4AF6A

Pea fnr l268v mutant
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
296
structure length
296
Chain Sequence
b'HSKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVYTNDAGEVVKGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGVKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN--NADP REDUCTASE, LEAF ISOZYME, CHLOROPLASTIC
molecule tags Oxidoreductase
source organism Pisum sativum
publication title Structural Backgrounds for the Formation of a Catalytically Competent Complex with Nadp(H) During Hydride Transfer in Ferredoxin-Nadp(+) Reductases.
pubmed doi rcsb
total genus 91
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4af6A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4af6A02
1W35A 2DY1A 4RD4A 2XNJA 2BMWA 1W2BB 2BVNA 2QEXB 1VQKB 1QFJA 5THXA 2BN4A 2HDNB 3WNCA 4ZCMA 3W2FA 5KSWB 2X3UA 3VNVA 4ACBA 1K73D 3QFSA 1S0UA 3J81k 1TUIA 3CPWB 3CCVB 4YHBA 1M1KD 4TMTA 4HE5A 4P3YA 1OGIA 1TLLA 1JJ2B 2GPJA 1QH0A 3G6EB 3AVVA 3MCAA 4BPRA 3OZUA 3QFCA 1E64A 2D74A 1QGYA 4PC1A 1QUEA 3ZBTA 3OZWA 1ELOA 3WNDA 3B82A 1KJZA 1FDRA 3AVWA 3G71B 2PLFA 3W2GA 3CCEB 4U9UA 3G4SB 4B4DA 3VO2A 1AIPA 1J9ZA 2CNDA 4ZGNB 2OTJB 1EP1B 3CCRB 1R5NA 1R5OA 5HXBA 4AC9A 4RD6A 1ZM3A 1TVCA 1VQPB 5JBQA 3CC2B 4PC6A 1QX4A 5H59A 3W5HA 3WNBA 1KK3A 3VMFA 1N0UA 4F7DA 1GVHA 2YWGA 1QFYA 3CB4A 4YAUA 1EP2B 2DCUA 3LVBA 4ZCLA 2QN6A 1FNDA 4M2LA 3CCQB 3CC7B 1VQLB 1DARA 1OGJA 3B78A 4B43A 1DDIA 2BV3A 3OJWA 4G1BA 2C78A 2B7BA 1VQ9B 2FX3A 2OK8A 5TR9A 2BM1A 5GV8A 1Q81D 4RD0A 1A8PA 1N0VC 1BX1A 3ZZ0A 2QDXA 2VNJA 1CQXA 1I7PA 1YITB 2B5OA 1G7TA 2ZITA 3CMEB 1DG1G 1H85A 4PGOA 4IW3B 3CD6B 4MYTA 1IB0A 3I1FA 1YJWB 3V76A 1KTVA 1YI2B 1JA0A 2QA4B 4B47A 1JNYA 4G5GA 4HE6A 4G1VA 4N3GA 1ZUNB 1NJID 1AMOA 4J0QA 4RJLA 4Y9UA 5TV2A 1EWYA 4MYUA 1VQMB 1QGZA 4FWTA 1EXMA 4WQMA 1UMKA 1F60A 2B7CA 2C77A 1W87A 5H5JA 3W5VA 2VNKA 1E63A 3QSYA 1G7CA 1G7SA 1ZM2A 3U2QA 3W2IA 1KC8D 1KD1D 2EIXA 4FK8A 1ZM9A 3W2EA 1Q86D 1JB9A 3OZVA 4RD3A 4YAWA 1Q7YD 2E1RA 1QGAA 1FRQA 5FA6A 4LBZA 1D2EA 1OB2A 1D1NA 1QFZA 4RCYA 1KK1A 3VNUA 4B48A 3JQPA 3LRXA 4LBWA 1U2RA 3CCMB 2VNHA 4Q7JB 1R5BA 4C43A 3AVTA 1GAWA 1B2RA 1EFUA 1EFTA 3MMPA 1YIJB 1D8TA 1GAQA 1IJFA 4PC3A 1KK2A 2CRVA 3AVUA 3W5UA 1EFCA 3U6BA 2J7KA 3LO8A 4PC2A 2OK7A 1YJNB 3P27A 4NBSA 4Y9RA 4ZV4A 4ACAA 3A1FA 2RC6A 1Q82D 1GO2A 4LBVA 4DQLA 2BGIA 3AGPA 2DEUA 3CRZA 3WBJA 1SM4A 4M1KA 4TN1A 4C0SA 3CW2A 3VO1A 3CCUB 2R6HA 3CCSB 4YALA 3AGQA 4RD2A 1K8AD 1FRNA 2RC5A 1QVGB 1H42A 4R71A 4H9GA 3ZBUA 1WDTA 1TTTA 4PC7A 3PENA 4UAJA 3CMAB 2AHOA 1QG0A 1G7RA 4Y7CA 3ES9A 4LBYA 1KRHA 1QUFA 1FNMA 3CC4B 3CCLB 4B44A 1KQSB 2BGJA 1K9MD 1YHQB 3SJZA 4YAFA 1SKQA 3ZC3A 1QVFB 1GJRA 5GV7A 3ZZUA 3MHPA 1B23P 1GR1A 3W2HA 1VQ4B 1VQ5B 3B8HA 1HA3A 4AF6A 2BF4A 1N8RD 3WBKA 4FN5A 2VZLA 3I56B 3JQRA 4YAOA 5TY0A 4M0LA 2EFGA 3WY9A 4NCNA 4ZCIA 2XEXA 2BSAA 4LC0A 1IJEA 1FNCA 2NPFA 1CNFA 1VQOB 2YWHA 2PIAA 3ZZTA 1YJ9B 3AVXA 1S72B 1VQ6B 4TMZA 1ZM4A 1BJKA 3CXCB 3OW2B 1E62A 2OTLB 1F20A 1BQEA 1VQ7B 2YWFA 2PMDA 1CNEA 2QTZA 4K1XA 2QMUA 2GQFA 4AF7A 4ZGQB 1NDHA 3FJOA 4DQKA 2VNIA 1FNBA 1KK0A 1BX0A 1JA1A 3OJXA 4QHYA 3WYAA 3QFTA 4EH1A 3E1YE 5DSZA 3CCJB 1XE1A 1VQ8B 4M53A 2DERA 3E20A 3FPKA 3WXMA 2DETA 4RCZA 2QTLA 3JQQA 1W34A 3QFRA 4TMWA 4TMVA 5AN9A 3LYUA 1M90D 2HMAA 1VQNB 2BPOA 5EMNA 4B3XA 4RD1A 3U6KA 3I55B 1DDGA 2VYQA 1XB2A 3P26A 4TMXA 2BM0A 1OB5A 4N3NA 3QE2A 2XNCA 3AVYA 2HCJB 2YWEA 4QFMA 1EP3B 4P6VF 4M4SA
chains in the Genus database with same CATH superfamily
4MDHA 2QLBA 4ZYZA 3UGKA 1IY2A 3EC2A 1S2LA 3RUDA 3H97A 4MVXA 5G3YA 4QPPA 4XYMA 1JVBA 2I6XA 2VXCA 2WNHA 1X8JA 3CLTC 4G4JA 2FZ4A 4EECA 5HCIA 2IF2A 1E9BA 4S0ZA 2PR2A 3CN7A 4X7DA 3IUJA 4ZCMA 5EGSA 3CY6A 4PLCA 1M2JA 2RONA 1UBMS 3MINA 3BCFA 1XK7A 1IMOA 2WJIA 2CMDA 4RMHA 1GZ3A 1QBKC 1OWOA 2PUDA 1KI4A 1FTQA 4KEAA 1K89A 5KVAA 2CXTA 1CQJA 2DPYA 2YRXA 1RP7A 3MLEA 4OSPA 4C0LA 4F8EA 3WJ1A 4DZTA 1IUKA 3EC1A 3EMDA 1UBKS 4OOFA 3P0EA 4P4UA 1E7WA 1JHRA 1RJDA 1QH0A 2FZCA 5JZVA 1G5IA 1MKYA 2R96A 3ML1A 4KQEA 2IHBA 1VDMA 1QR2A 4EQZA 3VYWA 5C8YF 2IWRA 4ZANA 3GYBA 5DI9A 4Y98A 4CMEA 4Q3CA 5F3DA 1YU6A 2VJMB 2ZXEA 4INPA 2EGGA 2JJ2A 5TGDA 1GZ5A 2BR3A 4JQCA 4AB1A 3ZHRA 3ANNA 2YOFA 3F8TA 3JQFC 1CK4A 1ODTC 4XASA 2RDMA 1RWBA 1OC4A 3ASVA 3C6YA 3KXPA 4Q3LA 4A16A 1EX6A 2JJ1A 1X92A 3GDHA 3I0MA 3I34X 4QUEA 1B8PA 1KZ1A 2B92A 1VPDA 1EBFA 1NRIA 2WVHA 4X64B 3MK31 3M6LA 1C9YA 3QXXA 4OMCA 2C3MA 2BHSA 2UAGA 4H1VA 1B8VA 1N7GA 3UYKA 3WIBA 4KIGA 4QDJA 3ANMA 2IHTA 4WN9B 3MT7A 4NVRA 4D8YA 4CLRA 1GL7A 1OLSA 1TA4A 2ZRJA 5H3HA 1IWBB 4L8LA 3U9LA 2PE3A 2QD3A 3NV9A 4M38A 3TLKA 3VBEA 3DMNA 3IHKA 1GNSA 2BONA 2CVFA 1KMHA 3ASTA 3HFJA 2Y1OA 3H5NA 4AJ4A 3NYWA 2HWUA 2YQZA 2XWBF 2ANBA 4NDZA 3TM5A 5BWNA 4D9NA 4RPHA 2H3HA 3NEPX 4DLNA 1PVOA 2XCOA 4RK0A 5KEIA 1JDSA 4FJ0A 3CPJB 2OPBA 4H7EA 2PL9A 3P9PA 4OH7A 4QDTA 3T7IA 1QP7A 4IGIA 2B5WA 2ZT5A 1ISGA 2CYCA 4OCZA 1DCKA 3ELBA 3OZIA 1XZQA 4HLUA 1Q22A 4W5RA 1MOSA 3ETCA 3PR1A 3CVXA 3I73A 2EW8A 3W8DA 1JFFA 3CUTA 4KQ2A 3FIUA 4MRNA 2VDVE 4ISBA 4C07A 5JHGB 2EKBA 2AYXA 4TTJA 2RHMA 4OU5A 1TK9A 4CUKA 3HDQA 1Z63A 1EVQA 3BVPA 5H0IA 2OGSA 3EIQA 3L6EA 3PA6A 2PRJA 3MWDA 2F1OA 2R6CA 2PSHA 2YBDA 1T1IA 4PAQA 4RYDA 4JYBA 1W75A 3R7BA 3VOTA 3QXHA 4HI0E 1II9A 2CD9A 3FWKA 2HEIA 4YO7A 3QUTA 2C4TA 3AIMA 5TPZA 4AMYA 5JRDS 1RI4A 2QT1A 5J2TA 1BC5A 4PX2A 4QBKA 4N8DA 3ND9A 4Q0MA 4OK6A 2PEZA 4CKCB 1ZD8A 4BEVA 2C5AA 4G2NA 4JJKA 3R9XA 3A6LA 4XUEA 5EMJA 2V97A 2YUIA 2HLHA 3HRHA 3B3QA 1K7FB 4MR9A 4O59O 3IP5A 5I7FA 3KXDA 4K6MA 4MI6A 1Z4JA 4MGEA 3N2GA 2NQ8A 1W36D 1GTL1 4LMRA 2UZ4A 4HVLA 5BNWA 4LXGA 2VSOA 3OC0A 4A26A 1OGJA 3SLDA 2A5DA 2VHVA 3A4LA 2B34A 3OSUA 4CKEB 4A2CA 3GR6A 1A8UA 1H2EA 4AS3A 1AB5A 2ADFA 1WCV1 3H9UA 5I9MA 2NTYC 5L7YA 2FSGA 1CTQA 5TQJA 2QTWB 1J6UA 3BMQA 2PS0A 1QHYA 5BQ5A 2FX3A 1YK0A 2CBZA 4UNRA 4BVGA 3PNPA 3S1AB 3K2QA 1SQFA 1NR1A 1EINA 1V3UA 2J31A 3OQBA 5TT1A 3LQKA 1CUWA 1P9NA 3GWGA 1DBRA 2O57A 4OSEA 1JDZA 1SR8A 4GLOA 2B1IA 4Q82A 4EB3A 4BCCA 1Z68A 1NVGA 1W88B 3KEMA 3GLQA 1OFUX 4B2IA 2ZITA 1QVRA 4GPZA 4JJ8A 4EB0A 1WZIA 1TK2A 3BH4A 2IHJA 2J41A 2G63A 3HADA 1H85A 1QGUA 2WT4A 2Z5VA 1Z06A 1QO0A 4KGVA 4XXHA 2WFZA 4BFWA 2VCHA 4CV0A 2VHUA 2A1TR 3EPRA 4QRDA 1G18A 4COOA 1IB0A 2FW7A 2HA0A 1TLTA 2BT4A 4TXJA 4DRXB 3OTHA 3G2IA 2RG1A 3WJ7A 2BIFA 2YYSA 1WUKS 3V76A 1OAAA 1YBAA 4YGXB 5JNWA 2CZCA 2J45A 3WKCA 5FV4A 2Z3WA 2IPNA 1AK9A 5E9AA 4LVNA 3NG1A 2V4UA 4B4WA 1JQEA 4XCQA 3WA6A 4RKEA 4BHTA 4CLEA 1GSHA 2UYGA 2R44A 2QJRA 2NO7A 4J1NA 1AKWA 2DFTA 1DC5A 2NO6A 3C3MA 3KD3A 5JMPA 4IS2A 1Z88A 4EZIA 1UC4B 3HV2A 3FOBA 3CZRA 5K6RA 2ODEA 2RGGA 4R1UA 3WIEA 4ZVRA 4C6RA 1N3BA 3U4HA 1C3VA 4L08A 4ZQHA 5B58C 5DFAA 5GY7A 2IH4A 2DPXA 3L6RA 2QBYA 2BEVA 3BIFA 3HBLA 2XY4A 3LVQE 3EZNA 5D1HA 4GI7A 1KEWA 3UCFA 4YDQA 1R0CA 2B1GA 4UAGA 5KX5F 3L0CA 5LLTA 2BMDA 2JCBA 1I0LA 2ZSUA 5E6TA 4XIYA 1F60A 2C77A 1ESDA 1SEVA 2HJHA 2AR7A 2WZBA 3N8DA 4IFEA 1JW9B 2HJGA 5ENDA 3ZNQA 1TPZA 2OV4A 1M73E 3MB5A 3OU6A 4KWTA 1TX4B 1V5IA 5HA5A 4DCVA 1X3SA 1KZHA 5I7VA 4D25A 3MRXA 5FHQA 3Q3VA 2Y8EA 6REQB 3KFVA 3D0QA 1HEIA 3GJQA 2VAVA 5I9IA 2WUDA 2B94A 3SX0A 4RZUA 1KYWA 3ECCA 3QKSB 4DY4A 4COKA 5LDDC 4OIMA 3DBVO 3OLVA 1OF1A 3RJMA 4L5IA 5HP4A 3A10A 4BVAA 4CIBA 1Z5NA 4MICA 4Q18A 4IO0A 4TS4A 5C31A 4R5HA 4GXTA 1QJCA 1YLOA 4CLXA 3WICA 2FJUA 2PUWA 3K0EA 5CGQB 4ZT6A 4RTJA 1MLDA 5IJ0B 3NUQA 3NDIA 4GRAA 3F3KA 5DYGA 2WSLA 2QOEA 1Z8NA 3AETA 4J9VA 5CEFA 3SHVA 4K9PA 1MH9A 1EA5A 1TM3E 1EGMB 4MGZR 3V6LA 2HK7A 4BB5A 1XDDA 1ZSNA 2Z09A 3IDFA 1D7OA 5LKRA 3O83A 1BKDR 3KALA 3OJLA 2ZBGA 4QU9A 5CH8A 2FRDC 5GZ3A 1HT2E 5LOVA 2BGRA 3AR7A 1OMOA 3AP1A 3PI6A 1Z2NX 3ZGLA 4BVLA 3TPFA 4MMYB 1B43A 2DKNA 3K09C 1TT7A 5JI2E 2V6GA 4YRQA 2XRYA 2D0OB 4V0OA 2VYFA 1V71A 4I81A 4W7IA 1GAQA 1L7EA 4QDUA 1ZO8A 2BI4A 3HKBA 5BR7A 5JCOC 2AFIA 3FBWA 1TD1A 1YB6A 1LDGA 2XB4A 3NHRA 5HCNA 4ZICA 3LUGA 3TF5A 4EA7A 4AWXA 3KZ1E 5JOQA 1SH7A 1FFEA 2QRJA 1NYLA 2CDNA 2YX1A 3Q3HA 1Z82A 3GH3A 4IRUB 1ICIA 1KDRA 3TJMA 4FXUA 4DWVA 2F8TA 4MW9A 4CMIA 4F60A 1ZK2A 3DUFB 3KV1A 1UF9A 3DDWA 1ACJA 4GU5A 5CFNA 3EOBI 2Q4RA 5GIOE 2LDXA 1HDEA 3SDBA 1O95C 1E8MA 2A5GA 2V4DA 1HDOA 5KTSA 2EW2A 1G6Q1 2AHRA 4GDMA 4Q15A 1E1QA 1VG9B 4ESVA 2GEDA 1IBKB 1AZLA 1KMNA 2GBGA 5KBYA 1W581 1HM5A 5BOSA 1RXSA 4QEZA 4N39A 3C3AA 3T7SA 1ZWLA 1YB2A 1ORTA 2C98A 3NVAA 4P35A 2ZE7A 1DTWA 1NLMA 1DBIA 1YZGA 3M9WA 2GEJA 3OF3A 4R81A 3PKJA 4A0GA 1VL8A 2NVUB 3T06B 1C50A 1ILEA 2ZT6A 1P7YA 1WW8A 1HNZB 3F5FA 3ZXSA 4K0KB 2QRHA 4Q3NA 4ZXFA 3ONDA 4XSGA 2D7DA 1YR1A 4J2OA 3CNQS 2C8JA 1WL8A 4BLRA 4TROA 3HKCA 3DZGA 1OH6A 4I5EA 2NQ2C 4OQEA 3JV7A 5EE5B 1GQRA 1HT0A 1J00A 3OOEA 4C6TA 2X4IA 3PQ7A 4LGVA 4RK6A 4FGWA 4XMYA 4QPJC 3AI3A 5JAOA 3GW8A 1D2AA 3CVVA 4IGFA 5JVDF 4BRWA 1RM5A 3HLYA 1NAIA 1OU4A 3L6UA 3FLBA 4B44A 3F73A 3LRPA 4EVRA 4DK1A 1ORRA 2H1RA 1C81A 1MX1A 1QF9A 3D4NA 5LQCA 3VSAA 2VJPA 5TQ0A 2IIVA 2XZTA 4E22A 2C9MA 1IHYA 4L22A 2JKYA 3GJXC 2WU0A 1Z4QA 3COJA 3GLGB 1JEDA 1V7PC 5AVWA 1DC8A 1XTZA 1DGQA 1RZ3A 1S4QA 1YRHA 3WRXA 2B78A 1QKJA 2FR1A 2FHSA 4ZP1A 2D5LA 1MO2A 3ZIDA 3DHYA 4RJJA 3A11A 2JKVA 3CT4A 1NVBA 3H11B 1OVMA 3FZQA 4AN1A 5FYDA 3P4XA 5F2KA 1PJAA 1JJIA 3ZBQA 3C4QA 3M9LA 3RTEA 1PT7A 4BTEA 1XZBA 5K3OA 3WO1A 4P4LA 1NVTA 5F23A 2BF4A 1PQPA 3ONNA 5E2BA 5TGZA 2CF4A 4IM7A 3QFHA 1XCPA 5ALVA 2YHIA 2XUAA 5L45A 1NVDA 1CY7A 2GEUA 4RF4A 3OE7A 1ITZA 2R8OA 5JNSA 2A1UA 5ILQA 1PK7A 3FUTA 3WMEA 5T7BA 2XTAA 5JMWA 3WY9A 2Z3ZA 4D26A 1SFRA 2KWIA 1K8YB 3LCRA 2AEMA 4UC0A 2LIVA 1MAHA 2YCLA 3P9KA 4OQ4A 4B76A 3ADDA 2YJNA 4FSDA 2LR0A 1NP6A 3L1KA 4MLPA 3UJCA 3DS8A 1A98A 1QHSA 2MYUA 3REGA 3JZFA 1H1TA 3ZKAA 1U2ZA 4R9UC 1ZW6A 3TXXA 2AZXA 4HQ0A 1J7JA 1BFUA 2GVNA 2EEZA 1HEYA 5SY6A 5L53A 1KH1A 3TNDA 2YMLA 4NOLA 3VH2A 4B34A 1XLWA 3FWHA 3N5KA 2W2OA 1E9SA 5DX8A 3VJKA 4CL0A 1R88A 4YV1A 1E77A 5K45A 3GJ5A 2ZFUA 4M88A 2W6NA 1WV0A 4DJEC 1X42A 2XUZA 2IYNA 1M6YA 2MU1A 4AF7A 1J2YA 2O7QA 3SXUB 3SAJA 4KFUA 3R9XB 2AEJA 4WCFA 1ZHHA 5KWJA 3LD9A 4MB2A 4OQNA 1US8B 4IBOA 2YJGA 2GERA 3PJRA 4Q1VA 1N2SA 3D4PA 4IDDA 1SXQA 1Z33A 2NVBA 4KQIA 4EABA 1WHTB 1OPXA 4R1LA 3OP4A 1VCNA 1FDTA 1THMA 2DOKA 1BCRA 4C3OB 1TCBA 1YZTA 3VISA 5KYWA 3VR3D 3AT1A 3Q9NA 1F0KA 4DC1A 1PJZA 2R6DA 2OSVA 3BWVA 2C4MA 5AVXA 2WB2A 3N8HA 5JYBA 1UT5A 2EVWX 4YV7A 2NXWA 2BISA 1XMVA 2PUTA 3ZVLA 4XDGA 1JFFB 2WE8A 3CUKA 2JIRA 5LZ4A 1NHWA 1XEWY 1ZK3A 4X95A 1N4AA 3WXMA 3QYPA 3ITKA 4DAOA 3HB1A 4UTRA 3TINA 3E8MA 2GMWA 1J22A 1DKNA 5IT5A 2VP0A 1IU9A 2BKVA 3Q8MA 2CJXA 3VR5D 2IQIA 4CVNA 1C1YA 2W8BB 5TB5A 4C76A 3LF2A 3M3HA 5EA2A 4MGKR 1IM8A 4P84A 4E08A 4EA6A 2F62A 2HNBA 2AYZA 3SYLA 5AO9A 4XJVA 1QCDA 1V5FA 2J0UA 1Z8FA 2ZSEA 1M90D 1SCUA 5DXJA 1SXIA 1U0OC 3TRIA 4L50A 1OXVA 3BOSA 4HH3C 3O4VA 3LPCA 1JIUA 4ZT7A 2OFOA 4UTPA 1W1IA 1F7VA 1T6XA 1F9AA 1M3SA 4FCWA 4N7JA 1R4MB 3HWSA 2IYWA 3DLBA 1OXBB 2FN3A 5TGTA 3WQSB 4I5IA 3J7AC 1TADA 2V6JA 4AJKA 4HEA1 3UHOA 5B55A 2D7CA 2N1MA 4P36A 5L7TA 2O8EA 3MVEA 2RK6A 2XNCA 3C8ZA 3DE2X 4ZTUB 1ZL2A 3MTJA 3RE1A 2JAXA 2Q0HA 1IK6A 2B8WA 1I1QB 1A9QA 5DLQC 4DRZA 3H4VA 3P94A 4CTOA 3BWMA 1W52X 1EP3B 3DFKA 1RVV1 2YVQA 1RRVA 3PNBA 3WA7A 3PHHA 2JLUA 1WKCA 4L3WA 4PBTA 4Q9KA 5C7OO 4N48A 1A72A 2XMZA 3O1LA 2VUIB 1X38A 2FEOA 3BDIA 1CNMA 1J2UA 2R1TA 3E15A 4LWZA 1IZ8A 1QIGA 2IBTA 1E3QA 3FFXA 3OU7A 1WBJB 3AKEA 5E1MA 2BN4A 1SHTX 3WNCA 2XGMA 1X13A 1OBVA 2RHWA 3GLHA 1P1CA 2CVPA 4FZ5A 4IGAA 4J9UE 5ERXA 5H83A 1X7YB 3IA7A 4JJ7A 3QUQA 4Z53A 5JTUA 1GQ2A 1SG9A 2H1FA 4B85A 1VLQA 1Y1SA 4P58A 1R0WA 3TE6A 3R74A 4AZ0A 4BFTA 4BB9A 2IYAA 3LGSA 2DXIA 2I7CA 3CONA 2DQYA 4DR7B 5DTQA 2PAFA 3RYFA 2NXEA 2J9GA 1IZ7A 2IIPA 4R2IA 5BYBA 4LS3A 2J9RA 1J5EB 5EPUA 1BX3A 3KZVA 4N0DA 1UD4A 5EHQA 4BQRA 5C1DA 2R79A 1NGSA 3CZ5A 4IMRA 2VNAA 5I7OA 3R0ZA 2GPYA 1GSIA 5BY2A 5DNUA 4CQNA 3JQ8A 4QPNA 3H0CA 4FUTA 4X20A 1AS2A 3KUXA 2WUEA 5T4FA 2G5TA 2V45A 3DOOA 2QSZA 4DDKA 1LPAB 1QK3A 2VSFA 1AQIA 2A9JA 3G59A 3RFVA 1EP9A 1K5HA 3UMSA 1SRRA 4XM2A 3O3CA 3EMBA 2X5KO 4PC1A 2FN9A 1Z47A 1FFHA 2ACEA 2DPMA 2VLBA 1Z62A 1NV8A 2Z95A 2DFNA 1H5QA 2GWRA 3H7IA 4NYMR 1CJMA 3HU1A 4QLBA 4HN2A 5AJHA 4PYKA 1FDRA 3BMQB 3INNA 1TMKA 3IXMA 4JUFA 5JWOA 4FNOA 1RZVA 2QTNA 1Y0RA 5GZ6A 4F56A 3DDUA 5CVTA 4P32A 1BVHA 1WUHS 3CRMA 4PLWA 4WVLA 2YWXA 3VHXB 3EULA 1KA9H 4N6NA 3ZX4A 5C2JB 5HZGA 3VO2A 2BUBA 4EPWA 1KMCA 3FHLA 3NVDA 1KS9A 3UCXA 2XYHA 3MAGA 1U0TA 5IVIA 2IE0A 3ZD7A 1WSVA 1VCHA 2Z5GA 4X3OA 1W2GA 2LIPA 3SG0A 4B33A 5D3KA 4UZFA 3P2YA 4DDTA 4ZEVA 3MJCA 2Q6IA 4ETWA 4V2UA 3TR5A 2HFKA 4OPSA 1DDOA 2NUAB 1N1EA 3IBTA 1SZDA 2RAPA 3TRJA 1OI7A 4P7FA 3GPLA 3B5EA 2CFRA 4QU8A 1G2IA 2L42A 1ZCBA 3Q6RA 1RWOA 2NZXA 3QV2A 2H2DA 4EG4A 2X5NA 3O95A 1ECBA 2Y1WA 4JJEA 3X1JA 4D74A 4EHDA 4DV1B 1NUHA 3L5OA 2F1LA 1J39A 3N6XA 1KEVA 1H9AA 5IDYA 2QSUA 3G13A 2EZ8A 3EGEA 4ZDKA 5A9RA 3DVSX 1DFGA 1GPAA 3N7TA 1JEAA 4EF4A 3DLTA 3O8CA 4N5DA 1OFUA 4B1FA 1M7HA 1LS6A 3SOZA 2PSFA 1VGRA 2G04A 4Q9HA 1U2GA 4E32A 1GTRA 3VZQA 3BEDA 3WGUA 4MCIA 2P6UA 2I7TA 1XZFA 2H4FA 3KNZA 5KWSA 3DBRB 3QX9A 3EASA 1JBKA 2C7RA 3ZI0A 1K6XA 4IFTA 4K6OA 4F1WA 2ZB7A 4HVTA 2DCUA 2QPTA 4UQOA 3SIWA 3IHLA 1THGA 4ZCLA 3B36A 1RXIA 3GRAA 3R3WA 4JL5A 2QTCA 4EHAA 2A0UA 4TVKA 1M1YB 1G3UA 3UGQA 1XHLA 3ZWMA 8ATCA 4RXTA 2C7PA 2XR1A 1TT5B 3KUDA 2BHRA 1TIPA 1YAHA 3EXHA 3OJ0A 4QUIA 4E2XA 3SWWA 1BU5A 1N5MA 4P86A 4OJNA 5JAMA 2IBSA 4X7MA 4DDUA 2ZTNA 1N25A 1YRQA 2PXAA 2Q1TA 3BBPA 3QKIA 4J0CA 4M8NE 1JLRA 4MLDA 5C3UA 3S1LA 1P0FA 3D6HA 4ENSA 3G8AA 4IQGA 3EZLA 5E4JA 5EFOA 4WFIA 4ER7A 4YN3A 2WYRA 1FDIA 1AGPA 5CVCA 3MJ4A 3HYNA 2V3VA 1Q81D 4BY9E 4QASA 1X15A 3MUOA 3A1SA 1HV8A 3B3AA 3NP7A 3AIKA 3VDMA 4WY8A 2VNJA 4ID3A 3RUIA 4Q7QA 1JSCA 2PZLA 1CYDA 3EBLA 4QTTB 5TMDA 5EQTA 3W8FA 4WSOA 2NPOA 1LLDA 1GGVA 2EFYA 4JXJA 4F5EA 3DC7A 5B4VA 4PZZA 3FCYA 3IRVA 4LRUA 1IN7A 3FYDA 3CD6B 3IELA 4I9FA 5CXQA 1EUCB 3Q2IA 4A92A 4M9RA 4V0ME 1VECA 1M6HA 3RRYA 1QHGA 3LUJA 3A6FA 1YJWB 5AP9A 2I5PO 2HUPA 2WRZA 4M0UA 1NKTA 3Q7EA 1ADJA 2X0FA 4EEXA 1H0KA 3HCCA 5ADWA 5IVHA 1YH3A 3AOEA 2SCUB 2XZOA 1NFRA 1SK9A 3BH6A 3PG5A 3ZCVA 4YY3B 5ALLA 2AV6A 1WP6A 3BFKA 3EFHA 3K6SB 2XOKA 2I4RA 1VG0B 1NY6A 3Q6QA 4GP6A 2CFTA 1AA9A 3L0YA 3RWMB 2ZP1A 3G49A 3TGWA 3A1NA 4MVJP 4NL4H 2WD7A 4HEA6 3RRMA 2XB6A 2OBXA 4Z4TA 2OB1A 2VO1A 3GJ6A 4FZJA 5ICMA 3PQ6A 2HY7A 2QVCA 3Q5EA 3W3AA 4A5OA 2WQZA 4BAZA 1SCKA 3H3FA 3PYLA 4QXPA 1JG3A 2GD6A 1U8YA 2JFOA 3ZPNA 1RLJA 4YRBA 1IY9A 1J2RA 2OYRA 2IVZA 2V3WA 4LKOA 1UKEA 4O25A 1XTIA 4IMJB 1JDPA 1QKKA 2IUFA 4QT0A 3T0GA 1AV7A 4CMAA 3IUEA 1C4XA 4LVCA 2PZEA 3ZS9A 3WQQA 3NHAA 4WKOA 1QIJA 1SY7A 4FQ7A 2HQBA 3F5SA 3UKDA 4OHXA 3Q8LA 2RIPA 5LMUB 4QVJA 2DBRA 2FCAA 4WT7A 3ORHA 4D4HA 1YS2X 2Q9UA 3AY0A 2Q0QA 3MMXA 5GMOA 5C81A 2NVWA 4MV0A 1VMAA 2EIXA 5ERYA 4FK8A 5CLGA 4OREX 5HFJA 3TQCA 3VVLA 2HV9A 5KC9A 2UYOA 3FWNA 2R6R1 1PK8A 4JUBA 3JVVA 2YQ4A 1QVZA 1A4IA 4X1IB 1L7MA 3OOCA 1T34A 1U3WA 3E23A 4LG1A 2OHOA 2HK8A 1UZMA 2BEKA 4KFRA 4YXWA 4FOTA 5K05A 3MGGA 3NC4A 3EA0A 3O8RA 1L4LA 4NK4A 4WAUA 2GN8A 2ZBFA 4P3PA 3H9EO 3L1JA 3VVBA 1SELA 3WMFA 3ZR4B 2W70A 4BO0A 4QGSA 2IYVA 2Q3HA 2XKBA 2IA5A 1WB4A 2VF4X 4I1IA 1LI7A 4G2TA 4BP1A 2ERYA 1BKYA 4MUGA 1MC8A 1GA6A 1UFKA 4RCYA 1RQLA 2C83A 3FTQA 1QWOA 2C4KA 3D2AA 3N2GB 3O4IA 3OEYA 9MHTA 3PCTA 4MVWA 4YIKA 1FEZA 4G07A 2H85A 3Q85A 1U2RA 1X7WA 4JIGA 3FW1A 1BIFA 4UBLA 5CW2A 1VKHA 3VOBA 3G7NA 3SGLA 4C0JA 3SQOA 1V1MA 3QU4A 2EJWA 1SB9A 2C07A 1P3Y1 4YASA 4D9CA 3ADBA 4YT8A 4YCSA 2B6HA 2VN8A 4RKYA 3L05A 1P80A 1ZBDA 2MIIA 5JIBA 4WA8A 4CN8A 5IUKC 1ZVKA 5HJ5A 1B93A 3KZXA 4PC3A 3YASA 3K73O 4JX8A 2YDYA 1A0OA 2GRUA 3GMSA 4MK4A 3RVDA 3ZHBA 2ATCA 1I4DD 1QHHA 1E1RA 2AXNA 4J0DA 2ZWIA 3OPYA 4KQXA 4BKUA 3DNFA 3VUFA 1H2HA 4C3UA 1V5EA 1V7ZA 2OMKA 1KEEA 2XLBA 3JU4A 2WIJA 4RQTA 3W8RA 1JU9A 4KTTE 3BQJA 4X3CA 1RAEA 1SG0A 4OXXA 4QYIB 5JO9A 4ZV4A 3A1FA 3BFPA 1GY8A 3UO8B 1Y3FE 3U4DA 2HREA 2PHZA 4EUSA 5FWNA 1JB1A 3L02A 3BZWA 1Q82D 2WHYA 3DWFA 2GBLA 5FI1B 3TXAA 2D0PB 1U63A 1SVUA 3RJ9A 1OKKA 1VE9A 1YI1A 1AKRA 4XM3A 1N8TA 3OHSX 4M7PA 2BFOA 3A6ZA 3DPIA 4M49A 2JFWA 3ZQKA 4EHLA 5C46F 4NTZA 2ZL6A 1H8ED 2E4AA 5AOBA 3BMNB 2GREA 2I3DA 3F74A 3SFZA 2B98A 4YRFA 4NYJQ 4Y30A 2FSFA 1XZJA 4C30A 2PUGA 2F1JA 4JBHA 1U0LA 5D3MA 1W36B 4H6XA 1FMJA 3KT6A 4ZQGA 1Y6JA 4ZZ0A 1K7SN 3QVGB 1JYSA 2CKDA 1L4BA 1G6HA 1FRNA 2WWRA 4TKMA 2QE7A 2E3JA 2ZSHA 3A6DA 3AOGA 3QOWA 2QE6A 2P65A 3BD6A 3JX9A 4RH1A 4KQGA 3S68A 3WSWA 4UBMA 2W9XA 4DBLE 1JLHA 2OXRA 1WDTA 4NCKA 5EKUA 4BEBA 1LJLA 4DV6B 2BC9A 1Y5IA 2FOLA 1QDLB 1WDLA 2VBVA 5DXAA 2AHOA 1TT5A 721PA 2XMBA 3P2IA 1PF7E 3WK5A 4WOBA 1I18A 2ENWA 2YHUA 5T57A 4XVRA 1JNXX 3FFAA 4JFRA 1P5ZB 1FL9A 1AMUA 4FNMA 3LLMA 2PH3A 2D4AA 3OFJA 2PWPA 3NHJA 3R9KA 4HDCA 4Z3OA 4BTLA 3FIJA 2SHKA 2Y99A 3HZHA 4F21A 1M67A 4TLCA 3O4GA 4H3SA 4S2EA 3AR6A 1CY2A 4CE6A 2YHIB 1G6OA 3UHJA 4UTXA 1RHUA 4IJWA 4UCFA 4YLEA 3OM9A 3MJTA 3OY7A 3ZLVA 2J1LA 4IIJB 1XTTA 4OKIA 5FUQA 2MDTA 2ZGVA 3AFIA 4OLFA 1QHNA 2A0XA 3IBYA 4IF4A 1RJ9B 3AV0B 4R9RA 2XB8A 2JLVA 2JW5A 3ZWXA 5B7GA 1R6BX 5F1KA 2OUKA 1XWIA 1CR0A 1XQYA 3HA7A 2GNAA 3CNOA 4G86A 2OCBA 2EQAA 2B9VA 5ER9A 3WL4A 3PNKA 4XKWA 4N65A 4Z1OA 1HYEA 1TRHA 4YCAA 5DBHX 4AU1A 2G0NA 4E51A 4W5NA 5G40A 2H18A 3K9FC 1LDNA 1QU3A 2FSHA 1HA3A 1GPJA 1QH8A 4LIPD 5DNDA 4EPYA 3RSGA 1YE3A 1DQYA 4H60A 1N8RD 2ACWA 2YOGA 3AIOA 4GYJA 3R5KA 4Z7JA 4TS3A 2XKAA 2QRVA 1R9JA 2OKGA 1JR6A 2JVIA 2EBHX 1VE3A 3E6AA 2P3QA 1KWGA 3ACBA 5A2GA 1SCJA 1A97A 4M0LA 3FUCA 3NTXA 5AVKA 4DWWA 4BNJA 4RPKA 5F2NA 5ALKA 2YV5A 2BRUC 2XEXA 5C5IA 3RHFA 3THRA 1G1MA 2HUNA 3LY9A 5LBUA 3Q88A 4TSFD 4DLXA 4I1RA 2NPFA 2AD5A 1DB3A 5LOVF 1UXIA 2CHFA 1S6YA 1VG1A 4FQ5A 2ZR9A 3UMGA 1W6RA 2NACA 2WI8A 2BMVA 3AF6A 4QFCA 5F2EA 4KDFA 3T9EA 1YAJA 2AOXA 1YA6A 5HIJA 1I94B 2GWHA 5K3FA 1HE5A 2VZEA 4MQ5A 4TSKA 3Q2OA 5FEMA 3VHQA 4MTCA 3SVZA 2ZT7A 3GFGA 3SR0A 2TRSB 3LTEA 2UXBB 3PDIB 3TIIA 1NX9A 1W85A 2VCYA 1ISJA 1QRRA 4IEEA 5BW6B 1TKAA 2WHRA 2YV2A 4EUNA 4DQUA 3N5CA 1QV6A 4X7FA 1KHHA 2ZB4A 1DTWB 4W9RA 4UDNA 3OEHD 3DWIA 1YBMA 1ZRNA 2BJVA 1YUMA 1ZUD1 2ZBUA 2JVKA 4X85A 4P12A 2LCFA 1FFSA 1CZKA 1JG7A 1XYGA 1ZXLA 4KWHA 2Y1LA 4WZBB 5J59A 4NYMQ 2IOQA 4C14A 3NTOA 3IE1A 3ABQB 3L9XA 3RU7A 3K70D 3UM9A 1N6IA 2E0IA 2C57A 1PIWA 2BCJQ 2O6LA 4RZ3A 2PE5A 4DEVA 2GM3A 4AO8A 2NU6B 3KYDA 2J08A 4AZ3B 2JFQA 4Y8VA 2GF9A 5C8VA 3A04A 4XD2A 3KR9A 2HW8A 4BWVA 3ABRB 1Y1KE 4IH9A 5I4BA 1FJGB 5FLXA 3E81A 3WSTA 3WYAA 2IEBA 5FWXB 2QG4A 4NMHA 4R7TA 3HYSA 4Z3DA 5FO1A 4C88A 3KU1A 4RVHA 3BMOB 3DEYX 4PCUA 2BZSA 3TRFA 4BO3A 3AUAA 1CUGA 4WBXC 1FX0B 2ISCA 3SHOA 4CM1A 1BXZA 2GSDA 1STOA 1PR6A 3GH1A 4B9AA 3O82A 2E37A 1W5FA 4XD7D 2R86A 3L0ZA 4AMUA 1KIMA 1CUXA 1PV4A 5F9HA 4D4JA 4HWTA 5CLQA 3QE9Y 4XM0A 1VQ1A 2JBHA 2I4NA 1E3LA 4TMWA 4MQEB 1RI1A 4MRAA 4Q34A 3NNDA 3EGXB 4O4HF 4WBNA 4IKPA 2RBEA 4RH0A 5AN9A 4FYKA 2ZWVA 1GQOA 1DAKA 3IAXA 3JQAD 1C7EA 1E2NA 2ZT8A 3HBFA 4O2AB 5LMCA 2NO5A 3B5JA 1KQPA 2FQWA 1NN3A 3GBSA 2FLVA 1E1RD 3WNVA 3A7EA 3ZDRA 1KIFA 1TYAE 5DULA 3AF4A 4L28A 1I51A 3NOOA 4CG0A 2PS9A 3DMYA 3Q6MA 4H7PA 1ISPA 4YQEA 5AI9A 8ADHA 1EX1A 4D3FA 2JDID 1OB5A 4U7GA 3QE2A 4QNNA 2PKQP 1N57A 4LFAB 3VKFA 2ZZQA 3A28A 3ZHTA 5HKOA 4GLLA 5JROA 1WPCA 4LJ8A 2MWMA 3EIFA 2W2XA 2FDXA 1MTOA 2BMWA 1L5WA 4R2MA 2WAOA 2VP5A 1VQKB 1D4ZA 3QE3A 5D6NA 3LWDA 3WHLA 1Q91A 1RQXA 1XI2A 2NXNA 3M49A 1U7UA 4G24A 3Q41A 1KE2A 3ST7A 3QELA 1MBZA 1EGHA 3DL2A 1CHNA 4G0XA 4D3SA 3JQ7B 1EUDA 4HWPA 2F9MA 3DHEA 4HLQB 4KUGA 4BVFA 1X94A 3PUJA 5KZMB 4B3DA 2VWGA 2WILA 4RNDB 1T9BA 1F8XA 1QG2A 1YVEI 2NYVA 1RKXA 5EZYF 5F4ZA 4EHBA 5MN6A 1FMTA 4KITB 3C5HA 3BN3A 4C0XA 3BFJA 1FTWA 2F1HA 4GSKA 4L74A 3M9XA 1C7IA 4RPGA 2V7PA 4J2HA 2P75A 1KI1A 2WU8A 1JQBA 1QTIA 2QN9A 3KQMA 4A7PA 5IX8A 3ZBPA 2EV9A 1ZMXA 4V3CA 4TSRA 2GPSA 1ECPA 3UPDA 4JJ6A 5HF8A 1H6AA 3NKFA 3IDOA 1FP2A 3N2YA 4MWCA 4WK6A 3MQ2A 4CEHB 3FGZA 4HNAB 4EI8A 1J7KA 2EBFX 2NG1A 2LTAA 4FP9A 4AMGA 2XE7A 4M60A 4AVYA 2QU7A 4XEHA 1U9IC 1P77A 4GUDA 3UXMA 5AW7A 3O4JA 2QDKA 1KJZA 5LXTB 1R0LA 4BP9A 2PQ2A 3B6JA 2WYIA 3LL4A 3O90A 4I4TA 4I8XA 4K6GA 4UVIA 4KHPB 2F67A 2UZ3A 3GHHA 4BC0A 2SECE 1BE1A 3CA8A 3R41A 4JZYA 2R48A 1O0BA 3G8BA 4NESA 1HDCA 4HGQA 1F2TA 3PEWA 3GFSA 5D3QA 4DANA 4FR0A 2I0FA 4MV4A 2C94A 2FSVC 4XQCA 5D7NA 2YY6A 4X63A 3E61A 3CEJA 4C20A 3AONB 1AJEA 2C7BA 2QUJA 4KACA 4G65A 4U2CA 4ZMSA 4OF4A 4F6RB 4C1NA 5C51B 3EW7A 4XCVA 2I6UA 4GQAA 1W0KA 2PQ6A 1U81A 5EKXA 2G1PA 4EI7A 2FG5A 2PRYA 4D9HA 4EGFA 1L7XA 4LXIA 4B4OA 4DBLC 1U28C 4UXHA 4ZI7A 5AVOA 3ET4A 4WZKA 1Y42X 1AN9A 3OM1A 4OHWA 4U7HA 1I3KA 3ROEA 4RFSB 4RD6A 1J5XA 2F1KA 2WUVA 3F49S 1YS4A 4KG7A 2EL9A 3DXZA 2W6IA 4MUJA 2ZI3A 1NVVQ 5C32A 2VDQB 3P0IA 2FB9A 1HDIA 1ZGCA 2FPIB 2DHCA 3M5DA 4D8WA 4KRXA 4YQYA 5TVGA 5KU7A 2VS1A 3LPDA 3S2ZA 1U9IA 1L4KA 3NBAA 1UK6A 3G0BA 4IEIA 3HI4A 2O8NA 3EBPA 1E1QD 4OYYA 3UGTA 5B7NA 2HQ1A 3WR5A 4PLYA 3JD1A 5EJMA 4XI9A 4QJIA 2G1UA 1QTNA 1ZOLA 3OCUA 4F46A 2CL5A 4FGKA 3TZLA 3ZX5A 2GF0A 1K5PA 3OLQA 1UT6A 1C0EA 3UMCA 4D96A 1DCFA 3AKYA 1ZNYA 3A7DA 1HTTA 1HNNA 1WAMA 5FORA 4FFLA 5CJJA 2QKYA 3FAZA 2OBNA 4KR7A 1QGED 2FEMA 3GDOA 4PSKA 1Z6GA 2AJDA 3CZAA 2HWWA 3M1YA 5JEDA 1KO8A 2ASVA 1XZKA 5FPPA 5FIUA 1X7ZA 3MT9A 5J40A 1RZRD 4HMQA 1Y1QA 2QR5A 3GLVA 4W1PA 1I2AA 1C9JA 2Z2KA 3UW3A 2AG0A 1Y6QA 5G0TA 3G5TA 2Q8PA 3AR3A 2IEDA 3A0RB 1JEQB 1IONA 2ZSFA 1P0IA 3EVNA 2F00A 3EG9B 1C7FA 3AUKA 4Z9AA 5GONB 1L5LA 4R5MA 3WRXC 1HZEA 4S1OA 1H8EA 1F8UA 5KC8A 13PKA 4I7EA 3LK7A 1SOUA 1MZVA 2PUHA 5K4HA 3CQ9A 4M8SA 3V4FA 5C8ZA 4PHGA 1L1FA 3L7NA 4GNKA 5B53A 3CX6A 4MDEA 1JX6A 3LIIA 4XDYA 1VLOA 5DLPA 4YJ2B 2A5JA 3H9CA 1EESA 1CUZA 4AY3A 2BWJA 5EP2A 2GZ3A 3URMA 4E21A 5BV2P 2XRFA 1E1YA 1Y7IA 4RK7A 1HOTA 5JUWA 3SJUA 3ISTA 3FWYA 5KQPA 4QVKA 4V0QA 3ZVKA 3CF0A 1DKPA 4HB4A 1JDBB 4FYMA 3ANSA 5CFZA 5JSYA 4HE6A 4G1VA 1Q0LA 4GYWA 1PFWA 1F0PA 2XUFA 5AD1A 5A0VA 1B73A 3FYSA 4QYIA 5HE8A 2Y3IA 2ZG6A 3RHZA 3MGCA 3E9MA 1QQ6A 1S8FA 2WSYB 3T4UA 1H94A 1XP5A 2PKCA 4WLOA 4HGYA 1BGWA 2Q99A 1UEXC 2WYOA 4FMBB 5AM4A 1WY5A 5TV2A 1JIIA 2GK6A 1M1NA 2D5AA 1B42A 3DFFA 1O89A 2XA1A 3ILXA 3K6KA 3KSZO 4PVDA 5F3RA 1V6AA 3TQOA 10MHA 2LVBA 1N7IA 5FFMA 2CNKA 1L5GB 3FDXA 3ANLA 5CURA 1XA0A 5FA8A 2DPHA 1O97C 4K2AA 3KOZA 1IXKA 3TLEA 1ZN9A 3V8BA 3DXYA 1VLVA 2MT9A 4LTMA 2OOSA 5DYYA 4TKLA 2GZDA 3L1UA 3K2IA 3T34A 3I12A 1P31A 1AS0A 1ZM9A 3B7WA 4PR0A 3NORA 4OEHA 3X1YA 1Q86D 2FXIA 2DKOA 4RD3A 3SC2B 5JH7B 4O2LA 1KRXA 3OE5A 3KHTA 1QE5A 1YKFA 3EGVA 1B26A 3PL5A 1SUSA 1X2EA 4M98A 4XDZA 4L4UA 4CIYA 2GCOA 2P6NA 2IU3A 3HG7A 2P11A 1T6NA 1HLGA 1CZLA 2WP8J 1P8AA 2F1MA 1T1GA 4A91A 5BURA 2QTFA 1VPTA 3HKEB 3DNMA 2BYTA 1T5EA 1ULHA 2XRMA 4PYMA 4EB8A 4ENWA 3KEWA 4PPNA 1CY8A 3T51B 4QUKA 2AMYA 1XTJA 2B4QA 3USCS 3U26A 1XZCA 4PRZA 2Y2UA 4CI0B 1G66A 1OD6A 1R9NA 1C1DA 2IUSA 3BIJA 2W6JD 3INGA 4LQLA 5AUQA 2FZGA 1X77A 3M34A 3M4NA 1Q12A 2JBAB 4M83A 2J3LA 2XJ9A 2Q3EA 1WDWB 2CNOA 2HIAA 2E5WA 3MD9A 3D5TA 2O05A 1CG6A 1VPEA 1GEEA 4BAGA 3BHNA 1EFPB 4TLDA 4JEUA 4B9EA 2XNKA 3ZYCA 1KK2A 3VPGA 4YRPA 1XQ9A 3AVUA 3D7MA 5KVVA 5K0ZA 1LDBA 3SXPA 4UEQA 2F1RA 4YEJA 1AKYA 1IPEA 2GR9A 3D2CA 4D9FA 4K88A 1CQIB 1NBHA 2VI5A 1DHTA 4XA8A 3ZJ5A 1O94C 2WJPA 1CZUA 4ABTA 1JPVA 3FTEA 4LVUA 1UDCA 3ID6C 3N2LA 3O6VA 1NFQA 1JXMA 1PTKA 2BSXA 2AFRA 2R2AA 3A3PA 4ZGWA 3V1NA 1L8AA 1GO2A 2C0QA 4YB8A 4YP9A 4LZPA 3ZGNA 5KOYA 4CG3A 3VSEA 5JDIA 3C14C 2XNDA 5DTIA 5A3QA 2P0YA 1SD1A 3O0TA 1K3TA 2RJ3A 3GIWA 1IBRA 3UKOA 4LDPA 4R7GA 4CIWA 5KCZA 5KO2A 3FYCA 4CPDA 2SNIE 2Y1FA 5TDHA 4ARCA 5BWLA 1VL2A 1XPJA 5HKBA 2AMJA 3FPJA 2A9FA 4INZA 1XA4A 3CW2A 1LNQA 4KN8A 1E2PA 4N49A 4ZT4A 2HBQA 1JAZA 1ZNWA 3BE5A 2C31A 1ENYA 4HWOA 5BQPA 4IDAA 3ABIA 2DIEA 5F98A 1G8KA 2ID7A 2LPMA 3BGOS 2WJWA 1JJ7A 4QOHA 4FDVA 3B1YA 1HKHA 1V5GA 3GLGE 2I76A 1T0HB 3FYUB 4OLAA 5DHAA 2G82A 4AICA 2JIMA 1DELA 1C3OB 4G26A 3RD5A 9GPBA 5JAIA 4DQDA 4X8IA 3QFFA 2GA9A 4RZ2A 2C5GA 3LNTA 3RS3A 2EF0A 3GLFA 3KLPX 4ZPXA 2Y0EA 2OFFA 3OAAA 2GAJA 2QTAA 3KS9A 3CC4B 2D2VA 3LA8A 5ALMA 2OZPA 1BMFD 1P2SA 2FUKA 2DUUA 4Z7QB 5KDDA 2I6FA 2BEJA 3C2QA 3GLKA 3GXBA 1VBMA 4TKVA 2RAVA 3F8SA 5KINB 1CIJA 1JWBB 1N07A 2EIHA 3G7UA 4OFXA 4PO1A 2C2KA 1Z07A 2ES4A 4IZ6A 3IPCA 3EWIA 4HNVA 3VR6A 4DADA 3K0FA 3RUAA 2I3GA 3H42B 3NAMA 3BY2A 3DZBA 2GB4A 2EWMA 2ARKA 2CHUA 3NYIA 1YI8A 4W9MC 3N6RA 3CZ4A 5EWJA 2XWPA 4CEHA 1ZU5A 5B30A 4DCPA 1TQ6A 2YASA 1P1IA 2OL4A 5LZ7A 5KAMA 5CFMA 1WTHD 2R1ZA 1GN9A 2FYTA 2LZJA 1EFAA 3O21A 4A8HA 1E58A 1ZOIA 5E6SB 2HF2A 2QAGC 3EBOA 3UENA 2FTKE 1BYIA 3R4VA 4MVJD 1QR6A 4L76A 4QFBA 5KKAA 3DBIA 4YJ3F 4J4TA 4AXXA 1JIVA 3GLIE 2AFHE 3C97A 4QUJA 1RAAA 4R1SA 4WKPA 3EVZA 4E5VA 4NG4A 4OSOA 5A71A 4GIBA 1YR3A 1CULC 1JHPA 1MD9A 2R5NA 4O29A 3HGQA 2A0YA 1BROA 2HHHB 3A4MA 2VBFA 3PUWA 3PPXA 3LKBA 4RY8A 5KSPA 4FMDF 1MAUA 3GLFE 4LV5B 2CV1A 2YW2A 3TG2A 5KNCD 3K0BA 3OX3A 1CUUA 3TD9A 2B83A 4S1VA 4UXIA 1LY1A 4MMZB 5EJEA 1YJQA 4GI1A 3NI2A 4GKBA 2O5CA 3MC1A 4P4SA 1R64A 1SJ9A 3WE7A 1G291 1KDPA 2AKAB 3V8NA 3W3AH 2P3MA 4B3SB 5TMEA 4H77A 5A62A 3LYAA 1JI3A 1U3TA 1VI6A 5K3EA 1Z2CA 1U0EA 1A5ZA 1H6CA 1QH1B 1JVNA 3HM2A 2YWDA 4QLAA 5EUCA 4FBGA 1DX6A 5B4TA 4KVAA 1NLFA 5GJBA 2GBCA 1HDXA 2C5EA 4LYHA 4G5FA 3BXEA 2ATVA 4ZO7A 1HFEL 3TVDA 5DYTA 2R66A 4OP1A 4BUJA 1U8EA 3K16A 2K7FA 3PFIA 3D0KA 5AOAA 5JISA 3QKRA 3UUWA 2GQFA 1CRZA 2O8BA 4JNKA 1FJ2A 4DBVO 2EFHB 3H4TA 3IT1A 5ED4A 5KVCA 2KQUA 2R7MA 2O7RA 5C4MA 1CQIA 3WP0A 1YGPA 1YCGA 3PSHA 1VI2A 4MR8B 3A1EA 5JECA 2QEQA 2W98A 5HW0A 1LWNA 3DAHA 1KMQA 4Z4CA 1EH5A 2HXSA 2YZKA 1YS9A 2BCEA 4UZUA 4MPJA 4DLPA 3DE3X 3EPKA 4CNBA 4QQFA 3JQ9C 4ZYUA 5KQGA 1P4HA 5M29A 1FU7A 4E12A 3K6SA 3L41A 4QGBA 3RUCA 1GGEA 3AP2A 2G9ZA 3L8GA 1FU4A 1GYPA 3AQIA 4LHVA 2XX3A 4HXYA 5A4DA 1WQ1R 3NHFA 3QIAA 3FTCA 2BEUA 1UC5B 2HU5A 4K28A 5TF4A 5ULLA 1Q0QA 1NV9A 5DCYA 2WHQA 1IN4A 3AHHA 1A2OA 3SJBA 4M1YA 3U7IA 4RQUA 1KI3A 1NF9A 5A4KA 1NF3A 3B7PA 1RLUA 2VWQA 3INYA 1T2AA 3KB6A 4J1QA 3VX3A 5HHTA 1KI7A 3PICA 4EUEA 2C20A 5E7QA 5A4FS 2A2ZA 1TU4A 4NULA 4RS3A 2H54A 1XMQB 2C9CA 2ZSKA 5I3ZA 1AMNA 4B6GA 3IB6A 1EVEA 3WRVA 1PJ2A 1RYNA 4MV7A 4PSCA 4UAVA 1NOJA 3WK7A 1UBCA 1UWCA 3QGMA 4FW9A 3PGJA 4HAUA 3U5TA 3V7FA 3F4KA 5AJUA 2R6JA 4KP7A 1C9DB 3SMVA 1JR3E 5I4KA 5JXWA 1AK2A 3O47A 1T0BA 4C4ZA 1KY5A 2XMQA 2JIZA 2XXBA 4FFDA 3LVFO 5BYJA 2IYLD 1AGNA 1JTFA 5JNTA 4EL5A 2H7CA 3RVSA 5ALQA 2YS6A 3L04A 4HRVA 4CM7A 1LDEA 3BSFA 1DDGA 3WMRA 3TB6A 3CT6A 4PICA 3GRUA 3S81A 2ZM6B 2J33A 3FNHA 4TLMB 1D0SA 2Q7XA 2E48A 3WB2A 1F2UB 1Y1PA 3NAGA 5I8WA 3TB4A 2X13A 3GCDA 1V47A 5A5DA 3RT1A 3IUQA 3AVYA 4NYIQ 4B73A 2RHRA 1ZS9A 5ICCA 1Y3IA 1QIEA 3OICA 3ZNOA 4QELA 3ZQ4A 1LU9A 1BXKA 1KJNA 2REBA 3R7LA 5HPYB 2Y1KA 3PPIA 2VYNA 3TQFA 1VHQA 4MQBA 1E9CA 1ZCJA 4L51A 4N12A 4TXMA 4H1HA 1FLAA 2VSYA 4QTYA 1IEQA 1W0JD 3CR3C 2VXBA 5KSWB 1C0LA 4YRJA 3VKWA 4IVPA 2JEOA 4RYLA 1OHHA 1MIHA 1LK5A 3D8SA 3F6RA 3QXCA 3C6ZA 3FPCA 3W4IA 2G3YA 5CBPB 3VKGA 1QANA 3R23A 2XYVA 1TUIA 5F5XA 5JDIC 5JYCA 4JY7A 4EATA 1MVNA 3DBOB 3OQVA 1T4DA 3BUSA 5A1JA 3RV4A 3F7NA 1KVUA 3P9NA 5ESDA 3URKA 3V46A 4C22A 2FPRA 1GARA 4RLFA 5CM2Z 4W1QA 1OI2A 5GZ1A 2RHHA 4LTDA 4QYWA 2XNHA 2YVUA 3VZCA 1A95A 1I2MA 4IQ4A 3TUZC 2O2HA 3JWEA 4HJRA 3UH1A 2A5FA 4BLTA 2PMKA 2K87A 3O31A 1GNRA 5JLAA 1NXOA 1OI4A 3IKVA 4DK0A 3ROMA 4JI8B 3E9RA 1D2GA 5DNEA 4KDEA 4AQYB 4FYVA 3SXUA 3LUPA 2QRPA 4M21A 1HLPA 1KR5A 3KQTA 4CKBB 4ND5A 3RDPA 5JQGB 3L2OB 1P2UA 3UBTA 1SBIA 4NH0A 4F2WA 5E2AA 1QLJA 1IBMB 3SY8A 2JF0A 3M7IA 1ISSA 3TLXA 1VMEA 1MV8A 3FH0A 3Q12A 3OUZA 1Y0YA 3W2GA 1Q7GA 1RKVA 1Z9BA 3OPQA 4C4RA 4E0BA 3OLZA 5KS2A 1MPTA 4MUBA 3K7EA 2PZJA 3VKUA 1AIPA 4JMLA 3AR5A 5SYNA 2QX8A 5GVRA 5CCXA 2R6GA 4E5PA 3PUKA 2DUNA 2VSQA 4EJFA 1BG6A 3OZ7A 3BCSA 4E94A 2OTJB 1QGDA 4LWQA 1N2GA 2VF5X 1SXJE 2C97A 3I5MA 5AOCA 4ZN6A 1JEYA 4TWAA 4KOEC 4DLAA 3FCEA 5F52A 1XPRA 2ZI4A 3IAS6 1S96A 3MCUA 2HYIC 3QP9A 3QXJA 5DRYA 3TMYA 4P3KA 3H4MA 3PGVA 4IVRA 3ZGYA 1DKOA 3GT3A 2E1PA 3DFIA 4Y1EA 4O2BF 4X1YB 1TF2A 5K3DA 5F51A 1PFVA 2IPXA 4YHHB 3ODGA 4B3RB 3MLAA 1UDRA 3TI9A 3WGJA 5J43A 5T67A 3N76A 1TVCA 3FMIA 1GHTA 4PWYA 3RYFB 4KE8A 3RIXA 4A23A 2WJ6A 1I14A 1P62B 1SCNE 4IQ8A 2VYND 3H05A 4MYCA 4O0LA 3S99A 3VDRA 3ZCUA 2J7PD 1OZ0A 4IEFB 1YZUA 5L8VA 4D9BA 4GKVA 3ASQA 1B6GA 2QRUA 3RRZA 2KI5A 3WGTA 3FUXA 1Q6ZA 2QSYA 1DRUA 2NTVA 3Q3CA 1NUQA 4K40A 5CVJA 2JAUA 2PKRA 3GL9A 1GVHA 3HS3A 4HN4B 4IHKA 2KSQA 1Q1EA 2PX2A 2XNDD 3E58A 3L7BA 4IUBS 4AJIA 1SQ0A 1CZRA 5C52B 1JHXA 4L5CA 1GU1A 5FYQA 5IBPA 3WLEA 1XKTA 3CXRA 4GO1A 1IAQA 3KTOA 4GOND 4OHYA 4QUAA 3W5DA 1JVSA 4JS0A 3ZHSA 2I54A 1I33A 1LVUA 4X7RA 2YHAA 4M2LA 1UP4A 2QX9A 3UB2A 5C8DA 1TCCA 3MJVA 1M6VA 3RVPA 3PHIA 5C8YB 5LR6A 3AEKA 1S9HA 3IERA 3QE0A 4Q5IA 5ITVA 2ICAA 3HKEA 4NOJA 4H31A 3B78A 3CYFA 4YJHA 2F43A 3BJRA 5BWBA 2Z56A 3W5CA 1YA8A 3UAXA 2PX0A 5CDFE 4PXSA 1MEEA 2VJAA 4CCAA 1PJ6A 4G1BA 5D8DA 4TWRA 2GAFA 2X77A 3G0IA 5K3FB 2C78A 1OBCA 3MNFA 2ONKA 2BI8A 5T3YA 3PV0A 1TYCA 1N5OX 3DTNA 3UMYA 4TL6A 4K9NA 1TF7A 3FCSB 2QG9A 3ZWOA 3OLWA 4Q93A 1UKVY 2NM0A 5EMHA 4YR9A 4I8IA 4OJKA 1MO4A 3GUHA 5DHRA 4TVSA 1YVPA 1EDZA 3GJ8A 3NDRA 2ZRPA 3HB5X 3B1KA 2XADA 4OQDA 4UEOA 3TO5A 4ZYLA 1RVDA 4Y3UA 3O38A 2WA1A 4JX9A 4K81B 2PMEA 5BR1A 4FYJA 1WZUA 1A9OA 2OORA 4YRZA 3CLRD 1GXSA 3A6GA 4WD3A 3NTUA 3ZV4A 4OIFA 3KG2A 3TIXB 3I2GA 3CPEA 3DKPA 4LKRA 3E4DA 3GPDG 3QEMB 2ZQ5A 3VZSA 2F1IA 4BU0A 1NL3A 3ELDA 3JQ9A 1A2BA 3JWGA 3QITA 4FYPA 2J0QA 5FOQA 1XAJA 2ZRKA 3F90A 3ILYA 1P7ZA 3VPSA 1OJLA 1S3IA 2I6GA 4N1AA 3EFEA 5J2TB 1X19A 4Z4YA 4DIDA 1TQ8A 2WIAA 3TS1A 3D31A 3ZK8A 2JJQA 1JNYA 2I3BA 2GN0A 2ZUVA 4WZBE 3U81A 2PZ8A 2ACKA 1D2HA 3DMRA 4OFWA 3R7WB 2EW1A 4K9KA 5ETJA 1SXJC 1RXWA 2AKYA 1RS0A 2YWJA 4LOAA 1LVHA 4G8BA 3E9EA 4J0QA 1EE2A 4QBFA 3CUSA 1F17A 3DCIA 4NENB 1O54A 2V5UA 4RW0A 3PTLA 4CTKA 4YMGA 4MRSA 4Y9UA 4QPCA 1LPPA 1MC1A 1V6SA 2O4CA 2QRZA 1UZNA 3VRHA 3NTVA 2CFOA 1KAHA 1OFIA 2QVLA 1ODIA 3NW9A 4QEDA 4R2JA 3WFJA 5AW9A 1RPTA 1FXWF 1GKKA 3EUFA 3O8OB 3AKZA 3R6JA 4LSWA 3BC9A 2JH9A 4RF5A 4PIVA 2B69A 4WQMA 3KLOA 3G68A 4RXUA 3TSOA 3DE6X 5H5JA 2IIQA 3MTGA 1Z34A 3WL7A 5JFOA 1OZAA 1RC0A 2X4LA 2B8NA 3RBAA 1HI9A 1KNXA 5KX5A 2P27A 3QSYA 2Q9AA 5BT8A 2WD8A 3NWOA 1PR9A 1EHYA 2H06A 1V6CA 3OJFA 5EUQB 3VR0A 4LMBA 5CA1F 1EUQA 1FW8A 1GPBA 4PSAA 4RY0A 5JAUA 2ZTVA 3IKTA 4K9LA 4OOXA 2BFDB 1XTKA 5IAAA 1FFBA 1MXFA 4FD2A 2QZ4A 2CLFB 1K86A 1K8QA 1ILWA 2BMAA 2ZBDA 3EGXA 3E1KA 4G37A 2C88A 2YJ4A 4ENPA 3KT8A 1U90A 2JL1A 2JIZD 2ZIGA 3CLVA 4EJSC 5BSGA 2PUBA 4KREA 1I6LA 4G36A 1YQEA 5AJWA 1ZKDA 1SUCA 3GVKA 5K2MA 4BNXA 2W4IA 4MWSA 4DT1A 5JHHB 4BEJA 3Q39A 1U2PA 1WBDA 2IXEA 4E31A 6REQA 2ODPA 2VJDA 4II3A 3CCMB 5JNLA 1CRPA 1XQXA 1CB0A 2AN5A 4HXFB 4PBSA 2QQFA 4QUHA 1ZGJA 3E4CA 4G4IA 4H2DA 4POOA 3Q3GE 2PD6A 2Z98A 4G1CA 3AWDA 5EXDA 4KI7A 3UWSA 4A82A 4PG8A 1IB6A 4IHJA 1KXJA 3VC1A 3U3KA 2XHEA 1UJ6A 5CIWA 4C7OB 2I4TA 1N1DA 4FSHA 2ECKA 3LYHA 1UKZA 2F8MA 1RIFA 4AY5A 2YXLA 4CL3A 1QIFA 3Q5GA 5HS6A 1UBOS 1IN6A 1ML3A 1Q5PA 1RRPA 4XIGS 2MTBA 3MB8A 2IRWA 1TC1A 2O5RA 3K1TA 2PWAA 4YDRA 4RK5A 1LBIA 2VRCD 1LS1A 4ENQA 1Y8QB 1J56A 1YRAA 4RA9A 4WZBA 1YJNB 1WMBA 1WKVA 5U4QA 3P27A 4WKCA 5B58T 1NX6A 3RABA 4PYIA 1E61A 5BN3B 3IMCA 1L7BA 3LUBA 2QVZX 4RFSA 4AWBA 2ZYTX 2PFGA 4AKEA 4M86A 2COKA 2G8LA 3GCXA 1NC1A 4DMFA 2DTDA 1N9GB 4QGAA 3LG2A 1V3VA 5E95A 1VPWA 1ZEJA 5EAIA 3TQSA 1BAPA 4OJMX 1SC1A 2IYFA 3KXKA 2YFHA 3G0GA 2ACVA 1PWEA 4P54A 4DV7B 2GN1A 3GVJA 1P18A 2EFEB 3WSVA 5EEGA 1PJ5A 4LV6A 3OZSA 2WJHA 1FYDA 2ZVQX 1PS0A 3FLAA 4UBOA 5A5EA 2VDWA 2MSCB 5FPYA 4HOYA 2N47A 5FHRA 4PGHA 5BNZA 5HTOA 4BGUA 4YALA 3SKXA 1A9XA 3C39A 3M4XA 3FYUC 3OCZA 3TIFA 2GN9A 2NTNA 2AD1A 3SFVA 5DM70 1A96A 2CKMA 2NT4A 3BXFA 2HAEA 2O5VA 2XMDA 3CE6A 1YASA 4OB8A 5BUCA 2HLDD 4FKBA 1FOEB 2RCYA 1HE2A 5HDBB 1P7CA 1WMFA 2Q2WA 1IZ9A 1Q7EA 2FRXA 4MO2A 1PJ3A 1TE2A 1NBMD 2DMRA 1L9XA 2IYXA 3PJFA 3MTEA 2XE6A 2WWGA 4AX8A 1E1LA 4HWRA 2JDIA 4GKKB 1CS0B 2RMKA 1J8MF 3OCYA 1KDTA 1ZI6A 5B57C 1DWOA 1ZRHA 2QZSA 2YN2A 2QXUA 3FG9A 3K9WA 3FOCA 3LBAA 3F1LA 2G28A 3ZCQA 1GDHA 4LOLA 1GRRA 3W9YA 3OUUA 3QV1A 4B0PA 1RFGE 4B3HA 4MARA 4TYNA 2V55B 1PGPA 2Z5FA 4DMHA 3K70C 2DBZA 4YMWA 4P9SA 1JDNA 1J99A 4D6YA 4CI9A 2UU9B 5C80A 1YHQB 3V7AA 2R8XA 3HDGA 2MHCA 4M9XA 4PS0A 4DLVA 1X87A 4E1BA 1G8SA 3JD3A 1EBBA 2I3ZA 3ZHZA 3G0OA 4BN5A 3R5SA 2IP2A 4ZI3A 2AC7A 2ZWAA 3F3SA 1MUUA 2CE2X 2J6BA 3IFSA 1XTUA 3OWHA 4KMMA 4OBWA 4D9GA 3DZDA 6GPBA 1Z7BA 2A84A 1SN7A 1XXHA 4LK3A 4OHPA 1YOVA 3O8LA 2R62A 3L46A 4CG2A 4BVBA 3ZZUA 3RYCA 2ATIA 3QELB 3U49A 1SAYA 3QA9A 5CDYA 1ZC4A 2O4UX 5ECDA 1X7XA 2XQGA 3RYHB 3BXPA 1I4TD 3NHZA 4JXZA 3B8HA 4YDHB 1AM4D 1Z7EA 3GCGA 3R0JA 4BE9A 5LOVB 5HKKA 1DBPA 1A4XA 3KSAC 1GZDA 1L8LA 1UJ4A 3C70A 1QRAA 3IAFA 5B3JA 3OFSA 1ZH8A 5CFOA 1SVLA 1DBWA 4PLZA 4C7KA 1E32A 1H2ZA 2RKWA 4D0RA 2QW8A 2EKPA 1LNSA 3KQUA 1P7PA 2YMQA 2WAAA 3DAPA 3DV2A 2PPLA 2BELA 4MVJH 4CF4A 1WUJS 4XB6B 3ESCA 1H65A 1DBVO 1RQGA 3KQOA 5CVEA 4GEKA 4D0NA 1U65A 4I1YA 4KL8S 8MHTA 2Y1DA 1OJ7A 4IHJF 1AXGA 3Q3IA 1EMDA 2IXDA 4E3WA 3KB2A 1VQ6B 4TMZA 1O9HA 1OC2A 2LP4Y 3EDOA 5D3ZA 5B3AA 5L3QA 2X8LA 1D09A 1II8B 3OW2B 2DWCA 4PPYA 2HF7A 2JGDB 2Q6OA 3NHPA 1TZ2A 3HCAA 4JHXA 4EG6A 1PDWA 4RIFA 5DCWA 2YRFA 4E13A 1XTQA 1GG9A 5AW3A 4MW1A 2XKKA 3L7JA 2N75A 4UUBA 5FBKA 1F1BA 1CT9A 1UR5A 3CGWA 4TQ9A 1C7RA 1KFEB 2FPMA 3IQFA 4KSCA 3RU2A 4KR2A 4PZLA 2GK3A 3E8XA 3UG6A 1Q0SA 5A3RA 1T5TA 1L3BA 3P5BA 1UFOA 1BZYA 3RH0A 3C6QA 2P2DA 3FSEA 2ZUDA 1H23A 4ZZ1A 1WY7A 3GFPA 2CFIA 4RTNA 3A2KA 3A8JA 1YZKA 1LKZA 3KR1A 3NIWA 4NE2A 1JEJA 1RCUA 2QBYB 1EVJA 3ZWWA 3BM5A 1UOPA 5TX7A 3DXFA 1FDOA 1HDGO 1W76A 4RLHA 2FXVA 3TW0A 1TZJA 3AFHA 5BSUA 1OGYA 3QH4A 1PX2A 4IMPA 4A0SA 4A8TA 1H66A 1O2DA 1AU9A 5HJ2A 3OOYA 5KNDH 2YH2A 5EGNA 3B20A 4MP6A 4CZ2A 3DTTA 1MVLA 3I01M 4PE5B 4WOCA 1TJNA 1X8LA 3Q7PA 2WUFA 2FVYA 4PTYA 3WJ2A 4F3RA 2ZYRA 4PLVA 2X76A 5DSXA 1K27A 1U5BA 1IZZA 2A57A 1NVXQ 3A8IA 2WDZA 1NTOA 3Q0EA 3IAM6 2O8CB 1E59A 2FSPA 2IY7A 3GVXA 3SEQA 2FR8A 4OGWA 2H2GA 1Z8HA 4JH0A 3RK4A 1YDMA 4OA8A 3C41J 3BL6A 4RCZA 3KE9A 3OTQA 4AM8A 2B25A 2QTLA 3D4LA 3PU6A 4TXLA 4EKYA 1ACLA 3GBPA 3HHPA 3Q6IA 4B8ZA 1GLGA 1Z5WA 3WQBA 3ETDA 3S28A 4YAGA 2ZULA 1I32A 3EPPA 1WB6A 3MWKA 3T3IA 1VE1A 1P4GA 1WA5A 2FEWB 2G71A 2XBUA 2YY5A 3JATB 3QZUA 4JA0A 4TV9F 2XVYA 1PYDA 1I13A 1TM1E 1V16B 3AF5A 4LSGA 1PZXA 4WZTA 2BPOA 5EMNA 5JCXA 4QYTA 2P2YA 1OWLA 2CEKA 1O4VA 4RD1A 2FMXA 2J9XB 1W5TA 3FHJA 5H80A 1MO6A 3QJYA 3PA8A 1KBZA 5A3VA 4GZ6A 1VBKA 4LRWA 3B9QA 1TO1E 1QO0D 2BM0A 4W4TA 1LX6A 2HPZA 3OQHA 4ID9A 1ZW1A 3ZXXA 1LW6E 4BMSA 4N3NA 5BV0A 5IMSA 4RTOA 4OXQA 2WFMA 3GP5A 3M1IA 4IMIB 3G9ZA 2VDWB 5JJLA 3K8YA 4K8RB 2WJ4A 5IM4A 4IX9A 4Q1EA 4P6VF 4JLJA 5D6OA 4MIOA 2CFSA 1YRWA 1KR2A 4NBLA 3PF8A 1IUOA 1NG1A 2QEXB 1YR9A 2ZYGA 4Q3EA 3HXTA 3W9SA 2NV6A 4JUAA 3KUCA 2FQYA 2YY7A 3EWAA 1XL0A 4IRXA 3QYAA 4Y0AA 2DTXA 1DAEA 3TJZA 3UK6A 4YMTA 1QYIA 1HG1A 1EX9A 4MULA 4UMEA 4B3IA 1Y8RA 3N2ZB 2IXBA 2WFLA 1XT6A 1CVRA 2ANCA 5JCOA 3V00A 5IULC 2I6SA 2QL5A 1HT3A 5JC1A 4UTVA 3Q3EA 4MVJE 2Y92A 1K2WA 2PCJA 1T36B 4HEJA 4B3JA 2A58A 3SE0A 3RRFA 1V39A 4NLLA 5JQWA 5BN4B 3UH0A 2MMCA 2IUTA 4I8DA 3TD6A 8GPBA 1JJ2B 4EI9A 1EFLA 1GSAA 2D5IA 4MQ4A 1M8PA 4G5OA 4EYOA 2JGNA 3GVPA 3H8SA 3VYSB 2D00A 4KQFA 5B2EA 5CB4F 1F6WA 3T3OA 1FJXA 1SIUA 3SHFA 2R1UA 1J33A 1UJ5A 3T3PB 5LNK1 3N59A 4MW4A 3UY4A 1XZGA 2HOQA 1RFLA 2EX0A 3MQFA 4PZPA 1P61B 3TL3A 1FY2A 4URUR 3WLNA 4LXTA 1IQPA 2WU1A 4CQMB 5M7EA 2GVZC 2HSDA 2E9SA 1F38A 3W8NA 4EHIA 3NBFA 1HPLA 5ED0A 5EMMA 2F3QA 1VMIA 2R65A 4MMXB 2JCYA 4FCTA 5A06A 5KPDA 2XQKA 5KNDA 1H93A 1MG0A 3FVQA 4HK4A 3QXGA 3MQ4A 2VJKA 4BGEA 5JO0A 4MQMA 5CT6A 4B4DA 1QB8A 5CAEA 5I5EA 3M33A 3OCJA 1E96A 3C5EA 4O1HA 1G5RA 2UUAB 2ILTA 2VHCA 4M1TA 5JU6A 3A35A 1XV5A 1KYYA 2ZLBA 3U7GA 2V4MA 2JLWA 4TUYF 5DX0A 2IS1A 1CUJA 1D1QA 2ZJ1A 2C5BA 3G0CA 1FIUA 2XMCA 2OENG 5JNVA 5HDQA 1H05A 1RXCA 1YUNA 1P19A 2ORVA 1M1ZA 4UM8B 3C15C 1SUDA 3GLIA 3QUBA 1R5OA 1KI6A 3EGOA 1ZIDA 4RVCA 1YTUA 1YE8A 4HAVA 3WAKA 1O96A 3Q8KA 4IQFA 1PQUA 1N9KA 3A4TA 4RADA 1OXUA 4ZYWA 1GZ6A 1LWOA 1EWQA 5KW9A 1P1FA 2HXYA 2D1TA 1E9VA 3DL0A 3I9FA 4D1YA 2R47A 3IOEA 3AY7A 2W90A 4ZKDA 1M2GA 5DDIP 9ABPA 1CEEA 1LX7A 1U2SA 3AB3A 5KHAA 3NHUA 2WZDA 4JGGA 4GPIB 3I1JA 1LRKA 3K0FB 2WYHA 4OI1A 4BBPA 2QXYA 4LYAA 4JEIA 4O4JB 5DZSA 4ZCPA 1E3TA 4RLSA 3DC2A 4XARA 5BNFA 5D86A 4WZ6A 4MWZA 4TQAA 2UDPA 4K0RA 4FOLA 3AB7A 2B1QA 2FN8A 1PR0A 2GJ8A 5E38A 3HWWA 4TKVB 2XEDA 5K8TA 2V0GA 1NPDA 3FAKA 5JNUA 1US8A 4LQ4A 5EJ4A 1XD8A 3AU8A 2BGNA 1JLLA 2CW5A 2L17A 2FFRA 2WYVA 1WSAA 4Q16A 5KJEA 2Q07A 4KXVA 3F2VA 2PBFA 1L0BA 3TKAA 1YSCA 1TJPB 4RIEA 2Y76A 3P7MA 5JVDB 1EX7A 2OYSA 3FRIA 4A10A 4YJKA 1BMTA 4G81A 4KU4A 3H2GA 4GQNA 2ZZNA 2IV3A 4RY9A 2FF5A 3RYTC 3ZU6A 2XDYA 4LE1A 4YRRA 2OGZA 4DQVA 1EWVA 5IAJA 4JLBA 4A6PA 5K4GA 1O6CA 1UAYA 3NLLA 3T5PA 3EF3A 5CIQA 4E2YA 1S1MA 3C1UA 3HPQA 1GTMA 3GOQA 4J7CA 5KYXA 2Z2ZA 1I5EA 2BSQA 3CKMA 5IN5A 1NBMA 1N2XA 1G20B 4L4ZA 3ZQJA 2A5LA 4KQ6A 1N2OA 5JW6A 2WIKA 1VCOA 1YZLA 2PQMA 3QG5A 2J5BA 3BZBA 4R8SA 2OUIA 2WVAA 1U7HA 1QF7A 2VPWA 3BDVA 4HQKA 4CV2A 4ZAVA 2Z1MA 4R3UC 2MINA 4DLKA 5I7UA 4CIAA 4F2GA 2O8FA 1A82A 4NZYA 4KWCA 3JD4A 1P1BA 3LHKA 2RJOA 2HTEA 4KLRA 2ZJFA 4FHDA 4UDYX 1IYZA 4PGOA 4L6CA 1XG5A 2V9PA 3PWKA 4NMWA 3NU1A 5EIOA 3UT5B 4E5KA 1Y8ZA 3KKMA 1ZM7A 5BSKA 3IO3A 3AC0A 3O94A 3AEQA 4DNFA 1MQ9A 3AF0A 2PD3A 4CT0A 3B53X 4ZJUA 2BFNA 2P8SA 3QWHA 4HNGA 5J4LA 3TW8A 3JAWA 1SIBE 3BK7A 3DEZA 4ZVQA 4CIVA 1QGOA 3AHIA 4P4NA 1EZZA 1GSOA 1KJIA 3CO0S 1BQ3A 1F48A 4MI3A 1G42A 3VU8A 4L1KA 4HATA 5C34B 1RC8A 4N3GA 3H5AA 1BMDA 5HIIA 3I9JA 1XCGB 3C1OA 1OUMA 1P5RA 3W0LB 3KWMA 1SU4A 1L7OA 2OYNA 2HK6A 1CY0A 5JD3A 4DPMA 3QVUA 2FUCA 1VE5A 1W30A 3NGMA 2Q0SA 1EWKA 1WCIB 2P2LA 1EQUA 1U1CA 1G60A 3K94A 3N3AC 3LQQA 3L79A 4F4UA 3ENVA 5IJZA 3FZYA 4P92A 1VQMB 4PG6A 3DOJA 1WW2A 2YIVX 3JYQA 3P2KA 1EIZA 2WJVA 1SBNE 5AVSA 1XSEA 4RDJA 4B3FX 1QH9A 4A2WA 3QVJA 2JI9A 3FDIA 3OQIA 4NMXB 5HS4A 1R18A 4HXGA 3OFND 4UEJA 3W5VA 3O9MA 4BVJA 1NBEA 1E63A 3HCBA 4XQFA 4RL6A 4EHJA 4EY3A 1YR7A 5K5EA 4Z0TA 5JJKA 1G7SA 4OHMA 3W2IA 4YCJA 4KXXA 3NT4A 1AKMA 2JJ8A 1LGYA 4W1RA 1LDMA 3ZE2B 4TYPA 1HRKA 4YS6A 2W0MA 4FTWA 3USES 1T8YA 2OM6A 3CUUA 4NY1A 3OIGA 3JRXA 4AMVA 5IABA 4GP7A 4QOGA 3I0NA 3AF2A 5IC6A 3AEXA 3H65A 3SMQA 5JJIA 2CK3A 2N0SA 1TFRA 3AHFA 1IL0A 2Q2NA 1K4MA 3CW8X 1JQKA 1UPXA 1B3RA 4KE7A 5JCZA 2ZYAA 1EHIA 5BQOA 2F3SA 1DAPA 4WXHA 1ONPA 1SUWA 1EZ1A 5IJAA 4CFSA 4NAVA 2EEPA 3OQJA 2AJCA 1KO7A 1G9XA 1MGOA 1M1YA 1TYDE 3KQKA 3EWSA 4MRVA 1E5QA 3JQPA 1OYVA 4XKVA 3O7WA 3O5AA 4DLYA 3A9CA 2F3TA 5ALWA 4Q7JB 3WDLA 5JAZA 2H5IA 3RC3A 1VP3A 1OXXK 2FWBA 3QKUA 5KCMA 2A3RA 1FQKA 1EG7A 2DFKB 1M0EA 2YYAA 3HFGA 4C04A 1Z17A 3V8VA 5K1ZA 2M9MA 4CT5A 1Z0SA 3N2IA 3JD0A 2EX4A 4PVCA 1KTIA 1IJFA 3MGAA 2PMWB 2D3LA 3EDYA 1O87A 3HBJA 1AHIA 1FP7A 2I34A 1GZHB 4MZDA 3S2GA 2JRLA 5FOUA 3U1VA 3CNLA 4B0OA 3FTFA 2YYYA 4HNHA 1RABA 4J03A 1G3IA 3DOUA 5ALSA 2GM5A 5HBGA 3GIRA 4ZEXA 1WSWA 1ZY2A 3JQBC 3N28A 2C0PA 5L4SA 1G64A 4IIFA 3NONA 1K68A 1R37A 3LQ4A 5CBPA 3CESA 2A0WA 2NSJA 4XFDA 5KOJA 4OJTA 1NUTA 1WXHA 3TM4A 2QX7A 1TM7E 1Y6ZA 5H8WA 3HN6A 1UXOA 1ZJWA 1IUPA 1REQA 2JIDA 3O2JA 4L02A 4KKTA 5BVHA 3IL2A 3T6KA 3WL6A 5LP6C 2Q6LA 2X1LA 4RHEA 1U3VA 1YB5A 3SPXA 2P9JA 1VCIA 5CVUA 5FOSA 5UKDA 1UEIA 4KI0A 2G1AA 3LO5A 3N0XA 4Q19A 4V0RA 1H3NA 1MJHA 4CCWA 1SM4A 5BWCA 4C0SA 1EYZA 1FPMA 1K8XB 1Q1NA 3CZ9A 4U2EA 2GBFA 4CYMA 1ZC3A 4PPGA 4Y2RA 1SUAA 3FHCB 3KB8A 3ZE1B 5L46A 1ONSA 3M0EA 4I1PA 4KFSA 1P17A 2Q21A 1A76A 1OZFA 1QAMA 2JS7A 3E0QA 1Z7YA 4OQZA 4P93A 4R7ZA 3KLNA 3L8DA 1L8XA 4LHSA 1KC1A 4G4GA 3DMHA 3AVQA 1LJ8A 3EXFA 3GARA 3JYNA 2I65A 1PNVA 3SI7A 3IKJA 1SKUA 2X6TA 3AZOA 3CMAB 2AG6A 3A3BA 1ISIA 3GWZA 3OCCA 1GKIA 1TKCA 4U3JB 4Y6RA 2ECQA 1UBHS 3WO0A 4DYHA 3AMVA 3JSXA 3EEFA 3WWCA 5B5SA 3FSGD 3ZCRA 3H17A 3WGVA 2Y4OA 4U5XA 1DIOB 4JOQA 4KN5A 4YMVA 3RKRA 1M8JA 3A0UA 4UNPA 3C7KA 5C7LO 5M04A 3ASSA 1XDUA 5G53C 3LS2A 3U37A 3D3NA 3QPAA 3JAMA 1G8MA 1V9SA 3HYTA 4UUNA 2XXAB 1CYEA 2JLBA 4XX0A 4JDUA 1KQSB 1EDDA 2H2WA 1SVIA 2ZJYA 1G2OA 4G1UC 4J8PA 1PJQA 3K0CA 4F4DA 4QJBA 2WM9B 4OK5A 4QBGB 1W0JA 3X0DA 2V31A 3OEEA 3G05A 2NU7B 4ZARA 1OIWA 2EZUA 5ILGA 3I01A 2I87A 4HJXA 1OXKB 1ST3A 1KFBB 1KOLA 1DS6A 3TEJA 4ASUD 2JFUA 3EMVA 3N2EA 2W6CX 2GFIA 5M3BA 1AF7A 2MMGA 2XVXA 5D5QA 3A4VA 2GBPA 3MEQA 4HX5A 2I2FA 3DOEA 3TTTA 1I0IA 3H1EA 1RYBA 3EARA 5HMLA 1NW5A 3EZ6A 3PE6A 4XX0B 5DGHA 4FILA 4AXBA 1VQ4B 2VZ9A 4E2ZA 1PS8A 1HMYA 1RT9A 2IYTA 4YT2A 4XIFA 4MVJI 3B6KA 2PKYX 1WORA 2DLDA 4F4JA 2G40A 3MTIA 1SIWA 2VBSA 4KQMA 3R6DA 2GI4A 2PGJA 2L2QA 1OA1A 3DVQX 1VMDA 1E1DA 2DHRA 4OTZA 4JJ4A 3GRYA 4A15A 5CK5A 3OLYA 4B7AA 5KYUA 1BGVA 1GGHA 3DZIA 4NPHA 4R83A 4RCVA 1JJFA 5H3LA 5LC1A 3GPCA 4XGQA 3EZ9A 4IJUA 5ALOA 4PRKA 3U7EB 4L4YA 3ELYA 1VQOB 1NOIA 3VPXA 3CNNA 4GGOA 2PIAA 1SQSA 2QTVA 2X8JA 1EGAA 3LY8A 4RGVA 3T5GA 1R10A 4R1OA 3MZ0A 4V1CA 4Z54A 2XCIA 4CM9A 3CJRA 1J5PA 5C3MA 2ZM5A 2XTZA 4JBWA 4CLHA 4DEXA 3CTPA 1QIHA 1ODJA 3IP7A 2OM2A 4FX5A 1BQEA 1MDFA 1CHDA 1IHMA 1CNEA 3QKTA 5B1DA 4JCOA 2V03A 2NW6A 2IF0A 3QU2A 4Q7LA 2ERCA 4P3IA 3X2FA 1ODCA 3N8GA 3STYA 1JKXA 4HLUC 1TJ5A 2Q6TA 2IXAA 3WLOA 5HM8A 4OY3A 5ALDA 2PXHA 1Z18A 1ZD3A 4N5IX 4MPRA 1ETUA 1XELA 4RK4A 3FJOA 2ZRFA 4JI7B 3R20A 1CE8B 2PX6A 3UTDA 2AZ4A 3A2MA 1HDYA 4BKQA 3F3MA 1KSHA 1PFYA 3DDHA 1OH7A 1VI5A 2D13A 2WC1A 3TAUA 4EOGA