4AF0B

Crystal structure of cryptococcal inosine monophosphate dehydrogenase
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
522
structure length
395
Chain Sequence
TNPNAPPRPDSLLNPSDALKHLEEYPRGDGLSLQELMDSRKNGGLTYNDFLVLPGHINFPASDVSLQSKATKNIVLNTPFLSSPMDTVTEDRMAIALALHGGLGIIHHNCSAEEQAAMVRRVKKYENYPYASKVPESKQLYCGAAIGTRPGDKDRLKLLAEAGLDVVVLDSSQGNSVYQIEFIKWIKQTYPKIDVIAGNVVTREQAAQLIAAGADGLRIGMGSGSICITQEVMAVGRPQGTAVYAVAEFASRFGIPCIADGGIGNIGHIAKALALGASAVMMGGLLAGTTESPGEYFYHEGKRVKVYRGMGSIEAMEHTGLDNAATARYFSEADAVKVAQGVSGDVADKGSINKFVPYLFTGLQHSLQDAGIKSVSELHSCARSGSLRFELRTAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title De Novo GTP Biosynthesis is Critical for Virulence of the Fungal Pathogen Cryptococcus Neoformans
pubmed doi rcsb
source organism Cryptococcus neoformans
molecule tags Oxidoreductase
molecule keywords INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
total genus 121
structure length 395
sequence length 522
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2012-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
B PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4af0B00
1LRNA 5FF4A 3W1AA 3IIZA 3SECA 2X1SA 1XDMA 3P84A 5AFDA 4K39A 1SZNA 4HPJA 3FJ6A 1YXYA 4HN4A 4Q32A 4DF2A 2A7PA 2OMAA 1H63A 2FFCA 5DELA 2JK2A 1YPFA 2QAFA 5ABTA 4K36A 1NFBA 1TTPA 3P8IA 3W74A 4CCDA 4MYXA 3ZFHA 2PRLA 1KLZA 2DZSA 4JY8A 4MJMA 4NX0A 4XWUA 3O6YX 3PM6A 3O06A 1QR7A 3SGZA 4UTJA 5F2LA 2E6FA 4JX4A 2A5HA 3W07A 1LLWA 3KVJA 5KZEA 4IMDA 3C56A 5T26A 4GWEA 4Z1BA 4PODA 3LCIA 1SPQA 3N19B 4ALDA 2E68A 1FWTA 1D9EA 4JTSA 5CG7A 2A6NA 1MXSA 2H6RA 3UWUA 3GDTA 3TA6A 3TW6A 4OU1A 1XI3A 1A5SA 2ZRXA 3ZS4A 1TSIA 3A9IA 1UJPA 5J5DA 4FNUA 1OFRA 1FQ0A 4EF8A 1GG0A 2ZZ7A 3U8GA 3M6YA 3SR7A 2ZBTA 3PY2A 4IX0A 5K9XA 1TPDA 5K2ZA 3LRLA 3SW6A 1VH7A 1JRBA 1ZY9A 3PAJA 3EX6A 1LOLA 4J9JA 3PG8A 1EP2A 3PS7A 7TIMA 5D04C 3GKFA 5G1YA 2C13A 1UUMA 1NVMA 5F1VA 1OX4A 1W3NA 3FOKA 3CIXA 4AAJA 4JTFA 1W0MA 4UTUA 3L21A 1RPXA 2YFOA 1H7RA 3SI9A 1GEQA 1XBXA 1KTNA 3IVTA 3K30A 4NZFA 4RJEA 4JTUA 3P60A 4N02A 4RZ4A 1G4SA 1QO5A 3STFA 3FKKA 4JS3A 5LNSA 1JRCA 2QF7A 4FNRA 3W2UA 3VI2A 2WSYA 1EA0A 1OYAA 5F2MA 3W1XA 3SSJA 3TSDA 2QCLA 1ICPA 1OFPA 2NXIA 3V75A 2CLOA 2VFEA 3R13A 2O7SA 2Y7FA 4QNWA 2E5BA 2ZZ1A 3QMRA 4FB7A 3C4UA 1SFJA 5HUPA 4DO6A 3TJXA 1OFBA 4Q33A 1AL8A 5E1QA 3DBPA 1NF7A 3JR2A 3QPYA 3LLFA 2I9EA 2GOUA 3MP3A 3DFQA 2PCQA 4X2RA 3THAA 1R46A 4JTEA 2YYUA 1LCOA 4YCOA 4OQVA 5SWUA 2GQ9A 2AAMA 5HR7A 4ORIA 1VYRA 4NNCA 4MKNA 3FFSA 1VJIA 1T0OA 1ZAHA 2ZCGA 2YZRA 1TREA 1KFBA 4ML9A 4QQ3A 1CW2A 3GYEA 3CEUA 4MPQA 4DO5A 2EHHA 1XBZA 2VEPA 3G1AA 4JIPA 2B7QA 1QPNA 1TV5A 3DH7A 4XKYB 2B7PA 3OEXA 2NX9A 1AK5A 2H8ZA 4QITA 3PUOA 3WJXA 1TPFA 3R8RA 5KMYA 3O16A 3GR7A 4GUHA 2NX1A 4PFMA 5FEPA 1P4CA 4GRSA 4BWLA 3JS3A 3D0CA 3LTYA 5G4WA 1LRQA 1RQBA 3LRKA 1SW7A 3S1UA 1ZENA 3BW3A 1XC4A 1W56A 4TX9A 4FXSA 5C54A 1K03A 1D3HA 4JEQA 1ZJIA 4XBKA 1KFJA 1GVSA 2BWGA 1OABA 2NZLA 3B05A 3DXIA 1W5QA 1W3TA 1F7BA 5AC8A 5D38A 2WQPA 4O1CA 4MY9A 3NG3A 2YDAA 3HGRA 4FHAA 3NA8A 4AMAA 1SFLA 4OGZA 5G5IA 1VHCA 3MI3A 1KV8A 3C2VA 4MZYA 1YADA 3L5AA 2FIQA 4GE8A 4O53A 2HS8A 4JR5A 1TMHA 2C3ZA 1HO1A 3G1DA 3KRSA 4OV4A 3F4NA 4YL2A 4GUGA 2RDUA 4JXCA 1BEUA 2J9YA 5D2XA 4OV9A 5F2GA 3B04A 3BLFA 3VKJA 2GVJA 1FCVA 3GLCA 4UFMA 3PR2A 2ZDRA 3NQEA 5AYYA 1PV8A 5HULA 3HG4A 4HSOA 4UTTC 4Z0SA 1TPVA 3W7LA 4LVAA 4MLRA 5D05A 5I3KA 4FX8A 2Z6JA 3TXVA 5L9FA 1S3HA 1NF0A 1TPH1 3NR0A 2B4GA 3NQVA 1M6JA 4A2SA 4O4VA 3BV4A 5AOUA 1HG3A 2V9DA 3MW7A 3L65A 3SGUA 4U28A 3LRMA 1G4EA 3B0UX 2FPTA 4MYAA 3CM4A 4JTLA 3WFAA 3I65A 4O17A 3W7IA 3U6WA 5IM51 1M5WA 1JQVA 3VE9A 2NXHA 2RDTA 5F1UA 4CCEA 1H1YA 4OHQA 4UIOA 1VCGA 1FX6A 1H5YA 3GNDA 4AB4A 4K7VA 3W75A 4BI7A 1XUZA 3EEGA 4JX6A 5CPOA 4I7WA 2A6LA 2EF9A 4YCPA 2GVGA 3N34A 5D02A 5GVJA 2H90A 3P5YA 3QQ0A 1I2PA 5EA9A 1J2WA 4I7VA 3W83A 1NEYA 3M47A 1S5VA 3OBKA 3DFOA 3QMSA 5AN7A 3C3NA 2VC6A 3NZ1A 3O1NA 3W9ZA 1OF6A 1XM3A 1AW1A 1ML1A 4FXRA 1EX5A 1YDVA 4Y96A 4O50A 2ZRUA 3HF3A 3P80A 4MLJA 4MY1A 4S1FA 4CCCA 3O05A 2Y70A 3ZR4A 3DENA 1O5XA 3SZ8A 3S1VA 1QFEA 4K7YA 1W54A 4LW7A 5IBXC 3M5XA 4Z0JA 2X16A 4FEZA 1GOXA 2YW3A 5KTLA 1QMLA 3G3MA 2DZWA 5EMUA 4MY8A 4JX5A 1VS1A 1OHLA 5A5WA 3BPWA 4JTIA 1GYNA 1T8XA 3T55A 1VYSX 3OVRA 4Y90A 4Z08A 2FB3A 4EF9A 3W84A 5I3HA 1JCLA 4XQ6A 3QSRA 4DPPA 4N6FA 4PL1A 2J6XA 3TR2A 3MYOA 4QISA 1BWLA 3QRHA 4WUIA 1PHQA 5CPMA 1FWRA 3IEBA 4RZ5A 3LCWA 1KM5A 1LROA 4RX0A 4S2CA 1DKWA 4JICA 4LV9A 1M7OA 3AO0A 4XUGA 2WKJA 5FF0A 3UQNA 1NSJA 2RH9A 1UUOA 5DXXA 5HQEA 2O7QA 3LXCA 2C19A 1LRTA 3FA5A 4BFAA 1WOBA 4JNMA 3M5YA 4I9AA 3R12A 4IMEA 1VRDA 5TQLA 4BF9A 4XTIA 3I7QA 4DF1A 2XN2A 1ADOA 3HPSA 4TU1A 1U5JA 4E2BA 4HSNA 5DBTA 4NT0A 1VC4A 4AH7A 2ZRVA 1TPUA 4DPQA 2NUYA 1ZAJA 3T44A 4O4WA 4FF7A 4JYDA 3M44A 1SW3A 3TNOA 3GX9A 2QUVA 1YTKA 2DZPA 3S5NA 2V8ZA 3NL2A 3WJYA 3WJWA 2G95A 3FEMA 3W70A 3Q94A 2JKEA 1QOPA 3F4WA 5FESA 3FYOA 2E09A 1EIXA 3NZRA 2YYTA 3NQCA 3HG3A 2J9XA 4JTJA 4NVTA 5HWNA 4LT9A 2CZFA 1KLYA 2R8WA 1MZHA 3TSMA 3MBFA 3KXQA 1EB3A 5LNWA 1YTEA 4M7TA 2WOQA 2VEKA 2B7OA 2EKCA 3G8RA 4WY0F 5G2WA 2C15A 1WBJA 1H7OA 4GUIA 5DCBA 4AWSA 3STGA 1OFAA 2OCZA 4MFEA 2H3DA 1ME8A 2YX0A 2BXVA 1GJPA 3NL5A 3G1FA 4AVFA 3EWXA 3R2GA 4LWWA 3TFXA 3L9CA 2DJLA 1IXPA 1GTEA 2V2HA 2C16A 2EAWA 3EWBX 4EIVA 3TAKA 1SO4A 2V82A 4N9EA 3CLMA 3CB8A 3S9YA 3HMJG 3PBUA 2QCNA 2JGYA 3HBLA 5KITA 3OA3A 4DF0A 1W5OA 1G67A 2DZUA 1QPQA 1X1ZA 3LM7A 2TMDA 4UTKA 4P61A 3C61A 3ZWSA 3C0JA 4FNTA 3MUXA 1G69A 4WQ6A 2Y89A 3WJSA 1S5TA 3M1ZA 3LCLA 3GIYA 3UPWA 3CWNA 4FIRA 1K7XA 4UFJA 4C1KA 2FLIA 2V30A 4CQ9A 3UXDA 3G24A 2CLMA 1VHNA 2GUUA 4O1DA 4LC6A 2G96A 1AW2A 2V5LA 3G1YA 1EWDA 3GNNA 3B0PA 4ONVA 3MYPA 3EXTA 4O10A 3ELFA 2NXGA 1TQJA 4M5PA 5AHLA 2Q3OA 5CZ0A 1IGSA 2A7NA 4QNEA 3F1QA 3NM1A 1K7FA 2RHGA 3GAYA 2BTMA 4JYFA 1F74A 5AHFA 5LHFA 5G4EA 2A4AA 4NXSA 4O14A 4LVFA 3FS2A 1OFOA 1Z48A 3C8FA 3CC1A 2ZRYA 4NZJA 3TK7A 4O13A 1I4NA 1W37A 2P10A 1AL7A 3C2EA 4L4LA 5AHEA 4X22A 3W1QA 3EWYA 3W86A 3A24A 4DXVA 1K3UA 4LS2A 1BWKA 3PWAA 4NX5A 4N4QA 4WJEA 1QDSA 2WJZA 3DI0A 4UFKA 1DORA 2ISVA 3I7RA 3MP5A 3TFCA 5K4XA 3W7RA 5LNRA 3RK8A 3MWAA 1WQ5A 3N73A 1FXQA 3BG9A 4IMFA 4WXYA 3ZWTA 2VELA 5HINA 3P74A 3OIXA 4IQLA 1Z42A 3DHFA 3LCXA 4FO4A 3MP4A 3M16A 3M7WA 1DOSA 1SSGA 4AEOA 5KINA 4JIQA 1R2RA 4BK9A 4O54A 5F4SA 4HNUA 3EXSA 1KFLA 4A2RA 3TX9A 1WX0A 3VFLA 3GKAA 2B0MA 3S42A 3P62A 3UYCA 3THQA 2B7NA 3KFTA 4EOUA 5LGZA 4S2BA 3G0UA 5MHBA 4UFLA 5F4XA 1OVDA 5K7JA 3FIGA 3KRUA 4UNLA 2HS6A 4JN6A 3N2XA 5HMSA 5DCDA 2CWNA 3GK0A 4HNNA 3IVUA 1YDOA 1W5NA 3AJXA 1IXOA 4BWLC 1GWJA 3O15A 4K6AA 3HGJA 3W2NA 1Q6OA 3DHDA 5K9CA 3DU0A 1H1ZA 2ABAA 4RXFA 1KFKA 4DO4A 5DY2A 2E5CA 3LGEA 4UMBA 4G1KA 3B4UA 3QQ1A 1H7XA 1SZEA 1DVJA 4HNTA 4KFNA 1XL9A 2CLEA 2ZQ0A 3C2RA 4KFOA 3DZ1A 3DGRA 1G7UA 1GQNA 1OK6A 3G1HA 3PG9A 2QCEA 3IIPA 1YDNA 3QW3A 1H7WA 5TBOA 1F76A 3QPZA 5DLCA 2OT0A 4LS1A 4QJ1A 3W1PA 1K7EA 1R2TA 1WV2A 3UD6A 3W1LA 1JCMP 1C8VA 3EWUA 3LOTA 4LU0A 1WA3A 5K3VA 3P5ZA 2GJLA 3NQFA 2AQWA 2X30A 3A5FA 2I14A 4JTGA 4TMBA 4IOTA 2C6QA 1TJRA 3P61A 2CLFA 3GDMA 4LVBA 1NAL1 3BLEA 4YWIA 3PULA 2NLIA 1P1XA 1KBJA 3E49A 5AB3A 3LDVA 1WAUA 3DAQA 1Q6QA 3W2MA 4MFDA 3G8EA 1QOQA 1U83A 1WBHA 4AWTA 1LP6A 1X8FA 2XN1A 1FCQA 3GXNA 4QM1A 3M43A 4LS0A 4QIUA 4PC8A 3G0SA 1C29A 4N2YA 2Z0IA 4IGHA 6TIMA 4ZQMA 1FWWA 4JTTA 5C6MA 2OJPA 1AG1O 2QCCA 4NUWA 2Y7DA 4ADTA 5EPDA 3TIMA 5LKYA 1SQ7A 4NJKA 4WX2A 1F6KA 4K38A 1B4KA 3UWYA 4O1BA 4GXMA 5D03A 4ADUA 1OK4A 3ANYA 3P82A 2ZA1A 3W88A 4RZ6A 5LSMA 3QH2A 1L2UA 1RQEA 1I2OA 2UV8G 1TV8A 3U2OA 3A5VA 2PRMA 1PL9A 4NQ1A 3GZ3A 2DP3A 3C52A 5AHNA 1I2NA 3M0ZA 3O8AA 2JBMA 1W8SA 5DN1A 1RVGA 5D2YA 3H55A 3JRKA 1IIHA 5EBUA 3M5ZA 3B06A 2P1FA 5D2VA 3W7JA 4Z1AA 1EUNA 1ICSA 1P5BA 1ZNNA 1W31A 3QYQA 4UTTA 1Q6RA 4R53A 3WK0A 1SO3A 2ZYFA 3W7MA 3GDLA 1IF2A 1F05A 4GFSA 2C1HA 5DY3A 1QCWA 1KM0A 3TW7A 5HJLA 1O5KA 2JGQA 3S5OA 1CX9A 5TIMA 4O15A 2Q8ZA 4HKPA 3L0NA 3CTLA 4R34A 1FDJA 4KWWA 3TV8A 4A29A 5H91A 1A5AA 1RZMA 3O63A 1SZFA 3IV3A 4XTDA 1Q45A 5FEWA 2EGZA 3LCFA 3QFEA 4TR9A 2ISWA 1H61A 4LNYA 1JCJA 3L68A 2V2CA 5HWJA 1PIIA 1G4TA 3NM3A 3RNDA 2E5DA 3KVKA 2Y85A 5D30A 3LX9A 5AYXA 5AC6A 1B4EA 1T99A 4PEKA 2RDWA 1EEPA 2QR6A 3EWZA 5G2IA 2R94A 5D32A 4KKXA 4LRSA 4NNAA 1QPOA 3N2MA 3MHFA 4U4MA 4NXKA 1ICQA 3W1NA 5CSRA 4GUFA 2ZTJA 2JKPA 1LYXA 1VQTA 3W7CA 1N55A 3IGSA 3N14A 4CNNA 1RQHA 3NQ7A 3W7PA 4LVDA 2V2DA 1DHPA 3CT7A 1J4EA 5LGXA 1Q6LA 4ZQRA 3YPIA 2VKZG 3OHIA 1DJNA 3LI1A 1F2JA 1IIGA 3WK1A 5EYWA 4CLMA 5D09A 4O18A 3QZEA 4MUZA 4GC4A 3TXZA 3EXRA 1QPRA 4HPXA 1VZWA 4ICNA 1YTDA 1TO3A 3B0VC 3DFTA 2CU0A 3INPA 2GJNA 2ZRZA 4RLIA 1JCYA 3W1RA 3W7HA 4E0CA 5A8GA 2XN0A 2Z2UA 5U4NA 3NPWA 1X1OA 4WXZA 2A85A 3NQGA 4ZQNA 3UXAA 4UFIA 4C1LA 5CGQA 3NPVA 5HWMA 3OVPA 4BI6A 3BVJA 2J24A 4H4IA 4Z1DA 2X1UA 2ATSA 1Y0EA 3PF3A 2FDSA 3LTPA 4IX2A 2G5WA 2Z1BA 2CLKA 2VFGA 4A22A 2WV8A 3LLDA 5J5RA 3UPBA 1R30A 1M7PA 4ZQPA 4O52A 1TYGA 1UBSA 4GNJA 3LXAA 4JY9A 5F2IA 3NGJA 3NXFA 5AHIA 3DI1A 5EKYA 3O6DA 3NDOA 2Y88A 3IGUA 1KFCA 2H8XA 2VXNA 3RF9A 1PE1A 4KFPA 4XKYA 1OF8A 1KM4A 1I8JA 3Q37A 2J27A 3S5YA 2VEIA 2HMCA 1A50A 3CIWA 3QJAA 3QM3A 4AHQA 3TDFA 4ZL1A 1XKYA 2NUWA 1BTMA 3L0KA 4JYEA 1TPWA 5FEXA 2QJGA 1OFEA 5D2TA 2OT1A 1FDZA 4DEFA 1W5PA 1O95A 4ORMA 3ABQA 1LBMA 1I2RA 4JTKA 2V0TA 2WPBA 4LC8A 5HNRA 3W23A 3EKZA 1G7VA 1VYPX 4IMCA 3UZ5A 4ZQOA 1HTIA 5LZLA 3BGGA 1B9BA 1MEIA 1TCDA 2XFWA 2WSQA 3N9SA 5FF2A 1B57A 4IUOA 3W2LA 1YLVA 4BR1A 4UFHA 1F73A 1I2QA 4CNPA 3LHUA 4UTWC 1OJXA 3BG3A 3LHVA 3P81A 2Y6ZA 5F4WA 3GXPA 3HPXA 1G4PA 1OFQA 1L6YA 4UNKA 4UR8A 3SJ3A 3QSTA 3HJZA 3W2KA 3L5MA 1DQWA 3ATYA 4K37A 1FDYA 1TV7A 3IIXA 3W6YA 3CU2A 4X3ZA 5D2WA 2Y7GA 4RR4A 3G1SA 4PL2A 6ALDA 3EX1A 1IXNA 4ZMGA 3STCA 2A1YA 2QCMA 4PTNA 5I3JA 4W9TA 1ZALA 1LOSA 2NWRA 1JULA 1XFBA 3O07A 1HO4A 3LCGA 3TH6A 1JCNA 2FJKA 2YXGA 4FNPA 4H3DA 2LLEA 1ZCOA 3W22A 3Q2DA 1DJQA 2R14A 3DKJA 1O60A 1FCUA 2FPYA 5G2HA 1TRDA 1XXXA 5CSSA 3O6CA 4O16A 4RV8A 3NO5A 2CW6A 4TMCA 4R7JA 4N6EA 3G1VA 1VR6A 1GVFA 2BSLA 3KX6A 4JDYA 3QC3A 2CLHA 2FPVA 3DFPA 3C6CA 5CZJA 5FF7A 3W85A 4FX6M 1BKSA 3S8HA 3P8JA 2QCHA 4N9CA 4WY0B 2H3BA 1Z44A 2DZTA 3TMLA 3BG5A 1KTCA 5BRBA 1FUYA 5DXYA 1H51A 3LHTA 4O11A 1JUBA 3BLIA 4A21A 2ZTKA 2CZ5A 4GUJA 3W7DA 1LORA 4HT3A 5DBUA 3CQ0A 3P7YA 1TPC1 1KV5A 1ME9A 2PRHA 3RLVA 3PB0A 2JKAA 1H50A 1KM6A 1XBVA 2W79A 4KWVA 1LBLA 3L0GA 3E02A 3QF0A 2QDGA 2VFHA 3NYZA 5D33A 5CKSA 2KZHA 3H53A 1PCKA 1C9DA 2QCDB 5K9DA 1OG0A 4M7SA 4AXKA 3NQDA 3UWZA 3ABSA 1RR2A 4O19A 2TPSA 1TB3A 3I6RA 3CPRA 2X1RA 1Z41A 1LTDA 2J88A 2VOMA 2QJIA 2E77A 4MZ1A 1TIMA 2VFDA 3T7VA 2ZZ2A 4JDBA 1TPEA 1ONRA 5FI8A 4MVAA 3HO8A 2ATMA 4UTMA 5C5YA 1PHWA 1P0NA 1TTQA 3W1UA 3VE7A 1GPWA 2YFNA 4D2JA 3UWVA 3KVMA 3GXTA 1HFBA 4Y6GA 3EX4A 4IWWA 4Y8FA 3KRZA 4ZVJA 1OX5A 1H7NA 2R91A 1SO5A 3HIJA 3W7OA 1GZGA 1FXPA 2VFFA 3SFKA 3MJYA 1H7PA 3TJLA 4I7UA 4UR7A 3RU6A 1OX4B 3TROA 4MJZA 1UCWA 4LTSA 1XBYA 3LXBA 2FB2A 5HR6A 4WD0A 4LY8A 2IQTA 2OZ0A 2X2GA 1DBTA 3LV5A 3MI2A 1XDLA 3G3DA 3UY7A 4UUIA 4LV4A 2W0UA 1DV7A 1TTIA 4OE7A 4ADSA 3DKLA 3EX3A 1VCFA 3H54A 4B5NA 4M6VA 1UASA 4RKAA 2FQIA 4HNVA 1PS9A 2P0OA 4QAIA 3W71A 1JVNA 3KHJA 3HG5A 1XUUA 3EKLA 1LLZA 1X6UA 4JD4A 3SY5A 1TPB1 1F5ZA 1OYBA 3W7KA 3L66A 3S1XA 3HG2A 3VCRA 3MI6A 3DFSA 1A53A 3BW2A 1VGAA 5FF3A 1JR1A 5BNKA 3TQVA 3WK2A 5KSWA 3S0CA 3G1XA 5AYZA 4PH6A 1WXJA 3N3MA 1SW0A 1K8YA 2Z6IA 3E12A 2E6DA 4IJBA 3STEA 4RK8A 4XZ9A 2C14A 4EWND 1LOQA 4DQWA 4E2DA 2I1OA 2YPIA 3G0XA 3LCHA 5CZSA 4LUIA 3W3OA 1YPIA 2F84A 1LZOA 3PBWA 1TQXA 2WNQA 4NJJA 1AW5A 2W6RA 8TIMA 3C2FA 1KTBA 4O0KA 3ABRA 3LB0A 3TAOA 4UMCA 2DZXA 3PSVA 4DBDA 1OX6A 1EWEA 2F7FA 3EWWA 3F03K 3GDRA 3RMJA 4LRTA 3ABOA 1A5BA 4DBEA 3GR8A 1EP1A 1KFEA 1O4UA 2DJXA 5BMXA 3E9AA 3QMTA 4PCFA 2CLIA 2A0NA 4EVZA 4P2VA 2VFIA 3M9YA 3L5LA 1JCXA 3NL3A 3LI0A 2QJHA 2QAPA 4GBUA 3V1PA 1N7KA 3MHGA 4Z1CA 3NPUA 3S1WA 4AWUA 2X1TA 2YW4A 1S5WA 4GJ1A 2YR1A 4QSHA 4MZ8A 3HPZA 1LDCA 1EPXA 3TC7A 1DQXA 2FTPA 2NV2A 2ZZ4A 2ABBA 4X9SA 3NVTA 2ZA3A 3R5EA 5CPLA 2TSYA 1JQXA 3W76A 4CQ8A 1G6CA 2GPTA 4IXXA 3W72A 2V81A 4UTHA 5EL1A 1K8ZA 5FEZA 2Y7EA 4MIMA 3KOFA 2TRSA 2YCEA 4UXDA 4O8RA 2C0AA 3TQ0A 4NU7A 2VEMA 4N4PA 3USBA 1W1ZA 4NNBA 1TTJA 1PVNA 1E51A 4O57A 5LNVA 2BLEA 2G97A 1GVOA 3IIVA 4TIMA 3NQ6A 1X7FA 3PBYA 5H2ZA 1RV8A 1KM3A 1QWGA 5I3IA 1MSSA 1MEHA 4WOQA 2YSWA 3B8DA 1D3GA 2V5BA 1KW1A 1K8XA 2ISSA 5I3FA 3ATZA 1GYLA 2YGYA 4CQAA 4HHPA 1FWNA 4LVGA 3OVQA 3UY8A 5KZDA 2J9ZA 4R33A 1I45A 1VCVA 3FYPA 3W7GA 3GDKA 1JJKA 2DORA 1R2SA 2TYSA 2ZFAA 3TU9A 1L6SA 3UWQA 3G18A 2Q3RA 1O94A 1VPXA 1YXCA 5BMWA 2AGKA 2GQAA 2PE4A 1K02A 2DU2A 3HGSA 1KA9F 3IGXA 4XBSA 5AHMA 1KM1A 2HTMA 1Q3NA 3PBVA 4A3UA 4ZQCA 3GB6A 3NNTA 4M19A 1IXQA 3W73A 3LBCA 2CLLA 1R47A 1F6PA 1YXDA 2ZRWA 1QO2A 4YLWA 1QNVA 1FCBA 3TUUA 3UZJA 3NQAA 3L2IA 1YYAA 3KAOA 4O12A 3FKRA 5BOOA 1H62A 3PSWA 4M6PA 1L9WA 4UTWA 3IRDA 4DELA 1P0KA 3NAVA 3DFNA 1KM2A 4N9DA 1JUEA 2VENA 3NL6A 5LHEA 3G22A 2NWSA 3TKFA 2RKXA 1WDWA 3M41A 1OYCA 2ZZ6A 5I3GA 4WY0A 3EX2A 4YMZA 3QW4B 2ALDA 3KVLA 2QUUA 4UCGA 3W7QA 4K8HA 3PC0A 3SIZA 1AMKA 1SUXA 2A7RA 1MO0A 3NOEA 5CZTA 4O1AA 2Y62A 3M5VA 4E38A 3I68A 2HSAA 4JGDA 2CZEA 4WOZA 1VLWA 5CPNA 4MOZA 3CEPA 3T4CA 1ZFJA 4HIBA 3OG3A 3PUDA 4LOCA 1H60A 2PURA 1PCWA 5E0KA 4H6KA 3NQ8A 3BO9A 3I7SA 3MBDA 4FNSA 1B3OA 3HB9A 2C18A 1WYIA 2ZZ5A 3P67A 3BK0A 4IPIA 2OX1A 2QCDA 4UTIA 5U7SA 3LHZA 3A21A 4WZHA 2GQ8A 5L6UA 3TE9A 3TSBA 1GVRA 5DCEA 4K8EA 4UMAA 1ME7A 3C2OA 5BW6A 2E1DA 3W1MA 1GG1A 3A23A 3T40A 5AC7A 3VNDA 1GT8A 3S5ZA 5HUOA 4IMGA 1SZGA 1SR9A 3IIOA 4AF0A 3FJLA 2GVLA 4N9BA 4OT7A 3UNDA 2QCGA 4LUJA 4Q4KA 4FIQA 3LHYA 2NX3A 2QDHA 3T78A 3W7EA 2QCFA 1EP3A 3PVFA 3FLUA 1HUVA 3HOJA 4M6QA 2PC4A 1TRIA 3UWWA 1QAPA 3QEZA 1DL3A 4UC5A 4NJIA 1ZAIA 3WK3A 5KZMA 1V5XA 1V7YA 3TQKA 3E0IA 1HL2A 4AHPA 4OWGA 1N8FA 3MMTA 3TMQA 2E6AA 1ZHAA 4O28A 3BGJA 3W7NA 1FY6A 4JTHA 4IXHA 2BZNA 5E93A 3TCEA 3LV6A 1OFDA 1GTHA 2Q8LA 3NQMA 2BX7A 2CFFA 1RD5A 4AF0B 3BARA 1EUAA 3W87A 3S6DA 3CWOX 3NPXA 2QKFA 4IPJA 3WJZA 5LNUA 2D73A 3Q58A 1W3IA 1VLIA 3BW4A 4UTLA 4ZZ9A 2CZDA 3R89A 2A2IA 1XCFA 2WO5A 2EPHA 2RFGA 3IVSA 3PB2A 3B03A 1W5MA 2NV1A 4L4MA 4YXGA 4PA8A 4Y9AA 1FBAA 4CNOA 3NEVA 3LERA 1WOAA 1SO6A 2Y61A 3RFAA 3W2JA 4AHOA 2QUTA 3NQ2A 1MEWA 5C55A 4RXGA 1A5CA 2DZVA 5K4ZA 3W1TA 3N9RA 3GVGA 1FWSA 3A22A 4O0ZA 3LHWA 1GVQA 1ALDA 2QEZA 4OBTA 5EY5A 2E6YA 4NJGA 4TO8A 1LBFA 3MO7A 4FNQA 2WNNA 1CI1A 1JUKA 3GAKA 2ZA2A 5G1TA 1THFD 3E96A 2Y63A 5C2XA 1T96A 5D37A 2WSRA 2NUXA 3LTSA 4BI5A 4NJHA 1SU5A 4RCXA 3CHVA 3HGOA 2ZZ3A 3PUEA 1L6WA 3EB2A 1KBIA 1UB3A 4FX7A 3RLUA 3HQ1A 1TJPA 4POCA 1LM1A 3L67A 3LBMA 5IBXA 2A21A 3TC6A 3MHUA 1J5TA 2WNZA 1SSDA
chains in the Genus database with same CATH superfamily
1ISZA 4MWAC 1GVEA 3SECA 2J8GA 4WSJA 5AFDA 3FJ6A 1UG6A 2JK2A 4Q8PA 1XSKA 3SCPA 3KE0A 4JCMA 2QXWA 2Y8UA 3MA8A 3OB8A 3W74A 3ZFHA 4MJMA 4NX0A 4JY8A 3O06A 3GW0A 2E6FA 4LUSA 5KZEA 4IMDA 3KP1A 1VD6A 3EOOA 1ZUAX 2D22A 3O0KA 4IF2A 3LCIA 3N19B 3EGJA 3AIWA 3QTGA 4US5D 1A0EA 1MXSA 3T09A 3UWUA 3GDTA 4CD4A 4OU1A 4WSHA 4S3CA 2QDEA 4C6LA 1XI3A 1A5SA 4QXIA 3ZS4A 5A8MA 1XG4A 1HKMA 1BLIA 2WHKA 5HOSA 1FQ0A 2IPWA 2CLPA 1V8EA 4CNSA 1WB0A 4C6NA 5AECA 4ZTYA 4XZIA 2UWFA 3CV7A 1ADSA 1LOLA 4PMQA 3PG8A 4Y2WA 3HURA 3GKFA 5G1YA 1NVMA 3WH7A 1W3NA 4DZ5A 1W0MA 3L21A 4U10A 3EA3A 1N8IA 2Z1VA 1H7RA 1Q7MA 2VRQA 5H6HA 1XBXA 4IFOA 4IGMA 4RJEA 4JTUA 1TA3B 1PSCA 4O0QA 1KXHA 5LNSA 1EQCA 1XCXA 2QF7A 2WSYA 1XS2A 3TSDA 3ITYA 5T8GA 1ZSXA 1OFPA 2WVSA 4PMRA 4FAMA 3CUXA 3DERA 2OEKA 1JXJA 2O7SA 2BP1A 3JVAA 2O9RA 4NHVA 4QNWA 3S83A 2E5BA 3OQ8A 5E5CA 4PUWA 5CGTA 1GOQA 3FSUA 2YBUA 1M41A 1AL8A 1JGMA 1TJ1A 2OTDA 1NF7A 1UP2A 2I9EA 4ZCWA 4BQ4A 1IQ8A 2VWTA 3XISA 3ZVHB 4I90A 2EQDA 3B97A 3EA2A 4S38A 3F2CA 4OQVA 1TJ2A 1TMLA 4JNZA 2YA2A 1VFFA 1AJ2A 4ORIA 3WL1A 1CIUA 1VYRA 4NNCA 4MKNA 2CEQA 4LB3A 2ZCGA 1DWJM 1KFBA 3G1RA 3SRDA 3CEUA 4DO5A 1NDYA 3G1AA 2ZXAA 3MZNA 1QPNA 1TV5A 2E67A 3DH7A 4XKYB 4GBDA 3O7UA 4WGXA 1VFLA 4GUHA 4Q8WA 2BV9A 1M7XA 3JS3A 3D0CA 3LTYA 1LRQA 1RQBA 2O9OA 4RDYA 5A8QA 1JNEA 2KAUC 1SW7A 1Z8AA 5EMYA 4IL2A 1EDTA 3GHTA 1W56A 1OGGA 4FXSA 5C54A 4JQ1A 3OYZA 4ROPA 4JEQA 2PDYA 4MG4A 3U3HA 3DXIA 4RNFA 4I6KA 4IISA 2WQPA 4MY9A 2A3EA 2DVXA 4BCEA 1KV8A 1JD7A 1J96A 1K9FA 1TMHA 4RZBA 3MUIA 1HO1A 3G1DA 3KRSA 4OV4A 4YL2A 1DJYA 2AAAA 4JXCA 3DUGA 5D2XA 1UIPA 3W02A 3B04A 3BLFA 3NEHA 2X2YA 3GLCA 3KLKA 2PBOA 1EJ7L 5RUBA 2ZDRA 1QW9A 3NQEA 5HULA 2QMJA 5E6YA 1TPVA 4HMEA 4MLRA 1UD8A 1MVYA 4R9XA 4WDTA 2J13A 3H2NA 5L9FA 1S3HA 1JPHA 3KEHA 5HPOA 2B4GA 1M6JA 1WP6A 3BV4A 5AOUA 3ZJ6A 1HG3A 2QJNA 4YVVA 5IFPA 3L65A 4F2TA 1YX1A 2FPTA 4MYAA 4K8GA 2I7GA 3U6WA 3VE9A 1E6RA 4OHQA 4UIOA 1FX6A 1H5YA 1TFVA 4L6OA 3W75A 3TC3A 5CPOA 5JUVA 1J9YA 4YCPA 2OPJA 3T05A 2C7FA 4DUVA 3WUBA 4F0RA 2H90A 3ORWA 2V6AA 4ZFMA 1S5VA 3D3AA 5AN7A 2D20A 1TJ0A 2G0WA 3IWPA 1AW1A 3GH4A 3KW3A 3E1F1 4FXRA 1EX5A 1YDVA 2Z4GA 2ACQA 5JQ9A 4O50A 4MY1A 3PZGA 3GXDA 5D9MA 1GK8A 3U4FA 4S3BA 3ZR4A 1O5XA 1S1RA 2FMOA 2PTWA 1W54A 3EYPA 4QEHA 4MWAE 5JBDA 1GOXA 3CK5A 1J8VA 1QMLA 3G3MA 5EMUA 4MY8A 2E8ZA 1OHLA 5A5WA 1T8XA 4IH3A 3T55A 1PIFA 3CHEA 3IACA 2FB3A 2DSVA 3P0WA 1H3GA 3PJWA 3IUDA 1X97A 5ABFA 3OODA 5ABEA 1UYQA 1RVKA 4QISA 3W27A 2IKIA 4WUIA 4XZBA 1CGUA 4D1IA 3IEBA 2XPKA 2V3FA 1KM5A 2Y5JA 1J11A 2B81A 3LEPA 1DKWA 3AO0A 4OZOA 3WDPP 1NSJA 1KR0A 5HQEA 1AQFA 4GZJA 3T6CA 1WOBA 2OELA 3M5YA 3BAIA 4I9AA 3TYAA 2VX6A 4BF9A 4XTIA 4H41A 2GJXA 3HPSA 3WMCA 1F3EA 1XD1A 1XLJA 1VC4A 1SM9A 4DPQA 5E9XA 1ZAJA 1LG2A 3ZLFA 3M44A 4KWUA 5GNZA 2GVYA 1QNQA 2WJDA 2G95A 4AVNA 2ZX6A 3O0FA 3B0YA 4I9TA 2JKEA 5FESA 2VO5A 3IJ6A 2YYTA 4A8LA 4CVWA 3GG8A 1PZ1A 4JTJA 4D72A 5HWNA 4PTVA 2QHAA 3MBFA 4GVHA 3RPTA 3SCNA 1E4NA 4INFA 2B7OA 4R7OA 1NELA 7REQB 1KRAC 3WH5A 3WD1A 1J6PA 2PTYA 5DCBA 1MQRA 1GKRA 4AWSA 3STGA 3TP4A 1ME8A 3OBEA 3QYSA 4NILA 3UR5A 2BXVA 3M46A 3G1FA 2CBIA 3XINA 2V2HA 1W9BM 3UJRA 3CLMA 3CB8A 2A79A 2QCNA 2JGYA 2WVTA 3H12A 3E3HA 1L6FA 2D69A 1CB7B 4BZYA 3OA3A 3AROA 5AC5A 3ALGA 1G67A 4Q7IA 1X1ZA 3MQTA 3LM7A 6TAAA 3BSGA 5AC4A 2WMIB 1J6OA 1L8NA 3ZWSA 3C0JA 4FNTA 3W29A 4HK6A 1S2AA 4FXFA 1B0IA 4FIRA 4UFJA 4C1KA 2FLIA 4CQ9A 4MJ4A 3RXZA 1IT8A 3AWOA 2CLMA 3VTRA 1VHNA 1FWGC 2GUUA 2XSBA 4N42A 2V5LA 2YA0A 2Z00A 3CGTA 3B0PA 4ONVA 4O10A 4M5PA 3WQCA 2Q3OA 4QNEA 3G5EA 2DZBA 3NM1A 2W62A 4YYFA 2RHGA 1F74A 4OVXA 1O5RA 5G4EA 2A4AA 5LHFA 3VX0A 4B16A 1UKPA 5IXEA 1OFOA 4PSRA 3SN4A 4OECA 4KW2A 1J01A 2FYMA 4NZJA 3TK7A 2X1IA 1I4NA 2G3IA 2FHCA 3LNMA 1JDCA 3VD9A 5TAOA 1KQYA 4JNYA 3KDOA 2AQOA 3EKGA 4HA1A 1JYXA 1BWKA 4NX5A 5HAOA 3WDRA 4LAZA 2Y24A 2ISVA 1MXGA 3RGTA 3MP5A 2GJRA 3MWAA 1N82A 1WQ5A 3N6QA 4WXYA 3WLJA 2J7DA 1GKQA 3U4AA 1GZJA 2ASHA 3VX1A 4U5KA 4JIQA 3EAUA 2PP0A 4O54A 1QI3A 4Q22A 5F4SA 4HNUA 2OG9A 1A49A 2GLKA 7CGTA 1V6YA 1XLKA 5EU9A 3SY1A 3THQA 3IANA 4PB4A 2OLSA 5MHBA 3QR1A 5F4XA 4B2DD 5EB8A 3OTRA 2ZXQA 1JYVA 2CWNA 3GK0A 1YDOA 3M0VA 2VGGA 4BWLC 2F8QA 1Q6OA 4AY7A 1QBBA 1T40A 2E5CA 3EBVA 2VRJA 3ZZ1A 4K68A 2YCKX 3KBJA 3DG7A 4KEZA 1SZEA 1DVJA 2O4MA 3ARQA 4DYEA 1NFGA 3IJ9A 1PZ3A 3C2RA 4KFOA 4L61A 4MF4A 1TR1A 1WKEA 1G7UA 3LZ3A 4NZ1A 1RBOB 4C5ZA 2QCEA 1UWTA 1U33A 1H7WA 3QPZA 3KOXA 2OT0A 1G01A 4QJ1A 3W1PA 1WV2A 1V7AA 3LOTA 3Q65A 5FSDC 2BXYA 3UCDA 4X61A 1QVBA 4JTGA 1GEHA 1AD1A 2ZADA 3P61A 1TJRA 1GOMA 1E1CA 3V5OA 3BLEA 2FHBA 1A5UA 4F66A 3ABXA 1P0BA 4YTTA 3LDVA 3LPFA 4RNHA 4M24A 3DAQA 3ANVA 2AKZA 3EOEA 1JZ6A 1I1XA 3B8UA 2CYGA 3WBEA 4QCEA 1FCQA 2AL2A 3GXNA 4LS0A 1C29A 2Z0IA 3K5XA 5C6MA 3E2RA 1XD0A 1B3VA 4NUWA 5LA1A 3KP0A 3TIMA 1Y7VA 4JZ5A 3WNPA 3BWWA 4IIBA 1XYAA 4K38A 5D03A 2UY3A 4ADUA 3CV1A 4ZSTA 3P82A 2ZA1A 4RZ6A 3P0XA 4GNVA 1L2UA 3NO3A 2UV8G 3POHA 4L56A 1ISXA 3WQGA 3RO6A 2YDRA 3M0ZA 1FH8A 4Z2HA 2ALRA 2JBMA 4OUEA 1RVGA 2EEXA 3LPGA 4H9TA 1Y5WA 1IIHA 3AI0A 2CBUA 4AY1A 3W7JA 1B5TA 1P6BA 4Z1AA 2VCBA 3COTA 1EUNA 1AJ0A 1FWDC 3G77A 1QATA 1M3UA 2VC9A 3QYQA 4R53A 1SO3A 3HZ3A 2ZYFA 4O1FA 1WUEA 2C1HA 5DY3A 4IICA 4KF1A 4CUCA 3PZUA 5LYRA 1BGGA 5REQB 5AKQA 5TIMA 1H4PA 2DVUA 3M64A 4XD4A 1A5OC 3TV8A 1CLKA 4A29A 2ZUSA 5H91A 3I6EA 3QLDA 3IV8A 4RDWA 3LA4A 4XTDA 5DEZA 1OG6A 4RE4A 2EGZA 2WHMA 3CMFA 2YCIX 3B9AA 1CXEA 2V2CA 3I3DA 3PZQA 4DNMA 1W1A1 5H8UA 4D8ZA 5AC6A 1T99A 4PEKA 2RDWA 4GJIA 1PTAA 4AX6A 3EWZA 2R94A 6A3HA 4KKXA 1VEOA 3PANA 4I8DA 4E3TA 4US5A 4LRSA 3WQ5A 1QPOA 3N2MA 3MHFA 4UOJA 3HV9A 1QTWA 4Q8NA 1ICQA 1UH4A 3BURA 1EFZA 2POTA 1VQTA 1E55A 5E70A 3IGSA 3N14A 1ODZA 3L4UA 1DHPA 2Q71A 1UP0A 5IDZA 3OHIA 1D3CA 1F2JA 2ANUA 3QZEA 4HN8A 5HA7A 4GC4A 4BHYA 4WLCA 1QPRA 2VUYA 4ICNA 3V5FA 1YTDA 1TO3A 1W2PA 2CU0A 3INPA 2ZRZA 4RLIA 2FMNA 4GKLA 2XN0A 1MUMA 1X38A 3NQGA 3UXAA 1JZ5A 4C1LA 2V67A 5CGQA 3GU1A 1O1HA 4H4IA 4PMJA 1B90A 1XLDA 2X1UA 4K1GA 2Y2WA 1POJA 2G3MA 2CLKA 3QY8A 4PUEA 4K1WA 3U2ZA 1TYGA 4MJ2A 4JY9A 2YL9A 1B2YA 1Q66A 3DI1A 5H8MA 2VD9A 5EKYA 1XIFA 3O6DA 3IGUA 4KS0A 3RF9A 1PE1A 2BHUA 3A12A 3Q37A 1I8JA 5HMFA 2J27A 4NZ3A 3MSRA 5I06A 3SRHA 3K4AA 2FJUB 3AYRA 3WH9A 3CIWA 1EC9A 1TV3A 1FVPA 2PDGA 3QM3A 1IZJA 3IJQA 3LYEA 4GXWA 2NUWA 1H1NA 2G50A 1UP3A 4H6QA 3BXWA 1C8YA 3GNRA 1IEVA 1VBRA 2ZOXA 3ABZA 5FEXA 2VDHA 4Q4OA 4DEFA 1GVYA 1W5PA 1F3XA 1O95A 2BVDA 4ORMA 1LBMA 1SYTA 4JTKA 2WPBA 3T2OA 4IMCA 3UZ5A 5LZLA 1HTIA 5JU6A 1X1NA 3GFZA 2XFWA 1PZ0A 2WSQA 5EGRA 5FF2A 4IUOA 4JIEA 1Q13A 5C7VA 4Q8TA 2ZIDA 2PWUA 4LY4A 3WSUA 3WQ8A 4KQNA 1GJUA 3GVQA 3P81A 1PWMA 5F4WA 2VTFA 3HPXA 1OFQA 4UR8A 4V2XA 1QW8A 1VB9A 3HJZA 3W01A 1Q6CA 3ATYA 1EJXC 3IIXA 2YDSA 3TN3A 1UWUA 1WZMA 2Y7GA 4RR4A 4NL1A 2ONEA 4W7WA 4NIRA 4HHMA 1EJTC 1OC7A 1IXNA 3STCA 2WSKA 5E0CA 2A1YA 3QV7A 4H2HA 4Z2KA 3K8LA 3R8GA 1JULA 2FHFA 1ITXA 2P50A 1YE4A 4JIRA 3Q2DA 1DJQA 2R14A 3LQGA 3F5LA 3CYVA 5G2HA 2OSWA 2XWDA 4IL0A 2IUZA 3O6CA 3FVMA 2CW6A 2NW0A 4TMCA 4N6EA 2HK1A 5FJRA 5MF5A 4PCNA 2BSLA 3KX6A 1WKDA 4JDYA 5IRPA 4GLEA 2DY3A 3TYCA 4FX6M 3BQ5A 3BLPX 1JPMA 3WD4A 3S2LA 1UWSA 4WY0B 3TWBA 4QR6A 2DZTA 2IPFA 3BG5A 5BRBA 3VNJA 1GHSA 5DXYA 5HNNA 3LHTA 1VENA 5HJYA 2PI6A 2XSXA 1H0GA 4A21A 2ZTKA 4J2MA 1NDWA 1V0MA 2DIKA 1K9TA 1LORA 4L9ZA 1TPC1 2PRHA 1RCXB 2VX5A 5B80A 1O6IA 3BAKA 5CC6A 1IYXA 3S1GA 3L0GA 4JEJA 2QDGA 4RL3A 1KD0A 3A4XA 3NYZA 1FA2A 2QCDB 4GYKA 4D71A 3RHGA 1GYMA 1OG0A 3NOYA 4M7SA 3VMOA 5CJMA 2WHLA 1W1IE 2I16A 2TPSA 3CPRA 1QNPA 1Z41A 1SFSA 2QJIA 2ZE3A 3AYTA 4MZ1A 3GG0A 2ZZ2A 4JDBA 1MRAA 4JTRA 2ATMA 3IS4A 3KOZA 5C5YA 3T42A 1C9WA 1DTUA 1TTQA 3VE7A 3GUWA 4GJJA 2VEGA 2VRKA 3UWVA 3KVMA 3GXTA 2IKJA 2SFPA 3AHYA 4EKJA 4IWWA 5CC3A 3KRZA 1OX5A 2R91A 3H7UA 3HIJA 2ZXDA 4ZOBA 5JH1A 3T0DA 1GZGA 1FXPA 3SFWA 1YKWA 1K9DA 4HTBA 2WZIA 2YB1A 5A94A 2VT0A 2WMHA 3QQWA 4I5RA 3KOYA 4C7FA 3TROA 1IGWA 5BOEA 1QOXA 4TVUA 4GG9A 2FB2A 1HW6A 5HJXA 4QAWA 3G3DA 3UY7A 5HMDA 1DV7A 4OBSA 5FACA 4ADSA 3IAPA 3EX3A 3H54A 1MW1A 4RKAA 2OO0A 5EFFA 1XLHA 1V03A 1PS9A 5C8BB 1Z6KA 4QAIA 4XG1A 2UY4A 5A6KA 4Y9NA 1E9LA 3NQBA 3N12A 4V1XA 1XUUA 1Z7AA 3FA4A 4MPKA 2PU1A 1XYCA 2QF8A 1X6UA 3ZT5A 4XIAA 3NSMA 1TPB1 5HXMA 3ITGA 3HG2A 3MI6A 8CGTA 1JZ4A 1SFTA 1VGAA 2BMBA 5BNKA 3TQVA 5KSWA 4ML4A 3S0CA 4GZEA 4ACZA 4F3HA 4XVDA 3RCYA 4IJBA 2VQUA 3H70A 1NOUA 1A3HA 3N4FA 3TN5A 4DQWA 2I1OA 5XINA 4Z2LA 2YPIA 3LCHA 2GVEA 1JDDA 1QNSA 2XZ7A 3WUEA 4J3TA 4AWEA 2W5FA 4NJJA 3RCNA 3VVGA 1KTBA 1PUDA 4O0KA 1CDGA 3ZYZA 3LB0A 3NUKA 3WD2A 2VX4A 1EWEA 1LWJA 1ECEA 2VM8A 1XF0A 3ISIX 1E5JA 3MSDA 3PP7A 3NZGA 2DUZA 1KFEA 4FLOA 3QMTA 2PC8A 3VKKA 5ECVA 4P2VA 2VGIA 4GX8A 1XGEA 2VFIA 4H9XA 4C1NA 4I9MA 1ZBWA 3V4BA 1E0VA 3A13A 2PU0A 4H7ZA 3FNDA 3MHGA 4JN7A 4Z1CA 1JZ2A 2EJ1A 1JYWA 4AD2A 4Q8QA 4QBXA 1ZJAA 5EMKA 4ZB5A 5BRQA 4ZOCA 4ZGYA 2ZDSA 1SJDA 1KCKA 5CPLA 3SRFA 1YHTA 3UA3A 1G6CA 2GPTA 4IXXA 4PBGA 3HTWA 3RDKA 4UTHA 5EL1A 2E40A 3VC5A 5GPRA 3R10A 2TRSA 2YCEA 4UXDA 4O8RA 4P7QA 4NU7A 1GOWA 4P5UA 2XU2A 4LAMA 2ZUMA 3UBPC 4KCTA 3UVAA 4AIEA 4A35A 3PJXA 1PVNA 3AFBA 1E51A 1MRQA 2G97A 3AQUA 3NQ6A 1KM3A 4MUPA 3B8DA 3ARRA 3UJ2A 1MW2A 1K8XA 5JBFA 4JKMA 2HCVA 3ATZA 4J3WA 1ONXA 4UB9A 2J75A 1FWNA 4LVGA 3RX3A 2D2OA 4PFHA 1I45A 1VCVA 5TF0A 3BANA 1L2QA 1VPXA 1O94A 1V6VA 2DU2A 3IGXA 2WJEA 2HTMA 2CWXA 3PBVA 2AKMA 4KRTA 5JXQA 3VOIA 3GB6A 4M19A 5C9RA 3ARZA 3OHMB 3LBCA 2XG9A 2CLLA 3QHMA 4AZGA 1F6PA 3DX5A 4L64A 4YLWA 1QNVA 4B92A 3UZJA 3BCDA 3R0KA 3FDKA 5BOOA 3BOFA 1L9WA 5CGMA 4DELA 4KCUA 3LU2A 3WZ0E 1JUEA 4JOMA 4WVXA 4KMQA 3ES7A 3TKFA 3JZEA 8XIAA 2GFTA 2DT3A 1C93A 3ECQA 2W61A 4F0HA 4BS0A 4GY1A 4NAFB 2XUCA 4CEUC 5I23A 1AMKA 4KERA 2A7RA 4O1AA 3I68A 5I02A 4UOZA 4CD8A 3WENA 4DBUA 4DUWA 4WOZA 1VLWA 2PLJA 2C91A 3SCUA 4LOCA 3PZNA 1H60A 4AIOA 1US3A 1R86A 5E0KA 3NQ8A 3CO4A 2OLAA 2C18A 4GMEA 1WYIA 2PDQA 1RH9A 2OX1A 2QCDA 3E2VA 4WZHA 3VNIA 5L6UA 4FS9A 4UCFA 4K8EA 4XZLX 2R1MA 2DSWA 4C5YA 1GG1A 3S2MA 3OZMA 2BGQA 1UD5A 5HUOA 1SZGA 1SR9A 2ZXBA 1YE6A 3EDKA 4IQDA 4AF0A 5FD0A 2VP8A 3UNDA 3LSCA 4MNMA 4H6RA 5A8PA 3THCA 3T78A 1FWFC 1K4HA 1TMQA 1EP3A 3UEQA 1AD4A 2PC4A 1TRIA 1B3XA 1CXIA 4UC5A 3WK3A 4M6UA 5KZMA 1M03A 4XAZA 1JPDX 3WKZA 3MMTA 2QNEA 1ZHAA 3VDBA 5CQ1A 1HJVA 1W32A 4JTHA 3WDHA 3A6OA 4IXHA 4GI6A 1GQIA 1GTHA 1ZS2A 1C3FA 4NZCA 2BX7A 2CFFA 1RD5A 4XZNX 2HVNA 4AF0B 3PBGA 4G5DA 1UKOA 1J79A 4B4HA 1NFPA 2D73A 2OLHA 4A8IA 4ZZ9A 1UZ4A 5DFAA 4PBFA 4YS1A 1WXYA 4A6GA 1YNYA 2G8ZA 1UROA 5GJNA 5HMEA 3B03A 4HU4A 3VIFA 3RYSA 4QQUA 1JF6A 4YXGA 1OQFA 1FBAA 3N2CA 1MUWA 1WOAA 2JEPA 2Y61A 4Q3MA 2VDIA 4RXGA 5HATA 1A5CA 1E9YB 3UGVA 1D8CA 1CWYA 2QVHA 2YZ5A 4XB3A 3AC0A 3GNXA 1OCBA 4AXNA 3CS2A 4JFVA 3M0JA 1ALDA 3CNYA 1Q7ZA 4PYSA 3AU6A 4D9PA 3RR1A 1W91A 1OADA 2J8FA 3MO7A 4FNQA 1T7LA 5AYIA 2TODA 1CI1A 2WNNA 1XW8A 3BJSA 2ZA2A 1THFD 3B0XA 1WDPA 4JFSA 4Y8EA 5C2XA 5D37A 2WSRA 4ICCX 3A4WA 2YXOA 2WMKA 2XIIA 1OZQA 3V18A 3T07A 1FHUA 4W7VA 1ZLPA 2V3GA 4F9DA 4FX7A 3F4VA 1HL8A 4AEEA 5FSEC 1C7TA 4QE4A 4ECLA 1HJXA 1VFMA 1W3LA 1B9ZA 2BBFA 4ZOEA 2X1SA 3P84A 1SZNA 4DF2A 2PP1A 2A7PA 1IHIA 1H63A 3TN4A 5ABTA 1C8XA 4K36A 1NFBA 4F0SA 4A3YA 4CCDA 4MYXA 3FCPA 2DZSA 4PZVA 1AH4A 1KGUA 4Y9MA 3SGZA 2A5HA 3PZIA 5IHRA 1HIZA 5A6TC 2X41A 1QK2A 4B3KA 2E68A 8XIMA 2FVLA 3QV6A 1WZKA 2E4TA 4LX4A 2A6NA 3TW6A 1SGJA 1E40A 1V0KA 2ZZ7A 3GXFA 2VEFA 3WLOA 1FP9A 3ARUA 1BXBA 4WGHA 3V7PA 3EDEA 5K9XA 1TPDA 5K2ZA 3LRLA 3WEZA 1E4IA 3EX6A 4AZ6A 2ZE0A 4GH3A 1U1UA 3DYPA 4BA0A 2RJHA 3OLDA 4J9JA 3WBAA 2H9AA 3PS7A 3TR9A 1OEPA 3HN3A 1YBQA 3OGVA 4JTFA 1KKOA 1MW0A 1FWEC 1G9HA 2YFOA 1GEQA 1KTNA 1NWSA 3A3HA 1TWSA 1XPGA 3WQVA 1XYZA 4NZFA 1HVQA 1G4SA 1PX4A 3DECA 5A6BA 3FKKA 1JRCA 6CGTA 4B5TA 3VI2A 1Z3NA 1EA0A 3W1XA 4L9XA 1A3WA 2QCLA 3V75A 2CLOA 1UKQA 3EWCA 3VDHA 3W82A 2Y7FA 1YW1A 3DOPA 2HVMA 3UT0A 1D8WA 3ZT7A 5HUPA 2ON3A 5DMLA 4DO6A 3GBEA 3WNMA 3IJDA 3LMZA 3DESA 4HMCA 5E1QA 1E9ZB 3LLFA 2VOTA 2PCQA 4X2RA 3THAA 4YCOA 1FWJC 3H24A 3ALFA 3RLHA 2BS9A 5HR7A 3VDCA 4YWSA 5C0QA 2WKGA 1CXKA 5ABGA 2YZRA 1KC7A 2BODX 4KBXA 3GYEA 4QROA 1E72M 4MPQA 2VEPA 3KM8A 1QASA 2XGBA 1ZJBA 3GR7A 3T1GA 2NLYA 4BWLA 5A69A 5G4WA 4MAZA 3LRKA 4Q7NA 1VIZA 2FGZA 1TWWA 1XC4A 1EA9C 2XIOA 2XIJA 4TX9A 4F2BA 1V3KA 4XZMX 1XLLA 1ZJIA 4C6JA 1UMYA 2HRWA 2NZLA 1W3TA 5D38A 4ZSUA 4O1CA 4GO8A 4CN4A 2IXUA 3MSYA 2J66A 3MKCA 1B30A 2XIQA 3NA8A 3M6DA 3C2VA 1KFWA 3L5AA 2FIQA 4L5ZA 1GKPA 1XIIA 2NQLA 3CBWA 1M1BA 2C3ZA 3R79A 4AZ5A 3M0XA 1BEUA 2J9YA 1K1DA 2J25A 4OV9A 5F2GA 3NCOA 1S39A 1BWVA 3RM8A 5DANA 1PV8A 3LY0A 4U3AA 2I9UA 4UTTC 3W7LA 2PZNA 2PDJA 2L5HA 3WBYA 2P5NA 3WF2A 5I3KA 4PCSA 4FX8A 1OGBA 3NR0A 2QW5A 4A2SA 3MPGA 1MXDA 2WMIA 1UR3M 4XAPA 2BHZA 4X0NA 2H9AB 4UQEA 3LPPA 4JTLA 3I65A 2GSEA 4O17A 3RRXA 3W7IA 1JQVA 3ZOAA 4R27A 1H1YA 5T9CE 4GNKB 3AUJA 4BI7A 1Z69A 1XUZA 5BRPA 2EF9A 1VFOA 3C86A 4KH2A 5D02A 1EGMA 4F8XA 4FK9A 2P88A 3GQYA 4I7VA 4HCHA 1R3SA 3DFHA 4YPJA 4LFYA 1NEYA 4LAKA 4PB5A 3WF1A 3I4KA 3OBKA 3JU2A 4FF5A 1XR2A 3O1NA 1NWUA 1OF6A 1VFHA 2BVYA 4L1GA 2EXOA 3GH7A 3KL3A 3P80A 4MLJA 2CZVA 4S1FA 1F9CA 4NI3A 3CIVA 1AZ2A 2Y70A 1HKJA 3S1VA 5GNXA 3IUIA 4XISA 2FDMA 1HXJA 1WDRA 3FX4A 1YDYA 3CZGA 3TTYA 3UFYA 3CAKA 4JKLA 2CXGA 2YW3A 1ELSA 4LUYA 4JX5A 1UHVA 1VS1A 1IZKA 1E73M 1VYSX 1Q7QA 1KCXA 3W84A 3SO7A 2WZTA 5I3HA 1GZ1A 5AZ0A 1RSCA 4N6FA 3N3TA 4PL1A 3QRHA 1PHQA 4Q4PA 2XWEA 3KS6A 4CQCA 1FWRA 1P43A 3WQEA 3LCWA 1BVWA 3APTA 5I78A 3OP2A 1D7FA 4LV9A 1M7OA 4OBRA 2WKJA 3QZ6A 1UUOA 2O7QA 3LXCA 2C19A 3URBA 3FA5A 1OM0A 5EMMA 4EPEC 4HSHA 4IMEA 1VRDA 5CBIA 1M53A 3AHXA 3R6IA 2XN2A 3B9DA 4E2BA 3A4AA 4HSNA 4NT0A 4AH7A 5LIWX 4XZHA 1UR9A 4JYDA 3VZXA 3U9IA 4H7CA 3PZ9A 3AICA 1A5LC 2DZPA 3S5NA 3WJWA 3K8MA 3S6TA 3W25A 1K6AA 4V1YA 3LUTA 3TLQA 3CUFA 3NQCA 5CLWA 3L4ZA 1GHRA 4IFKB 4LT9A 1A80A 3TSMA 5C2CA 3KXQA 1EB3A 2VZSA 4M7TA 2EKCA 2X40A 2HQAA 4OKDA 3UF9A 3V3WA 4A3RA 1V0NA 2Z2BA 2IKHA 1IEWA 3QHNA 4MFEA 4XO6A 1QNOA 1R9YA 3NL5A 1EJUC 1O7AA 3R2GA 3SUTA 3U2CA 2DJLA 1IXPA 3SCSA 4BJHA 1ITUA 2XGIA 3RRAA 1J0HA 2C16A 3VO0A 3MMDA 3EWBX 3PZTA 5KETA 3TAKA 1SO4A 2V82A 4N9EA 3V1HA 4NYUA 4ILSA 3T0TA 3BZJA 1UMLA 4IT1A 3HBLA 3LLXA 2PDBA 1QRQA 1ZB5A 3URAA 3O2LA 3OQEA 2ZC1A 1EGZA 1TVNA 3U5YA 3XIMA 1M9HA 1X6NA 2JFEX 3VMPA 3MUXA 1G69A 4PE8A 4WQ6A 4Y7EA 3WJSA 3PTDA 3GIYA 1QI0A 1LLOA 9XIMA 5IHSA 1EC8A 3UPWA 2FGBA 3UW6A 7ENLA 3S2CA 1K7XA 2Z2AA 4XSLA 4UQAA 3AZRA 1BF2A 3UXDA 3VNLA 2HDJA 2JIWA 4O1DA 1KBKA 3GNNA 2E8YA 3EXTA 4DLFA 2OODA 3ELFA 2NXGA 1JIBA 1W9DM 4B5SA 1IGSA 4GCAA 3ITOA 3CL6A 3QY6A 1Z48A 3N4EA 2OSYA 3CC1A 3GS6A 1OT2A 4JL1A 1XC6A 4O13A 5FA5A 5BWFA 2W91A 2P10A 3PFRA 3PJUA 2INZA 4L4LA 3EWYA 3GBDA 3HMCA 1K3UA 2OZTA 1RBAA 3PWAA 4IHCA 5A6SA 4N4QA 1BYCA 4DUXA 1QDSA 1HJUA 3DI0A 4D6HA 1E15A 3T0CA 3W7RA 3F4DA 2WSPA 4XAGA 1FXQA 1OY0A 1BRLA 2VELA 5HINA 3P74A 1AQHA 3OIXA 2OYMA 1Z42A 2WC3A 1E6PA 2XHYA 4H8UA 3MP4A 3M16A 3M7WA 1OBAA 1UOZA 2WBKA 1R2RA 1PJ9A 2WJFA 3BAJA 1HJQA 3EXSA 1KFLA 4A2RA 3GKAA 3PZOA 3P62A 3S42A 4EACA 3KFTA 1I1WA 3L4TA 4UFLA 3OYXA 1AA1B 4L1XA 1AJZA 3H2CA 3H2FA 3MVIA 3N2XA 4C7DA 2BFGA 5MKGA 3AJXA 1E71M 3W6LA 4K6AA 2QT3A 3W2NA 4C6CA 4GI9A 3TYUA 3FJ4A 4ROQA 3EPNA 3DU0A 2ABAA 2VJXA 4DO4A 1WKFA 3LN3A 4MWAB 1CEOA 3LGEA 3AMDA 1Q8JA 3REQB 1XIGA 4OJYA 4HNTA 4KFNA 4B9YA 4HA4A 2ZQ0A 4C90A 3TW9A 1GQNA 3BTNA 3PG9A 3IIPA 5FJTA 5TBOA 3HJEA 4LF1A 5DLCA 5M2FX 1K7EA 1OIMA 3UD6A 5AVHA 1JCMP 2W63A 1MZRA 4QGCA 3NQFA 4DAFA 2VR5A 5GQBA 3WDIA 5FJIA 4ACYA 2NLIA 2A3LA 4D8LA 4EK7A 2QZRA 3P93A 4WHBA 3BJFA 4RDZA 3GUGA 4MFDA 1QOQA 3BCJA 6REQA 1LP6A 2CBVA 2DUXA 2XN1A 3UU0A 4QM1A 3M43A 4QIUA 4IGHA 3C8NA 1RUSA 2QGHA 2OJPA 1AG1O 4HPGA 2FKPA 3NGFA 3GM8A 1TELA 4YHEA 4NJKA 4C1NB 2EPNA 1ESWA 4DI9A 5A95A 1F6KA 4CD5A 2DW6A 4M51A 3UWYA 4O1BA 4ZTXA 1XYMA 4NYYA 1OK4A 4F79A 3WY1A 1QHPA 5LSMA 1UC5A 1FWBC 3KRBA 4GQBA 3WDQA 3F2DA 3KL5A 1TV8A 2XIBA 3MV01 3U2OA 2PRMA 4BQ5A 4ICMA 2DP3A 3ID7A 4ZXOA 1KRMA 4KEUA 2VUNA 3CZ8A 2XVLA 4M1BA 3H7RA 1OINA 3QTPA 5EBUA 1T8QA 3M5ZA 1DWAM 1SMAA 2P1FA 3PZMA 2QJMA 4K3ZA 3TTOA 1BVNP 1ICSA 1P5BA 4U5IA 1P6WA 1W31A 2EPOA 3WK0A 2WCGA 2FH8A 4DBSA 4GIRA 4NY2A 1F05A 3ZVHA 4GZIA 1ZRQA 2OEMA 3TW7A 3S5OA 3D47A 4AC1X 3W81A 3UA4A 4HKPA 3AXIA 4DJDA 1F07A 1SZRA 3VGHA 3B8WA 1A5AA 2X7WA 4W85A 4Z2GA 1DXFA 1HL9A 6REQB 4MNKA 1ZU8A 3LCFA 3QFEA 3RITA 2J7BA 2V5JA 1JCJA 1DHKA 2PGEA 5HWJA 1G4TA 3NM3A 2VDGA 3KVKA 3LX9A 5AYXA 4RE0A 4WKHA 2FZNA 5D32A 1I75A 1XFCA 5I2UA 1C7SA 4J27A 1M7JA 4U4MA 5B7YA 9XIAA 3W1NA 4C6BA 2DIEA 3SCVA 4GUFA 2DQXA 2POZA 2JKPA 1EDGA 3VKBA 4W8LA 2PDMA 5A6JA 3W7CA 5B7ZA 1N55A 3CV2A 3UG4A 4ZENA 1UZ1A 1RQHA 2XSAA 3NQ7A 1E1EA 4QE1A 2PODA 3DGBA 1UWQA 5FAJA 4TV6A 1J4EA 4E8DA 3BQ6A 3LI1A 5FJPA 2VHLA 1CGTA 4CLMA 4O18A 1XJBA 4H1ZA 3TXZA 3L7RA 4HPXA 1VZWA 3OGSA 3F2BA 2I5QA 4ZXLA 1JCYA 4PCTA 2GGEA 3W1RA 3W7HA 4B3ZA 4EAMA 3CL7A 1Z89A 3NPWA 4J28A 4ZQNA 2FGLA 3NPVA 3BVJA 1OT1A 1ZBCA 4MB1A 5E09A 5LXEA 3PF3A 4IX2A 5A6BD 2G5WA 4JCLA 2Z1BA 1U1JA 2HEJA 3UJEA 3LLDA 2PWEA 4GISA 5J5RA 4LNCA 3T08A 3UPBA 2DIJA 1M7PA 4ZQPA 4O52A 4GNJA 3VOGA 4F0MA 3VKCA 3H21A 4GINA 3NXFA 5AHIA 7TAAA 2C1GA 1HGYA 2VXNA 3KBWA 1KM4A 3UG8A 2HPMA 3EZ4A 3MCOA 1FHDA 1FWAC 1H0IA 1V93A 1PO9A 4GD0A 2O4QA 3VDAA 4DBWA 3QJAA 1HJWA 4LYQA 4PMOA 3TDFA 2Q01A 3TYBA 2J47A 1Q63A 4JYEA 3C0QA 4EX4A 3VD5A 4QG6A 1OFEA 5D2TA 1FDZA 1UH3A 1EH9A 1I2RA 5HNRA 3H4WA 3UR2A 3W23A 3GDBA 3EKZA 4HMNA 3J7HA 1TCDA 2Q02A 3R0DA 3UESA 4RDVA 1EPVA 2D23A 3ZIZA 2X7VA 4MDOA 3C0LA 4BR1A 1VJZA 5M03A 1F73A 4BQ2A 3SQSA 4CNPA 5CCZA 4UTWC 5A8NA 3V0TA 2Y6ZA 1PZ2A 1N8WA 3GXPA 5A2AA 1L6YA 3OIHA 3QSTA 3SUUA 4DJDC 4GVIA 3W2KA 1AZ1A 5JIPA 4CD6A 1QUMA 1FDYA 1XX1A 4J40A 3RX2A 4F9JA 2XJ7A 3SURA 2F2KA 3IAQA 1UKTA 3ITXA 1CBGA 1CGYA 3NSNA 6ALDA 1LL7A 2WK2A 2QCMA 4GXPA 4W9TA 1ZALA 1XFBA 2QPUA 1J10A 2WW5A 1AUSL 3O07A 3LCGA 1JCNA 4FNPA 2Y0FA 1ZCOA 2DEPA 5T91A 4EXQA 4WCJA 1XXXA 4RV3A 5CSSA 1JXKA 4RV8A 3NO5A 1EGVA 1EZWA 1CTNA 4GKTA 3F4CA 1GVFA 3P3BA 3KS5A 3FSTA 2PD5A 6XIAA 2CLHA 1RY8A 2FPVA 3DFPA 5CZJA 5FF7A 5EBAA 2QDDA 1FTXA 4RUBA 3WLMA 3S8HA 4N9CA 3LPOA 2H3BA 4KWSA 1VEMA 1Z44A 2G3NA 4D6JA 4X0VA 3VOJA 2MUCA 5A6MA 4CNUA 1KB3A 4HVXA 2CZ5A 2YCLA 2I17A 2NQHA 3KTSA 3GTFA 3CQ0A 3AXHA 1KV5A 1ME9A 3RLVA 4HB7A 1JDEA 1LBLA 3OOQA 1XLEA 1ZPTA 1W17A 3QF0A 2A3HA 3T9PA 3H53A 4PUJA 2REQB 4ZFCA 4L4PA 4TVCA 3UP8A 3RG6A 4I5XA 4O19A 1RR2A 3I6RA 1R3YA 2J88A 1LTDA 1P6CA 1ZL1A 4FALA 4QG8A 3T7VA 3POCA 1HN1A 1VPYA 2XH7A 4REQB 1ONRA 4AZBA 2JF6A 4MVAA 3HU7A 4AISA 1UR0A 3HO8A 1CGVA 3V16A 3W26A 4WRHA 2QIWA 3LZ5A 2JF7A 2O92A 5LIKX 1DJZA 4Y6GA 2XFFA 3H6OA 1EHNA 3NDZA 3GD6A 1ITQA 3MTWA 1BG4A 1ISWA 3NZQA 3EDJA 3VZYA 2RAGA 4JTAA 4LGXA 3USZA 1MDRA 1A4LA 1UD2A 2VFFA 2VVNA 1EO7A 3TJLA 4I7UA 5I0DA 2DSZA 4UR7A 4S3JA 1MFUA 2XH0A 4QJ4B 2UZ9A 1MW3A 4LTSA 1FWCC 1XBYA 4IGNA 5AYBA 2PFHA 4WD0A 2IQTA 1DBTA 4CVUA 4UQ9A 4F0KA 4B5VA 3V0SA 4OE7A 1VCFA 4B5NA 4HNVA 1QPKA 4UZSA 4MAVA 4M29A 4M81A 2OU4A 3AS3A 1BG9A 3N04A 2BOGX 3W71A 1BSLA 3KHJA 2DPEA 1JCTA 1LLZA 3ZJ7A 1S5NA 1OYBA 1O68A 3L66A 5CPTA 1A53A 2VD8A 3BW2A 5FF3A 1JR1A 3I3EA 3G1XA 5AYZA 2EPLX 2ICSA 4GVGA 1TE6A 3E12A 2CNCA 4RE3A 4TTUA 4XZ9A 1LOQA 2X0YA 3AYSA 4GPNA 3LG3A 1C91A 5CZSA 4GA8A 4M80A 1OD0A 3W3OA 1UPMB 3H2EA 1TQXA 1QU4A 1W9XA 5LA2A 3OLGA 5JVLA 2DH3A 2WNQA 4KCVA 4XD5A 1EBHA 1HKVA 3PWGA 3PJTA 4UMCA 5H1WA 2DZXA 1CXLA 3PSVA 4DBDA 4LXFA 3R94A 3RMJA 1UD6A 2EG8A 1S2VA 4DBEA 5IOBA 4PCFA 4NZ4A 4G7EA 9CGTA 3M9YA 2PLKA 5HANA 2VMFA 1JCXA 1F4HA 2QAPA 3FXYA 4ATLA 2X1TA 2YW4A 2WXDM 3VDGA 1DQXA 2FTPA 3MSGA 5BCAA 4X9SA 1Q65A 4TQTA 3Q67A 3R5EA 4QSFA 3CYJA 4IPNB 4NP7A 1JQXA 2X0HA 3W76A 4BEUA 2PA6A 3W72A 2V81A 2OQHA 2HVOA 1K8ZA 5FEZA 3KBMA 4FR6A 2I56A 4NRRA 1EJSC 3USBA 1W1ZA 3N29A 4NNBA 4AZCB 3EPMA 1TTJA 3UGRA 3UETA 4O57A 2QUMA 4UQBA 5LNVA 2BLEA 1TIWA 2V3EA 5H2ZA 2YBVA 1RV8A 3S47A 1MSSA 3GU2A 4LBRA 4XZWA 4CKQA 2WNWA 1D3GA 2Z1KA 2ISSA 5I3FA 4Q4RA 1GYLA 4CU6A 3UY8A 3GXMA 4W7UA 4QLLA 2ADAA 2OQLA 1JJKA 2Y1HA 4QLKA 4PN2A 1R2SA 1NQ6A 1T5AA 1Z32X 2TYSA 3UWQA 2EG6A 1CYGA 1YXCA 5BMWA 2GQAA 3O3RA 5CLTA 1K02A 2DSUA 3IRSA 1ZP4A 4LB4A 4XBSA 5AHMA 1KM1A 1CGWA 5BROA 2PPGA 3FGCB 4EXBA 5M5DA 4ZQCA 3NNTA 1IXQA 2BXZA 2C79A 3QY7A 2C71A 2AQVA 4HZMA 4RW5A 4AZCA 1NJJA 1UC4A 2ZRWA 2WANA 5HK4A 4GCXA 4LUTB 2E0PA 1Q4NX 1S2WA 3NQAA 1TUFA 4EWJA 3L2IA 3NURA 3KAOA 1XQLA 3FKRA 4G6CA 3GC2A 1PWLA 3PSWA 1P0KA 1V08A 3GU9A 3NL6A 1J0YA 3G22A 4ZODA 1TUXA 2RKXA 3TCSA 1DJXA 5I3GA 1V6XA 1IE7C 4WY0A 4D6CA 4YMZA 2Z1XA 3B4YA 4CN1A 3W7QA 1R7AA 5HDRA 4DZIA 3PC0A 1ISVA 3II1A 1PDZA 3FHQA 1TWZA 2XIMA 4H01A 4JGDA 4LYKA 4P7LA 4Q6JA 5CPNA 4BEQA 1ISYA 3MC5A 2NSOA 1XLCA 1ZFJA 4V28A 1FH7A 3R7MA 4H6KA 4B15A 4AW7A 4JPGA 3FK4A 3P67A 4PTDA 2X0SA 4CCZA 3A3WA 3WLSA 1GVRA 5BXSA 3ZSTA 5BW6A 2E1DA 5EFDA 3UYIA 3T40A 5AC7A 3VNDA 2WQDA 1XH2A 3S5ZA 3HQOA 3P6LA 2PCEA 3IIOA 4OT7A 5A1AA 3LHYA 3VGBA 4DX3A 3PVFA 2UBPC 3WF4A 5CAHA 1ZQ5A 2FZMA 2ZX7A 1DL3A 4NJIA 1ZAIA 1V5XA 1V7YA 3TLLA 3N2BA 3E0IA 4UQCA 1K70A 4OWGA 3TMQA 2X42A 1EJRC 1R5YA 4O28A 2R1NA 6PTDA 4DUOA 3W7NA 2BZNA 4F0LA 3VIPA 1OFDA 3QKZA 3OVGA 1IWBA 3S6DA 1A5NC 3GFYA 3TJ4A 4XAYA 2QKFA 4AQLA 3SY8A 4IPJA 4KT2A 4YN5A 4DY1A 5C9WA 3ZVIA 1MYRA 1Q6GA 4UTLA 2OKOA 2ACRA 2HV5A 2F61A 4HJWA 2CZDA 4LH8A 1EO5A 3R89A 4AD0A 1XCFA 3NJ3A 4TTGA 3PB2A 4AC7C 2R1PA 3M0KA 2NV1A 4L4MA 4PA8A 4CNOA 3LERA 5CAKA 4UOQA 2Y8VA 1S5MA 4AHOA 2J7HA 4LCSA 4DNHA 3GZAA 4WR3A 1TWIA 1QI2A 3W1TA 3N9RA 4ZO7A 3A22A 4HK7A 3LHWA 2GGIA 1Y65A 3URNA 1GVQA 2QEZA 4OBTA 1UUQA 2E6YA 3T8LA 4TO8A 1LBFA 1GUVA 1AQ0A 4ZO6A 1JUKA 4EANA 1BHGA 3NXLA 1GOOA 2NUXA 4XSMA 2X8RA 2ZVIA 1SU5A 3CHVA 2BB0A 4HYVA 3SN1A 4DI8A 1L6WA 3EB2A 1KBIA 4NRSA 3RLUA 2ZX9A 1TJPA 4POCA 3AXXA 4KGLA 2ZKMX 3JW7A 1J5TA 1SSDA 3IIZA 4ATDA 1XDMA 2P8CA 4HPJA 2YDQA 1YXYA 1J93A 2OMAA 4A05A 3AIUA 5DELA 3ZSSA 2QAFA 2RGLA 2PMQA 2DT1A 2CIPA 1E6NA 3G2GA 4QHRA 3ZO9A 1TTPA 2PRLA 1KLZA 4XWUA 3O6YX 8RUCA 3PM6A 5F2LA 3WD0A 4AVOA 3W07A 1MNZA 3KVJA 5FJJA 1EC7A 1DXEA 2R9RA 2BY0A 3DHPA 1RP9A 3VUSA 5CSYA 4PODA 1SPQA 3CUZA 4E4PA 4ALDA 2YBTA 2XGZA 1FWTA 2VYOA 4JTSA 5TNVA 3VPLA 2E9LA 1XIHA 2GDVA 2H6RA 3JUGA 2GUBA 2HROA 3WH6A 4N7QA 2OYKA 3VCNA 3CUIA 3FAWA 1TSIA 5LIYX 1UJPA 5J5DA 1J5SA 2D1ZA 4FLRA 2QUNA 3M6YA 3W00A 3WLKX 3WF0A 2ZBTA 3B8VA 3PY2A 4IX0A 1TV4A 1CT5A 1DWGM 2ESCA 3SW6A 1VH7A 1JRBA 1ZY9A 3PAJA 2QV4A 1YIXA 3H2AA 4AFYA 1EP2A 2C13A 5CSUA 1UUMA 1EYWA 4JQAA 3U2EA 5F1VA 1OX4A 3OG2A 3FOKA 4AAJA 3G6LA 3DCPA 5CZKA 4Q8UA 3KOWA 4B9ZA 2V5KA 3SI9A 4XX6A 3SBFA 3FEQA 2GWGA 1OSEA 2J7FA 3K30A 3P60A 4N02A 2XINA 1WUFA 3VM5A 3S5SA 4FNRA 4GABA 1W6TA 1OYAA 5F2MA 3E2QA 3GIPA 3SSJA 1ICPA 2NXIA 4W93A 2GWNA 3A47A 3GC4A 3WUGA 4E8GA 1V3JA 2XVNA 2HXTA 2ZZ1A 3QMRA 3C4UA 1CLXA 3H4XA 5C9ZA 3MWCA 4Q33A 4AZHA 3DBPA 3E5BA 3JR2A 3QPYA 3MP3A 3CTTA 1US2A 4V33A 4JTEA 3W24A 1RCOB 2P3ZA 4GYPC 5SWUA 4H8HA 1W8GA 2WBGA 2O55A 4JFWA 3WEMA 3MY9A 3N6HA 3GHSA 1TVLA 2BVWA 1VJIA 1ZAHA 2VZVA 4ML9A 4QQ3A 1CW2A 4IQEA 3N4AA 5FOOA 3W37A 1V0LA 3N17A 1XBZA 1ZCCA 4GH1A 2W66A 2NVAA 5BZAA 1WCGA 4E6MA 2B7PA 3OEXA 2G37A 1QWKA 2NX9A 3QFWA 3PUOA 1XISA 1TPFA 3WJXA 4KEMA 3AZSA 4N0RA 1K6WA 4PFMA 1P4CA 1R85A 3A3XA 1P0EA 3UZXA 4H9ZA 4GI4A 2ZWYA 2JEQA 1POKA 3S1UA 1W1YA 2PTZA 1UOKA 3VMNA 3PNUA 1K03A 3L4WA 4LEFA 3GWQA 4XBKA 3OJGA 4UZUA 5GJMA 1XIBA 1GVSA 3CQJA 1OABA 3B05A 4YTRA 5AC8A 1BYDA 1TZ7A 1SR0A 2YDAA 3HGRA 1DJIA 2NV9A 4FHAA 5A6LA 3P2VA 4AMAA 1SFLA 4OGZA 1VHCA 3MI3A 4MZYA 1MQPA 4O53A 4JR5A 4RNIA 4BY3A 1XIEA 4GUGA 2RDUA 3WQWA 1B3ZA 3QN3A 4ZB2A 1GVIA 5DO8A 3M07A 5HQMA 1FCVA 4UFMA 3ERPA 4K2SA 5BU6A 5AYYA 3HG4A 4HSOA 4Z0SA 1W1B1 2E1WA 4IP5A 3BUVA 4LVAA 4WKFA 3MCMA 4P7NA 3TXVA 1EJVC 2WC7A 2Z28A 4YYCA 3NQVA 2R24A 2CHNA 4ZB0A 4DXXA 2V9DA 1I0BA 3I4EA 4ACZB 1CNVA 1G4EA 3AU2A 4A3HA 3NFUA 5AZ1A 2PDHA 3WFAA 5IM51 2NXHA 1FKWA 3GNOA 2RDTA 1LQAA 3B9EA 4CCEA 1TCMA 3GNDA 4AB4A 4U33A 3N11A 4K7VA 4GI8A 4XK2A 1MQQA 1W2VA 2A6LA 1UD4A 1U30A 2GVGA 3CV6A 3N34A 4PB3A 2DSKA 4RPQA 2ZX8A 4QFUA 3QQ0A 5EA9A 1I2PA 3VOHA 1X8CA 3GHUA 1BXCA 4A4AA 3D6NA 1R87A 1P48A 3B8IA 3W9ZA 1E0UA 2ISDA 1KXQA 1ML1A 5FIPA 2PDWA 1AVAA 1L6GA 2ZRUA 3HF3A 3WNKA 4TVDA 4AU0A 1GJWA 3DENA 3SZ8A 1QFEA 1F8MA 3BE7A 4LUSB 2E28A 5IBXC 4MHBA 2X16A 2PS2A 1HKIA 3S4TA 1XSIA 3VFCA 4JTIA 2GGGA 2VURA 4Y90A 3F5JA 4Z08A 1PTGA 4EF9A 3UG3A 1AMYA 3ARWA 2HE5A 2O0TA 3WLTA 3WMSA 1JCLA 3CAVA 4XQ6A 1LG1A 1S1PA 3QSRA 4H04A 4NASA 4DPPA 2GQ3A 1R3VA 1BF6A 3QC0A 3AJ7A 3MYOA 1XH1A 2PDKA 1H2JA 4R85A 4RZ5A 4HTYA 1LROA 4RX0A 4S2CA 4JICA 4DHGA 1UJQA 3UQNA 5FF0A 2DV0A 2RH9A 5DXXA 2TAAA 4QDWA 4BFAA 4JNMA 3VK5A 3I7QA 4DF1A 1ADOA 4C6OA 2V5DA 5DBTA 1VEPA 1TPUA 3L2LA 4CQDA 2NUYA 4O4WA 4FF7A 2WVUA 4U2ZA 1KBLA 1SW3A 3GX9A 3NVDA 4L9YA 1VBUA 1JL8A 1YTKA 2V8ZA 3WJYA 1XLFA 3FEMA 3Q94A 3F4WA 2QS8A 3FYOA 2E09A 1JZ3A 2QPXA 3UWEA 3GG1A 4NVTA 1GOIA 2CZFA 2F9RA 2J79A 2GJXB 3RAOA 5LNWA 2XM2A 4MWAA 2WOQA 2VEKA 3G8RA 2HK0A 1EQPA 4WY0F 5G2WA 2C15A 3W4RA 1REQA 1EEXA 3GTHA 1H7OA 4GUIA 5M1TA 3TYDA 3KCJA 4BKNA 1GQJA 4I9JA 2PB1A 2DT2A 3AMKA 1XIDA 3MCNA 3ONBA 4DYKA 2YX0A 1E0TA 1GJPA 3H8AA 4FP1A 1TG7A 4LWWA 3TFXA 3L9CA 1GTEA 2VNCA 2EJAA 4KRUA 3VIGA 2XVPA 1U5VA 4EIVA 3MMUA 2P76A 3H4GA 2C8NA 4QEEA 4PGLA 3AISA 3ARYA 4NAEA 1QI5A 4DF0A 2Y4SA 2J4GA 1ZTVA 3NWRA 2TMDA 4XAFA 1VFUA 4G7FA 2YXXA 4P61A 5ABHA 4UTKA 3OZYA 3C61A 4ZBCA 1MFVA 1V79A 1WAWA 3R58A 3CWNA 2PWHA 2Q8XA 3DEQA 3G24A 3RUBL 4HJFA 4LC6A 2G96A 3K46A 1AW2A 4E2VA 3G1YA 1EWDA 3MYPA 1LF1A 2CCRA 5E9AA 4C6KA 4AG0A 3ARVA 4GQQA 4V27A 4H6EA 3GAYA 4JYFA 5AHFA 2OR2A 4O14A 2UY5A 4XV0A 1UR4A 4LVFA 4D6EA 3VZZA 3DG3A 3FS2A 5CC5A 4LF2A 2ZRYA 3SADA 1DYSA 5LXXA 4UWMA 1RCQA 3WEOA 2E7FA 4HYRA 3C2EA 5AHEA 4X22A 5E6ZA 1HQTA 5GNYA 3W1QA 3W86A 4DXVA 5D9PA 2YJQA 5CPSA 4HA0A 2IS7A 1X98A 2WJZA 3AXMA 3H2OA 4WF7A 1DORA 5C9XA 4AYGA 3TFCA 5LNRA 3RK8A 4J2PA 3BG9A 3ZWTA 7REQA 3VINA 3LCXA 5CH9A 3BAYA 4AEOA 1F4AA 3FHAA 4GO9A 2OVLA 2C1IA 3TX9A 3VFLA 4ENLA 2B0MA 3UYCA 5DX7A 2B7NA 2R82A 1I60A 4U3CA 2GK1A 5BXPA 3G0UA 1NP2A 1JGIA 1I6NA 4P7OA 3WN6A 2AGTA 3VKDA 1OVDA 5K7JA 3FIGA 2WC4A 3DC0A 3FVDA 3EPOA 4UNLA 3S9IA 3U48A 3CLWA 4HNNA 1Q5MA 3IVUA 3CZJA 1W5NA 3BMVA 3SB0A 1GWJA 3SJNA 3SQMA 1QHZA 3QKEA 5K9CA 1CLVA 4RXFA 3S2JA 1UZHA 2BGNE 2PAJA 5DY2A 1XSJA 4G1KA 3B4UA 4UMBA 4QS6A 4CNTA 4IFRA 3QQ1A 3SAZA 1BFNA 4P8UA 3RPDA 1XL9A 2CLEA 1FWHC 3M7SA 5FJUA 1XLMA 3E74A 2IXVA 3DZ1A 1OK6A 8A3HA 2O9TA 3DC8A 1QT1A 4TOQA 3KTCA 3QOKA 1YDNA 1W9VA 1F76A 3MZ2A 3WLNA 5M17A 1R2TA 1KO0A 3A4JA 3HA1A 3ZJKA 3P5ZA 2GJLA 2X30A 6XIMA 2I14A 1XP3A 4TMBA 3OGRA 2C6QA 4IOTA 4LVBA 1XINA 3CQIA 2WMFA 4YWIA 1KBJA 3CPUA 1DE6A 1PYFA 3WLLA 1Q6QA 3ITLA 3W2MA 3WQ4A 1EIBA 5I5RA 1U83A 4HNOA 1X8FA 3D5HA 3WG6A 6TIMA 3G0SA 4N2YA 1UH2A 1KRCC 3WBWA 1IEXA 4ZQMA 1FWWA 4JTTA 2QCCA 2YL5A 2VX7A 2Y7DA 4EPKA 4Y9PA 5BU9A 1SQ7A 3TYZA 1VF8A 3UZWA 1JAEA 1B4KA 4JTDA 4OUIA 1A3XA 2DUAA 3VA8A 1HX0A 1HP4A 5C7HA 3WFZA 1IZCA 3AIQA 3QH2A 3VNMA 3FDGA 1RQEA 2HBXA