4AF0A

Crystal structure of cryptococcal inosine monophosphate dehydrogenase
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
522
structure length
395
Chain Sequence
TNPNAPPRPDSLLNPSDALKHLEEYPRGDGLSLQELMDSRKNGGLTYNDFLVLPGHINFPASDVSLQSKATKNIVLNTPFLSSPMDTVTEDRMAIALALHGGLGIIHHNCSAEEQAAMVRRVKKYENYPYASKVPESKQLYCGAAIGTRPGDKDRLKLLAEAGLDVVVLDSSQGNSVYQIEFIKWIKQTYPKIDVIAGNVVTREQAAQLIAAGADGLRIGMGSGSICITQEVMAVGRPQGTAVYAVAEFASRFGIPCIADGGIGNIGHIAKALALGASAVMMGGLLAGTTESPGEYFYHEGKRVKVYRGMGSIEAMEHTGLDNAATARYFSEADAVKVAQGVSGDVADKGSINKFVPYLFTGLQHSLQDAAIKSVSELHSCARSGSLRFELRTAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title De Novo GTP Biosynthesis is Critical for Virulence of the Fungal Pathogen Cryptococcus Neoformans
pubmed doi rcsb
source organism Cryptococcus neoformans
molecule tags Oxidoreductase
molecule keywords INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
total genus 123
structure length 395
sequence length 522
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2012-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4af0A00
4LU0A 3KRUA 4WD0A 4BI6A 4U28A 3NM1A 5FEWA 3S8HA 3OHIA 2E77A 2WNNA 3NM3A 1XKYA 4IPJA 3G8EA 1HO4A 2V81A 3EX3A 4LV4A 1FDJA 3CQ0A 2XN2A 5CGQA 3W73A 1SZEA 1YTDA 4HIBA 3TJXA 3LRMA 3TSMA 1NVMA 3LCXA 1VGAA 2OZ0A 4ZQMA 3OG3A 3STFA 3N73A 2GVJA 1EUAA 2A6LA 2HSAA 3QMRA 5J5DA 1AW1A 3SJ3A 2GPTA 4UNKA 4LY8A 2NWSA 1DQWA 4JDBA 3EXTA 2ZZ6A 3W2LA 5C2XA 1SO5A 3HF3A 1QAPA 2GOUA 3AJXA 3CB8A 3IEBA 3TIMA 3GAKA 1D3GA 4TR9A 2YXGA 1VLIA 4MYXA 4QISA 3NA8A 3CC1A 3RFAA 3HOJA 3S0CA 7TIMA 3B0VC 1QMLA 1W5MA 1IIGA 4M7TA 2CLFA 4K6AA 4UCGA 3A22A 4I7UA 3A5VA 1R47A 1VYPX 5EA9A 1S5WA 1LBFA 4GUJA 1H7RA 3Q2DA 1OX4A 2E6AA 5BNKA 3W1PA 2CU0A 5AYZA 1KFBA 1H61A 5KINA 1K03A 2DZWA 1A50A 4FX6M 1SZNA 3W1XA 3EWWA 5AHIA 2Z1BA 1F5ZA 4JTLA 2B7OA 1P0KA 3I7QA 4LVGA 4GWEA 4XTDA 2ZQ0A 1L9WA 3PF3A 1R46A 4GC4A 4RKAA 3E96A 3RLVA 4UTHA 3BV4A 1VH7A 3L5LA 1S5TA 1RV8A 1ADOA 2DZTA 2QUVA 1P1XA 1LORA 3W72A 3NR0A 1WV2A 2NUXA 4DBDA 1XC4A 2H3BA 3E49A 2QJGA 2ZRVA 1L6WA 1OABA 1TPFA 3S5ZA 3G22A 3M0ZA 3TU9A 3TR2A 1PIIA 3W7RA 1OFDA 1JUEA 1H1YA 5BMWA 4XBKA 3V1PA 4WQ6A 3FFSA 1VS1A 1TTQA 1W56A 4RZ5A 1N8FA 1TPVA 3GK0A 1FDZA 1I2QA 1OFEA 3S1XA 3LTPA 3P82A 1X7FA 2X30A 4MIMA 3RMJA 4NJGA 2FB2A 4O0KA 2A2IA 1SU5A 2FB3A 3UWZA 1FCVA 1V7YA 1Q6LA 2C16A 1H50A 3KXQA 3ATYA 3BG9A 4TX9A 1WX0A 4QITA 3W7LA 1LROA 2RHGA 3G1HA 2RH9A 1I8JA 3FLUA 4KFNA 5BMXA 3T55A 2Z6IA 4EVZA 3TSBA 1KM4A 2E6DA 3PY2A 1O5XA 1WBHA 1BTMA 1FUYA 3W74A 4RJEA 5AHNA 5LNRA 3TX9A 2GVGA 3LLFA 5G1YA 4GUHA 1F7BA 5I3HA 3MMTA 1TV7A 3W7GA 1O94A 2QCDB 2QUTA 3G1VA 3O1NA 2VFFA 2WSQA 3W23A 1FY6A 2JKPA 1LP6A 3PUDA 4UR8A 5FF3A 2C1HA 2VFHA 1YLVA 4S2BA 2ZYFA 4UTTA 1AW2A 1PCKA 5HJLA 3S5NA 2GUUA 4IOTA 4Z1DA 1PHQA 1QCWA 5K7JA 3BK0A 2Y6ZA 5DXYA 2BX7A 3PS7A 2V5LA 3GVGA 3N19B 2TMDA 1EA0A 4PC8A 4G1KA 3TCEA 1JCMP 4DO6A 4CQ8A 1VHNA 3LB0A 3G0UA 3GXTA 4NJJA 4MKNA 2EKCA 4RZ6A 4UUIA 1KFCA 3DFTA 4O13A 4FNUA 1WOAA 3W85A 1TO3A 3CEUA 2PRHA 1PS9A 3P5ZA 4X3ZA 3TQVA 1KM0A 2YX0A 3IVSA 3B0PA 2YPIA 1G67A 1QPRA 1TTPA 2O7QA 3B0UX 1I4NA 4X22A 4Y90A 1X6UA 1LRTA 1WDWA 4FB7A 1ICPA 3LBCA 1OVDA 2GVLA 3CU2A 4O11A 1SUXA 3ANYA 3C2RA 5CPMA 5AC7A 5IM51 4N2YA 2R91A 1PV8A 1Q6QA 3UZ5A 3P81A 1EUNA 4JTIA 1JCXA 3CWOX 3NZRA 3TAOA 1UCWA 3L0GA 2NV1A 1LLZA 2QCDA 4O50A 3LHWA 3W2MA 5E0KA 5LNSA 3RU6A 5CPNA 2CLIA 2HS8A 2ALDA 2VXNA 2TYSA 3NQCA 2QJHA 5AHLA 4Z1BA 2BTMA 1SSDA 3BO9A 5CSRA 3MBFA 2QAPA 4MZYA 3QF0A 4AEOA 2H6RA 3KVLA 4POCA 1O5KA 5FF0A 1JQVA 4O4WA 2DP3A 3NQVA 1EWDA 4BI5A 2ATMA 3P8IA 3FEMA 1HL2A 3NOEA 4FNPA 1G4SA 2ZFAA 3W1AA 2HS6A 4TMBA 3A5FA 2CLHA 3A24A 3CEPA 2QF7A 3HJZA 1FQ0A 2X2GA 3I65A 5D37A 2H8ZA 1JRCA 5G5IA 1NF0A 2X1SA 3IIOA 4RR4A 1K8XA 2ZZ1A 3O6DA 4IX2A 1U5JA 1D9EA 4WY0B 1EX5A 3G1FA 1YPFA 4Y8FA 3G1DA 4MZ1A 1OF8A 4NJIA 4JIPA 5D30A 3W7NA 3C0JA 1L6SA 2RFGA 1FWTA 3NQDA 5EBUA 3TJLA 3DHDA 3NQAA 1DKWA 3LHVA 3L5AA 3M9YA 1YADA 1LBLA 3NPXA 2VFEA 3R89A 5DLCA 1H1ZA 3PSWA 3TDFA 1ML1A 2PC4A 2RDUA 3KRSA 3EXSA 3DKJA 3UNDA 4UFJA 3SW6A 5D2VA 3A23A 3NPWA 1Z44A 3WK3A 3LI0A 3F4NA 3F1QA 1H5YA 3QYQA 1T99A 3GZ3A 3HGSA 2NX1A 4IMCA 4KKXA 2G95A 2J9XA 3CT7A 3GX9A 6ALDA 3PULA 4HSNA 3ATZA 4O12A 1GVRA 3OVRA 1K8YA 2D73A 2C13A 4LOCA 1KBJA 1JCNA 1PCWA 4M6QA 2ZTJA 3EB2A 4GBUA 1M6JA 3W7IA 2E68A 4EIVA 3W1MA 5FEZA 5HWNA 1XFBA 4JDYA 5BOOA 3PC0A 4N9EA 1W5OA 3W1TA 2E5CA 4WOQA 1PVNA 2ABAA 4UR7A 3UWUA 3C4UA 3CIWA 3MYOA 5KITA 3UXAA 1OFRA 2Q8ZA 3TKFA 4X2RA 2YYUA 1QR7A 4JICA 4ICNA 4LRTA 3FS2A 1TPB1 2BLEA 4AH7A 3TXZA 2J9YA 4CNOA 3HMJG 1JCJA 1EIXA 5HUOA 1LRNA 2GJNA 1YDVA 3GDRA 2QAFA 3UY8A 3TSDA 5K9DA 3C52A 3TW7A 2KZHA 3TK7A 1Q6RA 3SFKA 1EB3A 4LT9A 1AMKA 2YCEA 1F76A 4JTSA 2XN1A 3QM3A 2PE4A 5BW6A 1Y0EA 5AC6A 1W5PA 2DZUA 2NXGA 2VC6A 2AAMA 1I45A 2V8ZA 3NEVA 3PBUA 5AC8A 3STGA 5EPDA 1LZOA 1OX6A 2H3DA 3LV6A 3KRZA 1ZENA 4LVDA 2VFDA 5G4WA 3HGJA 3EWUA 1OX4B 2CZ5A 3THQA 3QMSA 3G3DA 5F4WA 3GKAA 1J5TA 1KM5A 2WOQA 3MI2A 1SZFA 5L9FA 4IX0A 4LS2A 3NL2A 3O07A 4LTSA 4N4PA 1M7PA 4M7SA 3W1UA 2C19A 4O1CA 1O95A 3S6DA 4ADSA 4CNNA 1WXJA 2ZRUA 3ABOA 3S5OA 1ICSA 3B06A 4UXDA 2ISVA 3L65A 2Q3OA 2FTPA 3HPZA 4WY0F 3B04A 1ZY9A 2I1OA 5G4EA 1QOPA 3E02A 1VLWA 4UNLA 4K38A 4RCXA 3BLIA 4D2JA 3MHGA 4W9TA 5AHEA 1FCUA 4EOUA 1SO3A 2QCHA 3WK0A 2FJKA 3P60A 1A53A 1JUKA 3PG9A 3ZWSA 4HNNA 2ZRWA 5D2WA 3H53A 4HT3A 3GLCA 3EX1A 3W1NA 5U4NA 4FIRA 1OG0A 1DORA 1H7NA 3DI0A 2P0OA 4MY1A 5D32A 2Z0IA 1V5XA 4E38A 4K7VA 2V0TA 3GAYA 2JBMA 4XQ6A 1KFEA 3NQEA 4L4LA 3TW6A 3LTSA 1SW0A 4O28A 4RLIA 3DI1A 3INPA 2A7NA 2AQWA 2VFIA 3DU0A 5EYWA 5F1VA 2ZTKA 2OJPA 1X8FA 2Z6JA 2NZLA 2YFOA 3L67A 1YDOA 3W76A 2TSYA 4O53A 1B3OA 4JX4A 2EHHA 3C2FA 4MJMA 3EX2A 4IXXA 4AAJA 2C14A 4QAIA 5F2IA 3DBPA 2J9ZA 3QH2A 3DKLA 5TQLA 4MYAA 3UWVA 4Z1AA 4UMCA 4LC8A 4ORMA 2ZBTA 2O7SA 2XFWA 1A5AA 3W7KA 2I14A 2FPTA 5LNUA 4A22A 1XBZA 3N14A 2PRMA 4BR1A 1QNVA 2CZEA 1DV7A 2NUYA 4N9CA 3UD6A 3CIXA 3NGJA 3MO7A 3O6CA 2QR6A 1OFAA 3QZEA 1GYNA 2NX9A 4ADTA 1VRDA 4AHOA 4NVTA 3SR7A 1F74A 4FXRA 1TMHA 4FHAA 1KLZA 3M5XA 1RQHA 2CZFA 5D2YA 4O16A 1KFJA 3GR8A 3R2GA 3TFCA 1C29A 4K7YA 1M7OA 3VE7A 3M44A 5LHEA 5I3FA 5K4XA 4DEFA 1GVOA 3MP5A 4O15A 5C54A 4BK9A 1DVJA 2ZZ4A 4JY8A 3QQ1A 1FDYA 3P8JA 1SW3A 3P80A 1B4EA 2TRSA 2CW6A 4JTKA 1BWLA 3AO0A 3NPVA 3MHFA 1QOQA 3NXFA 4A29A 1FBAA 2VOMA 3WK1A 4ZQPA 3W7QA 3Q94A 2P10A 3LLDA 2ZZ7A 4AF0B 3M5ZA 1VPXA 1LM1A 5F4SA 5LHFA 3PBYA 2CWNA 4O52A 3N9SA 2Y63A 2GQAA 4L4MA 1QFEA 3W2KA 1H62A 3B05A 1IXOA 1MO0A 3NL6A 1OK6A 1I2NA 4M6PA 1ZAJA 4NZJA 1KTBA 5D05A 1P5BA 1G6CA 2E5DA 3TXVA 2BZNA 2WSRA 2CLMA 4NJHA 2ZA1A 4LWWA 3LOTA 4OQVA 1SR9A 3PWAA 4XBSA 3W7PA 1UUMA 1R2SA 4FXSA 1G7UA 1GOXA 3CWNA 4JX5A 4FNSA 3F03K 2Q3RA 5CZTA 1GVSA 4FNQA 2QCLA 3NQ7A 3LHYA 3OVPA 3S1UA 3LXAA 2QCGA 5KZDA 4O8RA 3LDVA 3UYCA 1Q6OA 5G2HA 2V9DA 4MPQA 1EP1A 3N3MA 2C0AA 5D09A 4NNAA 3WJXA 1FXPA 4PL2A 4NX5A 3WFAA 3QW4B 2V2CA 3NL3A 4GXMA 1GEQA 2YYTA 2F7FA 2CLOA 4A3UA 3KAOA 1SO4A 1H63A 3BLFA 3KFTA 5T26A 4NNBA 4O14A 3T78A 3SIZA 1TQXA 3I7SA 4KFPA 3JS3A 3STEA 4Y96A 3G0XA 1OX5A 1MEIA 2J24A 4MLJA 1KV8A 2VFGA 5AB3A 1EWEA 2ABBA 5AYXA 4UFLA 4YLWA 3MJYA 4LS0A 4R53A 4WXYA 3BARA 1GQNA 3EXRA 4YCPA 5AHFA 1XBYA 1HUVA 2YFNA 2CLEA 3P67A 2DJLA 3KVKA 4WZHA 1GZGA 4M6VA 1YDNA 4O1BA 1S5VA 4E0CA 4C1LA 2VEPA 4LUIA 5HQEA 4K36A 1IXQA 2FPYA 3M47A 3OVQA 4UMBA 3SSJA 3EWBX 4DELA 1WOBA 2FQIA 1M5WA 3NNTA 1K3UA 4OV9A 4XKYA 1TYGA 3GB6A 3ELFA 4XWUA 4XTIA 3GKFA 4ZQRA 1TB3A 3LHZA 2Y7FA 3M5YA 3FOKA 1T96A 1OFBA 3CHVA 1F73A 3FKKA 1XL9A 2E09A 2TPSA 2Y70A 1GG1A 1OHLA 1JCLA 2X1RA 3GDTA 3GIYA 1LCOA 1G4PA 4WJEA 5AFDA 1W54A 4DF0A 4NUWA 4PA8A 2NWRA 3NG3A 1KFKA 5K2ZA 1AL8A 1KM6A 4IWWA 4LNYA 4IPIA 4ZQCA 3BPWA 1F6PA 4LW7A 3BLEA 3LTYA 3S1VA 3N2XA 4WXZA 1FWWA 3C6CA 4BFAA 1C9DA 4CQ9A 2QDHA 3L68A 1SFJA 5C55A 4M5PA 1HO1A 2C6QA 4DO4A 1UUOA 1R2TA 5HNRA 2A6NA 1FWSA 3W2UA 1YTEA 3LBMA 4FO4A 2G97A 3DH7A 5J5RA 2CLKA 4DO5A 2B4GA 1TIMA 1VCGA 3RLUA 1TPUA 2QEZA 4ZQOA 3C8FA 5LGZA 3C3NA 3I7RA 4JYFA 3W7HA 3LI1A 2A85A 3CM4A 1NFBA 3KVMA 4QNWA 1TV8A 3SZ8A 3TC6A 1KTCA 1LYXA 3HQ1A 3IV3A 1Z48A 4MVAA 5KTLA 1TJPA 4QQ3A 1RQBA 1OYAA 1KA9F 1AL7A 4HNTA 3W1RA 1IXPA 3MWAA 3UWQA 1TPWA 3FIGA 1KBIA 2PCQA 1W1ZA 3M43A 1VCVA 3G1AA 3B8DA 4HKPA 2QKFA 1A5BA 3NQFA 3E0IA 3W07A 4Y6GA 4FF7A 2QCNA 3CTLA 3L66A 3Q58A 1MXSA 2OX1A 3OIXA 1JRBA 3LXCA 2BSLA 3O06A 4UTIA 1ZALA 4WY0A 1D3HA 3EX4A 4I9AA 1YXYA 4GNJA 3PAJA 3L5MA 4JTJA 5CPOA 2WNQA 4HPXA 5CZSA 3W2NA 1T0OA 4UIOA 1LDCA 3N2MA 4UMAA 1Z41A 1RVGA 3HGRA 5DXXA 3LCFA 4OV4A 2DZXA 3QSRA 3GXNA 4FIQA 3UY7A 5H2ZA 3L9CA 1XI3A 3TROA 2UV8G 2RKXA 3F4WA 3H55A 2DZPA 4WOZA 4UFKA 3O05A 3IVTA 4MY8A 4OT7A 4UTWC 2QCFA 4OBTA 3NDOA 5H91A 3ZR4A 4KWVA 3S42A 1GJPA 1QO5A 3MHUA 2QUUA 3DFPA 2J27A 5LNWA 2JK2A 5CKSA 3L21A 5D02A 4UFHA 3VFLA 1OF6A 1RR2A 4JNMA 5LKYA 4RV8A 1JR1A 3EWZA 1ALDA 5I3JA 3EWYA 4MFEA 4S1FA 5FF2A 3MYPA 2ATSA 3GYEA 3W87A 3GDMA 4NU7A 4MUZA 3LX9A 3W71A 4AMAA 4EF8A 1GG0A 5DY2A 4UFIA 1XUUA 3W86A 1U83A 3BVJA 2EF9A 3TQKA 3RF9A 1ZJIA 4Z0JA 4MJZA 3BW2A 5FF7A 3L0KA 1K7EA 3A9IA 8TIMA 4P2VA 3NQ6A 2YW3A 4PEKA 3DXIA 3UPBA 5TIMA 2C3ZA 4DF2A 3CPRA 2XN0A 5HR7A 3QJAA 4QSHA 3IGUA 3DAQA 3U8GA 4LS1A 3BG5A 3PR2A 1GPWA 3R8RA 2E6YA 5MHBA 3S1WA 3BW4A 3W7EA 4OGZA 1J4EA 1OFQA 4NQ1A 1YTKA 3W88A 1DJQA 3M16A 3M7WA 2VENA 1JVNA 1O60A 3CLMA 4FEZA 5EKYA 1TJRA 1G4TA 3SGUA 1TPC1 5TBOA 2G5WA 1GWJA 2DZVA 3QMTA 4XKYB 5F2MA 4YWIA 4JGDA 4TIMA 2W79A 3NL5A 2RDWA 4AHPA 1OFOA 4Z0SA 5DCDA 1THFD 4JY9A 2GQ8A 4FNTA 1EPXA 3SY5A 2NLIA 1H7WA 5AOUA 4AHQA 3P84A 1WA3A 1DL3A 3KX6A 3LHTA 4LVBA 3NQGA 3GXPA 3HPSA 3W83A 1KM1A 1LOLA 4IQLA 2YSWA 1I2RA 3EX6A 4NJKA 2ZCGA 3BG3A 3W1LA 4JX6A 3NAVA 3PBVA 1JJKA 2A0NA 1ZAIA 1R2RA 3ABSA 4JXCA 4AF0A 1XBVA 4DBEA 4JTHA 4P61A 3UQNA 4EF9A 2QJIA 4YCOA 3I6RA 3GDLA 1DOSA 1KM3A 2V30A 4QJ1A 3O16A 5HWJA 5A5WA 5L6UA 2NUWA 3D0CA 2W0UA 1X1OA 4HPJA 2PURA 3TH6A 3W6YA 4O54A 3HO8A 4OU1A 3QW3A 3PUEA 4O1AA 1DJNA 1AG1O 2Y61A 4LV9A 2V2DA 2WJZA 1K7XA 3W7JA 4UTMA 1SFLA 1H51A 3W2JA 1KLYA 2FLIA 3QRHA 1OK4A 6TIMA 1ME8A 5KZEA 1K02A 1L6YA 3M5VA 3WK2A 4LUJA 1PE1A 1TCDA 1QDSA 4UTTC 3DHFA 4JTFA 1LOQA 3UPWA 5FF4A 4LC6A 2R94A 2GJLA 3UWWA 4EWND 4C1KA 4DQWA 1ZHAA 3SI9A 1P0NA 1UB3A 3HG5A 2C15A 3FA5A 2X1TA 1C8VA 1W8SA 4OE7A 3TMQA 4YXGA 1VHCA 1IIHA 1EP3A 4UTLA 1EEPA 1ME9A 2WV8A 1SW7A 2CFFA 1JQXA 3W22A 5LZLA 1HFBA 1J2WA 1Z42A 1PL9A 4O19A 3O15A 3WJZA 2Y7EA 4CCDA 2DZSA 5EL1A 2H90A 3N9RA 5FI8A 2ZRYA 5SWUA 4X9SA 4JYDA 1HTIA 2GQ9A 1XBXA 4XUGA 3QQ0A 4GE8A 1QPQA 2ISWA 3KVJA 1KFLA 2WO5A 4ALDA 3IRDA 5CZ0A 4KWWA 4CLMA 1GVQA 2B7QA 3TUUA 3MW7A 3VI2A 3GNDA 5DCBA 1XDLA 4MLRA 3IIVA 4R7JA 4ML9A 4JEQA 2V2HA 2W6RA 3DFSA 3LV5A 3B4UA 2A5HA 3MUXA 3WJSA 4IGHA 1PHWA 3YPIA 3S9YA 1TREA 1XDMA 3P5YA 4QNEA 5CSSA 2V5BA 2QDGA 4GRSA 3DFOA 3PM6A 3GDKA 1L2UA 5HR6A 4UTKA 1SO6A 5KZMA 3SECA 4A2SA 1B57A 1WBJA 1R30A 1G69A 1H7PA 3C56A 1LTDA 3NO5A 1TRDA 4TU1A 1IGSA 3EKLA 2B7NA 2Y89A 4HSOA 5HWMA 5DN1A 2LLEA 3UWYA 1LOSA 1KV5A 3QEZA 2ZRXA 1QWGA 3L2IA 4ZL1A 3IIXA 3HB9A 1ZNNA 3E9AA 1OJXA 3STCA 4J9JA 4KFOA 2X16A 5K9CA 2ZA2A 3RNDA 2R8WA 1TPH1 4DXVA 3Q37A 2QCMA 3UZJA 4IMEA 3WJYA 1DBTA 1G4EA 4A21A 4WUIA 2A7RA 2BXVA 5DBTA 3W84A 3T44A 2DU2A 4Z08A 1JUBA 1GVFA 3MI3A 3G1SA 4HHPA 4MY9A 4JN6A 5GVJA 2A4AA 1W3TA 3W7CA 4H6KA 3FKRA 3LCHA 1VQTA 5HMSA 4I7VA 2J6XA 1LBMA 3DFQA 4CQAA 1W31A 3LXBA 1BEUA 1A5CA 4OWGA 3HG3A 4UTWA 4FNRA 4TO8A 3HG2A 3VE9A 3NVTA 3G0SA 3OA3A 3E12A 1QPNA 3B03A 4Q33A 1GTEA 1ZAHA 3HGOA 4H3DA 4DPPA 5DCEA 2NX3A 3G1YA 3NQ2A 1W37A 3N34A 4RK8A 2E1DA 3MBDA 4M19A 3O6YX 4DF1A 1SPQA 4GUIA 4GJ1A 4Q32A 3W75A 3EKZA 4NXKA 4TMCA 5LGXA 4JTTA 4MFDA 2E6FA 3U2OA 1JULA 1YXDA 4N4QA 3G24A 4FX7A 4LVAA 3TQ0A 5A8GA 2A7PA 1IXNA 1K8ZA 1FX6A 1VC4A 1ONRA 4RXFA 5I3KA 1ICQA 4K8EA 2YR1A 3NZ1A 1RQEA 2E5BA 4CCCA 3U6WA 3TFXA 2CLLA 5LNVA 1YYAA 5F4XA 2EPHA 5D33A 3LRKA 1SQ7A 4UTJA 2X1UA 3KHJA 5U7SA 4E2BA 4IXHA 4R34A 4HNVA 4QIUA 3R13A 1SSGA 4AVFA 2V82A 3QSTA 1XUZA 3P61A 5G1TA 1YXCA 3W9ZA 4HN4A 2B7PA 4N9DA 1YPIA 4U4MA 2CZDA 4IMDA 4BWLA 3PB0A 5CPLA 4ZVJA 2Q8LA 3W7MA 5DBUA 3HIJA 5D04C 1CX9A 1VJIA 4CNPA 1RD5A 2VELA 4MZ8A 4LRSA 4Y9AA 5D2XA 3W1QA 2EGZA 3NYZA 1RZMA 5E93A 2JGQA 2VEMA 4GUFA 4JS3A 3I68A 5DY3A 5F2GA 5AYYA 3IVUA 4NZFA 1MEWA 3O63A 4QM1A 3C2VA 3IIZA 1KW1A 1P4CA 1HG3A 5D2TA 2Y7GA 2ZA3A 3ABQA 2YGYA 1AK5A 4YL2A 3P62A 1CI1A 4O1DA 3FYPA 3BGGA 1XXXA 4PFMA 1FCBA 2NXHA 4BWLC 5HUPA 3OBKA 4PODA 4NXSA 3FJ6A 2B0MA 3PB2A 3HBLA 1XCFA 1OYCA 4UC5A 2OT0A 4RZ4A 1FCQA 1GT8A 1TV5A 1UBSA 3HPXA 1IF2A 5K9XA 4XZ9A 1RPXA 2FIQA 1DQXA 3ZS4A 1NF7A 1VZWA 3LERA 4WX2A 5EMUA 4O4VA 4AWUA 2G96A 2DORA 3W3OA 5FESA 3T4CA 1LRQA 3W7DA 2I9EA 2WKJA 4ADUA 1VR6A 3EEGA 4DPQA 3JR2A 3FYOA 1NSJA 1UASA 3NQMA 3LGEA 4BI7A 1TTIA 1OFPA 4GUGA 3M6YA 5F1UA 3MI6A 3RK8A 1X1ZA 1WQ5A 5AHMA 2YZRA 4PL1A 1WYIA 1XM3A 4B5NA 4FX8A 2FDSA 2PRLA 2YDAA 1MEHA 2Y88A 4K39A 1NEYA 3MP3A 3TV8A 1TQJA 2WNZA 3ABRA 2AGKA 3IGXA 1N55A 3P7YA 1MZHA 4O18A 1F05A 1ME7A 3HG4A 2H8XA 4HNUA 2HTMA 1TTJA 2QCEA 2FFCA 5K3VA 1TPEA 4JIQA 1TPDA 1FXQA 1BKSA 3K30A 2ZDRA 3PUOA 4NT0A 1I2OA 3EWXA 3R5EA 3W7OA 2Y7DA 1MSSA 3USBA 5CZJA 1DHPA 4K8HA 3M41A 1W5NA 4O57A 3A21A 4O17A 4LVFA 1FWRA 4RXGA 1W3NA 4JR5A 3DFNA 4YMZA 1O4UA 1F2JA 3GNNA 4RX0A 1S3HA 1BWKA 3ZWTA 2NXIA 2VEKA 2FPVA 1I2PA 2VKZG 4R33A 2OCZA 4PCFA 1W3IA 3GR7A 1KTNA 3OEXA 1NAL1 3T40A 2VEIA 3P74A 3THAA 2F84A 4IMFA 3NPUA 4PH6A 1LLWA 3C2EA 3LCIA 1F6KA 4N9BA 1Q3NA 4NX0A 5KSWA 1CW2A 1H7OA 1ZFJA 3G3MA 4S2CA 5K4ZA 3SGZA 1A5SA 2ISSA 3BGJA 5LSMA 4OHQA 3C61A 4IJBA 1TSIA 1EP2A 4AXKA 5G2WA 4H4IA 2A1YA 5DELA 2R14A 4ZQNA 5E1QA 2Y85A 3G18A 4JTUA 4AWTA 2BWGA 4ORIA 3TE9A 1SZGA 4AWSA 5I3IA 1TRIA 4PTNA 4UFMA 5IBXA 5BRBA 2ZRZA 5HINA 5D03A 4BF9A 3G1XA 1JCYA 1VYSX 4IUOA 2IQTA 3MP4A 3DENA 4E2DA 3TC7A 1Q45A 2OMAA 3VNDA 3WJWA 4IMGA 3ZFHA 3S5YA 1T8XA 3M1ZA 2QCCA 1KM2A 1WAUA 5EY5A 4Q4KA 5CG7A 3PG8A 1W5QA 3L0NA 1E51A 3W70A 1VCFA 3QPYA 3NQ8A 1ZCOA 3LRLA 1G7VA 2WPBA 3LCWA 3PVFA 2Y62A 4JYEA 4ONVA 3TNOA 5D38A 1FWNA 3QC3A 3TA6A 4ZZ9A 2P1FA 2A21A 4JD4A 3JRKA 5AN7A 4I7WA 5IBXC 3LCGA 3V75A 4JTGA 4CCEA 2OT1A 4AB4A 5C6MA 1AW5A 4N02A 3TMLA 3PBWA 3O8AA 1N7KA 3VKJA 3QFEA 5HULA 4O0ZA 3QPZA 1H60A 2JKEA 3LM7A 3T7VA 5I3GA 2ZZ2A 2WQPA 3H54A 4Z1CA 4K37A 2C18A 3DZ1A 1UJPA 4N6FA 4N6EA 5C5YA 4A2RA 3VCRA 3LCLA 3C2OA 2YW4A 1QPOA 1W0MA 1OYBA 2Z2UA 3PSVA 2ZZ5A 3DGRA 3KOFA 3IIPA 5FEXA 2DJXA 4JTEA 4ZMGA 3FJLA 1GYLA 1K7FA 4O10A 2HMCA 5ABTA 3BW3A 4MOZA 5F2LA 4NNCA 3LHUA 2NV2A 3TAKA 4GFSA 1VYRA 2ZZ3A 3IGSA 2WSYA 2RDTA 1B9BA 2JGYA 1B4KA 5G2IA 5KMYA 2EAWA 3UXDA 1H7XA 3R12A 3G8RA 4UTUA 2J88A 2JKAA 1GTHA 1QO2A 5FEPA
chains in the Genus database with same CATH superfamily
2G3IA 3KRUA 4WD0A 4U28A 4AU0A 2VI0A 4D6FA 2DGAA 1L6FA 3I6TA 3S8HA 2CBVA 3KL0A 2WBKA 1XKYA 5I24A 1XIEA 4IPJA 4AG0A 5ENLA 2DT3A 3EX3A 2XISA 4LV4A 3ITYA 5LXXA 3UJFA 1ZU8A 1Q4WA 2WM0A 3AS0A 1YE4A 4JHOA 4NL1A 3VZZA 1UMLA 1VGAA 2OZ0A 2CWXA 4I6VA 3F2DA 3STFA 1QASA 1VJSA 2HDJA 3W26A 1BQGA 1AW1A 5I6SA 4UNKA 2F9RA 4LY8A 4UB9A 3MY9A 1RALA 3O6AA 2VC7A 5C2XA 2WNWA 1ISVA 1HJWA 2J78A 3SQMA 1D3GA 2YXGA 1E9IA 1BAGA 3RFAA 3HQPA 1M7JA 1JYWA 3AZTA 1ZJAA 4DI9A 3OGVA 3VFCA 3N2OA 3OW1A 5H8PA 2GK1A 3BLDA 3K4DA 2FGBA 3THDA 4QG8A 4L80A 4QQUA 1A50A 4FX6M 5CBIA 4AXNA 5EU9A 1Y8BA 3SN0A 3H7UA 2INEA 1P7TA 1T6MA 3UW6A 4FP1A 3KBVA 4PTWA 2HEJA 4LVGA 3OP2A 3URQA 1L9WA 4MB1A 3N4AA 1JNDA 1H09A 3ZLHA 4RKAA 3U5YA 4UTHA 3BV4A 3KRBA 4MB4A 1ADOA 2DZTA 3LSBA 3EOSA 3GBEA 4Z2JA 1L6WA 4UNIA 3TR2A 1CXKA 3RHGA 2HZGA 1H1YA 1VRXA 1XLCA 1GKPA 1MQPA 4LF2A 3VO0A 1XCWA 3GO2A 3LTPA 4A8RA 3P82A 3K2GA 2XM2A 4NJGA 3AZSA 1MYRA 3BDKA 2FB3A 3UWZA 3GFYA 4J3UA 2NQ9A 1V7YA 3KXQA 3TONA 5I23A 2W9MA 4TX9A 1WCGA 1WX0A 1WZLA 2PWEA 1K4GA 3FLUA 3T55A 1AD1A 2I16A 4EXQA 2VCCA 1O5XA 1FUYA 4GHRA 4D6GA 3GU9A 1QTWA 4RJEA 4ACZA 5LNRA 4GUHA 1DHKA 4NZ4A 1F7BA 5I3HA 1RA5A 4OOUA 1RBAA 2QUTA 4MDOA 3W23A 5BXRA 1FY6A 4UR8A 1NWTA 1YLVA 3OYZA 3RCYA 4S2BA 1IEXA 1A4LA 5HJLA 2GUUA 1JL8A 4Z1DA 1NOWA 3BLKA 1QCWA 5K7JA 5E6YA 4AVNA 2JFEX 2Y6ZA 3MZNA 3PS7A 5AVNA 2OSXA 2PDNA 2TMDA 1EA0A 1KB3A 1JCMP 4GI8A 4CQ8A 2OPJA 1EJWC 4NJJA 4MKNA 2ISDA 4RZ6A 2J7HA 4UUIA 2PGWA 1KFCA 3GD6A 1H0GA 2YKKA 3VX1A 4GH3A 5EMYA 3W85A 1TO3A 3CEUA 2P88A 2A3CA 1JPIA 1CGYA 3B0PA 2YPIA 3PZMA 5D9NA 3PTDA 3E2QA 1CCWB 4DB7A 1I4NA 1WKYA 1X6UA 4A4AA 1WDWA 1ZCCA 1V6WA 2XFFA 4FB7A 3XIMA 2XYLA 3LBCA 3CU2A 3A47A 1SUXA 5IM51 1UYQA 3LGDA 2R91A 2ZXDA 3EPMA 3GNRA 2H9AB 2BOGX 4QLKA 3TAOA 1UCWA 3L0GA 1VKFA 1LLZA 3LHWA 1EL3A 1DXIA 5GNZA 2VL4A 1WZAA 2ALDA 2TYSA 3GVWA 3MJMA 4JIEA 4WDTA 2CCRA 2V5DA 3VYLA 3OB8A 4LJ3A 2XIQA 3QF0A 2H6RA 4GOAA 3F4CA 3MCMA 3VMPA 5FF0A 1HKVA 4Z2IA 1T41A 2PMQA 3AFBA 3P8IA 1UR9A 2VZOA 2YB4A 4HMCA 4FNPA 2PBGA 3KS5A 1AQMA 3ID7A 2HV5A 2HS6A 3A5FA 1ITXA 2V38A 3A24A 3B9EA 3L4YA 2QF7A 2C91A 1LL4A 2X2GA 2FGLA 3N11A 4US6A 5D37A 3WNPA 2QS8A 1JDFA 3TYAA 5BOFA 3A3XA 1AFSA 1NF0A 2X1SA 3ZQ9A 3SRKA 2ZZ1A 4DWSC 4IX2A 4H2HA 1V7AA 4PULA 1W1IE 3G1DA 4MZ1A 2DIKA 3W38A 4AZ5A 2J66A 1XIJA 3C0JA 1L6SA 3NQDA 4WHBA 1SVDA 3LHVA 3L5AA 5A6AA 1YADA 2XVNA 3TYDA 1PSCA 2VFEA 1BWVA 3VDAA 4F4RA 1ML1A 3GH5A 2RDUA 1QI3A 2HPMA 4WSKA 2D69A 4QCEA 5D2VA 2NVCA 3WK3A 3LI0A 2ACUA 3F4NA 3TYEA 4DWSD 1B5TA 3N29A 3W81A 2UY3A 4IMCA 2EQDA 1H2JA 3PULA 5C9XA 5A6BD 3ATZA 4GGBA 1ECQA 3TWBA 1PCWA 4M6QA 4GBUA 1M6JA 2DIJA 4Q4RA 2UWFA 4EIVA 1E3XA 1OG6A 3W1MA 2WZHA 4JDYA 4IPNB 2GJPA 3P0XA 4JKMA 4WOQA 1VFOA 3C4UA 3WO8A 5KITA 1OFRA 4LALA 3SQSA 3KWXA 4JICA 2PDFA 4H8HA 4ERIA 2ZUMA 1MUWA 4CNOA 3HMJG 3UZWA 4RPPA 1EIXA 4QJ3B 4HMNA 1TZ7A 2QAFA 2EPKX 3VZXA 1PYFA 1XJBA 4PMRA 3C52A 2OGJA 2OEKA 2PZ0A 4Y9NA 2X7WA 2VRKA 4GQBA 1Q6RA 1FH7A 3SFKA 1AMKA 1F76A 3TZNA 1T40A 3AQUA 2XN1A 3WQPA 2PE4A 2AAMA 2XWEA 4DAIA 4XVDA 4Z2KA 3STGA 5EPDA 1YW1A 2R1KA 1MW1A 4LVDA 4V1YA 1HVQA 3WG6A 3EWUA 1OX4B 4FR1A 1FA2A 3IJ9A 3THQA 4MNKA 4IIHA 7XIMA 4AZCB 4C6FA 3GKAA 1J5TA 3LZ3A 3MI2A 5C71A 3TTQA 3VDBA 3ARQA 3AIVA 1JZ3A 3DC0A 2C19A 2IPWA 3N6HA 4CNNA 4M29A 4B5SA 1WXJA 1L0PA 3ABOA 4TX6A 3WQVA 3B06A 4UXDA 3EGJA 3RPDA 1ODZA 2Q3OA 2FTPA 4ML4A 3HPZA 3H2FA 5T9CE 2OLSA 1PKMA 5G4EA 3AISA 4UNLA 3BV7A 3I4EA 1ZSXA 5E6ZA 3MHGA 5AHEA 3T81A 1FCUA 2QCHA 4PRWA 1V6UA 1JZ7A 3QV7A 3GVVA 4HNNA 1UWIA 1CLVA 3TN3A 3QOKA 3W1NA 2P50A 4AZ7A 1OG0A 1OY0A 5RUBA 2P0OA 1W1VA 2NLYA 1JG9A 2Z0IA 4E38A 2P5NA 2I9UA 4B5XA 4XQ6A 5FA5A 4IUGA 1RK6A 3INPA 4JPGA 4RV3A 2ICSA 2PLKA 3DU0A 2FGZA 2YCLA 3V4BA 3ZVHB 2OJPA 3L4XA 5M3WA 1X8FA 2NZLA 4S3JA 1QHZA 2QPUA 4P7OA 5DANA 4JBRA 3SCVA 3W76A 1TUFA 1B3OA 1ONXA 1EDGA 2EHHA 4JX4A 5M03A 1RVKA 2CC0A 4IGNA 3DBPA 3RXZA 3AOFA 4HK5A 3QHOA 4MYAA 1ZQ5A 3RRAA 3UWVA 3COTA 4Z1AA 1PXGA 4DAFA 4HA0A 1ONEA 2V5KA 2E1WA 2O7SA 2XFWA 5CQ1A 1EJTC 3W7KA 2VM8A 5JUVA 3SUUA 4HNLA 3QZEA 2DQWA 4DLFA 1WPCA 4AHOA 3MSGA 1JXKA 3RR4A 1RQHA 5D2YA 3R2GA 4F0SA 1C29A 1CGVA 3VE7A 3AUOA 1XYFA 1FWEC 5LHEA 2XFYA 3MS8A 3NZPA 1DVJA 2O0TA 4JY8A 3QQ1A 5M2FX 4FLSA 1FDYA 3P8JA 1B4EA 3LSCA 3NYDA 4AY7A 2W91A 3AO0A 4X0VA 1OC6A 3NCOA 3MHFA 1NOFA 2IPJA 3DYOA 3Q94A 3J7HA 2ACRA 3LLDA 1XLJA 2VOTA 3M5ZA 1LM1A 5F4SA 3VNZA 1WDRA 1M03A 1R3QA 4JFUA 1E9LA 4PMDA 4HU0A 4XAYA 5JIPA 2F8QA 3KBWA 4KRZA 1XIBA 2WHKA 1XRTA 4KCUA 6XIMA 1P5BA 4GNVA 3PZTA 3UZZA 1G6CA 4P8VA 3NZQA 3W01A 2E5DA 1ZP4A 2R24A 4NJHA 4LWWA 4J3XA 1AUSL 1VBRA 1SR9A 3PWAA 3WLKX 1F3XA 2GSJA 2J77A 3ARSA 3N04A 1GVSA 3VD5A 3ORWA 3RYSA 3NQ7A 3LHYA 3OVPA 4H8NA 3PJXA 5KZDA 1SMDA 3UYCA 1SFSA 3CHFA 2YA2A 3WJXA 1H3GA 1VEPA 1J01A 1X7IA 3AALA 4NX5A 3BAIA 3EB4A 3WFAA 2EG8A 4GXMA 1H4PA 4S3CA 4PUNA 1GEQA 2VVNA 2YYTA 3C0QA 3UJEA 1NP2A 4JKKA 3GVQA 1B3WA 2Y5JA 5DMYA 3SCUA 4L1XA 3BSHA 1TWSA 1TQXA 3STEA 1ISZA 1XRSA 3NTYA 3G0XA 5DMNA 3MCNA 2YBVA 2VFGA 5AB3A 4YLWA 4GMEA 5JBFA 3F7JA 4WIWA 1HUVA 3NIYA 4M82A 5A94A 1Y5VA 4NYYA 2WW5A 3P67A 2QNEA 5I07A 4O1BA 1MNSA 3RG6A 4KS0A 4OBSA 1UH4A 1S5VA 2Q02A 4CD5A 2GLKA 4UOQA 4GI4A 2G3NA 4GFIA 3OVQA 4DNHA 4DN1A 1K3UA 1U1UA 4XKYA 1CGXA 3GB6A 1H41A 4TQTA 3LHZA 3M5YA 5FJJA 1T96A 2GVYA 1OFBA 1F73A 3FKKA 3U48A 2Y70A 1UQZA 1OHLA 1LCOA 1V93A 5JMUA 5AFDA 4TVUA 3BQ5A 3T42A 1AL8A 3CMFA 1OC5A 1CXLA 2Y5SA 1CIUA 3BPWA 1MNZA 1WDPA 1SZRA 2WMKA 4WKFA 2XM1A 1RJRA 4WXZA 3H6OA 1FWWA 3GG1A 2VGIA 3WLJA 1HO1A 3AXKA 4P8XA 4ERAA 2F38A 4DO4A 4F66A 5HNRA 3S46A 1SGJA 3C8NA 3RX3A 1JZ8A 3DH7A 4QX4A 5REQA 4ZFMA 3WD0A 4GA8A 1GGOA 3EDFA 1W1A1 2QEZA 3O3RA 3V5CA 3N2CA 2D3LA 4XISA 4AZ6A 1UQYA 3FXGA 5H1WA 3CM4A 3NVDA 1RCQA 3PFRA 2YL6A 4WRHA 1KTCA 1LYXA 1F3EA 2V3GA 1Z48A 5HMEA 5KTLA 4UCFA 1V6YA 2QV5A 1DWIM 1EHNA 1KBIA 2PCQA 2CHRA 4GI9A 3H12A 2DT2A 3SO7A 3OBEA 3L66A 3OIXA 4LYPA 1RBOB 5BWFA 1BLIA 3WMCA 1B9ZA 4HA1A 4EK7A 3L5MA 2WNQA 1WUFA 3WLHA 3W2NA 4UIOA 3W28A 5ABFA 1LDCA 2GWGA 4YHEA 4LUTA 4UMAA 1Z41A 2E9BA 5DXXA 4Q8OA 3DHUA 4OV4A 2DZXA 5I79A 3UY7A 3HQOA 3C3UA 1XI3A 1V3LA 2XPKA 5CSYA 1U22A 5GNXA 2CYGA 1UH3A 3EZ4A 5CAHA 4XZLX 1QBBA 1TZZA 3V36A 4AZBA 1RAKA 2RKXA 1FWHC 5KZ6A 1PDYA 4NSBA 2BNJA 2GSEA 2Y8UA 2DZPA 4WOZA 3CQJA 1WNOA 3O05A 3MUAA 4OT7A 4K8GA 4M56A 4XZIA 4GZIA 4KGLA 1Q6CA 3OLDA 3MHUA 2HE5A 4OJYA 2QUUA 2J27A 5LNWA 1TA3B 1OC7A 4PB5A 2PWVA 2W3ZA 3L21A 1IZJA 3FX4A 1XPYA 3VFLA 1E56A 2PTWA 3VOJA 1YNQA 3EWZA 5I3JA 4MFEA 4S1FA 3B0XA 3GYEA 1B0IA 4WR3A 2XTKA 1IHIA 3EMQA 3WH5A 4NU7A 3M46A 2ZX8A 4IGMA 3W71A 4EF8A 3VK5A 2YL5A 1JI1A 1F4HA 4J2MA 5AYIA 1R3TA 3R0KA 3L4VA 2EO7A 3NQ6A 3NWRA 5IFTA 3UPBA 5TIMA 1KRBC 1XYCA 2OLHA 2Y5EA 4QSHA 1XV8A 2DUAA 3DAQA 3PWIA 3A4AA 3U8GA 4UOZA 1EJSC 1UIPA 3VABA 4HOZA 1GPWA 3R8RA 4MF4A 1ZBVA 5MHBA 1AQ0A 2MANA 3GDBA 3W7EA 1C8XA 1J4EA 2PWUA 3M7WA 1JVNA 1O60A 3CLMA 2WJEA 4FEZA 2OTDA 3UZYA 1HQTA 4S3DA 3SGUA 2OO0A 2REQA 4KBXA 1KC7A 4H9UA 5F2MA 4YWIA 2J75A 4JGDA 4TIMA 4AHPA 4OECA 2GQ8A 1H11A 2FHFA 1EPXA 3SY5A 1H7WA 3P84A 4DHGA 3EKGA 3LHTA 4LVBA 1W9UA 3W83A 3WLSA 3STPA 2PTDA 3WKZA 2A0NA 1R2RA 4JXCA 4AF0A 4A3RA 4YJ5A 1P6BA 5JU6A 2XJ7A 5JXQA 1DOSA 1KM3A 3CHEA 1RK5A 1UWAA 4QHRA 4UR9A 2ON3A 4XAZA 3OQEA 4IP4A 1JYNA 4JNZA 2PURA 4PE8A 5T8GA 3TH6A 3W6YA 1TV2A 2Y61A 1AG1O 3G6LA 4ZO7A 5PTDA 1EO5A 4XBJA 1XD1A 4ZOEA 4R88A 3R11A 4UTMA 2JIEA 1HIZA 3TYUA 3NEHA 4MGGA 3WUGA 1K02A 4UZUA 4L6HA 3AC0A 3LPOA 3QGKC 4LUJA 1PE1A 3CHDA 1TCDA 3ISIX 1QI0A 1RLCL 5EMKA 4OZOA 3UWWA 4P7RA 3ZT6A 4L9ZA 3PN8A 1UB3A 2YXOA 3M0YA 4F40A 2C15A 4MWAC 2ANUA 2YLAA 4OE7A 4YXGA 2BVDA 2P8CA 1TX0A 1EP3A 2WC7A 4J3TA 4KRUA 1UPPA 1HFBA 4JOMA 1QATA 4DBUA 4HOWA 4CCDA 4ROQA 3N9RA 5FI8A 3IV8A 4X9SA 3PZUA 1R9XA 3BLOA 4LBRA 3W6LA 5FAGA 3TNBA 2OSYA 4Y9PA 1KFLA 5CZ0A 1QT1A 1AJZA 1GVQA 4AVOA 4QE5A 1WXZA 3GNDA 5DCBA 3VA8A 3PPFA 8RUCA 4WF7A 4GGHA 1V79A 3C0SA 3B4UA 3MUXA 1RJQA 1LWJA 1E43A 3P5YA 2V5BA 1JI2A 4KIRA 3DFOA 1E1CA 2PP3A 2W62A 4RDYA 1S2WA 4QE4A 1PX3A 3SECA 4A2SA 1WBJA 5JBEA 1H7PA 5CGTA 1NP0A 1TRDA 3U3HA 1BYDA 4LF1A 6ENLA 4XB3A 4HSOA 1QW9A 2LLEA 1DTUA 1ZGDA 4NP7A 3TP4A 4DJFD 3L2IA 2AL2B 1N8IA 3EDJA 3HB9A 3MQTA 3STCA 2ZXQA 2X16A 1DWAM 2ZA2A 4XD3A 4DXVA 3DHPA 4ASTA 4WUIA 2OFJA 4PR4A 1GVEA 3T44A 3WN6A 4F9DA 4PCNA 4Z08A 3AU2A 1Z8AA 4NI3A 1FWDC 1A5LC 1E0WA 4MY9A 2DW6A 4H6EA 4AWEA 3NO1A 3P2VA 2VGFA 2A4AA 1XIMA 3REQA 1SJDA 3BMXA 3F5JA 3V0SA 3W37A 4DNMA 1W3HA 5HMSA 4I7VA 2J6XA 3DFQA 4PB4A 2OU4A 3LXBA 3BCJA 3HG3A 3QV6A 3HG2A 3VE9A 1LF1A 3NVTA 3OZOA 2GJXA 3KDOA 1WKDA 4F0HA 3HGOA 3LD5A 2PDKA 4KCVA 1EH9A 5F7UA 3O6YX 3T0TA 4DF1A 1C9WA 4J28A 1G94A 6TAAA 2AQVA 1XW8A 2RAGA 3THCA 3IAPA 5LGXA 1S3TC 5BWAA 4LVAA 5A8GA 5HQMA 1ODUA 4HU3A 1ONRA 4NRSA 3BICA 2ZX5A 3B9DA 1KBLA 5F4XA 4F2BA 3MCOA 4JQ3A 3U2EA 1GUVA 2WJDA 1X8CA 3HURA 1W9BM 3A9BA 2E4TA 3R13A 4R3UA 3EOEA 2V82A 1WZMA 3P61A 4A3HA 2IPFA 1YPIA 4U4MA 3FN9A 3PB0A 2DY3A 4MWAD 4ZVJA 2Q8LA 2WC4A 3HIJA 1CX9A 1E4MM 5CLWA 1GZ1A 2W66A 2YJQA 4LBUA 4CNPA 1RD5A 2OZTA 3B8IA 2XVPA 4LY4A 3E0VA 4HN8A 4LRSA 3RM8A 1R7AA 3UGRA 5D2XA 1Y5WA 1E0VA 3GNPA 4K2SA 5E93A 2XGIA 4PZVA 3IVUA 1Q6FA 1XLEA 1GW9A 3N2BA 2ZVIA 3N3TA 2Y7GA 2ZA3A 2YGYA 3P62A 3FDGA 2R1PA 3FYPA 4HZMA 4LAMA 2PDPA 4L7ZA 2RGLA 2X40A 4BWLC 4R9XA 4CUCA 4IM4A 1BFNA 1VD6A 1G0CA 3FJ6A 3LENA 4ZBCA 1OIFA 2BHYA 2AKZA 4AZCA 3ABZA 4HHLA 1OYCA 3S4TA 1M65A 4RZ4A 4AX6A 1HKMA 1GPFA 1IF2A 4REQA 2E7FA 5K9XA 4J2PA 3EWCA 4CKQA 2FIQA 2GGJA 4B9YA 3ZS4A 5EMUA 1VPQA 4O4VA 3Q4DA 3GBDA 5E5CA 3T4CA 3SBFA 4ADUA 1VR6A 1X38A 3ZJ8A 1PZ2A 1HX0A 3B40A 2WMGA 5HJXA 2DH2A 3LGEA 4FI4A 5FJIA 3RK8A 3E74A 3NSXA 2REQB 4PL1A 4ZOBA 3CTTA 3TYBA 5CGMA 4FX8A 4KEUA 4BQ5A 2YDAA 4MPKA 4IQDA 1TQJA 2WNZA 3K13A 2B81A 1C7TA 4QBXA 3P7YA 3UG3A 4GINA 4GZEA 4QEEA 2H8XA 5K3VA 3GFZA 1FXQA 2P3EA 1GONA 3EWXA 3FCPA 5A6LA 2Y7DA 1MSSA 4QJ4B 3USBA 3BAXA 4Q8QA 4V15A 1UR4A 3ANUA 5I77A 1WDQA 1OBAA 4DLMA 3DIPA 3K5XA 4LVFA 4GQQA 2GSHA 4H8UA 1EJVC 4J35A 1V6TA 3GNNA 1B30A 1S3HA 4YVPA 3ZWTA 2NXIA 4BJHA 2VKZG 4DJDC 2OCZA 4WDUA 1EZWA 1KTNA 2XFRA 3T40A 2I5GA 3THAA 3C86A 3UXIA 4P5UA 1BD0A 3RCMA 3C2EA 2WMIB 3LCIA 3S9ZA 1Q3NA 1SJCA 1CW2A 1H7OA 3R6IA 3WH6A 4ILSA 4NYUA 2JQXA 3CGTA 3P14A 2ISSA 3BGJA 1P6WA 5LSMA 3HV9A 4E8CA 4IJBA 3AIRA 2A1YA 4AWTA 3WF1A 4C6LA 4NHVA 1XLGA 4ORIA 1UD3A 4IFOA 3CIVA 3U4FA 8XIAA 5HINA 4BF9A 3G1XA 1DEDA 3M4HA 4J40A 3GNOA 1QNQA 3MP4A 4QEHA 3ARWA 1GHSA 2VMFA 3VX0A 4E2DA 2OMAA 2YZ5A 1N82A 1FHLA 3VNDA 2OWXA 4PUJA 4S38A 5LA0A 1OSEA 1OD8A 3M1ZA 4ENLA 2ODOA 3PG8A 2D22A 4FZIA 3JVAA 1PX4A 3LCWA 2PDCA 1LUCA 4ONVA 4CU6A 1RCOB 5D38A 4GX9A 3ONBA 1VBHA 4PTXA 3PZ9A 4W7WA 2AOSA 4I7WA 5IBXC 4L65A 2OT1A 3C5QA 4W8BA 3AWNA 4RDVA 4MNMA 4AZIA 4YWSA 3PPCA 3QFEA 5HULA 5D4YA 1QNSA 2OKOA 1H60A 3LM7A 3T7VA 3OLEA 1W3JA 4H9YA 3VIHA 2C18A 1KBKA 3IARA 3IUDA 1F07A 4N6FA 4N6EA 4HNCA 2UY5A 2ZZ5A 2VEFA 4MNJA 1E1CB 3IIPA 4PMQA 3FJLA 3AS2A 1K7FA 2HMCA 1GOMA 3S47A 3M0JA 3QR1A 2WSYA 4AZHA 4CGTA 2JGYA 3CV1A 1BSIA 5G2IA 3N12A 3E2SA 1EKOA 5KMYA 3VCCA 3APYA 1W1YA 1KGXA 1FH8A 1OT2A 2YBTA 3T0DA 2XH2A 1ZPTA 3TVAA 5FEPA 1DE5A 5AC6A 1KQZA 4Y2WA 3NM1A 4PUUA 5FEWA 4DJED 3AMDA 4LEFA 2E77A 2WNNA 3NM3A 2VX6A 1RXOB 3FVDA 2C79A 1TWIA 1SR0A 3G8EA 1HO4A 5I02A 1V0NA 1W9XA 2V81A 2PP0A 1CYGA 2J13A 4QG6A 2VGBA 5CGQA 2CHNA 4LQ1A 1LJYA 3W73A 1VF8A 1YTDA 2AQOA 3WQWA 5CC5A 1CXFA 1LG2A 2TODA 4GJIA 1JDCA 1BTCA 3WEOA 3FJ4A 5I3DA 3TSMA 1P1MA 2IQDA 3N73A 2GVJA 1EUAA 4S23A 3AMGA 3SJ3A 1Z6KA 1DQWA 4JDBA 5TNVA 3LQGA 3EXTA 3W2LA 1SO5A 1KXQA 1A3WA 2GOUA 3CB8A 3IEBA 2Z1XA 2IUZA 4PFHA 3GTHA 4QISA 3NA8A 1TFVA 2W61A 5HBFA 2CLFA 4K6AA 2BG5A 3A22A 3MUCA 4JNYA 1DWGM 1R47A 1GZJA 2PD9A 3ZJ7A 3BAWA 4Z1YA 4GXPA 5FKYA 4GUJA 3CL7A 2E6AA 1BG9A 4BA0A 4AD4A 4CNTA 5AYZA 1KFBA 5KETA 1H61A 1Z69A 5KINA 2PLMA 4GACA 2OXNA 2EPNA 4XV0A 3NUKA 2C71A 5AHIA 2Z1BA 4JTLA 2B7OA 3I7QA 3VGFA 3T2QA 1HN1A 4GWEA 3ZR5A 1Q6GA 4PCPA 4Q22A 4DJDD 4GC4A 3H7VA 4GNKB 5I09A 1VH7A 3K4WA 3L5LA 1S5TA 1SFTA 3OPSA 1P1XA 1V3JA 4KWUA 4CCZA 2NUXA 3DECA 3MDWA 1XC4A 2H3BA 2QJGA 4YTUA 3PK7A 1OFDA 4U2YA 4AW7A 1V3MA 3CH0A 1VS1A 1C90A 4PMXA 3E0LA 1GKQA 1IEWA 3WF3A 1TPVA 3GK0A 1FDZA 1I2QA 3S1XA 1I6NA 1X7FA 2HROA 1W2VA 4MIMA 3VINA 6XIAA 1RJPA 2A2IA 5DT7A 3EDEA 4LX4A 2WVUA 3LPPA 4IJCA 1Q6LA 3ATYA 1UA7A 2V3EA 3GUGA 3W7LA 2RH9A 3CV2A 1BYCA 4KFNA 5BMXA 4C6NA 2E6DA 1WBHA 4UBPC 1BTMA 4C6EA 3JW7A 3W74A 1M01A 3M0IA 3QHMA 5AHNA 2GVGA 3B8UA 4DJDA 3LLFA 4W84A 2PLJA 4J3WA 2A3AA 5C2GA 2WC3A 3MMTA 4W7VA 4G6CA 1O94A 2QCDB 1FWGC 2YA0A 3O1NA 2C7FA 2PDXA 3LMYA 3BTNA 2C1HA 3KTXA 2QPXA 4UTTA 1AW2A 1PHQA 3UYIA 1YKWA 2RJHA 2BX7A 1VPYA 4LUSA 1RSCA 3GVGA 4L1WA 3N19B 2VEGA 2ADAA 3WDIA 1VFTA 1EQPA 4IJRA 3VDCA 4LSBA 3GXTA 1GOQA 3S2JA 3DFTA 4O13A 3SAZA 3VIOA 3CPGA 3WF4A 1PS9A 3P5ZA 5A8MA 2PEVA 1KM0A 3IVSA 3S3GA 1A49A 3V7PA 2O7QA 3B0UX 1EYEA 3G1RA 4GCXA 1I60A 4A8LA 5AC7A 1PV8A 3UZ5A 3P81A 3GG7A 3H8AA 4M80A 3E2RA 3PNUA 3P0WA 3W2MA 4LYQA 2QPSA 1G1YA 2YL9A 5CPNA 4Q3MA 2PSNA 5LIUX 3VKBA 3NQCA 3FK4A 4LGXA 1SSDA 1DJXA 1Q2SA 3MBFA 3WQOA 4MZYA 2HNHA 4AEOA 3T8LA 4DWSA 1TKKA 1O5KA 2DP3A 5CBJA 4M6UA 2FDMA 3DN5A 1EWDA 1LQAA 3NOEA 1IV8A 2PDLA 1G4SA 1ZBCA 3CPUA 3W1AA 4H9TA 2J7EA 3TYZA 2V5CA 2XWDA 4V27A 2VWTA 3MO4A 3SRDA 2GK1B 1GNXA 4L5ZA 2Z2BA 2H8ZA 1XIFA 3DBNA 4XD4A 1P7TB 1D9EA 4WY0B 4YVXA 1YPFA 4P7LA 4C5ZA 4US5A 1QUMA 4F3HA 1UZ4A 5D30A 3WL0A 3W7NA 3UR2A 1PWMA 3CJPA 4IG2B 2VD9A 1FWTA 3TJLA 4F8XA 3DHDA 4AD0A 3M9YA 4CNUA 3L2MA 5HATA 3NURA 3BMVA 2YLLA 3ABXA 2PC4A 1US2A 2WVVA 4UFJA 3MV01 5GPRA 3M0HA 1YIXA 1H5YA 3VIGA 1T99A 3U5UA 3GZ3A 3O2LA 3HGSA 4MWAA 2NX1A 4KKXA 3CT7A 4U5IA 1H0IA 2PDGA 1EGVA 1K8YA 4LOCA 1KBJA 2Z00A 2DSKA 2ZTJA 3W7IA 2E68A 4X0NA 3QY8A 3AMLA 4LUYA 2GFTA 5HWNA 4WDXA 3SSZA 4H7VA 1FP8A 2HK1A 5BOOA 4N9EA 1GOIA 4J27A 1PVNA 1QW8A 4KMQA 2ABAA 2NSOA 4UR7A 1CBGA 2DW7A 2Q8ZA 1Z9AA 4X2RA 1FWJC 3JZEA 1R3RA 4DBSA 4ICNA 4LRTA 3LNPA 3U2ZA 1UHVA 3WH8A 4KT2A 2J9YA 2OR2A 3UVIA 1YMYA 1LRNA 2GJNA 3A3WA 5HANA 5K9DA 4U33A 3TW7A 3ENLA 5C9RA 2PDUA 2E8ZA 5EB8A 2KZHA 2O4MA 3TK7A 2PZNA 3CZEA 4LT9A 3QM3A 1Y0EA 3OLIA 5LIWX 4KEMA 1W5PA 2V8ZA 3NEVA 3AHXA 3AUJA 9XIAA 3UJRA 3WX7A 1VP5A 1MXDA 5C2CA 5G4WA 4MB3A 3SURA 2CZ5A 4ATDA 2G37A 1DXEA 2J7BA 3FAWA 3QMSA 1R3VA 4Q8VA 1SZFA 4LS2A 3NL2A 3CO8A 4BHYA 4Q8MA 2ISVA 3VNJA 5LXEA 3NJ3A 2J62A 3M64A 4W87A 5AY7A 1QOPA 3E02A 3UEQA 1KFWA 4RCXA 2WKGA 3E3HA 1EZ2A 4D2JA 1E4NA 3I3DA 1SO3A 1S2CA 5CEWA 2JF6A 3P60A 3HJEA 3MMDA 1JUKA 1AODA 3PG9A 3ZWSA 3WFLA 2ZRWA 5D2WA 2J79A 4HT3A 3R7MA 4ZE5A 3VIMA 2YDSA 3SCQA 1HZYA 4F9JA 1B31A 3GY1A 3DI0A 3BZGA 3ZZ1A 3S1GA 4XK2A 4K7VA 4ECLA 4DJEA 2CXEA 3SN1A 4L4LA 3TW6A 1O1HA 5DFAA 3LTSA 1GVYA 1O5RA 4O28A 4RLIA 4PTVA 2BASA 2Z29A 2ZKMX 2WVSA 3VILA 1VAHA 5EYWA 2ZTKA 3D6NA 3QN3A 3VMNA 2Z6JA 2YFOA 4W86A 1J0ZA 5EBAA 1BSLA 4XG1A 1UKPA 1VBUA 3C2FA 3PBMA 1ECEA 3EX2A 3I10A 2C14A 2QHAA 4QXIA 5F2IA 1FHDA 3CK5A 1VJZA 3DKLA 1H1NA 3WIJA 5TQLA 1TIWA 4HMEA 3S2LA 2D0HA 4UMCA 2DZAA 3WLQA 1A5AA 3F4DA 2I14A 2HBXA 5LNUA 2R1MA 2D0GA 6CGTA 3SCSA 1QNVA 3MMWA 4EWJA 1DV7A 3UD6A 2VR5A 3CIXA 1OFAA 4U3CA 1P0DA 2WKLA 4NVTA 3SR7A 1TMHA 1VFHA 4O16A 1KFJA 3GR8A 1LL7A 2EJAA 1XLAA 2WK2A 4ZO8A 5I3FA 3WNMA 5K4XA 4O15A 2EPLX 2QGYA 1O7AA 1OZMA 1SW3A 2TRSA 2CW6A 4JTKA 1TJ1A 1P0BA 1NDVA 1BWLA 2NQ5A 2O9OA 3IPWA 3NPVA 4G56A 3WF0A 3KCJA 1XLBA 1AQHA 1PUDA 2P10A 2ZZ7A 2OZ8A 3PBYA 2CWNA 2YDRA 4O52A 3ITLA 4RNHA 1B1YA 1KWGA 3N9SA 1UZHA 2GQAA 4US5D 3OZMA 1QFEA 3W2KA 1IXOA 2FTYA 4C7DA 4GH1A 1I2NA 1L8NA 2VR4A 3F5LA 4R7WA 2CLMA 4XUYA 3LOTA 3MSYA 4AEFA 1UUMA 5A6KA 4FXSA 4ZCWA 4R9OA 1J96A 1GOXA 4FNSA 3VM7A 3TQPA 4D8AA 4HTYA 3F03K 4M0XA 2J25A 2VX7A 4JZ5A 1XINA 2Z1WA 4J4KA 2GGHA 2X8RA 3A12A 4V33A 2PTXA 4CU8A 3LXAA 2QCGA 4Q8TA 1Q6OA 1UOKA 1ZLPA 3UERA 1EP1A 1NOUA 4DM1A 2HVOA 1XP3A 1UD2A 1XWYA 4ZSUA 2AL1A 3EB3A 3KLKA 2V2CA 3DFHA 2F7FA 2CLOA 1LT7A 4A3UA 1WAWA 2GDUA 1EIBA 2PB1A 1H63A 4DJFA 1YBQB 1MFVA 2CETA 1XRVA 4NNBA 3ARTA 3SIZA 3I7SA 3W02A 2IKJA 4Y96A 4IP5A 3OZPA 1KNWA 1Q7QA 2J24A 4MLJA 1XD0A 1KV8A 1EWEA 4I5UA 5AYXA 4UFLA 4WXYA 4JL2A 1US0A 2G0WA 5AHFA 1XBYA 3MVIA 2YFNA 4HJWA 3AWOA 4UQDA 4GYKA 4C6PA 4XAPA 4IIDA 3KVKA 3KL3A 2IKIA 4JKLA 1Z7AA 2P0IA 2ZOXA 4E0CA 4MJ4A 2VEPA 4PMOA 2CBUA 1B3YA 3PFMA 3VM5A 1NELA 4N42A 1IXQA 2FPYA 4UMBA 2R1LA 2FQIA 1XYMA 4OV9A 1TYGA 3ELFA 1KKRA 3RMEA 4ZQRA 4FA3A 1TB3A 2FVLA 2QJMA 4PRTA 2VP8A 2E09A 2TPSA 4LUSB 1JCLA 2VRJA 2X1RA 1NFPA 1HW6A 3WLTA 3H4XA 4QJ5B 1UWSA 2Y0FA 4C6KA 2OYKA 1Z3NA 3NG3A 1R9ZA 1KFKA 1S1PA 2C0HA 4XSMA 5JIWA 2GGGA 2VDGA 1KM6A 4X61A 4LNYA 4AD5A 1F6PA 4GABA 4AUBA 3S1VA 4DO7A 1HT6A 2CIPA 3RIKA 5E9AA 4KEVA 3MUZ1 3L68A 5C55A 4M5PA 1R2TA 3SCPA 1IR2A 3AYVA 2A6NA 1S5NA 3IGHX 1FWSA 1XYZA 4E3VA 3MANA 2G97A 1Q8AA 1YHTA 1SJBA 3CUFA 1DIOA 1EXPA 3W7HA 4DX3A 3KVMA 1TV8A 4CEUC 3FXYA 2O55A 4JAWA 3FYYA 3IV3A 4B92A 4QQ3A 3UR7A 1KA9F 1TWZA 2CPUA 4U2ZA 1IXPA 3MWAA 3FIGA 4GZ7A 1K9TA 1XQKA 3M43A 1QNPA 5J04A 3B8DA 3ANVA 3QR0A 4HKPA 4NRRA 2BVYA 4IIBA 4A8IA 4Z2GA 1OZQA 3P93A 4FF7A 2QCNA 4HJFA 1KGWA 3CTLA 3L4TA 3ZSTA 1AVAA 2BSLA 3O06A 1R5YA 1UWQA 1ZALA 3SY1A 1N2VA 3BJTA 1YXYA 4GNJA 3PAJA 4XZNX 4J3VA 3N2MA 3AJ7A 2TAAA 3GXNA 4C1NA 4ZO9A 1E5JA 4U3AA 1DJHA 4HMDA 3L2LA 3H55A 4PMZA 4INFA 4QDPA 5XINA 4UTWC 2NQJA 1XFCA 3NDOA 4KWVA 3S42A 1QO5A 5GNYA 2C1GA 1XQLA 5BXTA 3DFPA 3EA1A 5CKSA 4FS9A 3GHUA 1BYAA 1EF3A 1K70A 4RV8A 5FF2A 3EWYA 3UVAA 3TTSA 3W87A 5AC4A 3FSTA 4NI8A 1IQ8A 5AZ1A 3ZSSA 4W7UA 4MUZA 2GGIA 1IT8A 1U83A 3BVJA 1F8MA 4MJZA 4Z2LA 3LS9A 3L0KA 3EBVA 3A9IA 8TIMA 4P2VA 3LK6A 2X0YA 3DXIA 3NSNA 2C3ZA 1WDSA 3WL1A 5HR7A 1HF6A 2UY4A 2ZX6A 3R58A 1CB2A 1XIIA 3QLLA 4FK9A 1DIEA 2IXUA 4CVUA 3OA5A 3GHSA 3OYXA 3OTRA 4Q7NA 2ZIDA 3HFTA 4E6MA 3S1WA 4JN8A 3M7SA 1OFQA 3W88A 3ZT7A 1DJQA 3WH9A 5FJUA 3AIWA 5CBBA 1TJRA 1TPC1 4BF7A 1GWJA 2Y8VA 3KBSA 3QY7A 3QMTA 4XKYB 4G7EA 4JQAA 2W79A 3IACA 1OFOA 1THFD 1I0DA 4JY9A 1QNRA 4FNTA 4C65A 2NLIA 5AOUA 3KW3A 1WA3A 1DL3A 4FLQA 1UD4A 1AZ2A 1JF5A 5DO8A 1XGZA 2J4GA 3HPSA 2EPMX 4YS1A 1LOLA 1Q7ZA 2YSWA 3MB9A 1UUQA 3PZVA 3BG3A 3R8HA 5A69A 3W1LA 4JX6A 3PBVA 1JJKA 4DBEA 4NZCA 4JTHA 3PZIA 4MKVA 2QJIA 1XF0A 4W93A 1S2TA 5HJYA 2HWGA 1HGWA 4IL0A 4B90A 5A5WA 5C70A 1X1OA 4O54A 1R7OA 3HO8A 4W88A 4OU1A 3QW3A 3V1HA 1CGTA 2F6XA 2GWNA 3HA1A 3EOLA 1K7XA 1BF2A 2XSXA 3W7JA 1DYSA 1H51A 3HPFA 2FLIA 3W2JA 4E4UA 3BAYA 3M5VA 4J7RA 3WK2A 4C6IA 2WZMA 4F2TA 1J0KA 3DHFA 5HMDA 1LOQA 1CECA 2XIJA 2DT1A 5FF4A 4LC6A 3N4EA 4M24A 2GJLA 4EWND 4DQWA 1ZHAA 3H2EA 1P0NA 1Q13A 4D1IA 2EBNA 4BEQA 2GYIA 4WSJA 3RUBL 2EJ1A 4PSRA 5LA1A 1IIHA 1EEPA 1ME9A 2WV8A 3ZO9A 4KRTA 1SW7A 2CFFA 1JQXA 4B15A 1Z42A 4O19A 3MMUA 3O15A 1BGGA 1EDQA 2FTWA 1BPLB 2Y7EA 2V3FA 2HE8A 3QGVA 1KCLA 5A6MA 2E8YA 1HTIA 1XBXA 4XUGA 3IRDA 4KWWA 4FOJA 1PZ3A 4C5YA 4CLMA 3RM4A 3TUUA 3WLLA 3MW7A 4KERA 3PJUA 3IIVA 3ZYZA 3ALFA 3WLOA 4ML9A 3WLIA 3K8LA 1CDGA 2ISFA 3NZGA 3DFSA 2WHJA 2MNRA 4QG9A 1KRCC 1GQLA 3YPIA 3F5KA 1XDMA 5CSSA 4N7QA 3UZXA 4JIRA 1O1ZA 4IL2A 3JZUA 1UKOA 4BKNA 4H19A 4BQ3A 3PHAA 3TZFA 4A8NA 4X9YA 6A3HA 4IPLA 2FYMA 3QFWA 1PAMA 3RDKA 1V0MA 2B7NA 2FFIA 5HWMA 4IP7A 1E40A 3A4XA 5DN1A 1MQRA 2ZRXA 4AD2A 1QWGA 1KCKA 2G8ZA 4CN6A 3KTCA 1ZNNA 3WUFA 2PAJA 3ARZA 3QV9A 1RP9A 5K9CA 2F2HA 4OKDA 3Q37A 4IMEA 4UQ9A 2FZBA 4BZYA 2A7RA 5DBTA 1MI3A 3EAUA 4AIOA 3ECQA 1CB7B 1JUBA 3MC5A 4OUEA 3W53A 4JN6A 4NZ1A 3BWWA 5GVJA 3CV7A 4H6KA 3CLWA 2FZDA 4CQAA 4DYJA 4OWGA 4U5KA 3WYZA 4H7CA 4GIAA 3UG5A 5D9MA 3G0SA 3GZAA 3E12A 3B03A 1JZ2A 2WVVB 1GTEA 4Q33A 2BY3A 4H3DA 4DPPA 5CAKA 5DCEA 5EFDA 5A2CA 4M19A 3VDHA 3W6MA 4GUIA 4Q32A 3A4JA 1I9CB 3UG4A 2WLYA 3KBMA 1YNPA 4NXKA 4TMCA 3G77A 4MFDA 2E6FA 2W92A 3U2OA 4N4QA 3G24A 4FX7A 4JQ1A 4D6DA 2MUCA 1K8ZA 4JTAA 5CSUA 4ZA0A 3HQNA 3U6WA 2CLLA 5LNVA 1YYAA 3L12A 3MV11 4A05A 5D33A 2Z1SA 3LRKA 1JD7A 3HV8A 3CT2A 3WUBA 3OIHA 3KHJA 5U7SA 2PUZA 4D9PA 2OQYA 4R34A 1SSGA 3QSTA 3B0YA 3VIKA 2X0SA 1E4LA 2CZDA 3IAQA 4IMDA 3MPGA 5FL1A 3GFXA 2AGTA 4LAZA 3RX2A 1IWAA 3FGCA 4MTVA 1IWPA 4B5TA 2EGZA 3NYZA 1RZMA 3FY1A 4GUFA 4JS3A 5DY3A 5F2GA 4NZFA 1MEWA 1KO0A 1KW1A 1HG3A 2PA6A 5DQPA 2ZC1A 1PZ0A 3GUWA 4F0RA 3PBGA 3BGGA 4GYPC 1XXXA 1FCBA 2QMJA 2NT0A 5HUPA 4DM2A 3WLMA 4EKJA 4GO9A 1E6XM 4NXSA 2B0MA 1QRQA 2HK0A 1W1B1 3HPAA 1Y65A 1GVIA 4UC5A 1ITQA 4WCJA 5AVHA 1TVPA 1TV5A 1H5VA 1A3XA 4R5EA 3SADA 4OBRA 3B8SA 2P3ZA 3QLDA 1K8CA 1KCZA 3N13A 1J8VA 3ZLFA 2DORA 5FESA 2VT0A 1GW1A 3E6EA 3W7DA 4Z42C 4OIFA 4DPQA 3H2OA 3JR2A 2VX4A 2FHCA 2INFA 1NSJA 3GW0A 2AMXA 2D1ZA 4TV5A 3MSRA 3M6YA 5F1UA 3MI6A 9XIMA 1X1ZA 1WQ5A 4LANA 4JCLA 1WYIA 4Q8UA 4B5NA 1TV3A 1RPKA 2FKPA 3RM9A 3ABRA 2OX4A 1YE6A 2AGKA 3IGXA 2FZ8A 1DQUA 3GHRA 4G5DA 1E3ZA 4FR6A 5I03A 4QE1A 1TTJA 2FFCA 1BKSA 4NT0A 1NU5A 2Y24A 4F79A 3PTQA 2PGEA 3VCNA 4MUPA 5XIMA 4K8HA 3APTA 1RHCA 5CG0A 4X63A 2P8BA 1XSJA 3N1AA 1DIDA 3KOWA 2FZMA 1YQ2A 2DUZA 1XCXA 4QLLA 3AYTA 2X7VA 1PEZA 2VEKA 5GJPA 2FPVA 3HFYA 3KTSA 3V16A 1IWBA 2GJXB 4ZGYA 4B9ZA 1F6KA 2D2JA 5KSWA 4WK9A 1ZFJA 5B7YA 3G3MA 4C6OA 1A5SA 3CXOA 4I5RA 4LB3A 2QZRA 3SY8A 3OQ8A 1EGMA 1BXNA 3AICA 2PTYA 5BU9A 5DELA 4ZQNA 2DIEA 4S3GA 4NASA 1FFRA 2WSKA 1XLHA 2BWGA 3PP7A 4V1XA 4AWSA 1QWKA 1TRIA 4PTNA 3R8GA 3PZGA 5D03A 1G01A 1N8WA 1JCYA 1VYSX 3BGAA 1NDZA 2IQTA 2VGGA 3DENA 3OODA 2RDXA 1NQKA 1IEVA 1XGEA 3WJWA 3ZFHA 3S5YA 1T8XA 2QCCA 1KM2A 1WAUA 2HPIA 5EY5A 4IF2A 1W5QA 1OCJA 3WBXA 2J7GA 3QPYA 3NQ8A 1UP3A 1G7VA 1IEIA 5MF5A 3PVFA 2Y62A 3GIQA 2JEQA 3VIFA 4Q8WA 4ZZ9A 1R3SA 3EDKA 2XINA 4JD4A 4S3KA 1FWFC 5AN7A 2BXZA 4RE3A 3LCGA 4JTGA 5CXPA 5C6MA 4LPCA 1PBGA 4N02A 3TMLA 1EBHA 2A3BA 2OZ3A 2YOCA 1N7KA 2EKGA 1NM9A 3FHQA 2FJUB 4Y7EA 3KP0A 3DEQA 1EQCA 2QXWA 2VCBA 2WQPA 3H54A 4Z1CA 4QS5A 4PUMA 4Y9MA 1D7KA 2BP1A 3U2CA 4A2RA 1DXFA 1X39A 5DEZA 3CYJA 1W0MA 2Z2UA 3PSVA 3DGRA 4O1FA 2WBGA 4ZMGA 5ABGA 2VCAA 4O10A 4MOZA 3FHAA 4NNCA 5M1TA 3TAKA 5A8OA 4GFSA 1B9BA 2DDXA 1ELSA 4OVXA 3UXDA 4F0MA 2XDFA 1UC5A 3R12A 3QOMA 4UTUA 5IHSA 1GTHA 1TJ2A 1QO2A 4DI8A 1J79A 4HPNA 5C7HA 1Q6DA 2WSPA 3ITVA 3OHIA 3RR1A 3HN3A 3NXLA 3OG2A 3BE7A 2OQLA 4E4PA 2HCVA 2OEMA 2AMGA 1V3HA 3VIIA 1E1EA 2QJNA 3AZRA 2GQ3A 1FDJA 2XN2A 4QDWA 1EO7A 4QGCA 4ZB5A 4MADA 4KGJA 3BANA 4GO8A 2PBOA 2WXDM 1OD0A 4PUDA 4I9MA 3LRMA 1W9VA 4RL3A 2J8GA 3OG3A 1DTNA 2J7DA 2A6LA 3B8VA 3URNA 3UA4A 2GPTA 1J18A 4GLEA 3P6LA 1XDJA 2ZZ6A 3TYCA 1QAPA 5HNTA 3AJXA 3TIMA 4TR9A 4DYKA 1VLIA 5C9UA 5FJPA 1JNEA 2Q71A 2Z2AA 3N6JA 1J11A 3CC1A 3MU7A 3HOJA 3S0CA 7TIMA 3B0VC 1QMLA 1RCXB 5E9XA 4I7UA 3A5VA 1OQFA 3QPEA 1S2AA 2GVEA 4JTRA 1VYPX 5EA9A 1LBFA 3W00A 1H7RA 3Q2DA 1OX4A 1ZL1A 5BNKA 1EFZA 3WF2A 3ZOAA 3KZSA 1K03A 1MRAA 5D9PA 1XH2A 1SZNA 2HVMA 1XIHA 4IISA 3EWWA 2Q09A 1F5ZA 4ACZB 1EX1A 2VTFA 3CO4A 2CXGA 4P7QA 3MZ2A 4TX8A 4XTDA 1CENA 4F0KA 4IIGA 1UR2A 2BVTA 4C7GA 4MKSA 1FWAC 3PF3A 4PBGA 1IT7A 1UR3M 3JUGA 1R46A 2AAAA 1HP4A 3E96A 4ZTXA 1RV8A 4P8UA 1KGUA 3NR0A 2D23A 4HPGA 4DBDA 2WANA 4IIEA 1OCNA 2PGFA 3DOPA 2ZRVA 1OABA 1CNVA 2NW0A 4H41A 3M0ZA 3TU9A 2QDEA 3W7RA 1XKJA 1B3VA 2EPOA 3RCNA 4ZE4A 5BMWA 4XBKA 3SRHA 3VUSA 5CZKA 4JQ4A 5LYRA 1N8FA 2VURA 4GIEA 1OFEA 2F61A 1PO9A 2X30A 1HGYA 3RMJA 3WQ5A 3H2AA 1FCVA 3REQB 2C16A 4ROPA 2YL8A 2RHGA 3G1HA 9CGTA 1I8JA 1T7LA 2Z6IA 3QKEA 1HJSA 4NF7A 4ZSTA 3TSBA 1LWHA 1KM4A 3PY2A 4HK7A 3TX9A 1U30A 1PIGA 2XHYA 5G1YA 4HGXA 1TV7A 1M7XA 3WD3A 2VFFA 1LUCB 1U2YA 2Z1KA 1XISA 3IJDA 1PCKA 3S5NA 4IOTA 4CD4A 4QR6A 3I3BA 1XLLA 3BK0A 5DXYA 4PEEA 2RJGA 2V5LA 5GQBA 3URAA 3HM7A 4PC8A 4G1KA 1WKEA 2ONEA 3OGSA 4IIFA 1ZJBA 4DO6A 1VHNA 3LB0A 4DXKA 4ZB2A 3OHMB 5I00A 4I9TA 2BY1A 1S5MA 1AD4A 2D2HA 1S38A 5AC5A 4KQNA 3FA3A 1UR0A 2CLPA 5TD4A 4X3ZA 5FOOA 1G67A 1QPRA 1TTPA 5I78A 4EACA 3PWGA 4X22A 2PD5A 4Y90A 1EC7A 1LRTA 1WE5A 7REQB 3W27A 4O11A 4ZFCA 2PS2A 3ANYA 3C2RA 4H9ZA 4N2YA 2XZ7A 3LM3A 4H9XA 1Q6QA 4H8VA 2PI6A 1EUNA 4JTIA 4FPSA 1NDWA 3CWOX 3NZRA 2NV1A 1BKHA 1GOOA 1Q4NX 4O50A 3SUWA 5E0KA 5LNSA 3RU6A 1J0YA 2CLIA 2HS8A 2QJHA 5AHLA 1W3LA 4PYSA 4UQBA 2QAPA 1VBJA 3WFZA 2QYGA 1JIBA 3KVLA 1ISXA 3UWEA 2QV4A 4Q8NA 1JQVA 4O4WA 4H00A 1B90A 1KQYA 4HVXA 4BI5A 3WNNA 2OLAA 5HA7A 1HL2A 3S6OA 1Q6EA 3A4WA 4URIA 3V0TA 4TMBA 1X6LA 2CLHA 2DSZA 2W63A 2B31A 1V51A 3CEPA 2C8NA 4XVEA 1Z89A 3POCA 1FQ0A 1IYXA 3KZPA 3I65A 5A8PA 2G4FA 3MKCA 3MVTA 3UPMA 1O68A 1EBGA 4AIEA 4RR4A 3IIOA 1K8XA 3CMJA 1U5JA 1F8IA 3G1FA 2XIIA 4Y8FA 3PUGA 2NV9A 1OF8A 2DFAA 4NJIA 4JIPA 1U33A 3RJXA 2RFGA 4AFYA 3NQAA 1DKWA 3PNZA 4Q6JA 3NPXA 4MNLA 3R89A 4AC1X 1H1ZA 3IJ7A 1PB0A 8A3HA 2GZXA 4WJXA 3EPOA 3RPTA 3KRSA 3DKJA 3UNDA 4GI6A 4ZO6A 3A23A 3F1QA 1GJUA 1VEMA 3QYQA 3VOIA 2WM1A 1RLDA 4M81A 2G95A 1Q8JA 6ALDA 2UY2A 1GVRA 3OVRA 2D73A 4IICA 1JCNA 2VUNA 3EB2A 3I4KA 3IWPA 1PTDA 2HBVA 4CN1A 3WCZA 4C6JA 3IUHA 5G4HC 5T9BG 4MG4A 1PKNA 3PC0A 3Q67A 1PKLA 1W5OA 3W1TA 4HZ7A 2E5CA 3UWUA 3CIWA 3TKFA 3B8WA 3KCOA 2EXOA 2Z1VA 2ZX9A 2YYUA 4S3EA 3N18A 3FS2A 2BLEA 4AH7A 1ZRQA 4GQGA 1POJA 3TXZA 5I06A 3LPGA 1JCJA 5HUOA 1YDVA 3GDRA 3VXGA 1JFHA 3V35A 3GIPA 4CEXC 1HKIA 4GPNA 1FHUA 4H9MA 2YCEA 4JTSA 4YVVA 5LIKX 2WWCA 1VENA 1BXBA 3GYCA 4HQVA 2D0FA 5JBDA 1UZ1A 2DZUA 2VC6A 1A0CA 1I45A 2BOFX 3PBUA 4H1ZA 5AC8A 1K77A 2I57A 3NDZA 3MUY1 2OYLA 2BHZA 1PTGA 1LZOA 2O4QA 1AJ0A 1ZENA 2VFDA 4U31A 3ZIZA 3HGJA 3WQ4A 1C91A 1UBPC 5C7VA 5E0CA 3SGGA 3TJ4A 3H4WA 3PAOA 2YIHA 4HYWA 3ZVHA 1KM5A 4A3QA 2WOQA 4IX0A 2Q6ZA 4J5NA 2CITA 4LTSA 1M7PA 4M7SA 4O1CA 3S6DA 3VNMA 1UOZA 4LUTB 3M6DA 1ICSA 2FH8A 3GS6A 3L65A 4P8WA 3TOYA 5FIPA 3G5EA 1J0IA 4C6QA 7A3HA 4K38A 2QVHA 3BLPX 1LQ2A 1RY0A 4DWSB 4W9TA 1XG3A 1ONWA 3CUGA 3GM8A 2FJKA 4AIUA 4CQBA 3A64A 2CBJA 2XUCA 5I7GA 3FVMA 2PDBA 3DCPA 3EPNA 3H70A 3CNYA 3EX1A 5U4NA 4FIRA 1DORA 1H7NA 3N6QA 1V5XA 4XO6A 1JF6A 1KFEA 3NQEA 4X2PA 1SW0A 4QFUA 1NWRA 3DI1A 2A7NA 2AQWA 2VFIA 4YHGA 4D6JA 3IRSA 1FP9A 4Q7BA 3MT1A 2ZICA 4O53A 5C9ZA 1IZKA 2IQ0A 4MJMA 2AKMA 4AAJA 1J0HA 3N2TA 4ZTYA 2ZC8A 4PTDA 2J9ZA 3QY6A 1L8PA 3D5HA 4YTRA 1BQCA 1K4HA 1WB0A 1BG4A 1JD9A 2Z24A 4KWOA 2VZUA 1GJWA 2Z7KA 1RH9A 4P7NA 4C7FA 2BHUA 1UIOA 2ZBTA 4G2DA 1TMQA 2DSUA 2FPTA 2OQHA 1XBZA 3CUJA 1AH4A 2PRMA 1VB9A 3CZ8A 4N9CA 1L2QA 1GYNA 3DUGA 4ADTA 1U5VA 2X1IA 1IEQA 1BYBA 1KLZA 5M17A 2CZFA 3TFCA 4DY1A 1M7OA 3M44A 1G9HA 1AH3A 2HXTA 3CUIA 4DEFA 1A5MC 4B3LA 3WQ8A 3B3DA 4TV6A 3P80A 1JPKA 1LL6A 3TJIA 1H49A 3RX4A 3NXFA 4A29A 1FBAA 2VOMA 3BURA 3WK1A 4L6DA 3W7QA 1MRQA 3PANA 4AF0B 1VPXA 5LHFA 2R1NA 3FW6A 1K9DA 1Z32X 2UBPC 2VUYA 4L4MA 3W0KA 4XIMA 3B05A 5HMFA 1MO0A 4L4PA 3NL6A 4M6PA 1ZAJA 4NZJA 1A0EA 3GTXA 1PJ9A 2JIWA 4JFSA 4J3SA 2ZA1A 2WYSA 2ZWYA 3V5OA 3AU6A 3MA8A 1R2SA 4HHHA 3CWNA 3TOPA 6REQA 1AJ2A 2Q3RA 2ACSA 4FNQA 3BXWA 3KEHA 2QCLA 1TX2A 3BCDA 2QQ6A 2POTA 4KESA 2D2GA 4GBDA 3KS6A 1R6WA 3LDVA 3PJTA 2E40A 2V9DA 2PDIA 2C0AA 3WNKA 3K4AA 3IJQA 1HKKA 4H04A 3FV9A 3GTIA 3C0LA 1P0EA 1SYTA 3NL3A 1I1WA 2Y2WA 2G3JA 1J12A 3TLQA 1W8GA 3KAOA 1SO4A 4GQ0A 3SCNA 1V3IA 4ZOAA 3H2NA 1FKXA 5FD0A 3UETA 9RUBA 3JS3A 3SCWA 1UD5A 1Q7MA 2BGQA 2YCKX 3N25A 3TN5A 1NJJA