DKWA 3T8QA 4GJJA 1OYAA 4JTUA 2ZIDA 1B0IA 2HTMA 4BQ2A 1ZNNA 2C13A 3W1XA 4G7FA 1QI2A 4IMGA 2CU0A 4QFUA 1XW8A 4LANA 4R7OA 3Q2DA 1OB0A 2X40A 2OMAA 3AO0A 3PBWA 3QV9A 3N2MA 5H91A 1ESWA 1LQ2A 4V1XA 1DQUA 3CQ0A 3MHGA 1XYBA 2R82A 3HGSA 1TRDA 3UCQA 3NTYA 5SWUA 4X22A 5FESA 1HX0A 4NL1A 3TA9A 2YCEA 5FIPA 5CC3A 4GA8A 3TYCA 3C6CA 5LSMA 4XKYA 3U4AA 1W0MA 2MNRA 4F4RA 1LOLA 5DRCA 3RO6A 4EXAA 1XFCA 3WLRA 2DGAA 3IK4A 4XIAA 3MW7A 1TIMA 2ZVRA 5B7ZA 1PBGA 2R14A 2FGZA 4L9XA 3KOFA 1RJQA 3WQOA 1KWKA 2OSXA 3PN8A 2HPIA 1ZBVA 4DUWA 3L4UA 2X41A 5F4SA 3VOCA 3QW4B 4X63A 3REQA 4PMVA 2B31A 1PWLA 3MB9A 1IT0A 2VM8A 4JY9A 2H3DA 2W61A 4A3UA 4JQ4A 3FYYA 4O17A 4JS3A 2PDUA 4UTUA 3VIFA 3NAVA 4KS0A 1V3JA 1V6YA 2PSNA 4BR1A 4IP4A 1H61A 3MO4A 4D6EA 1EZWA 3IGSA 3S2LA 2P88A 3O07A 2R1MA 2JF7A 4GHRA 1R9XA 3M41A 5D30A 3UEQA 4PFMA 1Z42A 2Q71A 5C2GA 3LSCA 1NF0A 3ARZA 3BDKA 2GGGA 3UPMA 4D71A 3MHFA 4MY1A 1H5VA 2XTKA 2W67A 4PMXA 5HNRA 2HS6A 4XZWA 4LV9A 2DZVA 3M0MA 4HN8A 4JTLA 4NAFB 4P8VA 2FTYA 2X16A 4L61A 3W6LA 3M0VA 5C9UA 4PSPA 1J0IA 1LUCA 3PM6A 2Z27A 3EB4A 3U6WA 3BAKA 3S5SA 2GJLA 1S3TC 2GJRA 1MDLA 3RM4A 5KZDA 1E1EA 2BHZA 3GNXA 4ZB5A 3GXPA 3W2KA 2AKMA 3NEHA 2X09A 1UUMA 1HVQA 4LF2A 1UG6A 2Z1SA 4V15A 2FPTA 4MOZA 3NQCA 2PDMA 3W7KA 2NSXA 4O12A 4XD6A 2E5BA 4LRSA 1DXFA 4N9BA 3A3XA 2CETA 1TFVA 3L5MA 4KESA 4H04A 4WSHA 3QC3A 3E2SA 3V5OA 1GW9A 3VDHA 1J0HA 4AISA 2XDFA 1CXFA 1NEYA 7TAAA 2V5KA 4UTFA 1K9DA 1GUVA 3A13A 1GQIA 1KM6A 1W1IE 1QNPA 1F3WA 4HPGA 4H8NA 1FCQA 3BJFA 4MB4A 4GY1A 5D9OA 3H23A 1QNOA 2CITA 4REQA 3RCYA 1JZ8A 4ZMGA 4N6EA 3SBFA 4LJ3A 4KETA 2Q3OA 2WVVA 4QDWA 3VVGA 4LS2A 1P1XA 1R87A 3FAXA 5JVLA 1J10A 1QI5A 2WSQA 4EVZA 5K4XA 1GNXA 3G77A 3EWZA 1M7OA 2O9RA 3EDFA 4RL3A 5AC5A 4D72A 2DUZA 3MP4A 3KTSA 4DO5A 2QGHA 3LCFA 1I2OA 3I65A 3WF3A 1V6VA 4FOUA 2X1SA 3FW6A 4ZTYA 1JIBA 5C9XA 1E70M 3GRIA 3LHUA 4C1KA 3U4FA 3CAWA 2A7NA 2A21A 1ALDA 2YJQA 3JS3A 4N4PA 5JMUA 2OG9A 1XPYA 3T1GA 4A3RA 1F3XA 3H7UA 5HNTA 3Q4DA 4AY1A 3QOKA 1JUKA 2F8QA 1CGTA 1ISXA 3E0WA 4UTMA 3Q94A 5CGMA 4KCVA 4E3VA 2FZ9A 2JEQA 2O4MA 1H0GA 1LCOA 1KXHA 4CNTA 4GVHA 1G94A 3HURA 3ECQA 1ADSA 4MUPA 3M0JA 1RH9A 4PH6A 1X1ZA 2ZZ4A 4O8RA 1C92A 4UC5A 4X60A 4A8LA 5CPTA 1FWSA 1DEDA 3WO8A 4NAFA 1EOMA 3U9IA 1HVXA 1Y7VA 4ZL1A 2C6QA 2OGJA 1E55A 4IP5A 2VVSA 1XIDA 3H12A 2FFIA 5LNWA 5AKQA 1XBYA 3TX9A 2WMFA 2VHLA 1CLXA 1JI1A 3V5CA 1TSIA 2I5GA 2J25A 5I79A 4URIA 2INEA 1T41A 4MPQA 1VZWA 2WK2A 2YOCA 3WF2A 2QPSA 2FZNA 1YDVA 5T9CE 1ZSXA 2ON3A 1SO3A 1BRLB 4XAGA 3G1VA 2JKPA 4WDWA 3TUUA 4CEUC 1MUCA 4L9YA 4LSBA 4A3QA 5CPMA 4A4AA 3UD6A 1D3GA 1SJCA 2PP0A 4EX4A 1V3IA 1E3ZA 1P4CA 3BOFA 4E0CA 1TJ2A 1MNZA 3NQAA 4IIEA 3C2RA 3PJWA 4D6GA 4M81A 4DWSA 3MSDA 3UW6A 3UWWA 3BG5A 1EIBA 3HV9A 3BLPX 1XLBA 1OYCA 3WYZA 1GOXA 4XG1A 2CLKA 1CB7B 1PHWA 2OZ0A 1HJSA 3B0XA 3ZLFA 4B9YA 3SEPA 3CB8A 1RV8A 2CNCA 3BICA 4Q8TA 1CGVA 3W7QA 5T91A 2G8ZA 3VD7A 4OBRA 1LTDA 2Q8XA 4A22A 1A3HA 4PR4A 4RE0A 2W92A 5CG0A 3AZSA 5EYWA 1OT1A 1LQ0A 2VL4A 3MI3A 4HD5A 2E09A 1VBJA 3NDZA 1Q7QA 1O5RA 3VGBA 3IIPA 1GOOA 2Y7DA 3TC7A 5LHFA 3NM1A 1PKYA 5HAOA 4E8CA 1KNWA 1XH2A 2FH6A 3LUTA 1UP0A 4DJDC 4HZ8A 4PEEA 1Q6RA 2C14A 1T6MA 5IM51 3I4EA 2BGSA 1XX1A 1Z9AA 2I9EA 5A6JA 3C61A 2VC7A 2A3CA 1QBAA 4IP7A 1MW3A 3VNJA 4JQ3A 2OEMA 3W1NA 1W9VA 1P7TA 3PTKA 4PB5A 3M5VA 5D38A 3ALGA 4IZGA 3QW3A 1EWDA 2EJAA 4YCOA 2DH3A 1OC5A 1NU5A 5L6UA 4HNVA 8A3HA 1RBOB 5CSUA 1B9ZA 4UNKA 1E5NA 4O1AA 1ZZMA 2E1WA 4X2RA 2QR6A 4RZ6A 3W74A 1D7FA 1EDQA 1UPPA 4A2SA 3KRBA 3RX3A 4W86A 1QO2A 5JBFA 3OO2A 3UETA 1LUCB 1R38A 2VDIA 1L8PA 2EPNA 1QW7A 2ZUSA 3LGGA 3M9YA 1W8SA 1K8YA 1U2YA 1GJPA 2GVEA 4JN7A 2GDQA 4ASTA 2Z1WA 1FWDC 2QCMA 3S2CA 1C90A 3UZXA 2DZBA 1YLVA 1Z44A 3QN3A 2UZ9A 4S23A 5D8ZA 3CYJA 4CD6A 4JAWA 1W5NA 2A5HA 3TQKA 3AICA 5CSRA 4JQ2A 1E73M 2X2YA 5G1MA 1X97A 3EWDA 2QVHA 4YS1A 1V7AA 2C1GA 4AZCB 4ES4A 2YIHA 3U7VA 4RZ5A 3O6DA 4LOCA 3W7EA 1RCXB 4K38A 1RCQA 1ZHAA 3MY9A 3U5UA 2PDYA 3EMZA 4ZB2A 3OIHA 2VWSA 2XIJA 5I23A 4ROQA 1U5HA 3GG0A 3P0XA 2TMDA 4JICA 8TIMA 1B1YA 3VC6A 2VWTA 3LXAA 1GZGA 1EHAA 1R2TA 3QV7A 5HPOA 4WR3A 2A0NA 3CK5A 3NQEA 1JL8A 5CKSA 1AMYA 1ECEA 2G4FA 4MAZA 4OV4A 3VO0A 1X6UA 1Z41A 4ADTA 3W7LA 1OCNA 4AD4A 2E9BA 2VC6A 1XD1A 1S46A 1MEHA 1FVPA 1NFGA 2PBGA 4GQGA 4IMFA 5CC5A 3BANA 4ZO8A 2J24A 3TEVA 3A4XA 5DRIA 4DBWA 4Q8WA 3RLGA 4DBEA 5A3HA 4H8HA 2H6RA 2Y8UA 3KXQA 4IPPA 1KXVA 4LVBA 3NGFA 3DXIA 3NPVA 5D4YA 3TE9A 4LBRA 3MTWA 2UY3A 4LY8A 1AVAA 1MFVA 1CGWA 1QHOA 1N8WA 3STFA 3IV8A 4RV8A 1GONA 3T2QA 3TN6A 1UR2A 3PBYA 4DUVA 2OXNA 3S4TA 1BRLA 1ZP3A 2QAPA 2O4QA 2GK1B 2PMQA 1UR8A 5DT5A 4Z1DA 1VFMA 1OD8A 2RKXA 4XUYA 4A8IA 4PMNA 1J4EA 3MA8A 2R1KA 3CQKA 4JHMA 3KVJA 2WNNA 3PSWA 4M7TA 1GJWA 3ZWTA 1S3HA 3FEMA 3H2MA 3AHZA 2FMOA 4MWAE 3VIJA 4GPNA 1C29A 3CIVA 3KLLA 4IHCA 3HFYA 5CGTA 4Z2HA 3B0PA 3G22A 4W5UA 1V8EA 5BZAA 5DEZA 2ACUA 1VKFA 2QCDA 3GU1A 4J2MA 2FFCA 4F3HA 3IJLA 3W7GA 4RDYA 3P74A 1FKWA 4AX6A 1FWBC 3UR5A 1V02A 1WKFA 3GR7A 3TC3A 4KWWA 2WNWA 1XICA 1SZFA 1TCDA 3CL8A 2G0WA 3R58A 3PWGA 4UQAA 4KMQA 5GNXA 4AD0A 3W1AA 4MWAB 4QJ4B 2E6AA 5FF7A 2PF0A 1FWAC 4ALDA 2ACRA 2CEQA 4HNLA 3TTSA 3MDUA 1JEZA 5LKYA 4S2CA 2XVKA 5HUOA 2GDVA 7PTDA 4IMEA 1BQGA 4JQ1A 1BVWA 5HOSA 3S46A 2PRMA 3M0KA 3VU2A 4JCMA 3BLOA 2Z0IA 4EANA 3LX9A 3N14A 1TWIA 4H2HA 4E3TA 1W9XA 2CKRA 4D6JA 2A6LA 2F2KA 4QROA 5XIMA 5FA5A 1TPH1 2BOGX 2VQUA 5CZKA 4AAJA 4JNMA 1WDDA 3GZ3A 3V1HA 4PL2A 2ZBTA 4L7ZA 1LRQA 4GFIA 2J79A 3WUBA 4D8AA 5BRQA 4IJCA 1K70A 1XRSA 4G1NA 4ATDA 4ZOCA 3HQOA 4CQ8A 1Q4WA 3RRAA 4YVVA 4IQLA 3B40A 5D8WA 4NZ5A 3L66A 4Z0SA 3UESA 3F2DA 5D2XA 1F4AA 2XWEA 4XD5A 2B81A 3WDHA 1EOKA 1E0WA 1A49A 5HR7A 1H1ZA 5C70A 3CHCA 1WA3A 1H7WA 3H4WA 4GISA 3HPZA 3SFKA 1GVRA 2Z6JA 2OLAA 3QMSA 1O12A 1GW1A 1D2KA 1VBGA 2A1YA 4US5A 3SECA 3L4XA 1R47A 1S2AA 2HK0A 3VK5A 4KIEA 4I5UA 4MYXA 5FF2A 4AIOA 3QLDA 4MB3A 4NILA 2VENA 3WFLA 4H7VA 4GKTA 3F7JA 1QO5A 2E6YA 1YXCA 3BLKA 3S2MA 1IZCA 3SR7A 4IOTA 4K68A 3PBUA 3L2MA 1K1DA 3TTYA 4A21A 4ERGA 3NR0A 2YCLB 1UUQA 3UPBA 2O55A 5HULA 3H2NA 3CNYA 5DMYA 4MWAA 3TLQA 5F7UA 1V0MA 3IUDA 1T0OA 3TYZA 3WL0A 4HVXA 4B4HA 2GWNA 3CIWA 1QNQA 2YGYA 3WLKX 1B2YA 1XI3A 4FP1A 1JZ3A 3TIMA 3TWAA 3M0IA 4HCHA 3A64A 3LLFA 1I9CB 3PP7A 2OJPA 3W70A 4GO8A 4XZMX 2V81A 1CX9A 1E1CA 3NO5A 4L80A 1ZAIA 2DP3A 3KWXA 3WQPA 2PDGA 3H4GA 3EPNA 1ZUAX 3WJSA 3PJUA 3SGUA 4RE3A 5I24A 1JFXA 3UP8A 5JXQA 1VCGA 2Y8VA 3FJNA 3W1UA 3GXFA 3OGSA 4AD5A 3HG3A 2J77A 3GM8A 2TRSA 1LP6A 1UD3A 3N6JA 3V7PA 1MXDA 4HSOA 4WKFA 3WDPP 1B3VA 4N4QA 1M5WA 5GNZA 1G4EA 2QJIA 2D2GA 2E5CA 4OIFA 3UT0A 4Q33A 4RXFA 3N4AA 2VC9A 9XIMA 1SPQA 1VFLA 1XCWA 1HUVA 3P8IA 3T0AA 2V3EA 3E0VA 3RR4A 1L8NA 4DWSB 1BPLB 3U2ZA 4HSNA 3LRKA 4MNKA 4MJ2A 2Z24A 1FDJA 5D2YA 1CGUA 3IPWA 2J66A 1T8XA 3TTQA 4ACZB 1EJSC 2RDUA 2RUSA 4RW3A 4BWLA 5CJMA 1R2SA 3THUA 1V0NA 3M4HA 3CZJA 1AH4A 1ZENA 2VNCA 1WXJA 1HL9A 1E15A 1NARA 1ZAHA 4A2RA 4G7EB 1XHGA 3ZJ8A 1TZ9A 2VELA 1Q63A 3GE7A 4AYSA 4GJ1A 1EXBA 5CJ5A 3INPA 4IPLA 4JTKA 1L6SA 2RH9A 2P53A 4FS9A 6REQA 4C7DA 3FDKA 3L23A 3EWCA 3KL5A 2QVNA 3FEQA 1FH9A 4D1IA 1VYRA 1HP5A 3T81A 4KW2A 3BV4A 4KIRA 2WHMA 5AYIA 3OQ8A 3WLIA 3H53A 3UY8A 2PE4A 4M7SA 4RNFA 4Y9AA 4PZVA 2B4GA 2G96A 4Q4OA 1MQPA 2A2IA 4DJEA 3KTCA 1QATA 4LU0A 3T8LA 6ENLA 3NXLA 2G3FA 4Z2IA 5C9RA 3TYEA 3OLEA 4GE8A 1CECA 3MC5A 4KRTA 1KBKA 3LQGA 3IJ7A 5GNYA 3UZJA 2PWFA 1LBLA 3N34A 4H19A 2PTZA 3ONCA 3P60A 2V63A 1EPVA 1I0BA 3M7SA 3DHUA 4HPJA 2FZMA 3LA4A 3NGJA 3M0XA 1QI3A 3WQ5A 2OGYA 3NL6A 5FJUA 3P7YA 2J8GA 3WNPA 5EMUA 2ZWZA 3VINA 2NQHA 1G9HA 2PD5A 3W71A 4Z1YA 2OR2A 2BHYA 4L1XA 5BXRA 3ZO9A 1ADOA 1KXQA 4AU0A 3PZOA 3AHVA 1TV2A 2W66A 3SO7A 4LVFA 1JXKA 3WNLA 1W3NA 1YHTA 2J6VA 3B9EA 1EYWA 3SM0A 5JBEA 1O68A 2WWCA 1K03A 1B4KA 1UCWA 3TYDA 1C9DA 4D8ZA 1V4YA 4W5ZA 1QVBA 3L68A 4REQB 2GJXB 1YRRA 2IPWA 2BP1A 6CGTA 1EJWC 2D23A 2IW0A 3R5EA 4DYJA 4GC4A 1CIUA 1HL8A 2H8ZA 2R1PA 3BGAA 4AEEA 3AHTA 4PMOA 2WC4A 1GKPA 2DW6A 3CO4A 5JBDA 4O18A 5GVJA 1TPFA 4JFVA 1DTNA 1H51A 4TU1A 3C3UA 2ISSA 2QUUA 1MUMA 3GVWA 3LBCA 2HROA 3UYCA 4B3KA 3MV01 3I6TA 1QWKA 5MF5A 3U7BA 3PJXA 3WQEA 2YL8A 2A3HA 1C8VA 2HS8A 3CMGA 2ZZ1A 4LH8A 4B2DD 1FFRA 2XVGA 2FH8A 4GXPA 4W93A 2VOTA 7TIMA 1QHPA 1XUUA 5BRPA 2PWEA 4J40A 4C6EA 1ICPA 1VPXA 4J4KA 4DIAA 8XIAA 3IJQA 2WANA 4MNJA 1AQ0A 5C2CA 3BW4A 1U5JA 2X05A 2OKOA 3TC6A 1RD6A 1CXKA 5KZ6A 5CSYA 3LI0A 4CN1A 3FSTA 1NIUA 2HEJA 4RXGA 2HCVA 1KO0A 3PZNA 5AOUA 5FEPA 3IK2A 3KP1A 1XH1A 1U1UA 2Y7FA 3A21A 3AYTA 1S5VA 1LL6A 1XYMA 4Q7BA 3USBA 4RE2A 1IZKA 4UXDA 4JYDA 4UTIA 4NF7A 1GYLA 3VPLA 1JD9A 3L4ZA 4CCCA 1TV4A 4U28A 1IXOA 1EP1A 4J3WA 3VFLA 3HA1A 3H2OA 2QT3A 3H8AA 1FFQA 3WQ4A 1G0CA 2WM0A 3PWAA 5I06A 4P7RA 4K1GA 3W7JA 3UCDA 3OU8A 3NZPA 3AXIA 4HNTA 3ABSA 4TV6A 4CQ9A 4ZR8A 2J7GA 2V38A 3GHTA 1NSJA 5HJXA 2CZDA 4G5DA 3T40A 5HMFA 1B90A 4MDOA 1RR2A 1VLWA 1AJ2A 1KFJA 3VKDA 3NQMA 3TP4A 3PG8A 1IV8A 5HQLA 2VR2A 4PCTA 3VD3A 1R9YA 1IWPA 4F0KA 4LAOA 1XSKA 4JHZA 1AQFA 2PTDA 3I10A 3RITA 5TNVA 3DGBA 4HP5A 5EMLA 4CD7A 3CLWA 3T7VA 2QJHA 3NG3A 2E1DA 4FOKA 1XRTA 3BG9A 4ZOBA 3CUJA 1L0PA 2QDHA 4M6QA 2QDEA 1TPB1 3VX0A 2VFDA 2VT0A 4IICA 5DN1A 2CBUA 1LL7A 3BH4A 4WSJA 1WNOA 3WEMA 1EUNA 5AC4A 3TU9A 3ZR6A 4UR7A 1UZHA 1EC9A 3VILA 2XIBA 1RLCL 1W5MA 5LGZA 1PTGA 2BY2A 3Q58A 3QTGA 4MB5A 3VI2A 3AZRA 3EOUA 2Q01A 3GR8A 4UB9A 3SFWA 2BZNA 2I7GA 2GSHA 2POTA 4EP8C 1W37A 1YNYA 3G1SA 3SDOA 3E2VA 4GI8A 4JTQA 2QCCA 1ZBWA 1JZ6A 1H49A 1A4LA 4OBSA 3GTNA 2VEMA 3TR9A 3H22A 3N9RA 4AVNA 4US6A 4W7UA 3P5ZA 1EJTC 1J0JA 4EK7A 2Y0FA 4IX2A 1V3MA 3ANVA 5FJJA 3IGXA 3VM7A 4GH1A 1HW6A 2OQLA 4Q8QA 3HGRA 3UG5A 1S2WA 2X1TA 3P3BA 3GNOA 3GVRA 3W1LA 4S3AA 5J5RA 3F5KA 2R91A 1W3IA 4WOQA 1AQMA 1W1VA 6PTDA 4ZCWA 2NXGA 3WQGA 5EFFA 4GABA 3PZGA 3S5OA 1E4LA 2ICSA 1PV8A 5I02A 4CLMA 3SZ8A 5FAGA 2A3EA 3LTYA 2Z1KA 2ZXAA 1JULA 2BV9A 3BLIA 3U2EA 5A6KA 1V6XA 3EWYA 3SN0A 1RVKA 4UTLA 1V6UA 4MAVA 2Y85A 3CT7A 5G4EA 5HUPA 4K36A 3LENA 4HJFA 1GVIA 1B3XA 5KINA 1XXXA 3NVTA 3QMTA 4YTSA 2YDSA 1JYVA 1LQAA 1PPIA 2D1ZA 1TV7A 3F4DA 5FJPA 3AFBA 3PUGA 2WV8A 1RQHA 4O14A 4HOXA 4GBDA 1XLDA 4AZBA 3XINA 3D47A 4GUJA 4F9JA 2NX3A 4RNJA 1W5QA 2NLYA 2R9RA 1IR1A 3SUTA 1XGZA 4GYPA 3DDMA 4IG2B 3VUPA 2WM1A 4LWWA 1IYXA 1QW8A 2XN1A 4CNSA 3P5YA 4ICNA 3O6CA 4PTWA 4GIRA 1XG3A 4CGTA 4H9VA 2ATSA 1X8FA 1ZLPA 3TKFA 3UA4A 4XISA 2DIKA 1ZGDA 4QLKA 2XH2A 3T2PA 5AZ0A 1PTAA 4UZUA 4WDUA 4F0SA 1UH3A 3E2RA 3CZGA 2E0PA 3M16A 2XVPA 2VZOA 3KVKA 2TYSA 1NQ6A 2HBVA 3RCNA 1XRVA 2ZDSA 2L5HA 2VTFA 3GU2A 3WQ6A 4WK9A 3AJ7A 1JDEA 1RXOB 3T9PA 3F2CA 1A0DA 5EMKA 3NL5A 5CGQA 3PZVA 3EWXA 4C6JA 3K13A 4A8RA 5A8GA 1OFAA 2GJPA 1KCLA 1F3EA 1OY0A 4QEEA 3K46A 3GU9A 4Z2GA 1Y65A 1OWQA 2QF8A 4I8DA 4PRWA 3PAJA 3TW6A 5G1TA 2XGBA 1BWLA 1G67A 3AWNA 3CPGA 1KTCA 3VNLA 1CXIA 2Y5EA 2VEIA 1KR1A 2PUZA 1UZ4A 3LSBA 4PTMA 1DHKA 1XIHA 1EQCA 1GGOA 1DXIA 2CPUA 1XFBA 2Y8KA 2WQPA 4LVAA 3ZIZA 3PC0A 2PLJA 4O52A 2DZAA 4JL1A 4K8EA 1MXSA 3DEQA 4AB4A 3WN6A 3SCOA 1AQHA 1U5VA 4H3DA 3AALA 3LGEA 2IS7A 4X9SA 1JDFA 3K8MA 5AFDA 5DY3A 4F48A 3HB9A 4HSHA 2PC8A 5J04A 2OU4A 2WOQA 3K2GA 3SSJA 3D46A 1J2WA 1J6OA 1RSCA 3BOXA 3I6EA 3VA8A 4XKMA 1NDZA 5LIWX 3GG8A 3CTLA 3MI6A 3GSMA 2B7QA 1RUSA 3OBKA 1E4NA 3SB0A 2V5LA 3AS0A 7ENLA 3K1DA 4KT2A 4LRTA 1DWAM 5LYRA 2PGEA 2WZHA 2NV2A 2YCLA 1AW5A 3URQA 4NI8A 1BLIA 3CL6A 4UQDA 2RJHA 3AMKA 1G01A 1TTPA 4JFTA 4HZMA 4HYWA 1SVDA 2D3NA 3SCUA 1G5AA 3VCRA 2VR5A 2WSPA 4C7FA 2DSUA 3NYDA 3TJLA 3EDEA 4J27A 4M1RA 3W1TA 2PZ0A 1JZ5A 4JIQA 3N12A 2B7NA 3V75A 2C91A