4AF0A

Crystal structure of cryptococcal inosine monophosphate dehydrogenase
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
522
structure length
395
Chain Sequence
b'TNPNAPPRPDSLLNPSDALKHLEEYPRGDGLSLQELMDSRKNGGLTYNDFLVLPGHINFPASDVSLQSKATKNIVLNTPFLSSPMDTVTEDRMAIALALHGGLGIIHHNCSAEEQAAMVRRVKKYENYPYASKVPESKQLYCGAAIGTRPGDKDRLKLLAEAGLDVVVLDSSQGNSVYQIEFIKWIKQTYPKIDVIAGNVVTREQAAQLIAAGADGLRIGMGSGSICITQEVMAVGRPQGTAVYAVAEFASRFGIPCIADGGIGNIGHIAKALALGASAVMMGGLLAGTTESPGEYFYHEGKRVKVYRGMGSIEAMEHTGLDNAATARYFSEADAVKVAQGVSGDVADKGSINKFVPYLFTGLQHSLQDAAIKSVSELHSCARSGSLRFELRTAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
publication title De Novo GTP Biosynthesis is Critical for Virulence of the Fungal Pathogen Cryptococcus Neoformans
pubmed doi rcsb
source organism Cryptococcus neoformans
molecule tags Oxidoreductase
total genus 123
structure length 395
sequence length 522
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2012-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4af0A00
1TQXA 2ZYFA 3UWVA 1Q6OA 4FXSA 2GVLA 4OV9A 1H51A 3G1XA 3TH6A 4Z08A 2GVGA 2E77A 4K37A 4UTTC 3MI3A 3FIGA 1R2RA 4BI5A 3WJZA 2WNZA 2QCGA 3TR2A 4UMAA 4KKXA 4XTDA 1NF0A 3C2RA 3NGJA 3S1XA 4H6KA 1UCWA 3S1WA 1GVQA 3CC1A 1I2RA 2ISWA 4O4WA 4GXMA 1E51A 3DFTA 2DP3A 4MIMA 3NL2A 4O50A 2Y7DA 5DY3A 1SFJA 1JR1A 1TRDA 2E6FA 3LHUA 2Q8LA 1AW1A 3HB9A 1SUXA 3VCRA 3FKRA 3UWYA 3M16A 2ALDA 2E5DA 4UFJA 4FNRA 3PBUA 4S1FA 3SGZA 5TIMA 4JR5A 6ALDA 1ZCOA 4KFNA 5I3JA 3TROA 1SU5A 1TMHA 1LYXA 3QJAA 3R5EA 5FEPA 4KWWA 3LBCA 4ZQNA 4RJEA 5LGZA 1J2WA 1OX4A 1GWJA 3H55A 1ZALA 4TMCA 2QCNA 3GIYA 1KM4A 1RR2A 3THAA 2DJLA 3BLIA 3D0CA 3EXTA 5LNRA 2TYSA 2NV1A 2VEIA 5U4NA 3HGJA 4D2JA 3JS3A 2WSRA 2EF9A 3IIZA 1NFBA 5IBXA 3HGOA 4PC8A 1JQVA 3W7QA 3SIZA 3TU9A 2C19A 3BG5A 3TW6A 3HG3A 4JN6A 1K7FA 4C1LA 3LXBA 1OYBA 4CCCA 1O60A 4M5PA 1F6KA 4H3DA 1QOQA 4I7WA 3LHYA 2TPSA 5C2XA 2QAPA 4WY0B 3L0KA 2CZEA 3N9RA 4JICA 3ABSA 3SY5A 1TTQA 1JUBA 3SSJA 5G4WA 2UV8G 1CI1A 4BWLA 3QM3A 4P2VA 2RH9A 1UB3A 4HSOA 4EF8A 1WXJA 1BKSA 3QW4B 3H53A 3MP3A 3NQEA 4LRTA 1OFQA 5AFDA 2FQIA 1K03A 1TRIA 1FBAA 1TQJA 5C55A 2X2GA 5CSSA 4OE7A 4AWTA 5F4XA 1MSSA 3DH7A 4I7VA 3EWWA 1TPH1 1W8SA 3FJ6A 1LBLA 1VLWA 3A5VA 4A3UA 3W7DA 2ZRZA 4PL1A 1UUMA 3GAYA 1K7XA 3QEZA 3L21A 2NUWA 2E5CA 2JGYA 3GLCA 5CPMA 3HG2A 4O52A 5HUOA 2ZZ3A 1O95A 2GPTA 4O10A 3W22A 1PCKA 3O05A 3Q58A 5D09A 4YLWA 1I2PA 5IBXC 1QAPA 2I14A 3QH2A 3W7IA 1H63A 3M1ZA 4A22A 1P5BA 1G67A 2A7PA 2DZPA 3G1HA 1EP3A 3I65A 1DV7A 3L67A 5HR6A 2DZVA 1H61A 5HWMA 4GFSA 3O1NA 4IXHA 4CQAA 5LNUA 4PTNA 3TC6A 4Y9AA 3QYQA 2R94A 3GYEA 4RLIA 3BW4A 3E02A 4ALDA 3U6WA 2FPTA 3TKFA 5F2MA 2WNQA 4JY8A 3LCWA 2V8ZA 3VNDA 3FS2A 4NZFA 2J24A 2FJKA 3R8RA 4BWLC 3O6YX 4YXGA 2NUYA 3RMJA 3EWXA 2J9XA 2ZRUA 3FKKA 1EEPA 3LXAA 3GAKA 1WX0A 4UMBA 3STFA 4H4IA 1WAUA 5F2IA 2FDSA 3W1TA 3W70A 4M7TA 5L6UA 2QUUA 1ICPA 2CLFA 4MY8A 1PCWA 5AHIA 1G69A 3A24A 4BF9A 1RV8A 3JRKA 3M5YA 4JTGA 4MYXA 2ZTKA 3P67A 3FYPA 2WOQA 2FTPA 2QDGA 3IGUA 3LDVA 2P0OA 3IIVA 4O11A 2Z2UA 1JCLA 3T40A 3W2MA 2VFFA 3M6YA 4AEOA 4UFMA 3NPWA 2BTMA 5K7JA 2CLLA 3EEGA 5AYZA 3N34A 3PBWA 1JUEA 3A9IA 4O12A 3P5ZA 3NPUA 3UQNA 3TFCA 2A2IA 3EWBX 2ZRWA 4LOCA 4RXGA 5D2XA 1RQHA 3C61A 1AK5A 2NXHA 4HHPA 4E2BA 4RK8A 3TCEA 5CG7A 1EUAA 1G4SA 4OQVA 2DU2A 1IXPA 1TIMA 2A85A 1OABA 2TRSA 3G1FA 3MYPA 3IGSA 5C6MA 1MO0A 2B4GA 2Y6ZA 3TXZA 1GVFA 3C2OA 5C5YA 3HGRA 2DZSA 1QPQA 3KX6A 4DPPA 1KA9F 3K30A 1PIIA 1TO3A 4MFEA 1FWRA 3MJYA 4HNNA 3F4WA 4FNQA 1H7WA 4NJGA 3W7GA 3OEXA 4P61A 3UZ5A 5J5DA 4MFDA 3PY2A 3PF3A 2AAMA 1VC4A 2H8XA 5D33A 2EKCA 2B0MA 4KFOA 5F4SA 5EKYA 2V2CA 3EX4A 3RLVA 1KW1A 1KM2A 1L6WA 1JCJA 3C3NA 4JIPA 4M6QA 4ZMGA 4PFMA 5G4EA 2JGQA 4XZ9A 3UWQA 3W7HA 1DQXA 1H60A 1IIGA 3LTSA 1KLYA 3USBA 1OHLA 3W85A 3NO5A 5D30A 3S0CA 2PRMA 3BLEA 1SQ7A 1X7FA 4OU1A 2VOMA 5I3KA 1R46A 4DF0A 3ZS4A 3ZWSA 3RF9A 4UUIA 2QCMA 1WOAA 2FPVA 3C4UA 3HMJG 3M43A 4JTSA 3W86A 3O06A 4NNAA 3GDMA 2FB2A 3NPVA 4U4MA 1GPWA 3PVFA 3S42A 1LDCA 3V75A 2I9EA 3N73A 1RD5A 5FESA 1WQ5A 4QQ3A 4IXXA 3LHWA 3PSVA 5EYWA 4LRSA 5K9XA 1KTCA 1EWDA 3P74A 1PV8A 1LM1A 1ME7A 5HULA 1XKYA 4NNCA 4MJZA 3KXQA 1G4TA 2A7NA 1TPVA 4MUZA 2HS6A 1F05A 2CLHA 3IIPA 2QCHA 3ANYA 1L6SA 1KM3A 1FCUA 4UXDA 1V5XA 7TIMA 1W3NA 3DGRA 1Z44A 3DXIA 1DHPA 1LLWA 4DBEA 2DJXA 1D3HA 1GTEA 3NR0A 4UTLA 5AYYA 5FF7A 5K4ZA 3UZJA 2YCEA 5D38A 1J4EA 5KITA 1KFJA 4FNTA 4TU1A 3T7VA 3B8DA 2PRLA 1TV8A 4LV4A 2GJLA 5F4WA 3GX9A 4JIQA 1SR9A 3P60A 2BLEA 2DZXA 2XFWA 4WZHA 1F7BA 1QCWA 3CIXA 4O1CA 4EF9A 5KZEA 1QPRA 3RU6A 4QITA 1J5TA 1IF2A 4FHAA 1JUKA 1FCBA 4UIOA 2C3ZA 3LERA 5TQLA 2QJIA 3BVJA 2ZZ1A 1JCYA 3W1QA 4DPQA 5T26A 1PE1A 3F03K 4JTUA 2VEPA 2A5HA 2V5LA 1ML1A 3C8FA 2QCFA 4BK9A 1FX6A 4O17A 1VH7A 2F7FA 5DBTA 4MY9A 5AC7A 1LRTA 2NXGA 1HO4A 3MI6A 4K39A 2QKFA 4RCXA 3W7JA 1ZY9A 4K6AA 1IIHA 5G1TA 1IXQA 1KFKA 4XKYA 3DENA 1T99A 4W9TA 2DZTA 3W7OA 4JTFA 1C9DA 3W1MA 3M7WA 3TSDA 3W1RA 1OVDA 4NT0A 1H7OA 5E1QA 3HGSA 2C16A 4KFPA 2AQWA 5CZJA 3MP4A 3M41A 3LOTA 3W2LA 1DOSA 3BG9A 3FOKA 1M6JA 3E96A 1ZHAA 1ONRA 1SZFA 1XFBA 1KFEA 1OX4B 3BPWA 2PC4A 3SZ8A 3N19B 1SW0A 4LW7A 3DFOA 1W5OA 1EP2A 3IVUA 4HPJA 3LTYA 5FEXA 1AMKA 4LWWA 4OT7A 1R2TA 5LZLA 3M5XA 1A53A 1GG1A 2OT0A 2J9ZA 1T8XA 4N9BA 3KRZA 4MVAA 3BW3A 4IOTA 1F73A 2BXVA 3T78A 3S5YA 1QPOA 5HWNA 4LY8A 1ADOA 5D05A 2A0NA 3WK0A 3C0JA 3T55A 1KM6A 2A6LA 3DFNA 3HPZA 3Q94A 1UBSA 5G1YA 1RQEA 4JX5A 1ZAIA 3MBDA 3S5NA 4NZJA 4Z0JA 1P0KA 3UY7A 1A5AA 4N4PA 3KHJA 4QISA 3PM6A 4UTJA 2IQTA 3L66A 2RFGA 3O6DA 2ISVA 2V30A 3MHFA 4UTMA 1LORA 1XM3A 3UPBA 2E09A 2YGYA 5G2HA 3G1DA 5EA9A 1O5KA 2C1HA 1W5MA 4IMDA 1CX9A 3TQKA 4GUGA 2Y7FA 3UPWA 2ZA2A 3THQA 1OFRA 1DKWA 3MHGA 5D37A 2E6AA 3CU2A 4Z1AA 4X9SA 3DKJA 3HO8A 4N9CA 2R8WA 4LC8A 3QQ0A 4LS1A 4L4LA 3W1AA 4C1KA 3JR2A 1GQNA 3M0ZA 2ZBTA 1CW2A 3TXVA 3GDLA 3W2NA 3FLUA 4MKNA 4UNLA 4JYEA 1SPQA 1YPIA 2BX7A 1FDJA 3C2VA 2X1TA 3UD6A 4O57A 2VFDA 3CM4A 3W88A 3HBLA 3DHDA 3ABRA 2ISSA 4HT3A 3BGGA 6TIMA 2NX9A 4S2CA 3NEVA 1KTBA 1I2NA 5FF2A 4UFKA 3CPRA 1FXPA 4M7SA 1H1ZA 2VEMA 2A6NA 3N3MA 5AC6A 1G7UA 2ABBA 3KVLA 4CNNA 1KV8A 2B7NA 2X1SA 2O7SA 4DF2A 1H62A 3G8RA 5G5IA 1QO5A 1XUUA 1GYLA 2G95A 3U8GA 4AVFA 1FCQA 1Q3NA 4O1BA 5DBUA 5TBOA 3EWUA 1KM5A 1Y0EA 4N4QA 5FEZA 1XBZA 4Y6GA 3DI0A 3GDKA 1F76A 2GQ8A 3P84A 4JTIA 3C52A 3LX9A 1RZMA 5F1VA 3WK2A 3LB0A 3G1SA 3CWOX 1B9BA 2ZA1A 4LVFA 1AW5A 3NQFA 4TIMA 1QFEA 2CW6A 1KFBA 3MBFA 2ZDRA 3R12A 1XBVA 3SECA 3N9SA 3L9CA 1K02A 2QR6A 5U7SA 3BG3A 3P81A 3I7RA 2YYTA 5A8GA 1OF8A 1YDVA 3TQ0A 3S1VA 2JKAA 2VC6A 4GBUA 1JQXA 1K3UA 3O63A 4WOZA 2JKEA 1A50A 2QJGA 1G4EA 3G3MA 3E0IA 2CU0A 4L4MA 4O15A 3SJ3A 1F5ZA 3TNOA 4AF0A 1SSDA 1IGSA 5MHBA 1LOLA 4NUWA 4XBKA 3Q37A 4MZYA 3LHVA 3NQGA 4HKPA 4EOUA 3IV3A 1FXQA 4K8EA 3UWZA 3HPSA 3W2KA 2F84A 3NNTA 2QJHA 1ZAHA 1MXSA 1RPXA 3NM3A 5AN7A 3E12A 2GVJA 5K9DA 1OYCA 4AMAA 4YWIA 4BI6A 1H7XA 3PC0A 4XQ6A 1QPNA 3GB6A 4GRSA 2EHHA 1LLZA 2Y70A 1NVMA 1BTMA 4GUFA 2ABAA 4IPJA 2A1YA 4O0ZA 3I68A 3M5VA 5LNVA 1H7NA 4AH7A 3LI0A 3H54A 1JULA 4IMGA 3W07A 1IXNA 3TJLA 3GR7A 3OG3A 4FX7A 4K7YA 1AG1O 1SZEA 3TW7A 3WJSA 3ATZA 1GZGA 1X1OA 3OHIA 1VPXA 4XWUA 2ZZ6A 2RHGA 3QRHA 4IPIA 2YXGA 3AO0A 1N8FA 2NZLA 1EX5A 1DJNA 3B04A 4FXRA 3MYOA 1ZNNA 3PWAA 1KM0A 3ELFA 3TMLA 3F4NA 2XN2A 5HR7A 3NQ2A 3ABOA 3N2XA 4ZQMA 5FI8A 1P4CA 4XBSA 4PH6A 4R7JA 1OFOA 3Q2DA 4UTKA 3QPYA 4POCA 4ZVJA 1TV5A 1XXXA 4X2RA 1PHWA 1ZENA 1L2UA 2WQPA 2TSYA 5HMSA 4FNUA 1OF6A 1B57A 4RZ5A 3I7SA 2R14A 4UTIA 4ADTA 5HNRA 1OFDA 3NPXA 3GDTA 2CZDA 5DY2A 1TB3A 1ZAJA 4OGZA 4O0KA 1YYAA 2GQ9A 3TMQA 3IIXA 1XBYA 5GVJA 3O16A 4CQ9A 3CEPA 3I7QA 4TO8A 3W6YA 1O5XA 5AC8A 1LRQA 2OT1A 4TR9A 4GE8A 2X1RA 3L5MA 3PG9A 2CZ5A 4OV4A 5BOOA 1SZGA 3E9AA 1QR7A 1Q6LA 2ZZ5A 2Q3OA 3W3OA 4Z1DA 5EY5A 2P10A 4UTHA 4XTIA 5DELA 3IEBA 3KVMA 1VLIA 1LZOA 2QCDA 5CSRA 3UY8A 1EPXA 3NAVA 3QMSA 3NVTA 3EX2A 4JYDA 5J5RA 4LVAA 4UFHA 4DF1A 3R89A 2V81A 4N02A 4AAJA 4CNOA 4K36A 5CPOA 3HJZA 1IXOA 4LS2A 5DCDA 1MEHA 3BV4A 4IQLA 1GTHA 2R91A 3HF3A 1EB3A 1FWNA 4A21A 4UTUA 4QIUA 5D2YA 1H5YA 5CZ0A 3W7EA 4UC5A 3B0UX 3GXPA 2WSQA 2ATMA 3STEA 3NM1A 3O07A 4EWND 4OHQA 1B3OA 1JRBA 3A5FA 3QW3A 4HSNA 1LOQA 1I2QA 1W0MA 3BO9A 4ML9A 4PL2A 4Q33A 1ZFJA 1R30A 2Y7GA 5AHLA 4YCPA 4ONVA 5BRBA 4ZZ9A 2HSAA 2QAFA 3GR8A 3IIOA 2OZ0A 3TV8A 3NL5A 2VFHA 4WUIA 4MLJA 4LC6A 2VFEA 3O6CA 1YADA 1R47A 4R33A 4NNBA 3QFEA 2ATSA 2A4AA 1DQWA 2X30A 3W1NA 1SO4A 3S8HA 4O1AA 4GUJA 2TMDA 1LRNA 1A5BA 3W74A 3W7PA 4GUIA 3U2OA 5HWJA 3WFAA 1EWEA 1TPUA 3LCGA 1D9EA 2BWGA 3GZ3A 4FX6M 1GYNA 1P0NA 3DKLA 3SI9A 3WJXA 3PUDA 5DCBA 3CQ0A 3FYOA 3E49A 1ALDA 4UFIA 1W3TA 1HG3A 3ZWTA 2CLEA 4HN4A 3NDOA 3M5ZA 4KWVA 2EGZA 3DFQA 2RDTA 3B05A 4M19A 3W72A 2YW3A 1G4PA 1LTDA 4OBTA 2V2HA 3DAQA 1LBMA 2Y89A 5I3GA 3OVQA 4DO4A 2WV8A 3PUOA 4DQWA 1X1ZA 3G1AA 1VCGA 1VYSX 1Q6QA 1FWTA 4WXYA 1A5SA 2B7PA 1C8VA 2YR1A 2V82A 4M6VA 4JD4A 3C2FA 3YPIA 2V2DA 2X1UA 2QCLA 3A23A 3NG3A 4UNKA 2Q3RA 5KINA 4MZ8A 3O15A 4WXZA 4WD0A 1B4EA 5CZSA 4CQ8A 4EVZA 1TYGA 2G5WA 2W0UA 4IMEA 3DU0A 1ME8A 3NQDA 2DZWA 4O16A 4RXFA 1W5PA 1OYAA 1VRDA 2YSWA 3M9YA 2NV2A 2FB3A 1WBHA 1WA3A 5AHMA 2AGKA 3CIWA 1W31A 3TX9A 4LVGA 1SFLA 3LCIA 2A7RA 1KBJA 5H2ZA 4QSHA 1TPB1 4EIVA 3B4UA 3QF0A 1XCFA 3CT7A 1TSIA 1Z48A 5EPDA 1WYIA 4A2RA 1P1XA 3T4CA 5HJLA 1KBIA 4MLRA 3LRKA 3W73A 3CHVA 3KFTA 3OVRA 4UMCA 3BGJA 4NQ1A 5LKYA 4N6EA 2WKJA 4UR8A 1T96A 5EL1A 3S9YA 2RDUA 3NQCA 2Y61A 4JTHA 2VFIA 1H1YA 2H3BA 2WSYA 4MPQA 4UTWA 5E93A 4RZ6A 3L2IA 4DO5A 4S2BA 1S5WA 2PURA 4NXKA 2Z1BA 1GVSA 2ZRXA 2Q8ZA 1LOSA 5CZTA 3QSRA 4YCOA 2E1DA 2PRHA 1FCVA 4LVBA 2V0TA 1KV5A 3V1PA 3EWYA 4NJKA 2J27A 3TE9A 3W76A 1DJQA 5LHFA 4AWSA 5HINA 2YDAA 2XN1A 4LNYA 2C0AA 1LCOA 3NOEA 3LCHA 3PR2A 3LRMA 2EAWA 4QNWA 2ZZ7A 2YX0A 2Z0IA 3G0SA 4MJMA 3QQ1A 3B06A 4IUOA 5BMWA 5K4XA 3W7NA 4JS3A 1BWLA 3FJLA 4FNPA 3R13A 4BFAA 1OFPA 4N9DA 4AB4A 3AJXA 3STCA 3P5YA 3F1QA 4N6FA 3LV5A 4J9JA 5D02A 4RR4A 4UFLA 3QMRA 1JCMP 1NF7A 4X3ZA 4DBDA 3GNNA 4UCGA 4LS0A 1GT8A 3MI2A 1OFAA 5I3HA 4AF0B 4NJJA 1MEWA 4M6PA 3LI1A 3LLFA 3OBKA 3FA5A 3TAKA 1F74A 3TJXA 1WDWA 4A2SA 3PAJA 1BEUA 1LP6A 5AHNA 3HG5A 1SW3A 1F2JA 1YLVA 3MP5A 4I7UA 4MOZA 4UTWC 3OVPA 3KVJA 4ORIA 4ADUA 3CB8A 4ICNA 3KVKA 4JDYA 4R53A 1XUZA 2QUVA 3RFAA 3G22A 1V7YA 1JVNA 5D2WA 2OJPA 2C13A 5G2IA 1XDLA 1K8YA 1W37A 2NX1A 4HNUA 1DL3A 2Y62A 4RKAA 1I2OA 3O8AA 3W2UA 5DXYA 4YL2A 2GUUA 1YTDA 1N55A 3LBMA 2H3DA 1DVJA 1ZJIA 3G24A 3UXDA 4K38A 1QOPA 3SGUA 1TPC1 3P8IA 3B0VC 4LUIA 3P62A 2XN0A 4AHPA 3LV6A 3LHTA 5KZDA 3GKFA 1K7EA 3HOJA 3MW7A 1Z41A 1SZNA 4ZQRA 5K9CA 2HS8A 4QAIA 3TA6A 5FF0A 4N9EA 3HG4A 4OWGA 2NXIA 4FIQA 4WOQA 3MMTA 3BK0A 1WOBA 1OK4A 2FLIA 4QNEA 3CWNA 1TPFA 4BI7A 1W54A 1VHNA 4JX4A 2FPYA 3TC7A 2O7QA 3SW6A 2C6QA 3N2MA 1DORA 4WX2A 1HL2A 1EA0A 4U28A 3PBVA 4UR7A 1TTJA 5EMUA 4FB7A 3WJWA 3P61A 4MYAA 3RLUA 1VYPX 4IGHA 1M5WA 2CLKA 3KRUA 2NWSA 3W71A 1M7PA 4BR1A 4R34A 2VENA 2X16A 4JEQA 3BLFA 1X6UA 1FDZA 2Y7EA 2NX3A 5CKSA 3UWWA 1HFBA 8TIMA 1QWGA 3B0PA 1WBJA 4O54A 1TCDA 2DORA 3ZR4A 5LSMA 2YFNA 3M44A 3KOFA 4GC4A 4Y90A 3EXRA 2YZRA 1VHCA 1JJKA 4NX0A 1FWSA 4IMCA 4RZ4A 1L6YA 3STGA 1HUVA 1QDSA 4Q4KA 2ZTJA 1JCXA 4JTLA 1GJPA 4LT9A 3LCFA 4JYFA 1VCFA 1AL8A 2QCDB 2VKZG 3G3DA 1N7KA 5D2TA 4JDBA 3L5AA 2BSLA 4JGDA 4HIBA 1ICQA 3LGEA 5ABTA 4O14A 2JBMA 3S6DA 2C18A 3PSWA 2E6DA 2Y85A 3NQ7A 2ZCGA 1OFBA 3LM7A 3L5LA 4CCDA 3IVSA 3TUUA 3QMTA 4O8RA 4WJEA 1PHQA 4PCFA 1XL9A 2GOUA 1TTPA 3W7RA 3TQVA 3NL3A 1VZWA 2NUXA 3W84A 4O1DA 3UXAA 3W9ZA 4HPXA 1AW2A 4WQ6A 1W3IA 1YPFA 5BMXA 4O28A 2CLMA 4DXVA 5LNSA 1KM1A 1VJIA 3TK7A 1W5NA 3PULA 3C56A 1T0OA 5H91A 1K8ZA 4K8HA 1OX5A 4LU0A 2ZZ2A 4QJ1A 1TPWA 1C29A 1XBXA 3R2GA 1O94A 1RVGA 4LUJA 2YYUA 3DI1A 3G8EA 2WPBA 2ZRYA 2E6YA 1TTIA 3RK8A 1GEQA 5CPLA 3TDFA 2NLIA 3TFXA 1M7OA 3GK0A 1YTKA 3PG8A 3DFSA 1OG0A 1OX6A 4TMBA 1VQTA 2ZA3A 5FEWA 3EX6A 1O4UA 5AYXA 4Z1CA 1HTIA 1K8XA 2E5BA 4JY9A 1TPDA 3P80A 2Z6JA 5CPNA 3WK3A 3EX3A 3TAOA 1WV2A 3KAOA 5D03A 4AHOA 5HQEA 2HMCA 1MEIA 2G97A 4HNVA 1AL7A 1KFLA 1QO2A 3QC3A 3C6CA 2WJZA 4O4VA 1VS1A 1OFEA 4JTKA 4JXCA 1UUOA 4Z1BA 3QSTA 1VCVA 5I3IA 1U83A 5K3VA 3CTLA 1A5CA 2KZHA 3PB0A 2RKXA 4O19A 3B03A 3TSBA 1W56A 4G1KA 4B5NA 3FEMA 1PVNA 4WY0A 3TIMA 1ICSA 1HO1A 2YPIA 1TPEA 3EB2A 1H7RA 2EPHA 2GJNA 2QF7A 4GUHA 4FX8A 2OX1A 3EKLA 4LTSA 5D32A 1SO6A 1OJXA 4Z0SA 3BARA 1FWWA 3P7YA 1G6CA 1LBFA 3LXCA 3UNDA 3SR7A 2OMAA 2PCQA 3NQMA 3C2EA 5D04C 2CZFA 2VELA 1TJRA 2LLEA 1H7PA 2FFCA 4E38A 3LHZA 2G96A 1YXDA 4CNPA 4XKYB 1SSGA 3TSMA 5C54A 2ZFAA 4FNSA 4GWEA 3EKZA 4AXKA 4TX9A 1Z42A 1GVRA 5KTLA 1YXCA 2YFOA 2HTMA 3SFKA 1SO3A 2PE4A 3VKJA 4NX5A 1Q6RA 2ZZ4A 1ME9A 4DO6A 4E0CA 3EWZA 1JRCA 4O53A 4Q32A 2Y88A 5DXXA 1S3HA 2ZQ0A 1EUNA 1KLZA 2C14A 2ZRVA 1THFD 4Y96A 3W1PA 5F2GA 3NQ6A 1XI3A 1L9WA 3W83A 2VEKA 4IMFA 3W7LA 1FUYA 1H50A 3L0GA 1NEYA 1VGAA 3M47A 3HQ1A 3MUXA 2CFFA 1MZHA 5A5WA 1UASA 4CLMA 1FDYA 4JTEA 2JK2A 4MY1A 5LGXA 3W1UA 1GOXA 4LVDA 2BZNA 5E0KA 5LNWA 4DEFA 3MO7A 4ZQCA 3NQAA 3UWUA 5DLCA 3G0XA 3DBPA 3NQ8A 4JTTA 4ORMA 1TV7A 3G18A 3A22A 3P8JA 4NJIA 3S1UA 4GNJA 4RX0A 1OK6A 3VE9A 4NU7A 4WY0F 4GJ1A 1JCNA 2QCCA 3GXNA 2W79A 2B7OA 1TREA 3UYCA 3L68A 4JNMA 2Z6IA 3NZ1A 4K7VA 2J6XA 4IX0A 3LCXA 3A21A 3INPA 3QZEA 1EP1A 3DHFA 5HUPA 4XUGA 1YTEA 2H8ZA 3EX1A 2VXNA 3PUEA 3L0NA 1NAL1 1R2SA 3ATYA 2GQAA 1GG0A 1I4NA 3N14A 5BNKA 4PEKA 5D2VA 3S5OA 1UJPA 2C15A 2QUTA 4LV9A 1FQ0A 4IJBA 4DELA 4X22A 1F6PA 5DCEA 1YDNA 5KZMA 3LTPA 3VFLA 3NL6A 4A29A 5AHEA 3MHUA 1BWKA 3GNDA 1Q45A 3ZFHA 3W87A 3W7CA 3P82A 5I3FA 3CEUA 1VYRA 4IX2A 5G2WA 3ABQA 1X8FA 4ZL1A 4FIRA 1VR6A 5K2ZA 2H6RA 2QDHA 3PB2A 4AHQA 4HNTA 4I9AA 5AOUA 1D3GA 3BW2A 1XDMA 3WK1A 1G7VA 1B4KA 1GVOA 4AWUA 1I45A 2A21A 3IGXA 2D73A 1SW7A 5EBUA 4MZ1A 4NJHA 1NSJA 3NZRA 2QCEA 3HPXA 3DFPA 5IM51 2E68A 1I8JA 4PA8A 1YXYA 3GDRA 2CWNA 3FFSA 4N2YA 4ZQPA 5DN1A 3W7MA 1DBTA 1KTNA 2WO5A 5F1UA 5CGQA 3RNDA 3VI2A 4E2DA 5BW6A 2VFGA 5FF4A 1QMLA 4JTJA 3G1YA 2V9DA 3LLDA 4NXSA 3W23A 3W75A 5AB3A 3HIJA 3W1XA 1W5QA 5F2LA 3NXFA 4IWWA 2QEZA 2B7QA 1TJPA 2DZUA 4FEZA 3W2JA 4UTTA 1SO5A 4FO4A 3WJYA 2P1FA 4JX6A 3NYZA 3PBYA 4O13A 1FY6A 3W1LA 3OA3A 2J9YA 2V5BA 4FF7A 3LCLA 3GKAA 3IVTA 5L9FA 5FF3A 1EIXA 3NQVA 5KMYA 4PODA 1U5JA 3GXTA 1PL9A 5KSWA 2FIQA 5AHFA 1PS9A 3I6RA 5SWUA 2OCZA 1LROA 4ADSA 1XC4A 3G0UA 3W7KA 1YDOA 3LRLA 3DZ1A 1W1ZA 2JKPA 3MWAA 3OIXA 4QM1A 3G1VA 2CLIA 4Y8FA 2WNNA 2I1OA 2CLOA 2RDWA 3GVGA 2W6RA 3KRSA 3NA8A 3VE7A 2J88A 3IRDA 1S5TA 4NVTA 4RV8A 3CLMA 1QNVA 5LHEA 3L65A 4CCEA 4YMZA 2H90A 3PS7A 2YW4A 3QPZA 1RQBA 2Y63A 3EXSA 2NWRA 4ZQOA 1KFCA 1S5VA 3T44A 3S5ZA 4O18A
chains in the Genus database with same CATH superfamily
2JIWA 3UWVA 2X8RA 4DNHA 2E0PA 1LQ0A 4EXAA 3H2NA 4UTTC 3FIGA 1R2RA 2XGBA 2Z28A 3KCOA 3TR2A 4UMAA 4XTDA 1OCBA 4PFHA 4GZJA 1QTWA 2I7GA 4H9UA 4GI8A 1I2RA 4GXMA 1BVWA 1WDDA 3NL2A 3EGJA 4IF2A 2V5KA 2E6FA 4JCMA 3LHUA 1W2PA 3HB9A 4BJHA 1BD0A 3FKRA 3TP4A 2X05A 1TE6A 4FNRA 3LSCA 1HKMA 1NWSA 4S1FA 4JR5A 3EDJA 3TROA 2VJXA 5BZAA 2QPUA 3ZJ6A 1F8IA 3R5EA 1Q63A 5FEPA 1ESWA 4KWWA 3SUVA 5LGZA 1YDYA 2CHNA 1I75A 4JPGA 3W6LA 2X40A 1GWJA 3H55A 1ZALA 4TMCA 1G0CA 2QCNA 4ES4A 3V36A 1FFQA 2VWSA 1SJDA 2DJLA 2I16A 3D0CA 1HJQA 2NV1A 1GNXA 3JS3A 4F0HA 4IGNA 2WSRA 4GO9A 4XZBA 4BZYA 2EF9A 1NFBA 3P0XA 4PC8A 1PX8A 3SIZA 4P8WA 3U2EA 4C1LA 3RU8X 3CV2A 4L64A 4M5PA 1KRBC 4H9ZA 1F6KA 4HCHA 3LHYA 2TPSA 1QRQA 4WY0B 3M0HA 4JL2A 3BMWA 4DYKA 1HJWA 1DE6A 1JAEA 5C70A 3LUTA 1OM0A 1E73M 1TTQA 1Y5VA 4B9ZA 4P2VA 4EF8A 3QW4B 1KRAC 3FAXA 4KQNA 1CGVA 2CKSA 2PSNA 4B5WA 4GQGA 5AFDA 1FBAA 1PWLA 3DH7A 1MUCA 2E9LA 1DTUA 4M8UA 1VLWA 2PDGA 4P7OA 1CB2A 2VYOA 2ZRZA 3USZA 1XPYA 3OBAA 2PU1A 3GAYA 3QR0A 1FFRA 5LA0A 4KEZA 3QR1A 2YDSA 3L21A 2WMFA 2JGYA 2WBGA 1TZZA 1E6ZA 1T5AA 7A3HA 2ZZ3A 2GPTA 4O10A 4C6MA 3O05A 3Q58A 5D09A 2D0HA 1XGEA 1AZ1A 4DNMA 1PYMA 1QAPA 2I14A 3QH2A 4J2MA 1G67A 3G1HA 4LF1A 3I65A 4LCQA 3BJSA 1DV7A 4GKLA 4NF7A 1H61A 3WDJA 2PWHA 4PTNA 3TC6A 1W3JA 4NG3A 1VPYA 4CUCA 4DYJA 1O1ZA 1ZJHA 4HYRA 4WEVX 3VGGA 1MUWA 1V3MA 3DBNA 3LCWA 3WSUA 2J24A 3ONCA 3VVGA 4YXGA 2R1PA 3KOYA 4PMRA 3FKKA 3LXAA 3GAKA 4DXXA 3VX0A 3UVIA 5BXRA 3W1TA 4J3TA 1RY8A 2QMJA 1XIIA 4MY8A 3BOLA 3MPGA 3UETA 4Q6JA 4BF9A 3LSBA 3JRKA 4Q8VA 2ZTKA 3P67A 3RR1A 3VXGA 3PZIA 2RGMA 3E5PA 3LDVA 2Z2UA 1JCLA 3BAXA 4I9JA 4WVXA 2BTMA 5AYZA 4ZO7A 1E56A 2A79A 1TR1A 3QC0A 3A9IA 3C0QA 1GOWA 4OIFA 5CJ5A 1K77A 3UQNA 1DWAM 3WBXA 2WZHA 3EWBX 1B54A 4ZEPA 2XFRA 5D8WA 5BWFA 5IHSA 1AK5A 3E2RA 1IYXA 3ZSTA 3CGTA 1EUAA 4OQVA 2DU2A 3W4RA 2ZE3A 1IV8A 3HQPA 1TMLA 2TRSA 3G1FA 3OQEA 4L65A 6REQB 3CYVA 1I0BA 4CCZA 2PP3A 3KBVA 2EG8A 2J77A 4XG1A 5C5YA 1YNYA 1DIKA 3P2VA 4RNFA 1PIIA 4MFEA 4J2PA 4P61A 5J5DA 4MFDA 1AJ2A 3BAWA 3OLGA 3EOUA 2AAMA 2H8XA 2EKCA 3PBGA 2C1IA 2V2CA 1JCJA 4JIPA 3B8SA 4PRRA 4XZ9A 3UWQA 1ZPTA 3BURA 5D30A 1V79A 3BLEA 4U5IA 1R46A 3BLPX 1RALA 1AQFA 3BV7A 1PDYA 3ZWSA 1EFZA 2VGBA 2QCMA 4ZR8A 1WOAA 6A3HA 3HMJG 3QLDA 4JTSA 3VIOA 2PDBA 3NPVA 1FWDC 2YB4A 3ALFA 4RNIA 4ERAA 2WPGA 1NFGA 3S83A 1WQ5A 4QQ3A 1UP0A 1KTCA 3BCDA 2QS8A 5HULA 1CBGA 1G4TA 2A7NA 4GOAA 2HS6A 4L6HA 2J7CA 1WKDA 4QJ4B 2QCHA 1WPCA 3ANYA 1GHRA 4PUMA 4TVCA 4UXDA 4H8UA 3M0IA 3NOYA 1Q2SA 4GA8A 3KDOA 1Z44A 4DJDD 4ASTA 1RP9A 5AVNA 2DJXA 1D3HA 4DJFC 3AICA 5AYYA 1JEZA 5K4ZA 3UZJA 3VKKA 4HCLA 1NOFA 2OFJA 4ICCX 2JQXA 4EX4A 4TU1A 3B8DA 2E8ZA 2FZDA 4LUTA 4IJRA 5JXQA 2PTXA 4HOZA 3AHZA 2ANUA 3WELA 1R85A 3CIXA 4O1CA 3W24A 1QPRA 3H2EA 3G5EA 4JQ2A 1J5TA 1IF2A 5LIXX 2WXDM 4UIOA 2C3ZA 3ARVA 3QKZA 2FZNA 3UWEA 3LERA 3M0YA 4DWSC 2ZZ1A 3SJNA 1JCYA 2VZVA 1DJHA 4JQ4A 1RAKA 5T26A 3F03K 1VB9A 1JZ2A 2QCFA 2Z1VA 1TA3B 5DBTA 5AC7A 1Z7AA 2I5GA 4MY9A 3HV8A 4RCXA 2INFA 3HMCA 1ZY9A 3MA8A 4K6AA 2CCRA 4XKYA 1T99A 4JTFA 1C9DA 1OZMA 3WD4A 1OVDA 2XSXA 3HGSA 2C16A 4KFPA 5CZJA 3ZJ7A 3M41A 3LOTA 4XAPA 3BG9A 3E96A 1RXOB 2YXOA 1XFBA 2A3LA 4A3HA 1OX4B 3THUA 1P0BA 4AUBA 2D20A 3V5FA 5CPTA 1BFNA 1SW0A 5A8QA 4PSPA 5A6BA 1UH2A 2I5QA 3A3XA 4GC3A 4WKHA 5FEXA 1MRAA 3K8MA 3M5XA 1A53A 2OT0A 5CH9A 1LL7A 3EOLA 3CUHA 4YYCA 5HWNA 3VKAA 1QHPA 2DH3A 4GFIA 4FZIA 2A6LA 2XWEA 1H11A 1OGGA 3Q94A 1UBSA 3FA3A 1UR4A 1PUDA 2J74A 2ACUA 4Z0JA 4C1NA 2GWGA 3PBMA 1BG4A 3KP0A 4QISA 3PM6A 1EDQA 3D47A 2CEQA 3VGDA 2PLKA 4QP0A 2XM1A 3CHCA 3L66A 2RFGA 4QE4A 2VURA 4J3UA 3FYYA 4UTMA 4KCWA 4R7OA 1QNRA 4RUBA 3H4WA 4AWEA 2YGYA 5G2HA 3U5UA 1O5KA 3IAQA 1XLAA 2C1HA 1A0EA 3THQA 2GUYA 1OFRA 1DKWA 3CO4A 3AHVA 2VHLA 2GGGA 2QMKA 1KO0A 3BICA 2XJ7A 4PZVA 3PPGA 1R9YA 3W1AA 3R8GA 2ZUSA 3APGA 3GDLA 3W82A 4DYEA 1S1PA 3WFZA 2PGWA 2XHYA 4J28A 5T8GA 2VFDA 3AOFA 1XSJA 4AY8A 2ISSA 4HT3A 2BVWA 4YVPA 2B31A 1U5VA 3MQTA 2NVCA 2FZMA 2Y24A 2D1ZA 3BAJA 3CPRA 1FXPA 3MVIA 4M7SA 1H1ZA 2FTYA 3AXXA 3GXIA 3WNLA 2PDCA 1L2QA 4Q8UA 1KR1A 4RL3A 1T8QA 1UWSA 4NIRA 1BVNP 3GIPA 2F38A 3FVDA 5G5IA 3CHFA 5EMMA 2JF6A 3IJ9A 1V93A 3S46A 1JZ5A 3KCLA 4CQCA 1SJCA 4GYJA 4Y6GA 2ZUNA 2VTFA 4IG2A 4ZB2A 3GDKA 3P84A 4JTIA 4AZGA 2VWTA 4W4QA 1RZMA 5F1VA 3LB0A 5FAGA 1B9BA 2F6UA 4KMQA 1UR1A 2ZA1A 1DPMA 4QQUA 3NQFA 2PB1A 1UZ1A 1QFEA 1XSIA 3WL1A 1BPLB 2H9AB 1WCGA 3R12A 4UNIA 3N9SA 3SURA 3BG3A 3CXOA 1AJZA 1V0LA 5HK4A 5A2AA 5LIYX 3WBEA 2VC6A 2RGLA 1QNSA 3O63A 5D8ZA 5FCZA 4WOZA 4M1RA 4Q4OA 1S2VA 4L4MA 4AF0A 1Q66A 5MHBA 4GYPC 4XBKA 3LHVA 3WY1A 2E7FA 1AD4A 3VIJA 3MY9A 4ERGA 2F84A 3DC8A 3NNTA 1ZAHA 1VBUA 4PMVA 3TWAA 1LF1A 3BUVA 4YWIA 5LYRA 4BI6A 1H7XA 3PC0A 3IS4A 1QPNA 1BQGA 3GB6A 2XZ9A 4HVXA 2EHHA 3O2LA 3ORWA 1NVMA 4INFA 2REQA 3LBOA 3M5VA 1ECQA 3H54A 3LI0A 4IMGA 3GW3A 1IXNA 3MUCA 3GR7A 2Y8KA 4UQDA 2WC7A 3NYDA 1XKJA 1JAKA 1X1OA 3OHIA 3VGEA 3H70A 3KBJA 3W29A 4WJXA 3VD4A 2RHGA 3R43A 2R9RA 3MSDA 3UXIA 1EX5A 3B04A 1E0WA 3MYOA 2Y1HA 5EB8A 1KM0A 3SRDA 2VI0A 3AI0A 1TV4A 2BVYA 4S38A 3N2XA 4IPNB 3K1DA 1KCZA 3NEHA 3AZTA 1E4IA 3B9NA 4UTKA 1V6XA 2J8TA 3TC3A 3ITVA 4PCNA 3H7RA 5D9PA 3H26A 1H5VA 3MUZ1 3SN0A 4IIGA 4UTIA 4ADTA 3NO1A 3MU7A 3NPXA 1W1VA 3GDTA 3CMJA 4M29A 4DJFD 2P8BA 1YYAA 3TMQA 1HIZA 5KEZA 3IIXA 1XBYA 2VRKA 3NQBA 3TN5A 1XS2A 3BZGA 3EPNA 5HA7A 4JCLA 3QGAC 1AH3A 2JE8A 4NAFA 4D6JA 2OG9A 4TR9A 4GE8A 2X1RA 3PG9A 2CZ5A 3AUJA 3WQ8A 3VDBA 3IRSA 3W26A 2IQDA 2Q3OA 3REQA 1S2AA 3BDKA 4UTHA 4QEEA 3VNZA 3SGGA 3BANA 5CSRA 3RJYA 3UCDA 4L1GA 2WHKA 3LZ3A 4DWSD 3EBVA 1I0DA 1IEXA 2V81A 3GVRA 2OEKA 1IXOA 1FH8A 1MEHA 4IQLA 2QJNA 4MB3A 3HF3A 4DB7A 3DFYA 3I3EA 2P0IA 1NP0A 3DIPA 5FJTA 4CU8A 4C6BA 4UC5A 4C91A 3B0UX 2ATMA 4E6MA 3STEA 1JRBA 3QW3A 4AVNA 4HSNA 4ACYA 1CYGA 2J47A 5FJUA 1Q8AA 2Y7GA 5AHLA 4YCPA 2PLCA 4I5UA 3ARXA 2P5NA 2OZ0A 1QK2A 3P93A 1FH9A 1R47A 2DUXA 3UJFA 2WBKA 1CLXA 4DWSA 2HDJA 2ATSA 5EU9A 2FGBA 3R1ZA 2BV9A 1DQWA 3CYJA 4AYSA 3BSHA 3VOIA 4LB3A 3TYEA 1SO4A 2PBGA 2X09A 1IWAA 3AZRA 4CKQA 2PDKA 4GUIA 4AZCB 3U2OA 1EWEA 5IDZA 3PUDA 2DSWA 1PKYA 1W3TA 4BS0A 4LSBA 1UZHA 3WDPP 3SBFA 3KZPA 2Z24A 3M5ZA 2EGZA 3OLEA 1XLBA 2RDTA 3B05A 1X98A 3L4YA 2DW6A 3DAQA 2VRJA 2Y89A 5I3GA 2I5IA 3WQGA 1ZBWA 4JEJA 3PUOA 1BYBA 4DQWA 2ACSA 4H19A 3ARTA 1KGWA 3G1AA 1VYSX 4ML4A 3OJGA 4JD4A 3C2FA 3YPIA 2V2DA 1J0JA 1MYRA 2QCLA 3EMQA 4N7QA 4AIBA 3WLLA 1XX1A 4BY3A 5KINA 4RE2A 1GKPA 4MZ8A 5I00A 5CZSA 4EVZA 1TYGA 1IZKA 1E0UA 4HNOA 2W0UA 3DU0A 4OJYA 3W6MA 4QG9A 1KGUA 5H1WA 4RXFA 1VBRA 3T0AA 2Z26A 1RPKA 2VC7A 2NV2A 4XIAA 2FB3A 3WF3A 1HN1A 2QGHA 1WA3A 1IWBA 3CJPA 4YU1A 2BY1A 2FGZA 3LCIA 3VDAA 1S2WA 4IIBA 4EIVA 1CXFA 1XCFA 3CPUA 1GW9A 3LEPA 1Z48A 2AL2A 3GTNA 1XQKA 2DDXA 2YL6A 1P1XA 2FKPA 4MLRA 2WJDA 3AIEA 4NZ1A 4D72A 3DX5A 2FJUB 4UR8A 1T96A 3BAIA 3VZYA 3LPGA 2HXTA 3W0KA 1XLJA 1CEOA 3PTKA 3CK5A 1H1YA 1GOMA 1O1HA 1W9BM 3ARWA 3N6JA 4UTWA 1RCXB 3PTQA 1ZQ5A 4S39A 4O8AA 1GQIA 3I3DA 1XFCA 3N4FA 3BXWA 1ZLPA 1YMYA 3M4HA 5JQ9A 2C79A 2Q8ZA 4HPHA 2E8YA 3QSRA 2E1DA 2PRHA 1K4GA 3UR2A 1FCVA 4KEMA 5XINA 3EWYA 4LEQA 4AWSA 2FFIA 3N29A 4LNCA 1XLEA 5BWAA 4RNJA 2XN1A 4B5TA 3NOEA 3LRMA 2EAWA 4QNWA 1FP8A 2JALA 1R3VA 3QQ1A 3WUEA 4IUOA 4BQ4A 1XISA 1IGWA 5K4XA 3E2SA 4B3ZA 3MKKA 4XD4A 3PZUA 3FJLA 4BFAA 2E3ZA 3STCA 3SCWA 4J9JA 2C71A 4NZCA 4R9XA 1XLLA 1JCMP 1NF7A 4DBDA 3GNNA 5C9WA 1BAGA 4GXWA 2HVOA 3LI1A 3FA5A 4RDYA 1E43A 3TTSA 1SW3A 3MP5A 1YLVA 5FOOA 3DEQA 3OVPA 4NRSA 1ENUA 2G3MA 4R53A 1K9DA 3G22A 4UTFA 1JVNA 5D2WA 2OJPA 4Q4QA 3NFUA 4JTAA 3JU2A 3CHEA 3O0KA 5HQMA 3GC5A 2Y62A 3CUIA 3LGGA 2C8NA 1N55A 2PF0A 3EPOA 3C8NA 1TPC1 3P8IA 3UBPC 3SRKA 3VU2A 2XN0A 4EAYA 2ZADA 1K9FA 5KZDA 3T4WA 3GKFA 1NDVA 3JZUA 5FACA 1SZNA 4ZQRA 5K9CA 2F9RA 2Z1WA 4QAIA 1GOIA 3HG4A 1BXCA 1ISYA 3K4DA 4FIQA 1VKFA 1BLIA 4KCTA 3MMTA 5JBDA 3BK0A 3FA4A 2CIPA 1V3JA 3AU2A 1XRFA 1EYEA 2FPYA 2O7QA 3SW6A 2PZNA 3M0MA 2HCVA 1HL2A 1AFSA 4GGHA 4PRWA 2GYIA 4MYAA 3RLUA 1VYPX 3ARQA 1NDYA 3W71A 3MSYA 4BR1A 4R34A 3VD7A 3VO0A 2NX3A 4AZ5A 4JNYA 3VGHA 1QWGA 1A0DA 1JGMA 3AXKA 1ZZMA 2VP8A 3KBMA 3OYXA 4MF4A 1L6FA 1XCXA 3M44A 2V67A 3CMFA 2YZRA 1VHCA 1POJA 4KT2A 2GFTA 1FWSA 4FS9A 2QXWA 4I3GA 7REQA 1JIBA 1H2JA 2J25A 4Q4KA 3ABXA 1GK8A 2W5FA 2ZTJA 4JTLA 1MW3A 4ZOCA 1M7JA 4JYFA 3R8HA 1AL8A 1ZBVA 2QCDB 1XIEA 4EAMA 1ICQA 5ABTA 3T0CA 4CN1A 1MDLA 3DG6A 1SJBA 1CGWA 4L6DA 1OFBA 4E4UA 2D2HA 3ALGA 1OD0A 4PUKA 4W7WA 4WJEA 4PCFA 4Q7NA 3RLHA 4FLQA 2O55A 1DJWA 3TQVA 1P0DA 3RPMA 2NUXA 1XYFA 1UD3A 3W9ZA 2BXZA 3AS0A 5BMXA 4HMEA 4O28A 1ZTVA 2WMIA 1IT7A 4I9TA 1TIWA 2YJQA 2VMFA 7ENLA 4I5RA 2DT0A 4E8DA 4LU0A 2ZZ2A 1B1YA 4QJ1A 1TPWA 5HNNA 4G8TA 2WZTA 4TX6A 1RVGA 3S1GA 2YYUA 4KESA 3DI1A 3A4JA 5A8MA 2E6YA 4AY7A 5HOSA 1A4MA 2QW5A 2FVLA 3TFXA 1M7OA 3VOCA 3PG8A 4D8LA 4TMBA 1O12A 2OQYA 2J75A 3C0LA 3EX6A 4Y2WA 1DJIA 4JY9A 1TPDA 1KQYA 2XWDA 4HK7A 3BTNA 2ZXDA 4AHOA 5HQEA 4JKMA 1MEIA 4HNVA 3TYZA 3B40A 3MJMA 2Z7GA 5DMYA 4OTKA 2HNHA 1VS1A 4AZIA 1J5SA 3SQMA 4BF5A 2VGGA 2PLJA 1A5CA 4ZO8A 2WCAA 4DZHA 4LY4A 1BWVA 3VIIA 4HN8A 4G1KA 1UMLA 2RUSA 1PVNA 4PTDA 3UG8A 1Y7VA 2ZX7A 2YPIA 3M0XA 4W88A 3CLWA 1NOWA 3WLMA 1SO6A 4W7VA 4Z0SA 3VIGA 3BARA 1K9TA 4D6DA 2BGSA 1G01A 1XD0A 4PBEA 3LXCA 4MB1A 3HURA 4J40A 2Y8VA 3NQMA 1XIDA 2F61A 2OO6A 1HKVA 2MANA 2O92A 3UZYA 2VELA 3WBAA 2DSZA 4XD6A 4E38A 3B9DA 3LHZA 2G96A 2P53A 4YTRA 4XKYB 1DJXA 2XIQA 1Z69A 4D6GA 3ITLA 3TSMA 1V6WA 1Y65A 2I57A 3C5QA 1M41A 2E28A 3EKZA 4AXKA 1EIBA 4CGTA 4TX9A 1Z42A 2Z1XA 2HTMA 1SO3A 2CBIA 4R27A 3VKJA 4DO6A 4GQQA 4O53A 2J7EA 5DXXA 4YTSA 3LNMA 3BLOA 2UZ9A 4Y96A 5F2GA 3N1AA 1XI3A 3GYCA 1LWJA 3F2BA 2E25A 3WUGA 3BQ5A 3H7UA 4WDWA 1UKTA 4MY1A 1GOXA 4LVDA 4NHVA 2VZOA 5E0KA 4I90A 3MO7A 4AZ7A 1Q4NX 1XDJA 3NQ8A 1UR2A 1TV7A 5BXPA 1E6RA 2J6VA 3A22A 1E6XM 4L4OA 1J11A 4H6EA 1OSEA 1V7AA 3GXNA 2W79A 2QLYA 7XIMA 1K6WA 4JNMA 1XLKA 1RD6A 4NI3A 1TVLA 2BOFX 2ZX5A 4C7GA 3AXHA 4XUGA 1YTEA 2NQZA 2H8ZA 3M64A 3VYLA 3XINA 3N14A 4MNJA 1UJPA 1FQ0A 4GZEA 4DELA 3GFZA 7TAAA 3NL6A 4QG6A 1M04A 2UY3A 3P82A 4H2HA 2ZWYA 4FIRA 4AIUA 2VX6A 2WKGA 4AHQA 1N8IA 1Q5MA 3WLJA 1IEIA 6ENLA 3PZMA 4ROQA 3MDWA 2A21A 2F2KA 3FN9A 2FVKA 3T2PA 1YEYA 1UWRA 3E5BA 1NSJA 2ZXAA 3M46A 5IM51 2E68A 3QY8A 4PA8A 1YXYA 5DN1A 3NTYA 1DBTA 9XIMA 4JBRA 2EJ1A 3VI2A 2CYGA 5TF0A 5BW6A 4OBRA 1KXHA 4JTJA 3WBWA 3LLDA 2DUZA 3SM0A 4WDTA 4GBDA 4HK5A 1MRQA 4TQTA 3NXFA 4IWWA 4IG2B 3KHDA 3FEQA 2B7QA 1RA0A 3KS5A 1M65A 4MDPA 1HT6A 2PDUA 1SO5A 4FO4A 4QAWA 4IPLA 3OU8A 2P1FA 3CQJA 3PBYA 3BMXA 1IEQA 3VNYA 1RA5A 2J9YA 1R9ZA 5L9FA 1SMDA 5DEZA 1EIXA 4IFKB 3NQVA 5KMYA 1OT1A 4HTBA 4HU8A 2PWGA 1J2BA 2FIQA 1PS9A 2OOGA 4HMCA 1YDOA 2RJGA 1YBQA 2OU4A 2DGAA 4MB5A 3VA8A 1W1ZA 2JKPA 3ZM8A 4JFSA 3G1VA 4HZMA 2CLIA 5C7VA 4AC1X 2G3IA 3U4FA 3QGKC 4JIRA 3VMNA 2QV4A 3MS8A 3GNPA 2GDUA 3CLMA 5LHEA 1JFHA 1PO9A 3DHPA 2QYGA 5ABHA 1UP2A 3ZR5A 2NWRA 2GGJA 4W84A 1DXFA 4W86A 2Q02A 2ZYFA 1RBAA 1EL3A 3HV9A 3H23A 3L2MA 5AYIA 2Z4GA 1GOKA 1H51A 4HPNA 4B5XA 3G1XA 2IPWA 3TH6A 3UYIA 5C2GA 4JOMA 2WNZA 2QCGA 3ERPA 5I7GA 1RK6A 4TUFA 1NF0A 3C2RA 3CL7A 3ES7A 3N9KA 4H6KA 3S1XA 5I77A 4FOJA 3CC1A 2ISWA 4O50A 4WKAA 2HQAA 1SFJA 3KE0A 4PB3A 1XINA 2DUAA 3UWYA 1U1HA 4QS5A 1QNPA 2ALDA 4GJJA 4UFJA 6CGTA 4PMDA 6ALDA 1ZCOA 3ITYA 4KFNA 5H6HA 3ITCA 1SU5A 3TCSA 3QJAA 3WENA 2OVLA 4RJEA 1J2WA 1NIUA 3WUBA 2YL9A 4FA3A 2DSKA 4DZAA 2Y4SA 2Y2WA 2WWDA 4LUSA 4F0KA 3THAA 5LNRA 4XSLA 1EHAA 2PDLA 1J0ZA 2TYSA 4A8NA 2EXOA 3ZVIA 4GY7A 4JHZA 5JH1A 4OFCA 1EJSC 3HGOA 3W7QA 3TU9A 2WMJA 2C19A 3TW6A 3H21A 1G9HA 3NZGA 3ARPA 1O66A 2CXGA 2EBNA 4H3DA 3HPFA 3BLKA 4AZHA 5C2XA 3STPA 3VDCA 2QAPA 2CZEA 1VFLA 1ZS2A 3WLKX 4IHCA 3SY5A 3VFCA 3W53A 1ADDA 3VCNA 5IFPA 4C6FA 2YA1A 1VJZA 4XAZA 1PTGA 4HSOA 4IZGA 4ZTXA 3E38A 5IHRA 4KCUA 4IIEA 4JFWA 3HA1A 3NURA 4LRTA 4HOWA 2HISA 3UNTA 1WZAA 5C55A 2X2GA 4AWTA 1MSSA 1E40A 3EB3A 4I7VA 1P48A 2EPLX 3FJ6A 1RJRA 2HK1A 4EKJA 4A3UA 4H9VA 3CUXA 4PL1A 5TNVA 3WQOA 4F2TA 1ZB5A 2E5CA 3GLCA 2ALRA 1A0CA 5CPMA 5HUOA 1JXKA 5I06A 1RJPA 3MZ2A 5IBXC 1WNOA 2Z1SA 3W7IA 5BOEA 4R9OA 2DZPA 3AYVA 3I4KA 3L67A 4HNLA 5HWMA 2Z2AA 4GFSA 4IXHA 4CQAA 4Q3MA 2R94A 3ID7A 3GYEA 8RUCA 3BW4A 4HOXA 4D8ZA 5CPQA 3U6WA 2FPTA 1EGZA 5F2MA 2WNQA 3EPMA 2Z2BA 2V8ZA 3VNDA 2WCSA 4NZFA 3AJ7A 3VUSA 4BWLC 2NUYA 3EWXA 2J9XA 4ZO9A 1E9ZB 3WH7A 1TKKA 3STFA 1WX0A 4UMBA 4UOJA 1A49A 3H2AA 2FDSA 4IQDA 1XWYA 3PPFA 1ICPA 5AHIA 4W89A 1G69A 4MAVA 3A24A 2WVTA 3ITTA 3M5YA 1W17A 2FTPA 2YCIX 1GQKA 2P0OA 3VKBA 3IIVA 4O11A 2PWFA 2VFFA 1M7XA 3M6YA 4QDPA 4UFMA 2WVSA 4YN5A 3NPWA 1UQZA 4EE9A 1GGOA 2X0HA 4M24A 5I79A 1FHUA 1ZSXA 2CLLA 2XUCA 3N34A 3CMGA 3WD2A 1QU4A 2YBTA 3P5ZA 4DY1A 3TFCA 4RXGA 3OQ8A 5BXTA 4IFRA 3ARSA 3C61A 1KCKA 4W8LA 4B16A 4E2BA 1F07A 4BF7A 2VGIA 4PUDA 1JPIA 1Y8BA 5REQA 1ZBKA 3WL0A 2PI6A 3KBSA 2DVXA 1MO0A 2Y6ZA 3MCMA 1HJXA 3CWHA 2ICSA 3HGRA 1QPQA 4DPPA 3K30A 2GSJA 4HNNA 4N42A 1H7WA 4NJGA 1U22A 4C6DA 1XYCA 3IARA 3C0SA 1VC4A 3M0VA 4K68A 5EKYA 3POCA 4ZMGA 2QULA 5DT5A 3A4AA 2JGQA 1YQ2A 3W7HA 4CNUA 1IIGA 1OHLA 1OB0A 2WB5A 1REQA 4JAWA 2DT1A 1LLOA 2PDWA 4DUOA 1Z89A 1SQ7A 4TVDA 2VOMA 4DF0A 5J8LA 2YCJA 3TTEA 2WLZA 4UUIA 4DJEA 1MVYA 3S2JA 2FPVA 3OODA 3MT1A 4IICA 4NNAA 4CQBA 2FB2A 5CC6A 1M03A 4JTDA 3N73A 1RD5A 4LCSA 4IXXA 5EYWA 4PCSA 1W3HA 4LRSA 1EWDA 4YNGA 3G77A 1ME7A 4J3SA 1XKYA 5FJIA 1J96A 2ONEA 3QHOA 1L6SA 4AX6A 4HP5A 4W5ZA 1E6QM 3S6TA 2XH0A 7TIMA 1W3NA 3WCZA 3WO8A 1J0YA 4QFUA 5FF7A 5KITA 1KFJA 1JXJA 4H7CA 2PRLA 3RM9A 4NAEB 3VMOA 1CGXA 3G6LA 4LV4A 1LL4A 1I1XA 4V1YA 2UY2A 5F4WA 3U48A 1EQPA 3GX9A 4P7LA 2Y8UA 4JIQA 3QV9A 1NDZA 2BLEA 3Q65A 4B5UA 3UZZA 2DZXA 4B15A 4WZHA 2VX7A 4AC7C 5DO8A 2D2OA 1UD6A 1XIHA 3OZOA 3GXMA 1XIJA 4FHAA 3V4BA 1JUKA 4GO8A 1FCBA 2QIIA 3N18A 4CEXC 1WZMA 3HTWA 3ITOA 3W1QA 1UWQA 4MDOA 4CU6A 3WEOA 2A5HA 2V3EA 4M82A 2PF8A 2VDIA 4BK9A 4O17A 1LRTA 2NXGA 4K39A 2QKFA 4GZIA 1YNPA 3V0SA 5G1TA 3DENA 6XIMA 2YDQA 2DZTA 3W7OA 4UZSA 2OO0A 1BGAA 4UQ9A 2D22A 3M7WA 3TSDA 3W1RA 2WMGA 4PTXA 1ONWA 1C92A 1VFTA 5A6AA 1ITCA 3C86A 3IJLA 1DOSA 1ZHAA 3QN3A 2PDFA 1KFEA 3GY1A 4XUYA 4HYWA 3ZOAA 3SZ8A 4F66A 1FWFC 3N19B 1CTNA 2WC4A 4P8XA 4AU0A 4PGLA 1PZ0A 5HDRA 3WMBA 4XZHA 1W5OA 4IMAA 4CD4A 1EP2A 4HPJA 3LTYA 1AMKA 1A5KC 4LWWA 4OT7A 5LZLA 3WIJA 1GG1A 4N9BA 3RG6A 1QUMA 4MVAA 1Q85A 4OUEA 2BXVA 2MNRA 3S5YA 3K46A 1EYWA 3FDKA 4PMUA 3C0JA 1KM6A 3EEZA 2QUMA 3WH5A 5HBFA 4D6IA 2BHYA 1RQEA 3K4WA 3MBDA 3GW0A 3S5NA 2CBVA 3IUHA 1P0KA 4LJ3A 1A5AA 5CBJA 3KM8A 3QGVA 1NFPA 2NT1A 3ARZA 1QI0A 1GPFA 1IZCA 2ISVA 1DIOA 1D8WA 3KL3A 5E6YA 1XM3A 2PEVA 3VIHA 3N6HA 3AMCA 3DGBA 3T42A 4B2DD 1BYCA 3QV6A 1H41A 1EDTA 3SCUA 1CX9A 1VRXA 1W8GA 4AMCA 4GNVA 4GUGA 1A5NC 3MHGA 1EJTC 4UZUA 1P7TB 2E6AA 3CU2A 3A3HA 1HJVA 3KTXA 4N9CA 3AIWA 3JZEA 1RCQA 4L4LA 2PZ0A 2ZBTA 1D3CA 5EMLA 3SCSA 2VVSA 2W66A 4JYEA 2BX7A 3AAMA 3C2VA 2X1TA 2EPNA 4O57A 5BU9A 2ZUMA 2G0WA 2HXUA 1JZ3A 2VC5A 2VD9A 2PDJA 1B3WA 3QR3A 6TIMA 4S2CA 1KTBA 1ZU8A 1OY0A 5FF2A 4UFKA 5DMNA 5BYWA 4AZ6A 4H7ZA 5I03A 2A6NA 1KBLA 1CGUA 2XZ7A 5AC6A 4B2DA 4GGBA 2AAAA 4P7QA 4ACZA 1R7OA 3VC6A 2O7SA 3GUGA 3T0BA 2FHFA 3G8RA 3WUFA 1XUUA 2G95A 3WMSA 5IFTA 1Q3NA 2PAJA 1Y0EA 4N4QA 1OGBA 5HQLA 5CQ1A 4KPLA 1EDGA 2PWDA 3LMYA 1ISZA 4LFYA 3V0TA 3WLPA 4DRSA 3WK2A 4G56A 2HROA 3VCCA 4L9YA 4WSJA 3BLLA 2OWWA 1SM9A 1KFBA 3FW6A 3MBFA 3OLIA 2ZDRA 3GG7A 1F3TA 2GVEA 2QR6A 3UFYA 3P81A 9RUBA 2HVMA 3I7RA 3U2CA 2D23A 3TQ0A 1CECA 2AQOA 1DJZA 1Q4WA 3OW1A 4ZE4A 1A50A 4EPBC 3H2CA 4XZLX 1G4EA 3MUY1 1V77A 2CU0A 3K1GA 3SIMA 2CNCA 2OR2A 3W00A 4NUWA 4XSMA 2Y0FA 3Q37A 3RO8A 3NQGA 4S3KA 3IV3A 3DESA 2J4GA 3NM3A 3U5YA 1A5MC 5AN7A 2GVJA 1E72M 1KR0A 2GLKA 1RUSA 3SSZA 3V3WA 3CUZA 3B8IA 5E70A 2O9OA 1LL6A 2IKIA 4IPJA 2CITA 3I3BA 1H4PA 3TTOA 3W27A 3OGSA 5D9NA 1H7NA 3BQ6A 4AH7A 2ACRA 3NVDA 2OYKA 4XIMA 1AG1O 1QHZA 1SZEA 1MW1A 3WJSA 5JIWA 1GZGA 2ZZ6A 5FL0A 2FMOA 3QRHA 1J12A 3BWWA 1JI1A 3AO0A 1BVZA 1QW9A 1XRTA 2WM1A 3TMLA 3M6DA 3F4NA 3I6TA 5HR7A 2WZIA 5I02A 1P4CA 2J79A 1GONA 3Q2DA 4O0QA 4Q4RA 1T40A 5DRIA 1TV5A 4Q8QA 2VRQA 1PHWA 2CXEA 4RZBA 1OF6A 1B57A 1UP3A 3I7SA 4RZ5A 2R14A 1H49A 3E0FA 1C8QA 4GQRA 3UG4A 1VJSA 2CZDA 3CAVA 3QXBA 5DY2A 1SFSA 1BKHA 1ZP3A 2XIOA 1WE5A 3ZLHA 3SO7A 2WZMA 5M1TA 2PDQA 1US2A 4P5UA 1J8VA 4TO8A 3W6YA 1O5XA 1UWTA 1QXLA 2VEFA 2IPFA 4OV4A 5BOOA 3E9AA 4KBXA 2ZZ5A 3VABA 1A4LA 5ABFA 4Z1DA 3UESA 5EY5A 5CLWA 4XTIA 3P3BA 5DELA 1R3TA 1FKWA 4M56A 3EKGA 3CTTA 3UY8A 4KERA 3NAVA 3S2NA 3W01A 2DSUA 4JYDA 3M0JA 4DF1A 2ON3A 3R89A 1YW1A 4LS2A 5DCDA 1WAWA 2JEPA 1OC5A 2XIBA 4KIRA 3RX4A 4EPEC 2R91A 1DJYA 1TWDA 4UTUA 4GQBA 5D2YA 1W9XA 2AMXA 3GXPA 3O07A 3N11A 4FXJA 4O1FA 4M3PA 1QK0A 3HJEA 1RBOB 5FL1A 1LOQA 1RHCA 1ZFJA 1R30A 1T41A 4HZ7A 1CXHA 3CZGA 4IM4A 2HSAA 3F2CA 3OVGA 3OGRA 3NL5A 4L9ZA 4Q22A 4MLJA 4LC6A 2VFEA 1TWWA 4REQA 3QTGA 2C91A 3OA5A 1JYVA 3EAUA 1IR2A 3W1NA 3S47A 3V7PA 4QROA 1XF0A 4O1AA 1LRNA 2FMNA 3W74A 3B9OA 4IFOA 4EACA 1V6YA 1P0NA 3CQ0A 3U4AA 3FYOA 4U33A 1ALDA 2CLEA 3NDOA 1G5AA 4PBGA 5EGRA 4UQEA 1XGDA 1UIOA 3ITXA 1QWKA 5AC5A 1G4PA 1U30A 1Z3NA 3NO3A 3TTYA 4Q8PA 9XIAA 1XYZA 1X6NA 4DO4A 2VZSA 1VCGA 1J9YA 5HJXA 1Q6QA 3F2DA 1C8VA 2YR1A 1TUXA 2V82A 4M6VA 2GUBA 2DZBA 4ZBCA 4E4PA 5CGMA 2EKGA 2VEGA 4MKSA 1HVQA 4QDWA 4CD7A 5JMUA 1GVIA 1VEPA 4IT1A 4WXZA 1B4EA 4CQ8A 3HQOA 4QRNA 3WQWA 4O16A 3UR8A 4XO7A 4LYRA 4OUIA 4AW7A 1J10A 2FVMA 2YSWA 3SDOA 3M9YA 4Z2LA 4G1NA 5FJOA 2AGKA 3CIWA 3CV1A 1E15A 3TX9A 4LVGA 3RLGA 4UWMA 8XIMA 3RGTA 1JPMA 4QSHA 4L1XA 2WKLA 1WYIA 1VIZA 4HSHA 5HJLA 3LRKA 3CHVA 3KFTA 4UMCA 4FPSA 1RVKA 4NQ1A 2XVGA 1JZ7A 4R88A 2WKJA 1E4NA 3QV8A 2QGYA 3U57A 1XLFA 2VFIA 1WP6A 3T09A 4MWAD 2FDMA 2BXYA 3WLTA 3LS9A 5FJPA 1FWEC 1E1CB 1QOXA 3AQUA 3IJ7A 4JN7A 2ZX9A 2W61A 3GVQA 1P6CA 1WDRA 4LX4A 2O4MA 3ZIZA 3ZMRA 1NQ6A 4YCOA 2IXUA 1B30A 4Z1YA 3PWGA 2V0TA 1KV5A 3ZT6A 1VIWA 1DJQA 1O7AA 4L4PA 2AKMA 1VPQA 2WK2A 1OT2A 1DJGA 2YDAA 3JVAA 1K8CA 1LCOA 3MANA 2VGFA 2ZZ7A 2YX0A 2Z0IA 3WLOA 1W3LA 4AEFA 2QVHA 3NZPA 3RPTA 2R1KA 3M7SA 4KIEA 1OFPA 4AB4A 3GIQA 3AJXA 2Q8XA 2BVDA 4N6FA 4PN2A 5C7HA 3GHTA 3S6OA 4MWAA 3RM4A 5M2FX 3QMRA 5B80A 4X3ZA 1POKA 4UCGA 1QW8A 3MI2A 1UWIA 2HBVA 4S3DA 3SFWA 1F3XA 2P8CA 3OG2A 1F74A 3VGBA 3TJXA 4H9YA 3PAJA 1BSIA 4CNSA 1F2JA 4MOZA 1QBAA 5E9AA 3AIBA 2XH7A 3T08A 3KOXA 3RFAA 3EMZA 2J66A 1B3ZA 4QE5A 3FJNA 3ICJA 4GVHA 3EYPA 5G2IA 1D2KA 2EPKX 4D1JA 1FWIC 3H4GA 4NASA 1YNQA 2ZUTA 4HNUA 1DL3A 1I2OA 1OCQA 3S9IA 4RE0A 2GUUA 1H1NA 2HK0A 2WANA 1AJ0A 4AHPA 3N6QA 4GIYA 1KQZA 3EDKA 3DFHA 3LV6A 2HRWA 4PE8A 1K7EA 2NQHA 3N13A 3HOJA 1Z41A 1LQAA 3IAPA 2YLLA 3TA6A 5FF0A 1XRSA 3N04A 2I56A 5AYBA 4BA0A 4CVWA 4RDWA 1NJJA 1MDRA 4WOQA 1Z9AA 3FXYA 1CT5A 3WLNA 4GISA 4H6RA 1TVNA 2OTDA 3DHUA 2WZEA 1FTXA 4D6HA 1VHNA 3KTCA 1EZ2A 3TC7A 4QBXA 2X1IA 1NTHA 2XINA 2ZICA 4U28A 5EMUA 4OZOA 2QPSA 4P7NA 1M5WA 2CLKA 2X16A 4JEQA 3H2MA 1EF2A 2Y7EA 2J7DA 3KEHA 3VM7A 5A95A 3UWWA 8TIMA 4H8NA 1WBJA 4O54A 1TCDA 3OTRA 4QLLA 4ZXOA 1V0MA 5LSMA 2YFNA 3WNOA 3KOFA 4GC4A 2QF8A 4RZ4A 3OPSA 3XIMA 4CU7A 1HUVA 1QDSA 4PMYA 3I6EA 3U7VA 1JCXA 3SCTA 1U2YA 4LT9A 2EPMX 2YB1A 3LCFA 1OGSA 1CXKA 2VKZG 2G4FA 5D2TA 4JDBA 4JFUA 4HIBA 5HAOA 4CEUC 3FNDA 1L8PA 3PSWA 1ZP4A 4JIIX 1HKJA 3LM7A 4CCDA 4CNTA 2GK1B 2DIKA 2BY0A 4O8RA 2YDRA 3WN6A 1XIGA 1YPXA 2GOUA 4JIHA 3NL3A 4C5ZA 1VZWA 3TTQA 2PTDA 3GZAA 4F9DA 2ZWZA 4HPXA 1AW2A 4WQ6A 1F4HA 1W3IA 3APTA 3UA3A 1PBGA 1VJIA 3AUOA 3PULA 4UOQA 1GJWA 1OC7A 1T0OA 4K8HA 1OX5A 4I9MA 1C29A 4LUYA 2ZX6A 3K4AA 3MUIA 3R2GA 4GD0A 4LUJA 2WPBA 4HA1A 2ZRYA 3UGRA 2NQJA 1EPVA 3QY7A 4UQBA 4M1BA 2ZOXA 3OO2A 2OOFA 3OZYA 2NLIA 2I9UA 5DRCA 3GK0A 3L4TA 3DFSA 1OG0A 2ZA3A 1VEMA 5RUBA 4A3QA 2NQ5A 3GH5A 1HTIA 1K8XA 2E5BA 4LBUA 1TELA 3WK3A 4MJ2A 1WV2A 5A6JA 2Z00A 2WLYA 1LWIA 1AL7A 3MSRA 4XV0A 3QC3A 1EC7A 3C6CA 3OOQA 2WJZA 5GQBA 4OOZA 4W7UA 1VD6A 1GUVA 4U10A 4Z1BA 3QSTA 1VCVA 1PDZA 3CTLA 4GG9A 2KZHA 2RKXA 4O19A 1EH9A 3B03A 3MKCA 4NZ5A 1JG9A 4B5NA 4WY0A 5G1MA 1EC9A 2WSKA 2F2HA 4WDXA 1NELA 1HO1A 1TPEA 1V6VA 2EPHA 3FGCB 3L4VA 4AD3A 4XKMA 4FX8A 4L6OA 2CPUA 5D32A 3UJ2A 2WVVA 1L6GA 2X7VA 3MTWA 3F5JA 2OMAA 3MVTA 3C2EA 2ZVIA 3R4IA 3UCQA 5I5RA 1JD9A 1MMFA 3NDZA 4JN8A 1TJRA 2FFCA 3SB0A 5CBIA 1TWZA 4HBKA 4CNPA 4QX4A 3M07A 4MMWA 1SSGA 1UROA 5C54A 4M51A 2W63A 4FNSA 1RJQA 4J4KA 3D6NA 3AS3A 4MUPA 1YXCA 3SFKA 2PE4A 2VCAA 4QCEA 6TAAA 4E0CA 3EWZA 3H2OA 1EUNA 1KLZA 3DERA 4LAOA 4IIFA 3VIMA 4IMFA 3W7LA 1FVPA 1H50A 2BHUA 1NEYA 1VGAA 2YLAA 3B8UA 4JTRA 3TVAA 1NP2A 2CFFA 4JTEA 2ZUVA 5LGXA 4W5UA 2BZNA 1PSCA 4CD6A 3NQAA 4QHRA 3AMKA 1NWUA 4JTTA 2Q09A 2J8GA 3G18A 3SQSA 3P8JA 1IWPA 1OK6A 1S2TA 2OX4A 1U5HA 1MNSA 4QDMA 4WY0F 4S3GA 4C6KA 2QCCA 1NDWA 3LNPA 2VC9A 1FWAC 3UYCA 3WFLA 1UWUA 3V5OA 4OKDA 2J6XA 5BRQA 3INPA 2JF7A 5EFDA 3VK5A 3DHFA 5HUPA 4B5SA 4E8GA 3WH9A 2R6OA 3PUEA 4IL0A 1R2SA 4ZOAA 1DQUA 1GG0A 1XYBA 5HATA 4LBSA 2HWGA 4PEKA 3S5OA 2A3BA 5A3HA 5HPOA 1Q6EA 1BGGA 2G50A 3D3AA 1F6PA 5KZMA 1MFUA 5AHEA 1Q45A 2BMBA 3W87A 1VYRA 4MNKA 4AD2A 1QVBA 4EXBA 5G2WA 4ATLA 4ZL1A 1MI3A 3T2OA 4PUEA 5K2ZA 4HNTA 3LG3A 4X0VA 4I9AA 2HJPA 1UD5A 4V1XA 3BW2A 4P8VA 3WK1A 2XTKA 3CZLA 1MQPA 6REQA 5EBUA 1Z8AA 4LALA 1XYMA 1Y5WA 2DVTA 3KWXA 3HPXA 1R6WA 1CB7B 1CNVA 1IEVA 3DC0A 1WDPA 3FV9A 1BF2A 3AZSA 3GDRA 3FFSA 3N15A 1CLKA 4N2YA 4GVFA 4DJDA 1ISXA 1VEOA 3RNDA 4E2DA 4ZODA 3GE7A 2QPXA 1FP9A 4DLFA 2V9DA 5I23A 3CS2A 3W75A 5AB3A 1MWOA 4KGJA 3W1XA 4HA4A 1S38A 1DIEA 2OSWA 1TJPA 4UTTA 3AMDA 3GFYA 1FY6A 4PUNA 2W27A 3OA3A 4C6JA 2V5BA 1CDGA 3MMWA 3GKAA 3IVTA 3DCPA 3GXTA 4WKFA 1HP4A 3PN8A 2D69A 1UA3A 3I6RA 3FDGA 3F5LA 4GVIA 2WQDA 1IT8A 5AECA 3SRHA 3B8TA 5SWUA 4ADSA 3G0UA 3W7KA 1UZ4A 3CQIA 2VL4A 5C9UA 2VZTA 1JDAA 1PB0A 3OIXA 5M03A 4Q8NA 1IQ8A 3L2LA 2XM2A 2CLOA 3GVGA 3ENLA 2W6RA 5CSUA 3KRSA 1UKOA 4E3VA 1WKFA 4H2CA 4HQVA 1NQKA 1S5TA 4FMVA 4RV8A 1NWRA 4WIWA 1S46A 1CGYA 2DIEA 3PZGA 4YMZA 2H90A 2XYLA 4LQ1A 3EXSA 9CGTA 3G2GA 4A4AA 1B2YA 1KFCA 1PWMA 3T44A 3S5ZA 4MTVA 1RSCA 4O18A 3FSTA 4DXKA 3IWPA 1TQXA 3CUFA 4US6A 4HHMA 1CZ1A 4OV9A 1C8XA 4HTYA 3PPHA 2WHLA 4Z08A 3F4CA 4BI5A 1JI2A 3II1A 3WJZA 3OGVA 3LU2A 4PMQA 2JIEA 4KKXA 1B31A 4DBWA 3KLLA 1UCWA 1XW8A 3UGVA 3P6LA 1R9XA 1GVQA 4AX7A 3GBEA 1E51A 3DFTA 2DP3A 4MIMA 1TA3A 3QYSA 2PDYA 1MUMA 1AQ0A 2GGEA 5DY3A 1JR1A 4D8AA 1TRDA 1J93A 2CBJA 3PAOA 1AW1A 3GRIA 4X2PA 4C6IA 2XDFA 2E5DA 2KAUC 3PBUA 3I10A 5TIMA 3DDMA 5I3JA 1SR0A 1TMHA 3LLXA 1LYXA 2HEJA 4ZQNA 4H9MA 4F40A 4JQ1A 1OX4A 2PDIA 3RIKA 1LUCB 3GIYA 4DZIA 2G8ZA 1RR2A 5JU6A 3BLIA 1EGVA 3FJ4A 1YX1A 3TOYA 3HGJA 2PD5A 4HPGA 3IIZA 3HFTA 1LG1A 1AH4A 1JPDX 5CZKA 5IOBA 4X60A 1JQVA 1W1TA 3BG5A 3HG3A 4DM1A 3KDNA 4JN6A 5LA2A 1R5YA 1ZCCA 3IJ8A 2VVNA 1TX2A 1QOQA 1M53A 3AROA 3WQPA 3AIRA 3CASA 2NVAA 4UQCA 3ABSA 4F2UA 3SSJA 1YE4A 3EA3A 1TG7A 2UV8G 4D6CA 1CI1A 2CETA 3QTPA 3QOKA 3QM3A 4XAYA 2DW7A 1SYTA 1CXIA 4GIRA 3H53A 3MP3A 2DQWA 1OFQA 1DHKA 2FQIA 1K03A 1TRIA 5MKGA 1TQJA 3D3FA 4OE7A 1HJUA 4JHMA 1VFFA 4EXQA 1PKNA 4BEQA 2PCEA 3W7DA 3QHNA 3TA9A 1P6BA 5I78A 2I17A 1K7XA 1DWGM 1GHSA 3L4ZA 4H6QA 4O52A 3NUKA 3W22A 1PCKA 4R3UA 1BG9A 3AWOA 3VILA 3OLDA 1E3XA 4YLWA 2F6KA 1IE7C 3TJIA 1VFSA 4H41A 2CESA 3TEVA 1H63A 1P5BA 4Z2KA 2A7PA 3GVWA 1EP3A 2BOEX 5HR6A 3UPMA 3MV11 3GO2A 2OEJA 4Y9AA 1OEPA 5CC3A 4HGXA 1NY1A 3BCFA 1Q2RA 3T8LA 5CJNA 3WG6A 4ALDA 3TKFA 3HPAA 3AYSA 3FS2A 2OEMA 3OZMA 1BYDA 1HKIA 1E71M 3R8RA 4F48A 4LAMA 4UR9A 1VBHA 3G1RA 2O9PA 2DVUA 4D1IA 2ZRUA 1DYSA 1EEPA 4DUXA 3RCYA 1WAUA 4BHYA 3W70A 4M7TA 5A8OA 4GCAA 4LYKA 4PB5A 1PCWA 3NGFA 2XIIA 1HNYA 1RV8A 3A13A 4U5KA 4JTGA 1HGYA 1EC8A 2H9AA 3FYPA 4ZENA 1XLCA 2IKGA 3GXDA 3T40A 3ZVHB 1FWBC 1F8MA 3PBWA 3MWCA 1G94A 3GTIA 2A2IA 2ZRWA 4LOCA 1R8LA 4PUWA 5D2XA 4KW2A 1VFUA 1FWHC 4QLJA 2NXHA 1KFWA 1Q8JA 4HHPA 3SUUA 3IJDA 4RK8A 3GQYA 3TCEA 1H0GA 1EJXC 4P7RA 2YCKX 1IXPA 2A85A 1OABA 3NDYA 3MYPA 4JTQA 3A4XA 4I8DA 3AHXA 2B4GA 5D9OA 3C2OA 2NLYA 4KGLA 4WGHA 3DUGA 2DZSA 3CH0A 1TO3A 4AVOA 4PUJA 1FWRA 3F4WA 1OIMA 4DJFA 3W7GA 3PY2A 2WAGA 4KFOA 2B0MA 5F4SA 3UERA 3COTA 3E6EA 1E4MM 3ARRA 1KW1A 1KM2A 1L6WA 4M6QA 4PFMA 2AQVA 2VDGA 3UXLA 5CSYA 4EWJA 2O9RA 3LTSA 3W85A 3NO5A 3H24A 3B8VA 3R0KA 4AIEA 2OZ3A 4W87A 2PRMA 1AQHA 5H8MA 4QG8A 4AD4A 3ZS4A 2HE8A 5GNZA 3VDHA 3C4UA 3W86A 1C90A 4HZ6A 3GDMA 1GPWA 3S42A 1LDCA 3V75A 1X7IA 4JNZA 4FR6A 4TVUA 5FESA 3S2CA 3LHWA 4HU4A 3P74A 5ECUA 1UR8A 1UR3M 3K8LA 4MJZA 3E0VA 3KXQA 3PPCA 5JH2A 3GM8A 1TPVA 3ZZ1A 1PJ9A 2V5DA 3NCOA 5FD0A 4J27A 4U2YA 1XC6A 3UU0A 2A3AA 4MG4A 1XYLA 1T7LA 3DGRA 3DXIA 3SCPA 3VOGA 4DBEA 1UD4A 4URIA 3NR0A 4UTLA 4JFVA 3OP2A 4LH8A 2YCEA 5C9XA 3KL5A 5D38A 3QBUA 4PCTA 3SCOA 4FNTA 1SVDA 1XIFA 1W9UA 3R6IA 1TV8A 3TONA 4KWSA 2GJLA 3EDDA 1XH2A 1UBPC 3B8WA 3O7UA 4QGCA 3P60A 3WLHA 3T0DA 2XFWA 5FA5A 4YHGA 3CAKA 1QCWA 3GFXA 4HNCA 1C9WA 4YVVA 5KZEA 3RU6A 4QR6A 5TQLA 1PXGA 4GI9A 1GOOA 3KL0A 4K3ZA 4YTQA 4Q4MA 4JTUA 4GVGA 3R25A 1ML1A 3POHA 4GK8A 2AL1A 3HN3A 1FX6A 2F7FA 1HO4A 3MI6A 4ZCWA 5IDIA 2XSAA 3RR4A 1IIHA 1KFKA 4W9TA 3W1MA 3AMLA 1O6IA 4NT0A 2GL5A 2Q6ZA 1AMYA 3UZWA 4JTCA 4S3AA 4G9PA 1HL8A 3MP4A 3LQLA 3TZFA 2FH8A 3FOKA 2KX9A 3W37A 1SZFA 1UKSA 1AVAA 2J62A 1C3FA 2PC4A 3UCCA 1DWIM 4HCDA 1KXTA 4LW7A 3DFOA 4NL1A 1WB0A 3KCJA 2OZ8A 2C1GA 5CCZA 1R2TA 2J9ZA 1T8XA 3KWSA 4YTUA 3KRZA 2C0HA 1QPOA 5D05A 2A0NA 3WK0A 2PFHA 4FF5A 4C6PA 1UOKA 1XSKA 2AMGA 4V2XA 5G1YA 2Y5SA 1EKOA 1KGXA 2HV5A 4MAZA 1BRLA 2HPMA 1KKRA 2IQTA 1SFTA 4V15A 1FHLA 1A5LC 2V30A 3MHFA 2NSOA 3UPBA 3URBA 4IQJA 1T6MA 1S39A 3WF1A 1JF6A 3TQKA 4RV3A 3TN6A 2FHCA 2ZA2A 1YKWA 3KBNA 1EO7A 3DKJA 4AY1A 3HO8A 2R8WA 4LC8A 1B90A 3QQ0A 2GJXA 4LS1A 4Q8OA 4YIWA 3WDQA 3JR2A 1GQNA 3M0ZA 3AXIA 1CW2A 3TXVA 1ISVA 4WRHA 3FLUA 4HMDA 4MKNA 3H4XA 4UNLA 4PSRA 1YPIA 3GTFA 4AFYA 3UD6A 3WNPA 4QEHA 2OKTA 4WLCA 3GBDA 4IPPA 3TZNA 3VZXA 5HANA 2JFEX 4B4FA 2NX9A 4IISA 4PMJA 2ZC1A 1I2NA 2EQDA 2GJPA 1GCYA 3MO4A 2NV9A 2VEMA 1NOUA 4FOUA 4GYPA 5CLTA 2ABBA 3KVLA 3NZQA 1KV8A 2A3CA 2B7NA 3B4YA 4A3YA 2R82A 4Z17A 4B4HA 1H62A 3OYZA 3U8GA 4AVFA 1FCQA 1QI2A 4O1BA 5TBOA 3EWUA 5H8PA 3ARYA 3L7RA 3EOSA 3MSGA 2IQ0A 2GQ8A 2W62A 3BAYA 5C8BB 3C52A 4C7FA 3G1SA 4H1ZA 3CWOX 4NRRA 5LIWX 3S9ZA 1UYQA 2BGNE 1AW5A 3IACA 4TIMA 1P1MA 1KBKA 3S5SA 1C8YA 1HGWA 2G3NA 2VT0A 1JZ8A 3SECA 5A6SA 2PDXA 3L9CA 3WH8A 4GJIA 3ECQA 4MNLA 4PR4A 3KBWA 5GJPA 4BEUA 2YYTA 4A8RA 1XCWA 1OF8A 4CD8A 5FJRA 1JQXA 3RRXA 2V5JA 4QLKA 4EK7A 1U1UA 2WVVB 1J0IA 3PANA 2QJGA 3UR7A 4RW3A 3TNOA 3SJ3A 1F5ZA 1LOLA 1CIUA 3OB8A 3J7HA 5M3WA 2W91A 4NILA 2V38A 3CB3A 3RXZA 4EOUA 4K8EA 3UWZA 3HPSA 3W2KA 4E8CA 2R24A 2QJHA 1MXSA 4GINA 3VD9A 3GU1A 4A3RA 4V33A 1O68A 3E12A 2G4JA 3WF0A 1JPKA 4H8HA 4AMAA 5GJMA 1PIGA 1PIFA 4DAIA 1LLZA 2Y70A 2ZXQA 1OADA 1JNDA 4GUFA 4O0ZA 4AG0A 3I68A 3QV7A 5LNVA 2DFAA 3W07A 3PZ9A 3OG3A 1JDDA 3PZTA 2XPKA 3TW7A 1W9DM 3WNNA 2W3ZA 1AODA 1EXPA 5FSDC 1QJWA 3R7MA 2YXGA 4LF2A 1E4LA 2OWCA 1N8FA 2NZLA 4D6EA 5ABEA 1QPKA 1XQLA 1DJNA 4E2OA 4FXRA 2D24A 1KCLA 3DECA 3ELFA 4FSAA 2V68A 2PDMA 1OCNA 3ABOA 4EP8C 5FI8A 4XBSA 1E9Y