4AF0A

Crystal structure of cryptococcal inosine monophosphate dehydrogenase
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
522
structure length
395
Chain Sequence
TNPNAPPRPDSLLNPSDALKHLEEYPRGDGLSLQELMDSRKNGGLTYNDFLVLPGHINFPASDVSLQSKATKNIVLNTPFLSSPMDTVTEDRMAIALALHGGLGIIHHNCSAEEQAAMVRRVKKYENYPYASKVPESKQLYCGAAIGTRPGDKDRLKLLAEAGLDVVVLDSSQGNSVYQIEFIKWIKQTYPKIDVIAGNVVTREQAAQLIAAGADGLRIGMGSGSICITQEVMAVGRPQGTAVYAVAEFASRFGIPCIADGGIGNIGHIAKALALGASAVMMGGLLAGTTESPGEYFYHEGKRVKVYRGMGSIEAMEHTGLDNAATARYFSEADAVKVAQGVSGDVADKGSINKFVPYLFTGLQHSLQDAAIKSVSELHSCARSGSLRFELRTAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
publication title De Novo GTP Biosynthesis is Critical for Virulence of the Fungal Pathogen Cryptococcus Neoformans
pubmed doi rcsb
source organism Cryptococcus neoformans
molecule tags Oxidoreductase
total genus 123
structure length 395
sequence length 522
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2012-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4af0A00
1H51A 3C2FA 3IVSA 1FUYA 4WQ6A 3UY7A 1AK5A 3UQNA 4M6VA 4NXSA 4QITA 1X1OA 3O16A 4KKXA 3CU2A 4MFDA 2Y7EA 3ZWSA 5DELA 2ZA2A 2FDSA 2NV1A 2Q3OA 1W5QA 4FNQA 3WJZA 3NG3A 3NNTA 4JD4A 1TPC1 4OU1A 1TV7A 1RD5A 1N8FA 5AB3A 1KM0A 2Q8LA 2A21A 4O28A 4JTTA 3W3OA 4I9AA 4K6AA 4L4MA 4IPJA 3P80A 3NQEA 3NQFA 1QMLA 4A2RA 3G1VA 3WJYA 4RXFA 2QCHA 3KRZA 5HINA 3NZRA 3KVJA 3N3MA 3CQ0A 2HSAA 1G7UA 1SFJA 3PG8A 4RKAA 3GDTA 3SECA 1HUVA 3TFCA 4N9DA 2DU2A 1K03A 2HTMA 1GEQA 1K8XA 3NM3A 2NX9A 3ABQA 3CWOX 1DORA 4ZMGA 4DO6A 1EPXA 2VFFA 1VJIA 5H2ZA 2H3DA 3KVMA 5FF4A 2VFEA 3HQ1A 3OVPA 1JRCA 1DV7A 2CLHA 3I7QA 2C16A 1RQBA 1R2TA 1WYIA 1FXPA 5HWJA 3S42A 4TMCA 2E6DA 4MLRA 4GUHA 1FX6A 2VXNA 3LCXA 2X2GA 4UFIA 1EIXA 4FB7A 2JBMA 3HPXA 4MZYA 3PB2A 2ISWA 2X30A 2GVGA 2C3ZA 2NX3A 1GZGA 3QW4B 5D2VA 4KFOA 1OVDA 2ZRUA 4RJEA 2VFHA 3O07A 4MFEA 3V75A 1X1ZA 3O15A 3UXDA 4ZZ9A 3G1DA 5D09A 4ADSA 5H91A 3QMTA 1GG1A 3DHFA 4NX5A 3TW6A 2RH9A 2V8ZA 1ME7A 3W7LA 4OBTA 5G1TA 1G4SA 3WK2A 3N9SA 3SFKA 1KA9F 3HMJG 2V81A 3NQAA 1XCFA 3NA8A 1TPUA 5D02A 4LWWA 1L2UA 2J9ZA 5CPMA 1U83A 2I1OA 3QF0A 2YX0A 3W9ZA 3S5ZA 3G1XA 3THAA 2A5HA 4ZL1A 4HPXA 4CCEA 3ATZA 2TRSA 4RLIA 4WOQA 1OFOA 4IMGA 2GVLA 2QCLA 3JR2A 4CQ9A 1C9DA 3OHIA 1W1ZA 3W7RA 5MHBA 1LRQA 4YXGA 4MY9A 5F2LA 3LV5A 3EB2A 2FB3A 1Z41A 5FF7A 1IIHA 4AXKA 3W87A 3NDOA 1VCVA 5U7SA 5C55A 1R47A 2XFWA 3A21A 4GC4A 1ZENA 2EGZA 3Q94A 5K2ZA 3IV3A 1DVJA 1Q6OA 4CNNA 3GX9A 4WXZA 1K3UA 3WJSA 4MUZA 1W56A 2JKPA 3MI3A 3BARA 4Z0JA 1F05A 1Z44A 4UNLA 1X7FA 5ABTA 4FF7A 1M6JA 3EWBX 4FO4A 2V2CA 2C1HA 3W2UA 1K02A 4R7JA 2QUTA 2V82A 4H3DA 2RDUA 3MWAA 1VS1A 3TC6A 4I7WA 4WJEA 5I3JA 2GOUA 1VR6A 1PV8A 2XN1A 2CLEA 1XM3A 1QOQA 2QJGA 3W1TA 1KLYA 5GVJA 4AWTA 2ZZ3A 5AYYA 1JVNA 3G1FA 1LZOA 3HPSA 3FKRA 2O7SA 5DXXA 4WUIA 1H50A 1A5SA 4AAJA 4JY9A 1YXCA 2GPTA 3EEGA 3CC1A 4W9TA 3OIXA 4O53A 3S6DA 2OT0A 4N4PA 4DO4A 4XKYA 3UXAA 2ZYFA 5TIMA 4OQVA 4TIMA 4LW7A 2VOMA 1ICQA 1HO1A 5D04C 4GFSA 3NM1A 1EEPA 4E38A 1W54A 3W1XA 5BMWA 4MYXA 3SW6A 3OA3A 5HUPA 3C2OA 1JQVA 1LORA 3EWUA 4Z0SA 5D33A 3EKZA 1GVRA 4ZVJA 1OX5A 4LS2A 3W7KA 1KM5A 3ZR4A 2R94A 4HN4A 4S1FA 1A50A 3LXBA 1FQ0A 3W1LA 2ZZ1A 5DN1A 5TQLA 3VKJA 4TMBA 3C3NA 3QYQA 1FWSA 1C8VA 3PSVA 2NV2A 1XBYA 4OV4A 4MIMA 4O1DA 3PUDA 4AHPA 3KVLA 2I14A 4P61A 1ZAJA 3QPYA 1P0KA 1Q6QA 4O1AA 1X8FA 4O1CA 2Z1BA 4FEZA 4Y8FA 3ZFHA 3LBMA 5IBXA 4CLMA 4OT7A 1CI1A 5EYWA 3BW3A 2J24A 1RQEA 4NJIA 5IBXC 3PBVA 4RZ5A 5EBUA 2QAPA 1VH7A 3CTLA 1AW2A 4K8HA 1B57A 1GVQA 3TJXA 1R2SA 5D38A 4BF9A 4AWUA 3M5ZA 3W2JA 4LT9A 3MHUA 5DBUA 3NAVA 4TO8A 3GXNA 4AB4A 3GB6A 1ZALA 2B7PA 4PFMA 2QR6A 3PBUA 2J9YA 2QUUA 1UB3A 3I65A 2ZZ2A 4S2CA 2R91A 3W22A 5C54A 1NFBA 1ADOA 2YSWA 3R2GA 3KRUA 4JGDA 1JUBA 2FB2A 1IGSA 4S2BA 2JGQA 3VFLA 1P0NA 3W70A 3DKJA 5CZTA 3NL3A 3Q58A 3NQDA 3GDMA 3GAKA 2VENA 2CU0A 4XKYB 3CLMA 1TPWA 4ZQPA 4MJZA 1XBVA 4MYAA 3F4NA 3GDKA 4WY0A 4K8EA 3RNDA 2QCGA 2Y6ZA 2YGYA 4BI7A 1A5CA 3E02A 2B7OA 1OFDA 1KBJA 1PHWA 3EXSA 1FXQA 4X22A 4NXKA 3TNOA 4OHQA 4BR1A 2GUUA 3GKAA 3RFAA 1O5KA 1OFRA 1O95A 4NVTA 2DZTA 4UTKA 1VC4A 4H6KA 1KM2A 3N34A 3PC0A 3MBFA 4DQWA 4CNOA 6TIMA 2E6YA 1VYPX 5CZ0A 2GVJA 4LVAA 3NVTA 3LV6A 4OGZA 1B4KA 4JS3A 1YYAA 3P62A 1JCNA 1W5OA 3OG3A 1I2QA 3I68A 1TPEA 4GE8A 4TU1A 3DU0A 4WX2A 4YCPA 3KOFA 3CPRA 4N9EA 3W23A 3S1WA 2C14A 3W1QA 4UIOA 3A9IA 4UTTC 1OFPA 4M6QA 1TTQA 4DF2A 1K7XA 1KV5A 3IIZA 1G69A 2I9EA 1DOSA 4AMAA 3OEXA 1ICPA 5C5YA 2ZFAA 3OVQA 1H5YA 3IRDA 4HNTA 1ZCOA 2DJXA 3W1UA 1PHQA 3ZS4A 4GRSA 3NQ2A 5HNRA 1ONRA 4O15A 4ZQRA 3L66A 1TREA 4UTMA 4M19A 1T8XA 1TTPA 3MYPA 3EX6A 3S1VA 3LHZA 4NNAA 4JDBA 5EY5A 3A24A 3H54A 4UTHA 3W7HA 3RK8A 1HFBA 4UXDA 2V5LA 5CKSA 1H61A 1OFEA 1OX4B 3R12A 5HWNA 4K7VA 2NWRA 4XQ6A 4RXGA 3GKFA 1VLWA 3VCRA 4O8RA 3SGZA 1VYSX 4PL1A 4UTIA 1S3HA 2EKCA 1XBXA 5CZSA 1QPOA 5G2HA 3O06A 1DJNA 2CZDA 2CLKA 1F5ZA 1OYCA 4AVFA 4N6FA 2YCEA 2Y85A 3ATYA 1I2RA 3U2OA 5D05A 1YADA 3IVTA 5DLCA 2QEZA 2PURA 3FA5A 3HGSA 1GOXA 4HKPA 2PC4A 1I4NA 2FJKA 4QNWA 3B0VC 3W88A 4O14A 3LRKA 1OF8A 1JULA 1UBSA 4XUGA 1P1XA 4UR7A 3DAQA 1MEHA 3NEVA 3A5VA 3L0KA 2G97A 5FEPA 3O05A 5HR6A 1KM3A 2Z2UA 2CWNA 3P67A 5F4XA 3HBLA 3PUEA 1KM4A 1BWKA 3GK0A 3FIGA 3TKFA 1LCOA 3SSJA 4LV4A 4U28A 3T4CA 1T99A 4JX6A 2WOQA 4JTSA 3PSWA 1GJPA 3INPA 4Z1CA 1EX5A 1W8SA 3BV4A 3G0XA 4JYFA 2RDTA 1DKWA 4RZ6A 1YXDA 2WSYA 1BWLA 4LRTA 1BTMA 5F2MA 5I3GA 2OCZA 3C61A 4Z08A 3O6DA 3B4UA 5EPDA 1RV8A 1W5MA 3PBYA 4TX9A 3T78A 1EB3A 3EKLA 2WNZA 3C2VA 5A5WA 1UJPA 2DZXA 3PWAA 5LHFA 2BZNA 1VQTA 3FYPA 2NXHA 4LS0A 3BLFA 4KFNA 3LHYA 1TPH1 1QPNA 1SZNA 2QCFA 4O13A 3EXRA 3HIJA 5F4SA 1S5VA 1OK6A 3SR7A 1LTDA 5A8GA 4BI6A 3I7SA 3AO0A 3F1QA 1KTBA 4A21A 4HSNA 3DFQA 1T96A 3L67A 3CEPA 2DP3A 5F4WA 4RR4A 5HWMA 5FEXA 3G1SA 2Y88A 5LZLA 4PH6A 5EKYA 3W76A 4AF0B 2YZRA 4IJBA 3WK1A 3IVUA 1QDSA 5D2WA 3D0CA 3UPBA 3LCWA 5BMXA 2CW6A 4A2SA 1KM6A 1SO4A 4CQAA 1Q3NA 2H90A 1JCXA 3W75A 5F1VA 3R13A 1JCJA 4Z1BA 1FCQA 5HR7A 4WZHA 3SZ8A 3N73A 4IOTA 3HO8A 1EP1A 1XDLA 3OVRA 3LERA 1SQ7A 3HG4A 1N7KA 2NLIA 3S0CA 1Q6RA 3NQMA 1QWGA 4HSOA 3LHUA 3BW4A 4RV8A 5HJLA 1ZAHA 1AL8A 2E5BA 3VE7A 1WOBA 2RDWA 4RK8A 4MVAA 2CLFA 2W0UA 1JJKA 1KV8A 3DI1A 3HGOA 1EWEA 3P81A 5CZJA 3W1AA 1G4PA 5LSMA 7TIMA 4A3UA 3CB8A 3C2EA 1FCUA 3DGRA 4N02A 3O8AA 1FWNA 2C6QA 2QCEA 4MLJA 3U8GA 2A7PA 1OFBA 2Q8ZA 3TH6A 4PCFA 1UASA 3TXZA 1CX9A 3LI1A 3NO5A 3R5EA 3LRMA 2FTPA 2G96A 1F2JA 3G8RA 3M41A 3UNDA 1WBJA 4IMEA 4Y90A 5FF0A 2TMDA 5LNVA 2Z6JA 1WX0A 4MJMA 1OX6A 1YDVA 1U5JA 2QF7A 1SO6A 2E77A 1VCFA 2CLMA 1QO5A 3F03K 4AH7A 1XL9A 1RZMA 3L5LA 4LOCA 3WK3A 4DBDA 3EXTA 3RLUA 3GXPA 5AC6A 1QR7A 5LKYA 2Y70A 1IIGA 2RHGA 3NPVA 3BG5A 3TROA 1KFBA 2ABBA 2VFDA 3KX6A 4EVZA 3EX2A 2Z0IA 1WXJA 3PY2A 3Q2DA 1JUKA 4LVDA 2Y63A 1PS9A 1FDZA 2E6AA 1H1YA 2ZZ6A 3T7VA 2YPIA 4AEOA 3TSBA 1GTEA 1BKSA 4RX0A 3FKKA 3CT7A 1L6WA 1MXSA 3WJXA 2A2IA 4MKNA 5G4EA 3HGRA 2CLOA 1OFQA 3DKLA 4K7YA 5DBTA 2FPTA 5FF2A 1D9EA 5G2WA 1VCGA 4NNCA 1F74A 3CIWA 3O6CA 1KFEA 3QZEA 1KBIA 3TW7A 3JS3A 1M7OA 5F1UA 2VEMA 1XUUA 4Q33A 3B0PA 1NF7A 3W72A 3O1NA 3BG9A 1PIIA 4UMBA 4IX2A 1KFCA 3BW2A 1A53A 1K7EA 2V9DA 3GZ3A 2WPBA 5KZEA 1PCWA 1FBAA 1GG0A 2ZZ5A 5HUOA 3TSMA 3Q37A 1H7OA 3CWNA 4GBUA 2C15A 3LGEA 1MZHA 2VFIA 4JN6A 4O17A 2A0NA 4UCGA 3P8IA 4ZQNA 4YWIA 1J5TA 1PL9A 1O4UA 3W1RA 3B03A 1LBMA 1R46A 1AMKA 3C0JA 1FY6A 4I7UA 4JY8A 1TPDA 2VFGA 1SR9A 3IGXA 4P2VA 3M43A 1LLWA 3NR0A 4JTFA 5G5IA 4QM1A 4FX6M 2ZRWA 4N9BA 1AL7A 5LHEA 5LNRA 1XUZA 5G4WA 3P82A 5EL1A 3UPWA 2ALDA 1Q6LA 5AYXA 4ORMA 3PM6A 5K4ZA 1SPQA 5CGQA 1TQXA 2GQ8A 3GYEA 1LBFA 3WK0A 3W1NA 4YCOA 5K4XA 3QSRA 2H6RA 4LVGA 4DF0A 2ATMA 4ONVA 1TRIA 2BSLA 4JTHA 1YLVA 2E6FA 1OHLA 1ICSA 4GUFA 4L4LA 3DFSA 2F7FA 3EWZA 2G95A 1OG0A 3W07A 3LB0A 3UWUA 3LX9A 3HGJA 3ANYA 2ISSA 4AHQA 3PS7A 1LDCA 3NQGA 3MJYA 3P84A 1H60A 2PRHA 3T55A 1SZEA 4Y6GA 5L6UA 1WQ5A 2H8XA 4UFLA 4QSHA 3W84A 2NX1A 2V30A 3EX1A 3FS2A 5DCBA 1LOQA 5C2XA 5DCDA 4UTWA 4JYEA 3KFTA 3S9YA 1IXPA 2E5CA 3G24A 4UC5A 3L9CA 4UTWC 4HIBA 1TRDA 1G4TA 1YDNA 4O12A 3MP5A 4FIQA 5D2YA 5K9DA 3QFEA 5AFDA 4MY1A 5EA9A 1ZNNA 4IUOA 3TR2A 4N2YA 2PRLA 1LP6A 1TB3A 1OX4A 1XC4A 1I45A 4UTLA 3QQ0A 4C1LA 1PCKA 4UFMA 1VPXA 1XDMA 4O52A 1DJQA 2FQIA 4POCA 3M0ZA 2Q3RA 1N55A 3QQ1A 3ZWTA 3RU6A 2WNNA 1J2WA 4JEQA 1THFD 3TXVA 1F73A 2A6NA 3QMSA 2P1FA 2W79A 2D73A 1FWRA 1EA0A 2YW3A 3WFAA 8TIMA 2QJHA 4ML9A 3GDRA 5KITA 1OYBA 5LNWA 2EHHA 1T0OA 5BNKA 1MEIA 1ZFJA 3GNDA 3VNDA 3S5YA 3TE9A 3HG2A 3M16A 1Z42A 2UV8G 1W0MA 4E0CA 4OV9A 3TSDA 2V5BA 1WBHA 3LLDA 2DZPA 4PEKA 3UD6A 3E9AA 1G6CA 1Z48A 1H7RA 2P0OA 1OYAA 2GQ9A 4NJKA 2G5WA 5KINA 4LUJA 4DXVA 1YTDA 2JKEA 3C6CA 2V0TA 1LRNA 4FX8A 4JIQA 1A5BA 3GVGA 1AG1O 3GIYA 1EP3A 1E51A 4UFJA 1I2OA 2VEIA 3QSTA 2YFNA 3TUUA 3UWZA 3UWWA 3W7PA 4AWSA 4HNVA 4DO5A 4DPQA 5LNSA 2ZA3A 1TJPA 1V7YA 3W83A 4LV9A 2BX7A 4JX5A 3DHDA 2HMCA 2QDGA 4FNRA 3HG5A 2NZLA 3ABRA 3IGUA 1P5BA 3I7RA 3MHFA 3TMQA 3WJWA 1DHPA 2XN2A 3PR2A 1RR2A 4GJ1A 3A22A 2QAFA 5F2IA 1QO2A 3G1YA 3NOEA 5EMUA 2ATSA 4NQ1A 1IF2A 5HQEA 1VYRA 4JTIA 5FF3A 3MP3A 4J9JA 3I6RA 1I2PA 3GR8A 2ZBTA 1J4EA 1EP2A 1S5TA 1QPRA 4G1KA 4NJJA 2Y7FA 2QKFA 5BRBA 1SSDA 3MBDA 3N2XA 3NQ8A 3OBKA 2WQPA 3T44A 4CCCA 1ME9A 2DZVA 3DBPA 1UUMA 4O1BA 3TDFA 2H3BA 3N2MA 3DH7A 1JCYA 3W7GA 3KAOA 3GDLA 1TPFA 1QCWA 4O54A 2OX1A 1XFBA 1ZJIA 2XN0A 2F84A 3LCFA 4AF0A 5D32A 1FWTA 1FCVA 3MYOA 4XTDA 2FLIA 2C13A 4Z1DA 1RPXA 3SIZA 1M7PA 3EX3A 1W37A 2HS8A 3W7JA 3W7MA 3IIOA 1H63A 3G3MA 1YDOA 4O19A 3W2LA 1RVGA 4A29A 5C6MA 1WOAA 4LU0A 3PUOA 3NQVA 2VKZG 3W86A 2A4AA 1SZGA 5AC8A 2VC6A 2DZUA 3PG9A 2WO5A 1LYXA 2Y89A 4H4IA 4ZQCA 3L68A 2QDHA 4AHOA 2B0MA 3M5XA 4Z1AA 3W7EA 3W6YA 5T26A 3UZ5A 3DXIA 4O10A 2WV8A 1HO4A 1JUEA 2X1TA 2JK2A 2ZRZA 4R53A 4M6PA 4IGHA 2Y7GA 3M5YA 4JR5A 2A7NA 3CIXA 1MSSA 2X16A 5CSSA 4O11A 1IXNA 1JR1A 1D3HA 3KXQA 1SU5A 3PULA 3M9YA 3LBCA 3P5ZA 4FNTA 3TIMA 3EWYA 2W6RA 5LNUA 2AAMA 3LOTA 4O0ZA 4JIPA 1TQJA 3E96A 1SUXA 3TU9A 5U4NA 3RF9A 4X9SA 3QMRA 1W5PA 3MO7A 1TIMA 3BO9A 1O5XA 2HS6A 3GR7A 3NPWA 4JTEA 2NXGA 3N9RA 5I3KA 1ALDA 2NUYA 2QJIA 1B9BA 2E5DA 3HG3A 2WSRA 4UNKA 2DZSA 5CPOA 3USBA 2OMAA 5G1YA 3TMLA 4R34A 2EAWA 3UWQA 4GUJA 2OJPA 1XKYA 4PODA 1L6YA 1AW1A 4GWEA 2YDAA 3G1AA 1MEWA 3C52A 4FXRA 5K3VA 1QPQA 5TBOA 5CPNA 2C18A 4KFPA 3SJ3A 1K7FA 5K9XA 3THQA 2YR1A 3S1UA 3PVFA 4XTIA 4BFAA 3L65A 2GJLA 1W3NA 4DPPA 1G7VA 2A6LA 2JKAA 3GXTA 1I8JA 3L0GA 1I2NA 3QC3A 5DXYA 4WOZA 5E93A 1ME8A 4B5NA 3NQ6A 3FJLA 3CHVA 1KFKA 2EF9A 3L2IA 4XBSA 1B4EA 3LCHA 4IXHA 3FLUA 1OK4A 1EUAA 1KLZA 3UWVA 3PF3A 4PC8A 2VEKA 1QOPA 3M6YA 3G18A 1H7NA 4JYDA 4NX0A 1IXQA 4LVFA 3M5VA 1GVSA 1DL3A 1FDYA 3FJ6A 4JXCA 3LHVA 4K37A 1GYNA 3LXAA 3GNNA 3W7DA 2BLEA 2B7NA 1VZWA 1QAPA 5D03A 2CZEA 2X1RA 1F76A 3ELFA 3LTPA 4JTUA 3S5NA 2NXIA 1SFLA 5DY2A 2QCNA 4ORIA 1W31A 3FEMA 3TQVA 3QRHA 3V1PA 2WSQA 4HT3A 2FPYA 5HULA 4LC6A 4GXMA 4NT0A 5FEZA 3HF3A 1GPWA 3NPUA 4BI5A 3C4UA 1TV8A 2H8ZA 4UFKA 3LRLA 3W2NA 2E09A 1SW0A 2ZTJA 2A1YA 4K36A 1WV2A 3TC7A 3NXFA 5CPLA 3BGGA 1X6UA 5AC7A 2CLLA 2QCCA 1QNVA 3K30A 1GYLA 1O94A 1GTHA 1PE1A 4NU7A 4FX7A 3LTSA 3MW7A 3W1MA 3DZ1A 2LLEA 3QM3A 2PE4A 4FNUA 1H1ZA 2C19A 1TJRA 2PRMA 2QCDA 3G3DA 3MI2A 3W7OA 2ISVA 3P5YA 1WDWA 3RMJA 2CZFA 5KZMA 2BTMA 4EF9A 2J9XA 3F4WA 2NUWA 3TAKA 3TV8A 1NAL1 4HPJA 1L9WA 3DFPA 4O4VA 3A23A 3DFNA 3TQKA 1F7BA 1ML1A 5KSWA 4QQ3A 1H62A 1GT8A 3IGSA 4IXXA 4ZQOA 5DCEA 2NWSA 4LUIA 2YW4A 4PTNA 3P74A 4JICA 4EOUA 4MZ1A 3TK7A 4WY0F 3FFSA 4ICNA 3NL6A 3DENA 3B06A 1LOLA 2X1UA 4UUIA 4LS1A 3T40A 4O57A 5KMYA 2ZRVA 5I3FA 1VRDA 4FNPA 1ZAIA 1Y0EA 1RQHA 4XWUA 4IMFA 4BK9A 4RCXA 3HJZA 3L5MA 2VEPA 5F2GA 3TQ0A 1TYGA 1HTIA 1KFLA 3W7IA 2C0AA 2O7QA 5LGXA 3UY8A 1KM1A 3C2RA 4UFHA 1H7XA 2A7RA 5AHFA 3MI6A 1PVNA 2V2DA 3NYZA 2FIQA 2CLIA 4EIVA 2B7QA 3IEBA 4QIUA 4O50A 1AW5A 2Y7DA 3C56A 4YMZA 1ZY9A 4Q4KA 2V2HA 5FESA 3PB0A 4IPIA 1KTNA 2YYTA 3B04A 3LI0A 5HMSA 5CG7A 3N14A 2KZHA 3BPWA 3NL5A 1BEUA 1TTJA 1YTKA 2B4GA 1MO0A 1D3GA 4FHAA 3STGA 1HL2A 1SZFA 4NNBA 5G2IA 4JTKA 3H55A 3DI0A 2P10A 1QFEA 3DFTA 3LXCA 4CCDA 5AOUA 1FCBA 1R30A 2TSYA 4NJGA 4A22A 2J6XA 2QCDB 3LLFA 4M5PA 2CZ5A 1O60A 2FPVA 3L0NA 4YLWA 2RFGA 3HPZA 4O4WA 3M7WA 3R89A 4XBKA 4Y9AA 3H53A 3O6YX 4FXSA 5I3IA 4JDYA 2ZDRA 3LM7A 1SO3A 1SO5A 4WD0A 3LCIA 3EX4A 3LDVA 1G4EA 5KZDA 1G67A 3P8JA 4DEFA 1Q45A 4XZ9A 3STCA 4ALDA 4MOZA 4QISA 3A5FA 3FYOA 3BVJA 3E0IA 3QJAA 4NJHA 4EWND 1DBTA 1LLZA 2NUXA 1OJXA 2ZCGA 4DBEA 1GVOA 2ZTKA 3UYCA 1F6KA 3BG3A 3P7YA 5K7JA 1GQNA 4JTGA 3B0UX 1L6SA 5DY3A 3RLVA 1A5AA 4M7SA 3ABOA 3M47A 4LTSA 3BLIA 4PL2A 1NEYA 4KWWA 4X3ZA 2ZQ0A 4FNSA 4X2RA 1SW7A 1DQWA 2WKJA 4NUWA 1XBZA 5AHMA 5AHLA 1B3OA 1FWWA 1YXYA 3G8EA 4JNMA 4IQLA 4JX4A 4CQ8A 3L21A 3S1XA 1KTCA 2GJNA 1DQXA 3STEA 1EWDA 1TCDA 4OE7A 3E49A 4MY8A 1F6PA 4TR9A 3S8HA 3CM4A 1JRBA 4CNPA 4UTJA 2PCQA 3UWYA 1YTEA 5BOOA 1TPB1 3P60A 4D2JA 1TO3A 4EF8A 2WNQA 2ZRXA 3W7NA 2AGKA 5FI8A 3M1ZA 1K8ZA 3BGJA 1JCMP 1XXXA 1LRTA 2E68A 1TPVA 3NPXA 3QW3A 3KHJA 2DORA 4K38A 1FDJA 1C29A 3S5OA 2OZ0A 3G22A 3QPZA 1GVFA 2ABAA 1VHNA 1SW3A 3GAYA 3W1PA 5J5RA 3HOJA 4O0KA 3UZJA 3TJLA 1NVMA 2EPHA 1LOSA 3MP4A 3PBWA 4NZJA 1OABA 5AHIA 4K39A 4QAIA 2Y61A 3W2KA 4C1KA 1VGAA 4WXYA 1CW2A 1UCWA 5E1QA 2ZZ7A 5IM51 4OWGA 3B05A 4LNYA 2CFFA 3LCGA 1W3IA 4MZ8A 3PAJA 3R8RA 5AHNA 2ZRYA 5AN7A 4UTTA 3G0UA 5FEWA 3AJXA 4UMCA 3P61A 1JQXA 2X1SA 2VELA 4NZFA 3W2MA 5BW6A 1TTIA 4UMAA 3W73A 4JTLA 4U4MA 5LGZA 3EWXA 1XI3A 1VHCA 5SWUA 3LHWA 4HNNA 4O18A 3NL2A 4IX0A 2TYSA 3GLCA 1LROA 2Y62A 3KRSA 4QNEA 4HHPA 2WJZA 4ADTA 1NSJA 1IXOA 2R8WA 3SI9A 1P4CA 3L5AA 1HG3A 1M5WA 1TMHA 2BWGA 2IQTA 3SY5A 3E12A 4I7VA 2GQAA 3JRKA 2OT1A 4LRSA 2ZA1A 3W7QA 4BWLA 1K8YA 3BLEA 4M7TA 1YPIA 5AYZA 4IMDA 3DFOA 5E0KA 2RKXA 4N6EA 4R33A 1SSGA 1V5XA 3MHGA 1JCLA 4BWLC 2QUVA 4Y96A 5I3HA 3W71A 1NF0A 3HB9A 2Z6IA 1W5NA 4WY0B 4DF1A 4QJ1A 3TFXA 4KWVA 2FFCA 3TAOA 1LM1A 2YFOA 3LTYA 4FIRA 4UR8A 3NQ7A 3TA6A 2TPSA 3TX9A 5L9FA 4LY8A 3KVKA 4O16A 4HNUA 1R2RA 2J88A 3QEZA 3N19B 1GWJA 5KTLA 1TSIA 4ADUA 2YYUA 3O63A 3LCLA 1EUNA 4PA8A 3BK0A 2ZZ4A 3MUXA 1OF6A 3QH2A 3ABSA 2E1DA 3NQCA 3B8DA 3IIPA 1OFAA 3EWWA 3U6WA 1VLIA 4UTUA 5D30A 5J5DA 5D2TA 1H7PA 4E2DA 3VE9A 3IIVA 2YXGA 2DJLA 3SGUA 1WAUA 4RZ4A 1KFJA 1WA3A 3G0SA 4MPQA 3C8FA 1W3TA 1H7WA 4N9CA 3NZ1A 3W7CA 4Q32A 4GUIA 2J27A 2AQWA 3G1HA 4LC8A 2JGYA 4IMCA 5D37A 4YL2A 4GUGA 1TV5A 6ALDA 5K9CA 2DZWA 3TCEA 2QCMA 4GNJA 3IIXA 3W74A 3NGJA 5AHEA 3FOKA 3W85A 3MMTA 5CSRA 4DELA 4N4QA 1S5WA 5D2XA 4IWWA 4LVBA 1YPFA 1UUOA 1ZHAA 3M44A 3YPIA 3VI2A 3LHTA 2A85A 2BXVA 3CEUA 2R14A 3STFA 4JTJA 4E2BA 1LBLA 1KW1A 4ZQMA
chains in the Genus database with same CATH superfamily
2FVLA 4JQ4A 3N12A 4Z2LA 1FUYA 2VR5A 4QITA 3KHDA 2ANUA 2GVYA 2J7GA 3SRFA 1EH9A 3KEHA 3EOLA 1NTHA 2HNEA 4PGLA 2ZA2A 4G1NA 3SRHA 2OGJA 2FDSA 1W5QA 2ALRA 1FHVA 3NNTA 1TV7A 4W8AA 2CLPA 3UZYA 1KM0A 3LUTA 2HEJA 4IG2A 1N8IA 2W27A 4M29A 2VRQA 4IPJA 1JG9A 1QMLA 4OUIA 4Y2WA 1ENUA 5HINA 2YL8A 2PS2A 4G6CA 1XLGA 2QVNA 3KVJA 5CGMA 1G7UA 1SFJA 4RKAA 1GQKA 2J7HA 1HUVA 2DIKA 3QGAC 1R3VA 2QUNA 3LEPA 1K8XA 1XLBA 2OB3A 4G9PA 5FCZA 3H12A 1EPXA 3BAIA 2CERA 4LYRA 4XAYA 5FF4A 2HNHA 4HU3A 3T09A 5A2CA 2VQUA 3THDA 4UOQA 3REQB 1DV7A 3I7QA 1RQBA 1WYIA 2HPIA 1BTCA 3G1RA 4GY0A 1XLDA 5HJYA 4JKKA 1XSKA 4GUHA 1FX6A 2VXNA 3O0FA 3UG5A 4DAIA 5FJRA 2X2GA 2I5IA 2PGWA 2X0YA 3WSUA 2ZUTA 1IE7C 2ISWA 2X30A 1V3MA 2C3ZA 2NX3A 1W3LA 4CKQA 2PC8A 1XIDA 4DZAA 3RMEA 1VFSA 2E9MA 4TUFA 3G1DA 4ZFCA 2PA6A 4X60A 3DHFA 8XIMA 4LNCA 4H9XA 1G4SA 4JOMA 3SFKA 1EKOA 1BXNA 1XCFA 3N6JA 3MCNA 4X2PA 4DRSA 2J9ZA 3TWBA 3VIHA 4A8IA 3G1XA 4HPXA 3W24A 5LYRA 3S6TA 2QCLA 4H6QA 4CQ9A 3VIPA 4GI6A 3ITGA 2ZXQA 1L6GA 1W1ZA 4NAEB 4P7RA 1HNYA 3RM9A 5F2LA 3XISA 1NFPA 1ZCCA 4NAFA 5IHRA 1IIHA 4AXKA 1YRRA 1E6QM 4S3GA 3W87A 1VCVA 1OGSA 4QGCA 2Z7GA 3PJTA 4GC4A 3U3HA 2EGZA 2CKSA 1Q6OA 3DC8A 3GX9A 1K3UA 3WJSA 5I5RA 3MI3A 3N2BA 1US0A 3RRAA 1T41A 3IGHX 3IS4A 3EWBX 1LWJA 1ZUAX 5HK4A 3GVWA 1GW9A 1MMFA 4H7ZA 2V82A 1VS1A 3TC6A 3WD4A 4I7WA 4WJEA 4QQUA 1BXCA 4AD2A 1PV8A 2J7CA 2XN1A 2FZBA 3W1TA 5JH2A 1KLYA 2J25A 4ZXOA 2ZZ3A 3HPSA 2F6XA 4MWAA 4B5UA 1A5SA 1FWHC 3MWCA 4CU7A 4JY9A 1YXCA 2DVTA 2GPTA 4W9TA 4BQ2A 3OYXA 3PK7A 4O53A 2NQZA 1QT1A 4DO4A 4CU6A 3UXAA 1RXOB 2HRWA 1EJ7L 4OQVA 5D9PA 1WO2A 4MUPA 2GJRA 1XP3A 1GOKA 2E8ZA 4GBDA 4S23A 4F2BA 1PB0A 1TWZA 4Z0SA 3EKZA 1GVRA 4LS2A 3W7KA 1KM5A 4JEJA 1YKWA 4GZEA 2R94A 4HN4A 5T8GA 1PKNA 1OG6A 4PCTA 4W86A 1UPMB 4GKLA 3WMSA 3MY9A 2G3MA 3H7UA 4I5XA 1ZTVA 3CT2A 3VKJA 4MNLA 4R88A 3KE0A 3GO2A 1ZBWA 3QYQA 1C8VA 3KOYA 1O1HA 3K1GA 2OGYA 4XZBA 1RH9A 4LAUA 3W28A 4DM1A 1W17A 3ZOAA 4P61A 4AIEA 5BWAA 1P0KA 1QW7A 3AZRA 3IJ9A 1A49A 4AYGA 3KOWA 1X8FA 3WF1A 3KTSA 5E0CA 1OZQA 2Z1BA 2PSNA 3DHPA 4CLMA 4OT7A 4GNVA 5EYWA 2PGEA 4D8ZA 3BW3A 3HTWA 1RQEA 4IZGA 5IBXC 2WLYA 5EBUA 3UT0A 3B3DA 1B57A 1Z3NA 1D8CA 1GVQA 1R2SA 3URNA 1Q63A 3M5ZA 3W2JA 1CGXA 1HP5A 4Q6XA 4LAKA 1ZQ5A 4AB4A 2ESCA 3PBUA 4K68A 2J9YA 4JIHA 4JGDA 2W4XA 4W8LA 4LCSA 2FB2A 3AI0A 4MM1A 3W70A 1OQFA 3NL3A 3NQDA 1WDQA 3GAKA 3N29A 4GZIA 4LUTB 4MJZA 3SCSA 4S3JA 2Y6ZA 4M81A 3E02A 4CNTA 1P43A 3L2MA 1FXQA 4F0SA 1UKQA 2POZA 4Y9NA 3TNOA 3BAJA 4BR1A 1C3FA 3QLDA 4NVTA 2W61A 4UTKA 4DJDD 3CASA 4PULA 4CNOA 6TIMA 2E6YA 2DZBA 1Q8JA 4OGZA 1B4KA 1TUXA 4C6NA 3F5KA 1JCNA 3MSRA 1TPEA 1XS2A 2IKGA 4GE8A 4TU1A 2PCEA 3CZKA 4GACA 1DIEA 4WX2A 3KOFA 2BHZA 3NQBA 4B16A 4BS0A 5BRPA 3S1WA 2C14A 4QDMA 3VKCA 2I7GA 3CNYA 3GHSA 4DF2A 2O56A 1K7XA 1E55A 1WB0A 3WDQA 4A3QA 1FWDC 1VBUA 1I75A 4PRTA 2ZFAA 4OKDA 4HNTA 4B4FA 3WDRA 2PDNA 3L66A 5BOFA 2QPSA 2V3GA 1M7JA 4E6MA 1IZKA 4GZ7A 4JDBA 2WHMA 4CN6A 3CHCA 3POHA 4UXDA 3R79A 5BOEA 5CKSA 2QPXA 4NZ1A 3CMFA 1CCWB 1OFEA 1B31A 3R12A 5HWNA 4XQ6A 1ZZMA 4O8RA 1V7AA 4REQA 4LUSA 1V6XA 1R9XA 4PMVA 5XIMA 1S3HA 1O5RA 1DJIA 5CZSA 1QPOA 5G2HA 4H19A 3TTEA 3CZGA 1NFGA 1DJNA 1JZ7A 1V3JA 1UZ4A 3ATYA 1I2RA 4LJ3A 2UBPC 1EF3A 5DLCA 3GTNA 2QEZA 1HVXA 1EBGA 3FA5A 3HGSA 2PC4A 3R6IA 4QNWA 2E0PA 5C9UA 3LRKA 1OF8A 1JULA 1UBSA 5FIPA 3E2RA 2REQB 3OGSA 4XUGA 1BYAA 1P1XA 1RLDA 3EOSA 3W53A 4UR7A 3NEVA 1MEHA 3KDNA 1UD8A 4J2PA 3GC4A 4OOUA 2PWGA 2DT2A 3BJSA 2Q01A 2BODX 2Z2UA 2CWNA 3FXGA 4GKTA 1QUMA 3WQVA 2FJUB 1ECEA 3GK0A 4JL2A 4BKNA 1KXVA 2OQLA 4H7CA 3BICA 1JXKA 4R3UA 1AODA 1EYWA 4Z1CA 1EX5A 2IS7A 1W8SA 5AKQA 4AUBA 7ODCA 1EHAA 2YCIX 1HGYA 4PUEA 5I3DA 1XYBA 5FAJA 4MHBA 1BTMA 3CGTA 5I3GA 3H21A 3EMCA 2OCZA 7REQB 3C8NA 1FH9A 3SGGA 3T78A 4C5ZA 4RNFA 3QTPA 4WDUA 2BZNA 3FYPA 3TWAA 2NXHA 3PN8A 4KGJA 3UR8A 3FSTA 1QPNA 1A4MA 3WD0A 4F2TA 1ECQA 4YWSA 2WWDA 1OK6A 2CPUA 4WSHA 5FD0A 1RK5A 4Q6JA 5A8GA 3I7SA 3AO0A 4A21A 3I3DA 3SCRA 3D5HA 1LG1A 2I5GA 4GYFA 4XSMA 1E56A 1NQ6A 3P3BA 1Q8AA 3OZYA 4RR4A 4INFA 1GYMA 5HWMA 5FEXA 3G1SA 4PCSA 3GU2A 2YZRA 3IVUA 2I17A 3LCWA 2Y8VA 4IFOA 1S46A 1Q3NA 1XYZA 1CXHA 5TAOA 3HFYA 3SZ8A 3WD3A 1XDLA 3B9NA 3LQGA 1E4LA 3HG4A 4GVGA 3S0CA 3NQMA 1SJDA 1KCLA 4HSOA 2UY3A 3PZQA 4RV8A 2Z4GA 3HFTA 3QBUA 4K3ZA 1VBRA 2HBXA 5KETA 4QCFA 1EZWA 1R0MA 3WENA 4BQ4A 5ECVA 2CLFA 2ZXDA 4I8DA 5CZJA 2VQTA 1XIFA 1G4PA 5LSMA 4ACZB 7TIMA 4YN5A 3CB8A 3C2EA 3IJIA 5A6JA 1MW1A 1E0XA 2Z00A 2UY4A 2D23A 4ZCWA 1YEYA 3CBWA 1XRSA 5C70A 3KDOA 3IJQA 4JN8A 3VKKA 1ONEA 2O4MA 1W1TA 3G8RA 3L4VA 3M41A 3MVTA 2ONEA 3H23A 4GOAA 3LMZA 2TMDA 3T05A 5LNVA 4LGXA 2PLJA 2FZMA 4E2VA 1SO6A 3ITXA 3N15A 3VD9A 1XLJA 3THUA 4QLJA 2F38A 1W9VA 2X41A 4QG6A 4MG4A 4RL3A 3EGJA 3ALFA 4DBDA 3EXTA 3NJ3A 5AC6A 3BURA 2V67A 1QR7A 4QE4A 5LKYA 4S3CA 3S1GA 3NPVA 4F4RA 2ABBA 2QUMA 2VFDA 2VX7A 3Q2DA 1CENA 3H4GA 4NZCA 1MFVA 1FDZA 3FVMA 4X9YA 1IT8A 4IL0A 2ZZ6A 1A80A 3T7VA 1BKSA 4RX0A 4MF4A 1N8WA 3FKKA 3CT7A 2J13A 3WJXA 4MKNA 1Y5WA 2FPTA 2E7FA 3M6DA 4GMEA 5FF2A 5G2WA 1F74A 4B92A 4WIWA 1PX4A 3TW7A 1JFHA 2WMGA 1XUUA 4Q33A 4U5KA 3B0PA 1NF7A 1AD1A 3K46A 1KFCA 3BW2A 4M6UA 1A53A 4HU8A 4GCAA 1PCWA 2Z27A 4KQNA 2PTZA 3T42A 4WVXA 4FXFA 1O66A 3PWGA 3Q37A 3CWNA 3V4BA 4GBUA 3DG7A 3LGEA 2J6VA 3UJFA 2VZUA 5I02A 3PBMA 4XSLA 2A0NA 3P8IA 4GLEA 1RBAA 1W8GA 3GIQA 2VFGA 1SR9A 3VGEA 3M43A 4IPNB 2P0IA 3TJ4A 4GH3A 2HE5A 5LIWX 4URIA 2IPFA 2ZRWA 3VAVA 1A3XA 1AL7A 3MZNA 4RE3A 4NP7A 5LNRA 5C9RA 5EL1A 3EPNA 2ALDA 5HNUA 7ENLA 4ORMA 4I6VA 3RILA 1P0EA 3WLJA 4EPBC 5CGQA 2HCVA 1GQLA 2QW5A 1WKYA 3WQ4A 3DCPA 3AHYA 1EJSC 1V6VA 1A0DA 1A5UA 5IFTA 4B90A 1YLVA 1R85A 3LB0A 3VIOA 4QR6A 3HGJA 4PTVA 2PZNA 4AHQA 4NYUA 1JGIA 3GNXA 1SZEA 5L6UA 4F3HA 5AY7A 4UFLA 4QSHA 2NX1A 2V30A 3MUAA 5C2XA 1NQKA 2J8TA 3G24A 1E5JA 4UC5A 4HIBA 1TRDA 3OJGA 1YDNA 2J7FA 1RSCA 1TCMA 2PWDA 4FIQA 2YCJA 5D2YA 4P5UA 1ZNNA 4H83A 1HL9A 1OX4A 4YTRA 3QQ0A 1PCKA 1P7TA 1DJQA 1TX2A 1Y5VA 2JF6A 1N55A 3QQ1A 2WNNA 4JEQA 2A6NA 1ZJBA 1FWRA 3ANUA 3T8LA 5HNNA 1OYBA 1VFHA 2EHHA 1T0OA 4B5TA 3S5YA 3TE9A 1EDQA 2GWNA 2Z1KA 2Z7KA 1Z42A 2UV8G 5A95A 1M03A 2WXDM 1WBHA 3LLDA 1JYWA 3MS8A 3JW7A 2BOEX 3KBVA 1V93A 1QI4A 2P0OA 3ZSSA 1NELA 1HN1A 4B5XA 4IQDA 4Q8UA 2WQDA 2PDUA 2PBGA 3KUMA 1YTDA 2WNWA 3LG3A 1LRNA 1TX0A 4FX8A 3GIYA 1E51A 3PBGA 2PTYA 2PD5A 4XAZA 2QV4A 3UWWA 3GH4A 2FHCA 1QTWA 3RO6A 3W0KA 5LIYX 1R7OA 3C0SA 1UWRA 1OIFA 2H9AB 3S2JA 1EXPA 1CXKA 4JTCA 1P5BA 3PZOA 1YW1A 3I7RA 3TMQA 3VTRA 1G94A 1M3UA 3MT1A 3C2YA 3A22A 1HJQA 2QAFA 4DJEA 3G1YA 1O5QA 5HQEA 1W9UA 3B9AA 3H2FA 3MP3A 3KTXA 1TKKA 3NSMA 3FA4A 2D3LA 3WCZA 1I2PA 1GVIA 1X6NA 1QPRA 4NJJA 4OECA 2NVAA 1VEPA 4KRUA 3GFZA 2ACSA 1SSDA 1W1B1 1R9ZA 3LPFA 3NDYA 3O9NA 3GDLA 4E8DA 4O54A 4I3GA 3RG6A 3E5PA 2C13A 3M07A 4C6LA 1RY8A 3SIZA 2ZWYA 3IIOA 3PJWA 2V6AA 2Z24A 4LU0A 3KZSA 3MZ2A 1JAKA 2VKZG 1HZYA 1QPKA 3KTCA 3EEZA 5A8PA 1XLCA 2DSVA 1KBKA 3L4ZA 2Y89A 1EL3A 1JNDA 2X7VA 4L61A 3GBDA 2V3FA 4ZQCA 3L68A 2QDHA 3AXKA 2B0MA 5HA7A 4J1OA 1KCXA 2WHKA 2CCRA 4XAFA 3MUCA 2WAGA 4O10A 4KMQA 1RBOB 5EB8A 3CH9A 3GRIA 3RCNA 3WEOA 4CQDA 4Y7EA 4DNHA 4TTUA 5CSSA 4ERGA 4O11A 2YBTA 1Z32X 1IXNA 1JR1A 1VFTA 1J5SA 1SU5A 3M9YA 3LBCA 4FNTA 4KH2A 1W1YA 4L56A 3SCUA 4O0ZA 1R38A 2P8BA 1SUXA 3TU9A 3V7PA 3RF9A 1RP8A 4X9SA 3QMRA 3SBFA 1W5PA 3AHVA 2HS6A 3NPWA 2NXGA 3N9RA 5CC7A 4RDZA 4B9YA 1J12A 4D8AA 2WSRA 4L1XA 3AMKA 2GWGA 4ZTYA 2DZSA 1S39A 2DDXA 4GUJA 2Z1SA 1R86A 3AICA 1L6YA 3S4TA 4QE1A 3UCDA 1Q85A 4KCTA 1U5VA 3SJ3A 4H6EA 3VU2A 3PVFA 4XTIA 1XG3A 3L65A 2GGJA 3DYPA 2JKAA 1I8JA 1IT0A 2D22A 1ME8A 1H3GA 3FJLA 4HA3A 1BF6A 3SCNA 1J0ZA 2CETA 4HJFA 3HPFA 3LCHA 5I78A 3AWOA 4US5A 5AVHA 1J8VA 1VJSA 4LBSA 2AL2A 4JZ5A 2BV9A 4LVFA 3IJ7A 4S38A 1BGAA 1GYNA 3TOYA 5FAGA 3W7DA 1RVKA 4LB3A 5HMDA 1QAPA 2VT0A 2WCAA 4AYSA 1F76A 5IOBA 3S5NA 2XVNA 1SFLA 4ORIA 1KR0A 3FEMA 5AC4A 2W91A 2FZNA 4HT3A 4KGLA 4R27A 5FEZA 3C4UA 1VBHA 4Q8PA 2ZIDA 4JQ1A 4WJ8A 2G50A 3CO4A 1TWWA 2PUZA 5CPLA 3BGGA 1VBGA 1X6UA 5AC7A 3KCOA 4JHMA 4MJ2A 4GXPA 4I90A 2QCCA 1QNVA 4Q4SA 3QGVA 3IJ8A 4W7VA 3CHEA 4FX7A 5C7HA 2CC0A 3CYJA 5DQPA 3MW7A 1RY0A 3DZ1A 3BDKA 4ICMA 4QE5A 4YVPA 1H1ZA 4F8XA 3APGA 2Z29A 3W7OA 3ITYA 4LB4A 3QY6A 2NUWA 3C0QA 3TV8A 4HPJA 1FWEC 4DB7A 4I6KA 4J27A 3TQKA 3VIMA 4QQ3A 1H62A 4LCRA 2OYKA 3UZXA 3BSMA 2YW4A 1JPHA 2GDUA 3UF9A 2R1NA 4C6IA 4ICNA 2V38A 1YMYA 3SO7A 4UUIA 3JZEA 3B8VA 4O57A 4ZXLA 2GZXA 4FNPA 4CQBA 2AQOA 4HCHA 3U5UA 1J6OA 1M04A 1CNVA 3L5MA 2VEPA 3TQ0A 3GFXA 3VOHA 1XIGA 2PD9A 1Q5MA 1HTIA 2CWXA 1GKPA 5LGXA 3EDEA 3UY8A 2F8QA 1H7XA 4W84A 4GQBA 3MI6A 2WSPA 4QDPA 2FIQA 2XPKA 3VYLA 2B7QA 4TXEA 2PU0A 2Y7DA 3C56A 5C8BB 4Y9PA 4Q4KA 3LI0A 4H9TA 5HMSA 3M7SA 4DX3A 1ISYA 4UR9A 5I07A 1BPLB 3UVAA 1UR4A 5G2IA 4JTKA 3ITOA 4CCDA 5FL0A 4ECLA 1R30A 4RE4A 1FA2A 2QCDB 2XGBA 3IJDA 1DIDA 4M5PA 3W26A 2PLKA 3HPZA 5C71A 3MTWA 1XV8A 1AMYA 1W32A 5I7GA 1FP8A 3T9PA 1MUMA 3LD5A 3EX4A 5LXXA 4F9DA 5KZDA 1G67A 1WNOA 4AXNA 2EPLX 4W4QA 3QJAA 4NJHA 3WBAA 4XAPA 2W5FA 2ON3A 4EAYA 3A4XA 2ZCGA 4DBEA 3M46A 1OCQA 3ARWA 4DYJA 3BWWA 4W5ZA 3P7YA 4LCQA 4DO7A 2XVGA 2BVYA 5HXMA 3ICJA 3R1ZA 1JDEA 1NEYA 1JF5A 1SW7A 4A8RA 1FWWA 1YXYA 4CQCA 3A4AA 2V69A 3L21A 3S1XA 1KTCA 4KIEA 6TAAA 3STEA 1ITUA 2AOSA 2P53A 3N6QA 4HU4A 1XYCA 3NXLA 1KRAC 4TR9A 3V3WA 3CM4A 4CNPA 4UTJA 5JMUA 1VFMA 1TA3B 5BROA 5T9BG 2AGKA 1NOFA 3C0LA 3RX4A 4G7EA 4K38A 3S5OA 5MKGB 1E40A 5GPRA 1UPPA 3WLQA 1I60A 4O0KA 3UZJA 4XZWA 3MKKA 3TJLA 2VGGA 2EPHA 5JVLA 3MP4A 2WCSA 3WLOA 3DC0A 3II1A 3KL0A 1REQB 3NZQA 3W2KA 2C8NA 1VGAA 1JZ6A 3OA5A 3CK5A 1UCWA 2XFFA 1XHGA 2ACUA 2IKJA 3T07A 4ERIA 2QPUA 1FWBC 1ZLPA 1FHUA 3AIRA 5AN7A 4UTTA 4QEHA 3STPA 3TN6A 3VIFA 2MANA 4GPNA 4MJ4A 4UMCA 3GG8A 3I4EA 3SN1A 3FVDA 1TTIA 2GFTA 3W73A 4U4MA 5LGZA 3SUVA 2PDMA 5REQB 4NYYA 1JCTA 1UD3A 4GIRA 1NOWA 4HHPA 3RO8A 4W5UA 2GUBA 4L7ZA 1AH3A 1NSJA 5D8WA 4QBXA 4IH3A 2R8WA 3SI9A 1UWUA 4Z2JA 3GNOA 4HPHA 4AIOA 4Q4QA 4LAOA 4PMXA 3UR7A 4Y9OA 1YQ2A 3SY5A 2VYOA 3GTIA 3LU2A 2JF7A 2JEPA 2XVLA 1GVYA 4QLKA 3ZLHA 4A8NA 3N2OA 3PAOA 3DFOA 4QRNA 2QMKA 4N6EA 1IEXA 1NOUA 2XIMA 3MHGA 4BWLC 2QUVA 5EMYA 1NF0A 4WK9A 4DWSC 3CUZA 2PDPA 1EO5A 4DF1A 4QJ1A 3BLKA 1LM1A 2YFOA 3ZT5A 4H1ZA 4UR8A 5HMFA 2OYLA 2D2HA 4DJDA 4B15A 1PZ1A 4LY8A 3KVKA 3W00A 4HNUA 1R3YA 4ADUA 4FS9A 3BK0A 1UYQA 3WNOA 4PUNA 2E1DA 3RN6A 4A05A 5GNZA 3IIPA 3K4DA 1VLIA 4UTUA 3UPMA 2G0WA 3IIVA 2YXGA 1KFJA 4MPQA 4N9CA 3W7CA 3VDHA 1QXLA 1UQYA 4YL2A 4AD5A 1TV5A 2CZVA 3D3FA 5K9CA 3TCEA 3BJFA 5DO8A 1EZ2A 5AHEA 4HZ6A 1UJQA 3W85A 1NU5A 3AS1A 3BCFA 4N4QA 4LVBA 1ZHAA 3BOXA 3CAKA 3MDWA 5I0DA 2B81A 2PGRA 2TODA 3WF2A 3MMWA 3CHDA 4HMNA 5C9WA 4E2BA 3ABZA 1SR0A 3C2FA 3BAYA 4DAFA 3UY7A 3FYYA 1FKWA 4M6VA 4WHBA 3SQSA 1X1OA 3O16A 2FZ9A 1PYMA 3WZ0E 4MFDA 4Y8EA 3KLLA 7PTDA 1W9XA 4X61A 1D3CA 2QULA 4RW5A 4JD4A 3VCNA 1RD5A 1N8FA 1UD6A 2A21A 1R3RA 1RD6A 4O28A 3P2VA 2HK0A 1K9DA 3NQEA 3OYZA 3KP0A 4MGGA 4QAWA 3CQ0A 2OZTA 4PMJA 5H8PA 3GDTA 3TFCA 1VEMA 4N9DA 4HJWA 1ONWA 2DU2A 1POKA 3WL0A 3CAVA 3VUSA 1XCWA 1MUWA 2NX9A 3CWOX 2V3DA 3A3XA 2G8ZA 2V5KA 4DO6A 4LFYA 2VFFA 1VJIA 3WH7A 3KVMA 3BAKA 4AD1A 3WKZA 4IIFA 3ARYA 5CAHA 2NQ5A 3GU1A 2DSWA 3VNLA 2X40A 1VFOA 1X96A 2YCLA 3GBEA 5E6ZA 2HISA 5HWJA 3S42A 3KWXA 2W3ZA 4KRTA 4OTKA 4UFIA 4D1JA 1EIXA 2JBMA 1RUSA 1OBAA 4MZYA 4HU0A 3QKZA 1DWIM 2QJMA 3OIHA 2PBOA 5D2VA 2O9RA 1RALA 4KFOA 1OVDA 2WVTA 4RJEA 4DLMA 1PXGA 1F6YA 1DJZA 5EMJA 3SCPA 3TLQA 4OFCA 3UXDA 1JF6A 4D6CA 4LALA 1ME7A 3BLLA 3QQWA 3TYZA 3WK2A 3N9SA 5BZAA 4HNCA 2V81A 3NQAA 3UGVA 5D02A 1OC6A 2IMRA 1L2UA 1EJUC 4H9UA 1U83A 2I57A 3OODA 1YBQB 3B8TA 3TJIA 3WFLA 2YX0A 3W9ZA 4ZL1A 2OKTA 3ATZA 1NWTA 2TRSA 4WOQA 1K4GA 4P8XA 1C9DA 3OHIA 5JIWA 3AROA 4YXGA 2OSXA 2PWHA 1Z41A 5AVNA 3FCPA 5FF7A 2NQ9A 1Q6GA 1R47A 5FA5A 2XFWA 4G7FA 5CJMA 3BMXA 2PF8A 2YBUA 3AMGA 4CNNA 1W56A 2E9BA 2JKPA 4Z0JA 5FJPA 2IXVA 5CBJA 1X7FA 3L4UA 4FF7A 1M6JA 1UZHA 2FFIA 4FO4A 4FLQA 1OIMA 2V2CA 3SCOA 1K02A 2GSHA 2RDUA 1E0VA 1SFTA 1W9BM 5LA2A 5I3JA 2GOUA 3PANA 3DEQA 1VR6A 2X2YA 1EPVA 1HW6A 1QOQA 1RBLA 4PTDA 1GEHA 5D8ZA 1V0NA 3FKRA 3CUJA 3GG7A 1DYSA 5DMYA 1VPYA 2E8YA 3MSDA 4WUIA 1H50A 1AUSL 1XGZA 3LSCA 1Q2RA 1PAMA 3AISA 3OIXA 4XV0A 1ADDA 2OT0A 4N4PA 4H00A 4TIMA 2AQVA 4LW7A 4JHOA 1JPKA 1HO1A 3RXZA 4LBRA 9RUBA 2Z26A 3LENA 2XZ7A 5HMEA 1EEPA 1L8PA 2W66A 4HK6A 4M1BA 1EX1A 5D33A 1OX5A 4FZIA 5EBAA 3ZR4A 4PB5A 1PWLA 2R1MA 1A50A 4S1FA 5AECA 1RA0A 2HXTA 2PMQA 2GYIA 3CO8A 2EG6A 3HU7A 1JDDA 3GTXA 4NAFB 3GVVA 1MW0A 3AS0A 3M0MA 2EQDA 5GJPA 4OV4A 1FP9A 1RLCL 3RPTA 3UA3A 1JXJA 2I14A 4IQJA 3A4JA 3QPYA 1DEDA 2FMNA 4KIRA 4O1AA 2ZUUA 3FK4A 4JN7A 3ZFHA 1PWMA 2QNEA 1CI1A 2HE8A 2EJAA 3P6LA 1GW1A 4DJFC 3GTFA 5I77A 4NJIA 1FKXA 3WUGA 4YTSA 4IL2A 2WKLA 3UXKA 1O12A 2EJ1A 3PBVA 1I1WA 4K8HA 2XH4A 1NDWA 3UGRA 1DWHM 4BF9A 4AWUA 5DBUA 3NAVA 3GB6A 2B7PA 4PFMA 3T8QA 1TJ2A 1LQ2A 2QUUA 3SN0A 1UB3A 1M7XA 3I65A 1XYMA 3PNUA 1E3XA 4S2CA 2R91A 5CJNA 4XUYA 5C54A 3R2GA 2JIWA 3KRUA 5I24A 5M5DA 1ZRQA 4LPCA 4L6HA 3RAOA 5CZTA 3Q58A 3GDMA 1HL8A 2CU0A 4MYAA 1E43A 3F4NA 4K8EA 1BYBA 1A5CA 1OFDA 1KBJA 3EXSA 4OHQA 3V0UA 1FWCC 3IK2A 1YE4A 1OFRA 1DJGA 3N4AA 1XYAA 3N34A 4ZSTA 1BRLB 3EBVA 5CZ0A 2GVJA 3NVTA 4JS3A 1YYAA 4ICCX 3AU6A 3W6LA 3OG3A 1WXYA 3DU0A 4H01A 5CXPA 2CKRA 4MNJA 3CPRA 4N9EA 3SQMA 3W23A 4M1RA 4AU0A 4HNOA 3W1QA 4XISA 1GOOA 4UTTC 1OFPA 4M6QA 3CV1A 4JFSA 1J01A 3IIZA 1XISA 2GK1A 2X09A 5FSEC 4AMAA 3OEXA 5IHSA 4D6JA 3WH8A 1LQ0A 3B8IA 5HNRA 2QS8A 2V5JA 1LUCA 1TTPA 1VIZA 4HPNA 4KWUA 1J0JA 4NI8A 3EX6A 3VD7A 2PI6A 4B2DA 4HA4A 2VUNA 5ABFA 5EY5A 4L4OA 3H7VA 3ITLA 2FZ8A 3GM8A 3A24A 3H54A 1JDAA 1HFBA 1H61A 3RX3A 4DI8A 3BL3A 3AUOA 4AG0A 1Q7MA 4PMNA 1BG4A 4K7VA 2NWRA 4MADA 4RXGA 4WJXA 5CBBA 3VCRA 4YU1A 2J62A 4NILA 5JIPA 2VDGA 3MSGA 3O06A 1HGWA 2XH0A 3T08A 1MFUA 2HVMA 3W4RA 2DW7A 1RPKA 2Y85A 1U1UA 2IKHA 1UR2A 3IVTA 3CXOA 3AYRA 2PURA 3GH5A 5DFAA 1OB0A 2VUYA 4HKPA 1I4NA 1IWAA 3BAWA 3CZ8A 4E3TA 1XICA 1W1PA 3A5VA 4GJIA 5FEPA 3TZFA 3LNMA 3ID7A 1FWFC 1H5VA 3U4AA 1C93A 1KM4A 3TKFA 3WUBA 1LCOA 3HQOA 4EXQA 4U28A 4JX6A 1KR1A 4JTSA 3REQA 3PFRA 3INPA 2GDVA 2RUSA 1XH0A 1K8CA 3WO8A 4OBRA 2G4JA 4B3KA 5A6KA 4GIEA 2RDTA 5BCAA 1DKWA 1YXDA 2WSYA 1BWLA 5F2MA 4UZUA 3F2DA 1OC5A 1E3ZA 3CH0A 3WBWA 3C61A 4Z08A 3R0UA 3B4UA 1W5MA 3PBYA 1UKTA 3EKLA 1OD0A 5CSYA 3PWAA 2J74A 3PHAA 1VQTA 2P88A 3BLFA 3EOUA 2QF8A 5HJXA 4H9YA 1TPH1 1SZNA 2QCFA 2OOGA 4Z2IA 2CIPA 3HIJA 1EGZA 1S2VA 1S5VA 4DVOA 1Y5XA 3KS5A 1LTDA 2X0HA 3F1QA 1KTBA 2CXEA 1M01A 5LIKX 1V6YA 3DFQA 1T96A 1ITQA 3TCSA 1JI1A 3M0IA 1ZJAA 1A5OC 3N3TA 2VDHA 1ITCA 3WIJA 3VX0A 5FL1A 3W76A 1R9YA 4AF0B 2E25A 1VEOA 4NAEA 3W27A 1XIJA 3WK1A 2F61A 3WBEA 4CCZA 2P3ZA 1NP2A 3L2LA 3UPBA 1Z89A 1MW2A 1QI5A 2XU2A 2H90A 1JCXA 2INFA 3VIJA 2C1GA 1JCJA 1VIWA 1FCQA 4IFKB 4ZE5A 3N73A 3AYSA 1OCBA 3I3EA 1V77A 4ZEPA 2NLIA 2Z28A 1HVQA 2D20A 3BAXA 3GR4A 3ZVHB 3UFYA 4PUUA 3LHUA 4J3TA 5HJLA 3ARXA 1ZU8A 1J0IA 1WOBA 4L64A 2RDWA 1UIOA 4AZGA 2OQYA 4RK8A 2YBVA 5BU6A 3LPGA 4MVAA 2W0UA 1JJKA 1KV8A 4V1YA 3HGOA 1WXZA 3ECQA 1Q65A 3W1AA 5FJUA 3EPOA 4IIHA 3SCQA 1CWYA 1V03A 3AALA 3O8AA 3S2NA 4MLJA 1UASA 2J7EA 3WBXA 4GQRA 3TXZA 2XIBA 1CX9A 2HJPA 2X0SA 4N42A 2FTPA 4QXIA 1F2JA 1XF0A 4QP0A 1BYCA 2QIWA 4IP7A 3LNPA 4IMEA 8RUCA 1YDVA 5HPOA 3EA2A 1GNXA 1XL9A 1RZMA 4OVXA 4LOCA 4R9XA 3RLUA 3E0WA 1QRQA 1DXEA 1ZS2A 4DM2A 1E9ZB 3BG5A 4X0VA 1KFBA 2Z0IA 1WXJA 1E4NA 3IANA 2WLZA 2Y63A 2E6AA 3FGCB 4GY1A 1X98A 4GYKA 1FWJC 1H1YA 5A8MA 4AEOA 3TSBA 4AZCA 1DXIA 4HMEA 1ISVA 3D47A 1IQ8A 1ZPTA 3NZPA 5G4EA 5CG0A 4K7YA 5DBTA 3G6MA 4PCNA 4NNCA 3QOKA 3CJPA 5ABEA 3RYSA 3QZEA 1R3QA 3SQLA 5A6BD 3JS3A 2X42A 3O1NA 4JCMA 2XIJA 4MTVA 2V9DA 3GZ3A 4NHVA 1HJVA 5KZEA 4YTTA 3E5BA 3AIEA 4AIUA 1KD0A 1PJ9A 3VZYA 4DUOA 3UJEA 1NIUA 1UP0A 4PYSA 2DT1A 1MZHA 2CESA 3ES7A 3R25A 4JN6A 2GVEA 3VKBA 4UCGA 1CZ1A 1KC7A 4YWIA 1J5TA 1XLFA 3W1RA 4Z2GA 3B03A 5CSUA 4QEEA 1FY6A 4LUTA 2J7DA 4JY8A 1TPDA 3IGXA 5G5IA 4QM1A 4FX6M 3EB3A 1R3WA 1S3TC 3IPWA 3T81A 3V36A 4EE9A 1QOXA 5LHEA 3SURA 4E8GA 1LJYA 1E4IA 4L1WA 4E4FA 2WZMA 4GK8A 4KPLA 2WBKA 1PX8A 1EEXA 3WK0A 3B0XA 4LY4A 2ISDA 1KXHA 5HNTA 1LLOA 1ITXA 1RJRA 3EWCA 3WH9A 4LVGA 2WVSA 2YLLA 2QGYA 4C1NB 3A64A 3F4DA 1X1NA 2BSLA 3GFYA 4ONVA 1ICSA 4GUFA 1JGMA 3SCWA 3EA3A 3WDIA 3EPMA 1OG0A 3W07A 3NTYA 1R5YA 3BE7A 3UWUA 4J3VA 3ANYA 1XC6A 2ISSA 3NQGA 3CZEA 1KQZA 2ZADA 1H60A 3T55A 4Y6GA 4EP8C 4V2XA 3W84A 3FS2A 1LOQA 3LLXA 5DCDA 4UTWA 2DSZA 3GZAA 5A8QA 1P48A 1IXPA 2WPGA 3CHFA 3L9CA 2DFAA 5H8MA 1B2YA 1G4TA 3PPGA 3U7BA 3KCJA 1K70A 3QFEA 5AFDA 3E38A 4IUOA 3TR2A 1XH2A 2PRLA 1LP6A 3OG2A 4DIAA 4M8UA 1XDMA 3VO0A 4HOZA 1JFXA 3E3HA 3QLLA 1E6SM 2G3NA 3O3RA 2BB0A 3M0ZA 1XLAA 2VVSA 5A8NA 4EAMA 3ZWTA 3RU6A 2ZX5A 1IHIA 3SEPA 3LK6A 1E1CA 1QI2A 1EOMA 4KEVA 4ML9A 1WDSA 4BZYA 2YCKX 5BNKA 2YXOA 1Z69A 3GH7A 2DZAA 3PTQA 3HG2A 2YOCA 4C6OA 4QJ5B 1HKIA 4Z42C 1TELA 1W0MA 4YYCA 4OV9A 9XIAA 1SYTA 4PBEA 3GG0A 2REQA 1XLKA 4ATWA 3UXLA 4PEKA 3WQDA 1LT8A 1A3HA 1FHDA 2EO7A 3QN3A 1H7RA 3ARQA 1UW9A 1JIBA 2VURA 2X1IA 4IHCA 1A5BA 2VGIA 1EP3A 3GYCA 1I2OA 1NJJA 3ARPA 3LYEA 1QATA 3W7PA 5RUBA 2C79A 4DO5A 2ZE3A 3ITVA 3F7JA 3FDGA 4XVEA 1V7YA 3Q45A 4LV9A 3A6OA 2JQXA 1HJWA 2HMCA 2NSOA 1ZB5A 3HG5A 1AQHA 2PDLA 7REQA 4EKJA 3GVQA 1DHPA 2EPNA 1Y7VA 5T91A 1RR2A 4GJ1A 3N4EA 1XYFA 5EMUA 2OR2A 4PTMA 1P7TB 1IF2A 4E5TA 5FF3A 1KGUA 3HQPA 4J9JA 2OSYA 2ZBTA 1UWTA 4IJCA 4JFUA 3GE7A 3MBDA 3T44A 3L4TA 2OLSA 2DT3A 1UUMA 3DH7A 1JCYA 1EDGA 2PP1A 3T6CA 3W7GA 1QCWA 3ARZA 2XTKA 2OX1A 1ZJIA 2XN0A 4NRSA 2F84A 3WX7A 8CGTA 1ISZA 3CZLA 4XTDA 3MYOA 2FLIA 3TW9A 9XIMA 1QNPA 4DZHA 2HS8A 3W7JA 2UWFA 1RJPA 3W7MA 2D2OA 1H63A 3N2CA 4FLRA 3IACA 4B5VA 1J0HA 3W2LA 3DGBA 1WOAA 4QHRA 3PUOA 1SZGA 2VC6A 2DZUA 3GXMA 1LYXA 1PUDA 4OJYA 3K4WA 4UBPC 3SB0A 4UQBA 5DT5A 1V6WA 3QZAA 3M5XA 3TZNA 3GXIA 3UZ5A 2NSXA 1BYDA 1HO4A 2UZ9A 1JUEA 4BQ3A 2X1TA 2ZRZA 2XM2A 4M6PA 4IGHA 2XWDA 4KCUA 1B90A 3CIXA 3B0YA 3I6TA 2WM1A 1F9CA 1GZJA 2C1IA 3V0SA 3VIGA 4ACZA 1TR1A 4PUKA 2BP1A 3KXQA 1Q7ZA 3EWYA 2IPWA 3RUBL 4Q8QA 3LOTA 4Q8VA 2CBIA 1E9IA 3KBMA 3WDPP 3H70A 2FVKA 1G1YA 5U4NA 3VUPA 4IIDA 3MO7A 1PYFA 4H2HA 3WF3A 3NURA 4DI9A 4H41A 2GGGA 1ALDA 4I9MA 4F48A 1JI2A 1HX0A 1XLEA 3WEZA 4QG8A 1XIBA 3VFCA 4DWSB 5GNYA 2BOGX 3BQ6A 4BF5A 3LPPA 3TMLA 1FWGC 3TTSA 4R34A 2EAWA 2EG7A 3KLKA 2OJPA 1C90A 5JQ9A 1XKYA 4D72A 2VVNA 4XZIA 1VAHA 3E74A 4PMQA 4Q8TA 1X38A 3Q4DA 1TZ9A 4G5DA 4XK2A 2YDAA 3C52A 4FXRA 5K3VA 1QPQA 3BLDA 1CLKA 4OOZA 5K9XA 3THQA 3S1UA 5DMLA 2EG8A 2YJQA 2GJLA 3RCMA 1SJAA 1I2NA 2G41A 4WOZA 4B5NA 3OB8A 2EF9A 3ZYZA 4JIIX 1B4EA 1OM0A 4IXHA 2P5NA 3FLUA 1A5KC 2PDHA 3TYUA 1QOPA 2BBFA 4JL1A 4CUCA 3R43A 2DUZA 3RGTA 4CD4A 5CBIA 4YVVA 3FJ6A 2HWGA 3NEHA 3MV11 2A79A 4UCFA 1KFWA 1QHOA 2B7NA 1VZWA 3KOXA 1O6IA 4ACYA 1W2PA 5D03A 2WC3A 1H41A 3ELFA 3BMWA 4I9JA 1O68A 5DY2A 2YL5A 1W31A 4HVXA 1C8QA 2DPEA 1TVNA 1UWIA 4ML4A 5HULA 4NKCA 1PX3A 1S2UA 2PB1A 1GPWA 1MQRA 3J7HA 3NPUA 2Y8KA 1TV8A 2X7WA 2H8ZA 3W2NA 3WDHA 4O0QA 4K36A 3IUHA 1AZ1A 3NXFA 4QLLA 2BHUA 4DUWA 3VMPA 2MUCA 3MMUA 3T0DA 3V16A 3BGAA 3CPGA 1S2TA 4ZOBA 2OWWA 5C7VA 4HZMA 2ICSA 1CLVA 3NO1A 1O94A 2PFHA 2VDIA 4NU7A 1XRVA 1VPQA 2PRMA 3LZ5A 5IFPA 1Q13A 1VD6A 1XINA 4MSSA 2CZFA 1SZRA 4UWMA 1UMLA 3R8HA 1AJ2A 4RPPA 4D1IA 3IRSA 1L9WA 3DFNA 5KSWA 1F7BA 4C6BA 2FGLA 1GT8A 3IGSA 2JALA 4ZQOA 5DCEA 2OTDA 2NWSA 3H2AA 5CPTA 4PTNA 3P74A 2EBNA 4WDXA 4ZOEA 3NL6A 4UQDA 1LOLA 1U33A 1PO9A 2YL9A 1UKSA 5KMYA 4MPKA 1RQHA 4XWUA 4BK9A 2ZICA 4W88A 2J47A 4JQAA 1TYGA 2PLMA 1KCKA 1JPIA 3AWNA 4UQ9A 1UBPC 5A1AA 3VABA 3IV8A 1KBLA 4UFHA 1JYNA 5C2GA 5AHFA 1V3HA 1GOQA 3VOJA 3KL3A 4DWDA 3PZNA 3VIKA 3AHZA 1HIZA 3PB0A 5FESA 6XIMA 1GORA 1ZBCA 3B04A 3WD1A 1DTNA 1EHNA 3NL5A 3V1HA 2VI0A 2GGIA 3MCOA 5IRPA 1GOIA 1HL2A 2KX9A 1SZFA 4NNBA 4GC3A 2P10A 1QFEA 4FMVA 4HGXA 3SJNA 3SRKA 4MNMA 4NY2A 3UZWA 3WQOA 2TSYA 5IXEA 4YTQA 1V02A 3R89A 4QFUA 3M7WA 2VD8A 2PDQA 3LN3A 1X6LA 2D0GA 3H53A 3O6YX 4FXSA 4DUXA 4JDYA 4WDTA 3LM7A 4C7FA 4OBSA 3LA4A 1LF1A 1VBJA 4IP4A 4DEFA 2GSEA 3N9KA 4XZ9A 3STCA 4ALDA 4MOZA 3EZ4A 3L4WA 4IM4A 1NWSA 3W25A 3FYOA 4F79A 1OCNA 1BKHA 2H9AA 3VD4A 1H0GA 1OJXA 1E0WA 1GVOA 3UYCA 4LYPA 1F6KA 5IDZA 2DQXA 5K7JA 3GNRA 3QR3A 1W3HA 3B0UX 4S3DA 2CXGA 2VCBA 1A5AA 3BH4A 4LTSA 3M47A 3WNKA 2V63A 1RJQA 3E6EA 2ZQ0A 2P50A 2WKJA 1EJVC 5AHMA 1YNYA 5AHLA 1F8IA 1GPFA 2NLYA 4ZB2A 3VGFA 4JX4A 4CQ8A 4GZJA 3PTKA 3CV2A 4PEEA 3WQWA 5A6LA 4MY8A 1F6PA 3VNJA 1E1EA 3S8HA 1SJCA 1YTEA 2OKOA 5BOOA 2BY0A 3OLEA 2E4TA 2ZRXA 4L4PA 3W7NA 3M1ZA 2HDJA 3BGJA 2E68A 1UD4A 2XUCA 3NPXA 3QW3A 3KHJA 4S3BA 4Z1YA 1C29A 2NQHA 1GVFA 4MB5A 1VHNA 1SW3A 3GAYA 1IEVA 3AYTA 4PMOA 3PZ9A 5J5RA 3HOJA 2ACQA 1PZ0A 3DYMA 1LOSA 3PBWA 2WMHA 3AMCA 3G77A 1KRMA 2Y61A 4XIAA 4C1KA 1CW2A 5E1QA 4V15A 4H6RA 3B05A 2YA0A 1XR2A 1C8YA 2OZ3A 1US3A 1JDCA 4GY7A 5I06A 2JFEX 1LT7A 1JQXA 2X1SA 1XWYA 4LYKA 5BW6A 3URBA 4UMAA 1XD0A 3EWXA 4LF2A 1XI3A 1VHCA 5SWUA 3LHWA 3JU2A 3PJXA 2WMFA 3T2PA 3QVQA 1Q7QA 2TYSA 2Y62A 3KRSA 4XZLX 5BXTA 4ADTA 2VR4A 1SMAA 1K6AA 4XKMA 8A3HA 4X0NA 1E9LA 1W6TA 1IEIA 2FH8A 3MKVA 4YHEA 4GQGA 3ZMRA 2ZVRA 3FAWA 3EYPA 3PUGA 4H8UA 5DMNA 2GQAA 2D0FA 3JRKA 4PUWA 3T0AA 1NARA 3UWEA 1JAEA 2OOFA 4LRSA 3EOEA 1TUFA 4IP5A 2VJXA 3BLEA 4IMDA 1YIXA 1MXDA 3WFZA 2V3EA 3FEQA 4L5ZA 1UWQA 3DBNA 4Y96A 3W71A 4PR4A 1MI3A 4HNLA 1DJXA 1XDJA 1ODUA 3ZT6A 1W5NA 4WY0B 1NDZA 3WBYA 1TJ1A 4ZE4A 2NT0A 4KWVA 3LSBA 3TYBA 2DVUA 1F4AA 4R7OA 3LTYA 1KQYA 2F9RA 1HJUA 5A6SA 5L9FA 4O16A 3M0XA 3N19B 2EKGA 1GWJA 1UIPA 1GCYA 3QV7A 4QROA 3O63A 3USZA 3LCLA 1EUNA 2OXNA 1NM9A 2F6UA 4PA8A 3VK5A 1AQ0A 2ZZ4A 1OF6A 2C7FA 3GC5A 2VMFA 3QH2A 3ABSA 3NQCA 3B8DA 3R0KA 3U6WA 2WMJA 2O9OA 2FH6A 4GA8A 3VE9A 2FHBA 2VEGA 3L7RA 1W3TA 4HHLA 4Q32A 1GUVA 2AQWA 2J27A 3G1HA 3HQNA 4LC8A 2JGYA 1JYXA 1U5HA 1AQMA 1OGGA 1CGWA 3W74A 1V0KA 3WNLA 1W3JA 3PZIA 2A3BA 4RDYA 4UQAA 2NV9A 2VC7A 5D2XA 1YPFA 1JDFA 3VI2A 2BXVA 1IYXA 3RPMA 4JTJA 1UR8A 1AJ0A 2BY1A 2XISA 5JBDA 2ZOXA 3URAA 2DSUA 3IVSA 1T8QA 4WQ6A 2R9RA 3PZMA 3CL6A 1AK5A 4MWAE 4NXSA 1XSJA 4GINA 1RCOB 2I16A 3CU2A 2XSAA 4MAZA 2Y7EA 4GIAA 4PRWA 1MDRA 3ZWSA 4RUBA 5DELA 4Z2HA 4FAMA 1UA7A 2NV1A 1WKEA 1RA5A 2Q3OA 3MU7A 3QOMA 3WJZA 3NG3A 1TPC1 4OU1A 1V0LA 3UA4A 1XLLA 4C7GA 5AB3A 3TA9A 2Q8LA 1F3TA 3DECA 3VOCA 4C60A 2VZSA 1PTDA 3OLIA 4K6AA 3H8AA 4L4MA 1TIWA 4QTGA 3MV01 3G1VA 3WJYA 2QCHA 3KRZA 2OYMA 4FOUA 1U30A 2Y5SA 2DEPA 3SECA 1AJZA 2HTMA 4J3UA 1GEQA 3NM3A 1QNSA 4D6EA 1UOZA 1H09A 2F6KA 1B9ZA 4U2YA 4PUDA 2BGQA 5HATA 5H2ZA 2H3DA 1Z8AA 3TYAA 3HQ1A 3OVPA 4WSJA 1W3KA 3QY8A 5M3WA 3KCLA 2RGMA 5A3HA 1JRCA 3GQYA 3AZSA 2C16A 4JIRA 2DUXA 4GHRA 1FXPA 3KBJA 4Q7IA 1A5NC 4I5UA 3EDDA 2IQDA 3GC2A 4QX4A 4ATDA 3ZXWA 1WZLA 1L0PA 3GWQA 4FB7A 2EPOA 1PKYA 2QZRA 3PB2A 2GVGA 1GZGA 3B97A 3WN6A 2VZVA 1XIEA 6ENLA 4PSRA 4JKLA 3CAQA 3NIYA 4HZ8A 4AZHA 3N13A 2EXOA 4ADSA 3HA1A 5H91A 1GG1A 4JBRA 4J3WA 1CPUA 4ZB0A 4NX5A 2RH9A 2V8ZA 1IR1A 5CLWA 3W7LA 4OBTA 3VX1A 1KA9F 1JL8A 1EGMA 3NA8A 1TPUA 4H8NA 5CPMA 1JZ2A 3WUEA 5JH1A 2I1OA 3S5ZA 1XYLA 4HHMA 4IMGA 2GVLA 4TV5A 2OPJA 1OZMA 1UH4A 3UP8A 4MY9A 2BVDA 3LV5A 3EB2A 3TP4A 2FB3A 1TWDA 1AD4A 2TAAA 3OLDA 1EA9C 3NUKA 5LIUX 5U7SA 4JTQA 1CDGA 3PPFA 1X39A 3Q94A 5K2ZA 3IV3A 1DVJA 4MUZA 4PMYA 3BARA 3E2VA 4UNLA 5ABTA 5F7UA 2PDKA 3E0LA 4GI9A 3WYZA 3A4WA 3QZ6A 3ABXA 3TN3A 4JQ2A 1OT1A 4C6EA 2C1HA 3W2UA 3ARTA 1EF2A 1AH4A 3AS2A 4HA0A 4R7JA 5D4YA 3PP7A 3OO2A 3GVRA 3MSYA 1Q6DA 2XIIA 1ZP3A 4GYPA 3K8KA 3SUUA 2ISFA 3LGDA 2CLEA 1XM3A 2QJGA 3K13A 1BF2A 1RK6A 5GVJA 2DT0A 5AYYA 3G1FA 4F2UA 3HV9A 4J2MA 5DXXA 2VX6A 3RITA 4AQLA 4EXBA 3CC1A 1A4LA 2WVVB 1TA3A 4MWAC 4XKYA 2ZYFA 2VOMA 3DYOA 1ICQA 3CQKA 5D04C 4S3EA 4GFSA 3NM1A 3W1XA 2WC7A 5MKGA 3SW6A 3WLIA 3C2OA 1JQVA 3POCA 4UOZA 2IKIA 3C5QA 4L65A 2J4GA 3EWUA 3LS9A 4AZBA 1PKLA 3S3GA 2WB5A 5KEZA 1REQA 3LXBA 3TYDA 4DXXA 1FQ0A 3E0FA 3W1LA 2ZZ1A 1QJWA 5TQLA 4CD6A 3C3NA 4AMCA 1NY1A 4D6HA 4CNUA 3TTQA 4XO6A 4O1DA 4IMAA 3PUDA 4Q4OA 4AHPA 1ZAJA 3VDBA 3K4AA 4KWSA 4XIMA 1BQCA 5REQA 4PB3A 3RR1A 4O1CA 4FEZA 4PTWA 3UG8A 1V8EA 5A6BA 5IBXA 4EX4A 2J24A 3GTHA 3QV8A 4AC7C 1FFQA 2ZUMA 4U3CA 2XH2A 3CTLA 2QDDA 3ITTA 3TJXA 3PZVA 5D38A 3TR9A 3WLHA 3GXNA 3TNBA 4MB1A 4HK7A 3CMGA 5JBEA 2EPMX 1WZAA 3WQ8A 1Z9AA 3LQLA 2FYMA 1NFBA 1ADOA 3GHRA 1JUBA 3VFLA 3DKJA 4DWSD 2VENA 3GDKA 1S1RA 3RNDA 1HQTA 4BCEA 2YGYA 3K8LA 5E6YA 1AA1B 4AY8A 2CNCA 5HQMA 1Y65A 1PHWA 3D3AA 1RP9A 4NXKA 4QDWA 1XIMA 5E5CA 5IDIA 4H6KA 2G4FA 1KM2A 4IQEA 4K2SA 4MKVA 1VYPX 3LV6A 3CB3A 3VNIA 1SMDA 1W5OA 1QK2A 3FN9A 3I68A 3LZ3A 3H24A 3O0KA 1FH7A 1YNPA 4YCPA 2YA2A 4D6GA 1FTXA 4TX8A 1TTQA 3WH5A 2XYLA 2I9EA 1DOSA 3RM8A 3OVQA 1H5YA 1JD7A 3IRDA 2DJXA 3W1UA 1PHQA 4GRSA 1GOWA 1XKJA 1IT7A 4O15A 2WMIB 1DIOA 4M19A 1T8XA 4WKHA 3COTA 3MYPA 1X97A 1QNRA 3S1VA 2ZUNA 1CBGA 3H2CA 4FOJA 4NASA 1JZ4A 4UTHA 4V28A 1GVEA 2RAGA 3BANA 1FWIC 3WMLA 4KEMA 4K1GA 4CGTA 3AJ7A 1KWGA 1P6CA 1E6NA 1JZ8A 4UTIA 2E28A 2BS9A 3LMYA 4KF1A 3VOIA 1MNSA 1LQAA 1NWRA 2A3LA 3O7UA 3OOQA 1GHSA 4AVFA 4E8CA 3VA8A 3U2OA 2OLAA 5D05A 3U57A 1YADA 3KWSA 1UROA 3FW6A 4EACA 1E6PA 2FJKA 3I6EA 1GOMA 4O14A 3EDKA 4WF7A 6CGTA 1S2AA 2XJ7A 3GU9A 1XJBA 5FOOA 3DAQA 5A6TC 1XRFA 3L0KA 2G97A 4DLFA 3O05A 1MRAA 3PZGA 3N17A 2XVKA 3HBLA 3PUEA 1BWKA 3N2TA 4LV4A 3T4CA 1T99A 3B8UA 2WSKA 4J4KA 2WOQA 3T2QA 4AVNA 3UU0A 3PSWA 3PWIA 4DUVA 1A5LC 2PDBA 4JTRA 4OZOA 4GVHA 1I6NA 1G01A 3TTOA 1J0YA 4WGXA 4F40A 2ZVIA 3R4IA 4LRTA 5CQ1A 1LUCB 3BSGA 5ABGA 1Q6CA 4D6DA 1GQJA 2JE8A 4TX9A 3UBPC 1MDLA 1DIKA 3SUSA 5A5WA 3QGKC 5E0FA 4KFNA 3GW3A 3EWDA 1A0EA 4O13A 1E0TA 3EXRA 2PTXA 1HKWA 1CXLA 3WLMA 1KKOA 3QKEA 3SY8A 4Q4RA 3WF0A 3CYVA 4BI6A 3ARVA 3L67A 3QC0A 4RE2A 4ROPA 3CEPA 1YBQA 4FALA 1YE6A 1XFCA 2XSXA 1VP5A 1H2JA 5HAOA 1UP2A 2Y88A 4QJ3B 1GHRA 4GD0A 2WJFA 1L2QA 4AZ7A 4GO8A 1J79A 4IJBA 3UCCA 1QDSA 2AMGA 5BMXA 4A2SA 1SO4A 4M51A 5A2AA 4CQAA 1SM9A 1BXBA 3KRBA 4AX6A 4JKMA 1KGXA 3W75A 1OGBA 1W1A1 1E0UA 3R13A 4Z1BA 2Q02A 2DVXA 4WZHA 4IOTA 2PP0A 1EP1A 1BQGA 2I56A 3LERA 2O9TA 4W85A 1SQ7A 1F07A 2WK2A 3VZZA 4GXWA 3VZXA 4XD6A 3CQIA 4FR1A 1QWKA 3CMJA 2BY3A 2DGAA 2Y24A 3Q65A 4JFTA 1AL8A 3U5YA 1IEWA 1XRTA 3VE7A 8XIAA 2CBJA 3SN4A 1RCQA 1V3KA 1BD0A 3NCOA 1EWEA 3V18A 3P81A 2RDXA 2QDEA 4D6FA 1NDVA 3DGRA 4N02A 4AX7A 1FWNA 3U2EA 1UKPA 3U8GA 1OFBA 2Q8ZA 3TH6A 4PCFA 3LI1A 1CGTA 3OGRA 3LRMA 3UR5A 4AIBA 1QI3A 1UR3M 1FOBA 5CEWA 5I03A 4Y90A 1VB9A 5FF0A 4JCLA 1U5JA 2F2HA 2QF7A 2E77A 3VKDA 3VOGA 1VCFA 3EKGA 2CLMA 3QFWA 3F03K 1IZCA 3RRXA 4AH7A 1G5AA 2PODA 2BGNE 3PZTA 4CD7A 2BOFX 1MUCA 2J7BA 2Y70A 5E09A 2RHGA 3ZZ1A 3TROA 3QHMA 3HZ3A 4LVDA 3S5SA 3OPSA 1QBBA 1WKFA 1MXSA 2OO6A 2Z2AA 4DZIA 3SCTA 2OELA 1CXFA 2WMKA 3HGRA 4HB7A 4BQ5A 3DKLA 1VCGA 3URQA 3CIWA 2E9LA 3O6CA 3CQHA 1KFEA 3V35A 4DJFD 2D1ZA 3IUDA 2VCCA 3DOPA 4FA3A 1XD1A 5F1UA 2VEMA 4C91A 3W72A 3MMDA 4AFYA 1K7EA 1MWOA 1OT2A 3WQPA 1PDYA 2ZC8A 4IPLA 5HOSA 1XGDA 3WG6A 1FBAA 4GYPC 2ZZ5A 3TSMA 3JUGA 5JXQA 3QY7A 2C15A 3AU2A 3VILA 2VFIA 3NGFA