4AF6A

Pea fnr l268v mutant
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
296
structure length
296
Chain Sequence
HSKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVYTNDAGEVVKGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGVKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Backgrounds for the Formation of a Catalytically Competent Complex with Nadp(H) During Hydride Transfer in Ferredoxin-Nadp(+) Reductases.
pubmed doi rcsb
source organism Pisum sativum
molecule tags Oxidoreductase
molecule keywords FERREDOXIN--NADP REDUCTASE, LEAF ISOZYME, CHLOROPLASTIC
total genus 91
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4af6A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4af6A02
4EH1A 5HXBA 4B47A 3W2HA 4G5GA 2EFGA 2DETA 3ZZ0A 3I1FA 4LBYA 1EP1B 3W2IA 1W34A 3QFTA 1GVHA 3ZBUA 2QA4B 1QVFB 4ACAA 4TMZA 3E20A 4AC9A 5GV7A 1CNFA 5H59A 2PMDA 3WBJA 2B7CA 2PIAA 4K1XA 2B7BA 3OZUA 1BQEA 3ZZUA 4ZCIA 4PC6A 4TN1A 3WBKA 1DARA 2CNDA 1YIJB 1DDIA 3G4SB 3CC7B 3LVBA 4G1VA 3AVWA 1VQKB 4YAWA 1D2EA 3B8HA 1N8RD 1EP2B 4B4DA 1KK0A 2VNJA 4LBZA 4PC1A 1VQNB 2RC5A 1NJID 4C43A 1VQ9B 5KSWB 3OW2B 3AVYA 1VQ5B 4M0LA 3CCQB 3CXCB 4PC3A 2BF4A 4U9UA 1N0VC 1SM4A 3VNUA 3E1YE 4M53A 2J7KA 1B23P 1K9MD 2AHOA 3CCVB 2DERA 1Q81D 5TV2A 4P6VF 3W2GA 4NCNA 2YWHA 3CC2B 5H5JA 1I7PA 3ES9A 1VQOB 1E62A 2VZLA 1TUIA 3W2EA 1ZM9A 1GAWA 1GAQA 2D74A 4RD3A 1JA0A 1K73D 2FX3A 3CCEB 1H42A 4G1BA 4LC0A 3W5VA 2QEXB 1KQSB 4MYTA 4Y7CA 2HCJB 3AVXA 1W2BB 1JB9A 1GO2A 3QFSA 1EFCA 3WNDA 3CCJB 1JNYA 1JA1A 1FRNA 4Y9UA 2B5OA 1QUFA 1KK3A 1CQXA 4RCZA 4B48A 1GJRA 1BX1A 5FA6A 3MCAA 1IJEA 1YJNB 1XE1A 3CC4B 1IJFA 1N0UA 1G7SA 2QTZA 1QFZA 1Q82D 2VNHA 1E64A 2XNJA 1KK2A 1DDGA 3VNVA 3MMPA 3G71B 3QSYA 4TMWA 3WXMA 3W2FA 4PC7A 4B3XA 1F20A 4B43A 3MHPA 2RC6A 3WY9A 2BM0A 1Q86D 3QFCA 2VNIA 2BMWA 2BSAA 3VO2A 1G7RA 1R5NA 4H9GA 5GV8A 4PGOA 1YJ9B 4ZGNB 2C78A 3CPWB 3CMEB 2NPFA 4IW3B 1QVGB 3CCMB 3A1FA 1BJKA 1FNMA 1FRQA 1JJ2B 3P26A 4RD6A 3OJXA 1G7CA 1QFJA 3ZC3A 4YAUA 1A8PA 3J81k 2YWFA 2HMAA 1YHQB 2BVNA 1YI2B 2BN4A 4DQKA 1K8AD 3AVVA 3JQPA 1HA3A 1FNDA 1R5BA 2BGJA 5TR9A 4R71A 4B44A 1W87A 1EXMA 2C77A 4N3NA 4TMXA 1QG0A 3I55B 1B2RA 3JQQA 1VQLB 4MYUA 1KJZA 2DCUA 2EIXA 3VMFA 4M2LA 3JQRA 1ZM4A 1CNEA 5JBQA 3FJOA 3CCSB 3CB4A 3FPKA 1M90D 3CCRB 4UAJA 5THXA 1WDTA 3AGPA 2QTLA 1QX4A 1QGZA 2HDNB 2YWGA 4YALA 2DEUA 5DSZA 3QE2A 1IB0A 3CCLB 3SJZA 1E63A 3G6EB 1FNBA 2R6HA 4RD2A 1D1NA 1M1KD 1KK1A 1F60A 1XB2A 1QGAA 2ZITA 2YWEA 4C0SA 1VQ7B 4M4SA 3PENA 1D8TA 2BGIA 1GR1A 4YAOA 4M1KA 4RJLA 1H85A 3OZWA 3VO1A 2OTJB 1KC8D 3W5UA 4ZV4A 2VYQA 2PLFA 2OTLB 1EP3B 1W35A 2QN6A 1OGIA 3LYUA 3LRXA 4F7DA 1FNCA 4AF7A 4DQLA 3WNBA 2QDXA 4J0QA 4Y9RA 4BPRA 3AVUA 2BPOA 2OK7A 1TLLA 3ZZTA 1VQMB 1ZM2A 1OB2A 3P27A 4RD4A 3U6KA 2X3UA 3CRZA 4HE5A 3W5HA 2VNKA 4ACBA 1TVCA 1YJWB 3B78A 4FWTA 1OGJA 1VQ6B 4YHBA 3WYAA 3QFRA 1G7TA 5TY0A 1FDRA 3OZVA 3CCUB 1ZUNB 4TMVA 1YITB 1KTVA 4AF6A 2BV3A 3CMAB 4NBSA 3I56B 4RD1A 2GQFA 1R5OA 2E1RA 2GPJA 1Q7YD 1OB5A 4FK8A 1QFYA 1U2RA 4LBWA 1AMOA 4QFMA 1ZM3A 1VQ8B 1QH0A 3V76A 1EWYA 3ZBTA 2OK8A 4RD0A 2QMUA 1S72B 3CD6B 1SKQA 1QGYA 3U2QA 3CW2A 5AN9A 1EFUA 4TMTA 4QHYA 2XNCA 4RCYA 4PC2A 1VQ4B 4WQMA 3U6BA 2XEXA 1TTTA 1UMKA 4ZGQB 4Q7JB 4HE6A 3B82A 2CRVA 1KD1D 3AGQA 4P3YA 4ZCMA 1J9ZA 1EFTA 4LBVA 5EMNA 1NDHA 2BM1A 1DG1G 3WNCA 2DY1A 3OJWA 1BX0A 4ZCLA 4FN5A 1ELOA 3AVTA 1AIPA 3LO8A 4YAFA 1KRHA 1S0UA 4N3GA 1QUEA 1VQPB
chains in the Genus database with same CATH superfamily
1J0CA 4L85A 3JAWB 3OESA 4EGCB 5ITSA 4IH9A 2B20A 5LU9A 1XDDA 2FCAA 5EUQB 4PHFA 1XWWA 2VRCA 3B1WA 5KTRA 3W2HA 1N6LA 4OHRA 3VDRA 1TPYA 2EFGA 3PLRA 4WA8A 1MBZA 1W4BA 1ZOLA 4HDKB 1TFRA 3I1FA 2J5RA 2NSYA 2P5SA 3PQ7A 3VPCA 1Z25A 4MRRA 1E1RD 5DXJA 3RV3A 3FFTA 2GO7A 4FOPA 3Q98A 4IS3A 4QDXA 2YRWA 4D3DA 2PA0A 4RF4A 2C42A 2VF4X 1RQPA 3CJTA 3NIBA 4IQFA 3MRVA 4KB5A 3UPTA 2DE0X 2DH6A 1L9KA 3RTCA 2V98A 3ESCA 1ABBA 1VLQA 1Q1QA 1X1TA 1L5QA 1LI5A 3ROMA 3V7UA 3HU1A 1DJNA 3OAAD 5BWNA 1OLSB 2KB0A 3JTMA 4Y0NA 1NMYA 3VVMA 1VSUA 5CFMA 5J58A 1DGQA 1MFPA 2Q99A 2P9GA 4XVUA 1A9TA 1S01A 2B35A 1YDMA 1DIRA 2GCNA 2P0AA 2VS1A 3IQHX 3QUCA 4B8WA 5BWMA 5AI4A 3WBJA 4UOZA 3GA7A 3ASYA 3CLRC 3ER9A 3AHIA 3TXXA 3PNLA 2Q6IA 3FW1A 1ESMA 1G8AA 1YVDA 3SJAA 4X1OA 2I4OA 3H1FA 3S2GA 4ZVOA 4DXAA 1BOFA 3HL0A 2FZKA 2XF2A 1SHLA 4A4DA 1J1IA 4A73A 1TEXA 4HAOA 2IUYA 5LOVA 3WBKA 1BFUA 2HZBA 2QHXA 3GP5A 5CYOA 4D42A 1AHHA 1PV1A 1TQ8A 2GJPA 1I2CA 2A4MA 2Q2VA 4JOCA 3WGMA 3GSIA 2JJQA 3OZXA 1GTJ1 1NUUA 3A14A 1D2EA 2HL6A 4CFSA 3GLFE 1ZJYA 2WWHA 1UP6A 1ZUD1 2QVYX 1YJBA 4RFSA 2FZLA 1ZD1A 2DC1A 3QPUA 3V1MA 1NYRA 2VCHA 4MVJH 1YULA 1PR6A 3DGEC 1J56A 1VQNB 5FL7D 5LP1A 3HZOA 2VT3A 1XHFA 3E58A 1OREA 1I4OA 1QO0D 2MYUA 2AFIE 3FVRA 2PK3A 4RGYA 2OVFA 2J0UA 2R5WA 4JQCA 3S55A 1G59A 4QUIA 1URPA 2OV2A 1MHTA 5DO9A 3PFBA 4A1OA 2QR2A 4C87A 4DXDA 2RH5A 1FW8A 3RSZA 2H2HA 1PWXA 3HKDB 4M9SA 2E5LB 3D3EA 3QHPA 5ALTA 1I2BA 4V0LA 3UB4A 1R3DA 4D8WA 1R88A 5DCWA 3K2QA 4FONA 3L4EA 3LKZA 3EUAA 2GHTA 1F51E 1K9MD 3RG8A 1CUEA 3RC1A 4R81A 3QBVA 1Y9ZA 4FYMA 4REOA 4BVFA 2R6GA 4MPJA 5F7JA 4JLSA 1QP7A 5K05A 2R7MA 4C2UA 1ZUHA 6CHYA 5MF6A 4YUVA 2BMFA 1CF4A 3C48A 3IR5A 3C3JA 4EDHA 3Q7TA 1Q81D 5TMBA 4COOA 2V1UA 4Z3OA 4YA6A 2X3YA 1XUOA 5KX5A 1GCOA 2LBPA 4XVRA 3LFUA 1YR6A 2GT1A 2VRBA 5NLLA 3MWDB 4BQEA 4AKEA 3ZQ4A 4JJKA 3U7FB 3IDOA 4F4UA 1L7DA 3A3NA 2J59A 1MIHA 1C9EA 2V31A 3BTOA 2Z9CA 1PV2A 4AY6A 1OF1A 2IODA 1TJYA 1GN9A 2VATA 3L8EA 3ON5A 3GJ0A 4JIMA 2E89A 2IELA 1VQ1A 2HU7A 2OGZA 4OG2A 4R9UC 4RHFA 3R7FA 2CNKA 5JFTA 1TPZA 2AG8A 2Q28A 4LF4B 1Z4IA 4D25A 1GFSA 2RG7A 1E6LA 1LGYA 1P1IA 3WQSB 4X24A 3EDYA 1L7VC 3DM9B 3IBCA 4POOA 2YC4C 3QI7A 3ADKA 4RPBA 4OHMA 4DGQA 3HKDA 2F8SA 2DXIA 4LV6A 1Z6XA 4D96A 2QE7A 4IMPA 2C84A 1P45A 2E4ZA 2PZGA 3P9YA 3HADA 3TUIC 2HNKA 3QU7A 1YRYE 4I9HA 2FW9A 5TIIA 5LQUA 1QNLA 2FE4A 4HRVA 4RJ2A 1WL8A 3OECA 4WLOA 2NXJA 1Q0SA 3ADOA 1QC5A 3R4VA 2CZGA 4Q4AB 3GD5A 7MHTA 2Q49A 2B5OA 1OBFO 3DXZA 3LM8A 3QVXA 4B48A 1JIXA 5HFJA 1SHTX 1O0CA 3K0BA 4IJVA 4JQZA 1B6SA 1YJNB 1LVUA 2BUAA 2RBEA 3F2IA 3IUYA 4JWTA 2CXRA 2ZRLA 2Z2YA 4D44A 1KQGA 5AI8A 2GR9A 4KN5A 1RLUA 4RE6A 3AHGA 2YX1A 3A4NA 1XTZA 3ONEA 5DULA 4O3MA 2XNJA 4C7BA 1AB6A 1H2BA 1S2OA 1VIAA 4HXGA 4Q7MB 3RSFA 4N48A 2FDRA 1KC3A 2HB6A 5EUCA 4G23A 1VIVA 1MPTA 5EYPA 5CLFA 1HDGO 2I87A 4L5IA 3Q3GE 3VU3A 4B2YA 1POWA 4WT7A 3L6UA 4B3XA 1YO6A 1CZNA 1L8LA 3EF1A 4YI3A 5HG0A 4E4YA 3H83A 2DT5A 2IZ6A 2XMPA 3VM6A 3O2JA 3RWBA 1JSLA 2QN1A 4OXKA 4RANA 3RFVA 3SSNA 4BWYA 5IF3A 5JZOA 4DV1B 1YE3A 2AE2A 3EC7A 4EPVA 3LLMA 4LJLA 1LPOA 1NXTA 2LCFA 1VLVA 3CKKA 3F67A 4WZEA 4NC9A 1X74A 2JLRA 4H15A 4KW7A 5DVZA 1MAAA 1MJGM 2PUVA 5AW9A 4GQAA 3TEFA 4L08A 1ISGA 1A4RA 2RBKA 3AIOA 3GHHA 4V2UA 4JDPA 3L7CA 1WOPA 1S2IA 2C04A 1BE0A 1WTCA 5JAHA 2ZYTX 3DR5A 5ALEA 3CF0A 2ZZMA 3KOZA 1XMXA 1K7SN 2OMEA 3R74A 1C0PA 1RXYA 2O1SA 4EL0A 2ZJ4A 1IIBA 1S89A 3G89A 1FRQA 4NJMA 4JEHA 2Z8ZA 4KQEA 3HJUA 3W04A 2VHWA 1ECPA 4MAFA 3LVQE 5ERYA 2OBTA 1AF4A 3HCAA 2W6ID 4ETIA 1SEPA 5ESDA 3M6AA 4CEIB 2WTNA 1FMCA 5LNK1 4A36A 2FWBA 2ID8A 2B1JA 4FJ1A 4FFWA 1W49A 2QZSA 1ZN8A 3AU9A 3IP6A 3QMVA 1PX0A 3VGJA 3VH4A 1LW6E 3ND9A 4W9NA 3T1TA 1PJ8A 1U28C 2BFCB 3CIFA 3WLFA 1HA3A 3S4YA 3KP1A 5KX5F 2VPZA 1T8TA 2FRDA 3PCXA 4U2FA 2AQ8A 1DWQA 4V0MA 3PGJA 4EJ2A 5ICMA 5K3FB 2Y1WA 4DYVA 2VHZA 4TXNA 1L7RA 2WJJA 5BMOA 3IPAA 4Y2SA 4YRPA 2ORVA 3G59A 4LHSA 3W7AA 5EERA 4XWKA 2BEWB 1JFFA 3FI9A 1IY8A 1N5LA 3IAEA 2C77A 4MRPA 5L3ZA 4MDFA 4B76A 5JO0A 1I7DA 3ISJA 4MQMA 2VP4A 5TE9A 4EG8A 3EQ2A 1B2RA 3JQQA 3EXEB 1KSJA 1IOVA 1UBFA 3K0FA 3AVQA 4PZEA 2EIXA 4I5GA 4O4IB 5F9HA 3F97A 2ORYA 4QBKA 4XLCA 3VYTB 4OQNA 2C96A 4DDUA 1L5RA 5EP4A 5TNXA 1LH0A 1T6NA 2PMCA 3N75A 3LWDA 3RRFA 1D0IA 1F6BA 3OOJA 3ABSB 3A3GA 2Y0DA 3CCRB 5ALFA 2R44A 3TECE 3I5YA 3IEKA 1P31A 2IC5A 2OFPA 1NPTO 4DV3B 4Z4TA 1WU8A 3VFDA 1ECLA 5HP4A 1ZGHA 2BZSA 4O4LF 3KHUA 4B2PA 4O29A 4R0MA 1N06A 4LSZA 5CITA 2ZTGA 1G8JA 5AK0A 1A04A 3DFZA 3KJFA 1X1SA 1F3LA 4Y6GB 3ROPA 5T3YA 4TWJA 4FE3A 1YIAA 4H1UA 1SPXA 2AMVA 3AEUB 4LE0A 1JLLA 2AZXA 2ZTMA 2ZW9A 4CQNA 3EZNA 2VBGA 4RVOA 2XCQA 4OU4A 2RKOA 3ONFA 1WULS 2PH3A 4ZOBA 4FYWA 4EG0A 4EW6A 4WUTA 1QLWA 3ICVA 1S4MA 3C4VA 3UA4A 3DE0X 3T1HB 7YASA 3WYBA 2AF3C 2YWEA 3R0ZA 4R8KA 1X87A 2VPWA 4DA7A 4RM0A 1Y1SA 2V7UA 1E3DA 3OEWA 4O33A 5IEBA 1WXWA 2XB9A 4FGKA 2QX8A 3PT5A 4OLFA 5SZHB 5DE3A 2OHHA 3TLAA 2E4YA 1D8TA 1OC4A 2QQEA 1T0UA 2D1FA 3ESXA 3UG6A 1YL5A 3N07A 1KDYA 2R2GA 1FP2A 4XYMA 2EP5A 1OOEA 4KL8S 5EZYA 2Q5CA 4KO4S 4D4HA 4D98A 5JS1A 1Z2AA 4W1PA 3QTBA 4G2NA 1KEEA 3LVFO 1KC8D 3P0IA 3O2SB 3GLGA 2B9VA 2DCMA 1T5SA 1OILA 3G1UA 1YL7A 5CVVA 2VYQA 3NT5A 4PHHA 4WUVA 4Q7EA 1JQJC 1HYGA 3KK0A 1MLDA 2NTVA 2IEZA 2ZYVX 1NSTA 3MFQA 4JSYA 3LYUA 4ZAZA 2V8BA 2XQJA 5L4NA 3I8XA 1TKBA 2ECKA 1PDWA 1Y7TA 3M9XA 5H70A 1UK6A 2CC2A 4E5YA 1IHUA 3LU1A 2C8KA 2PZ8A 3LV8A 2XSZA 3LFHA 1YDEA 1PQUA 1IXKA 1ZSNA 3EIEA 3FCYA 3FFAA 4J16C 1XZCA 3IKMB 3R6TA 1T35A 1UFQA 3G7UA 4MWOA 2LIVA 3IAHA 4YRJA 3A9SA 2CDBA 2V4DA 2FWJA 4C3UA 1U5CA 2QDXA 2GYWA 2OL4A 1T0JB 2VSXA 2YV1A 1AZLA 1KKMA 3DVQX 3GI1A 4J7UA 4DCVA 3TGLA 4S0XA 1SC6A 3KQUA 1NUAA 1GNQA 5KB3A 1DX9A 4BUJA 3TJMA 3MJRA 1JEYA 3ZHZA 4FR2A 1AM4D 2DGDA 2VEDA 1T36B 4IZHA 5JRJA 3ONDA 4PVCA 4WHMA 4KQ1A 2X0IA 4XDYA 4Z1MA 3G79A 4UNIA 3TRIA 4HY3A 2O2IA 5DFAA 4OHYA 3IUQA 2H1OA 3DE5X 1XPUA 3TIIA 5LWQA 1TVCA 1C29B 1YJWB 3H5NA 4MR7A 1GPWB 3P9SA 4NZNA 5BSWA 5CLQA 4CMGA 4YAJA 1VLMA 4WBXC 3OEYA 1FPQA 4YHBA 1KWKA 3LIIA 3QWFA 2FI1A 5EFZA 4D0RA 3A4TA 2A9RA 2WTAA 2CYAA 3HA7A 3CVWA 3VR0A 1T2NA 2ZSJA 2P3OA 4LFAB 1GV1A 5I51A 2I2BA 2O0JA 2XT0A 1HYHA 3FKQA 1AKYA 2AVDA 2AJCA 4PAAA 1SIOA 3SJUA 1E3WA 1SIBE 3TOSA 4L9RA 3V2UA 1HNNA 2I03A 4HWKA 4K1LA 4CNBA 2J0VA 1NNEA 1IATA 1V7ZA 2BFPA 4MV3A 2G06A 3BSWA 4IS2A 1Z7WA 4US2R 1FMFA 4CKBB 1RZRA 1G5PA 3FMOB 4V03A 1B8UA 2AMFA 4C0QC 2J3DA 3PC3A 5AICA 5C1PA 4K6HA 4QG7A 4WINA 3ZH9B 3IEUA 5ISMA 2RHWA 1R5OA 3R41A 3M4ZA 2OG2A 1W2HA 4QUHA 3UB2A 1SC4A 3B2NA 1D5WA 3ZWPA 5AOCA 4KKVA 5J5AA 3THRA 3H7AA 4RIIA 6ADHA 5D3MB 2E55A 4A6EA 3OFKA 2QSJA 3QKSB 2PT5A 3H3XA 1Z6TA 3ROEA 1ZN7A 2OHXA 2WJ4A 2A1UA 5T4FA 2Y77A 3DKRA 4QOSA 1EUCB 2JHAA 3CC8A 4H77A 5JAOA 2PN1A 2FF5A 4Q03A 1P7VA 5L95A 4XJXA 2GN1A 4A03A 4BVKA 1S72B 2XMQA 3LX8A 1MOQA 3BULA 3FUTA 1RPNA 2BOVA 3DV0A 3BPSA 3HDJA 3HWSA 3IVMA 1X39A 4HNGA 1TJNA 3HCBA 1ZGBA 3UEOA 1TIBA 4K81B 4FDAA 3FRHA 3ZE6A 4QHYA 4DDMA 1VG9B 4XIFA 4F4HA 5CNIA 3QKRB 4FLMA 1FTGA 2EZTA 2WIAA 3REQA 3VJMA 3VSCA 4YMTA 2CDNA 1M6YA 2Q1TA 3EAFA 2IGBA 1U2SA 3LY7A 4IUYA 4D97A 4WCFB 5H7XA 5JJCA 2J9FA 1H2WA 2ZREA 4JQYA 4ARZA 1WUJS 2QRJA 3AF1A 3IDSA 4U3JA 3UHOA 2F2TA 4DK0A 3I04M 4NKRA 4KMSA 4KPUB 1T4BA 3PUXA 2HIGA 1YZLA 1DQSA 4G4JA 3NONA 1JI0A 4G25A 4KDFA 1MC1A 3KJHA 5J2TF 3FROA 1MJNA 3DL2A 1BJTA 4JXJA 5IJAA 2PFGA 2NUPA 4YMVA 2G1PA 4YONB 3NJRA 2HR1A 5DISB 2WFLA 3ELWA 3T1YB 3N58A 4LA4A 3UV3A 3AWDA 5BO5A 5T8KA 2O52A 2QIOA 1KDRA 1P0PA 3BMXA 5DH9A 4X41A 3IXLA 8LDHA 3X1JA 1WEHA 4RTKA 4W8GA 4TMYA 3IALA 3TLXA 4NULA 2QPOA 4UAUA 1E2DA 5FWDA 1KMNA 2WWWA 3M4XA 4J0KA 2P68A 4P0TA 4RV4A 3B1JA 4BKRA 3BXPA 4R2WA 1BA3A 1SD1A 1RKBA 4KQXA 5A3QA 7ADHA 1N8SA 3QE0A 1Z38A 2BGUA 2J5XA 4FXOA 4KQFA 1Y9AA 3L8DA 5JNTA 5HXBA 3FRJA 1ZU4A 2KW5A 2MHCA 1EFPA 2HOQA 3HK2A 3CPJB 1QHGA 3U3XA 2HBYA 1BMFA 2EW8A 3DMFA 4RC9A 2P4EA 2VBIA 2ZSAA 3G2QA 1Z28A 3VUEA 1P4JA 1FU4A 1LNSA 1LLQA 4EB6B 1EVIA 4GBED 4DPLA 4YV1A 4I9UA 5ALSA 4PW0A 4P25A 2I4IA 2X8LA 3L41A 4DV6B 5D1NA 1SKBA 3H5IA 5U9CA 2QORA 2C5SA 5T67A 2OCYC 4ER7A 1IBLB 3E9QA 2I54A 3WRWA 1GTRA 1DB3A 1L7NA 1GEGA 1BG6A 2V4UA 2YHUA 2PQ2A 2GNAA 4RJIA 4ZCQA 1V5VA 3AI7A 4OKIA 1WCWA 5CBKA 1WQ1R 3EMVA 4BX9A 1I1NA 4BE9A 1VG0B 4L5YA 1TUEA 2I4RA 3BWCA 4MVJM 5LBTA 5BOSA 2GK7A 2OZPA 3ASQA 5FL7A 1C3EA 1CUDA 1DFHA 1SURA 3R9KA 4EGSA 2B7BA 4QU8A 4QQRA 4LZAA 1BCRB 1YKSA 1IN8A 1YR1A 1R12A 1YK1A 1PZEA 2VQEB 2VVTA 3ZVKA 2X41A 4BMSA 5KYUA 4P9SA 1DAPA 2AMYA 3U3DA 1J00A 3ZXSA 2WTXA 2OO3A 5AVQA 1M7BA 1E79D 3M5DA 4WIAA 1WBBA 1O6CA 3AI3A 3Q3VA 3U4AA 5CIYA 2OV8A 1Y6GA 2ZVQX 4QTXA 4MP3A 3UATA 2YJ5A 3ME5A 2QPLA 2CJWA 1XMIA 1ZRHA 4GOOD 4NPCA 5ALOA 1K4KA 5AT1A 6PFKA 3M5WA 4G0WA 4JT2A 5FO0A 2FX2A 4J7XA 2UUCB 4EPRA 3GRAA 1JQ5A 4Q9IA 1BEEA 4NYJR 3EXEA 3MNFA 4DYHA 4R7TA 2OBLA 3ZGVA 4MPTA 1L4BA 4HTFB 5TQVA 1KY2A 3KPWA 1PLLA 4WXPA 5M7EA 4BQIA 4YUAA 1PVOA 2FK7A 2YIDA 3LF2A 4ON9A 4ZYWA 1HNXB 3OJEA 1WD5A 1XYYA 4QODA 1H94A 1P2FA 2D1SA 2IRWA 3A04A 4QDJA 1H3EA 2UYHA 3ICOA 5IM4F 3WKDA 1DCKA 4KK4A 5GJVC 1DCTA 3E1YE 3TRFA 5CIWA 3WGIA 1M1YA 3QE4A 1YS9A 1E2FA 3RS8A 1X8JA 2P67A 4F3YA 2QB5A 3C7KA 3VKUA 4A23A 2SKDA 4S0ZA 3GZTB 5ALZA 1DAOA 4P54A 1HL7A 3C14C 3DD5A 2CFIA 3L8MA 4II7A 3W2GA 1W0JA 3VKGA 4RNDB 1VE1A 2A59A 2J9GA 4RK0A 2Z1NA 4IIYA 2JLUA 3AUUA 1G2OA 4W9RA 3UK6A 5H5JA 5L3SA 2EJVA 2V7VA 5FPQA 5CB0A 4TRRA 2MSNA 1SOMA 1PJ4A 2R68A 1YX2A 4AP5A 1UKAA 3MYYA 4L9AA 4FHEA 1ZXBA 2BZ1A 4R4JA 5AKYA 5B3KA 2DTEA 3UGKA 5F3DA 2ZBFA 2IZ5A 3A4IA 3H13A 5K0BA 2OMKA 2Q0SA 1S2MA 3CLVA 4BC1A 1ZN2A 1H3FA 5JCOA 5HGXA 2ZSUA 4G84A 2GS9A 1N5IA 4Q9NA 2QXTA 3P5BA 1NT2A 3EDMA 4M0EA 1KQSB 4QC2A 3DVRX 5JROA 3OEHA 3SXUA 3ROGA 1XMSA 4QOJA 1GN8A 3ID6C 4DCGA 1LLDA 2CMKA 4HQOA 3JQCA 3FH0A 1BEZA 1LB1B 3K9CA 4G09A 4QEKA 3H84A 4BB6A 4QYIB 1NJ5A 1N6NA 3UMRA 5C18A 3BIFA 2PUEA 5C51B 1YHZA 3MAAC 2P75A 4J3FA 3GZJA 1B43A 4NZOA 5CVEA 5H0IA 3X43A 5KWJA 1VE6A 4DJFC 2J85A 1PNQA 4J4BA 2A0UA 4EB8A 2OZLB 5DTJA 4AYWA 2IXBA 2Z58A 1CDDA 1DKLA 3N7AA 1WPRA 2WJVA 2TRSB 1C1XB 3R75A 4MGZR 5J3JA 1QU2A 3NVAA 2PU7A 3F4LA 3ZHQA 3BB4A 1N5RA 2D2EA 4J2OA 1KNXA 3HYSA 3A06A 2JI4A 1ZNYA 1HURA 3T9CA 4FC7A 3CUVA 3F6EX 4QNMA 3MA0A 5EUMA 3VHQA 4C0AC 5EJAA 2C4TA 2NO9A 1X19A 3IMKA 3LDUA 1C7QA 2Y67A 1YZNA 1IM5A 4JJGA 4JVNA 2MMCA 4B5LA 4BZQA 4EFDA 1ZMOA 3R3ZA 1ZMRA 4QFBA 3KS9A 5AYVA 2V4MA 2L82A 1UANA 2OHFA 3E8XA 3MMNA 1JXAA 2ZWMA 2QTZA 1UAYA 4J1SA 5IJZA 3I76A 2W2LA 4EECA 3TGPA 4PPNA 1IQRA 4OPVA 3B7PA 4UDNA 7REQB 2WVGA 4K6FA 4L50A 4YT5A 4CCWA 4G7WA 3G71B 3LZCA 3OJ0A 4G4IA 4OXIA 2W90A 1AC5A 3EWSA 2HX1A 3IAAA 1IPFA 3DYIA 2F17A 4AI6A 3LX6A 4WCFC 3ZX5A 2HMWA 1U0OC 4WN3A 3NHAA 2F67A 3EDQA 2Q6KA 4EY8A 1PGQA 3OY2A 1PRYA 3BAFA 4D92A 3EUFA 2OO5A 3TLGB 1T8WA 1P18A 4UU8A 3FF1A 1CP2A 2YQ5A 3ZYZA 5SYAA 2BFEB 3DBRA 4Z8YA 2ZRCA 2FUG1 3KXIA 4FFDA 2CK3D 5B3LA 2D7DA 4YIKA 2DPYA 4G1EB 3C98A 1Q2XA 3UYLA 2ODQA 1JR3D 3HZRA 3THOA 3V97A 421PA 5MN5A 3LRPA 3G0HA 2BM8A 1GIAA 2E1PA 2HDWA 2ZJYA 4JK3A 4DNTB 4U7JA 3I6ZA 2V7QA 4YCAA 4KV7A 1KS9A 1RWKA 3OF2A 1GKUB 5E1MA 5K2MA 1V8PA 4Q1BA 4DOMA 3O7WA 3PSAA 1F9AA 2R66A 2VAMA 4HI0E 2PGLA 1GPH1 1HKHA 2FLWA 1N77A 3CY6A 2WD7A 4F85A 1G8YA 2G5GX 2WRZA 4UNQA 1B3RA 3MOIA 3GLKA 4HTAA 4B2IA 5BWLA 3MJTA 4O5OA 4LDPA 4TSKA 4FNAA 3T3PB 1XVIA 2PDAA 1KDOA 3CNNA 1R1DA 3FSEA 4OPSA 2QQFA 2PGIA 3OA0A 1EGMB 4NCJA 5ENDA 4JC4A 5A5EA 1EI9A 1V5GA 4FLEA 2ZTLA 5E6RB 3VZCA 3DCJA 2HMAA 4YXWD 1GUBA 3KR2A 2H4JA 1N1EA 3UMVA 1C9DB 2XCTB 2P7IA 2FZVA 1CLUA 2ZOSA 4HCJA 4DB4A 1J8QA 3HXLA 2ZQ5A 3EZYA 1X80A 5HA5A 5B7GA 1R5BA 5E7IA 1K5GA 1K98A 2W6PA 1QS0A 4ZO4A 1DIBA 5JRDS 4TSFA 1OY1A 3I05A 3E8SA 5AVYA 3OPVA 1R16A 4EUHA 1KARA 3HZZA 3Q3JB 4XEUA 5H3LA 3CMCO 3N2KA 3GCZA 5E95A 2IYZA 4N3NA 1MH1A 5C53B 5BMVB 2XIQA 3MF4A 3N8HA 1QG0A 1QIHA 4FBMA 4PG8A 3U09A 1CUJA 1BXGA 3WV4A 1ECJA 1SBYA 3RIXA 1A2BA 4IIBA 3PRYA 4M2LA 4YJ2F 2HADA 3JZIA 2IX3A 3SQOA 1EBBA 4AWBA 2VTVA 2Q46A 4TM7A 1CRQA 2ERXA 1TUGA 1R10A 2ZSHA 3OJFA 5DBOA 5FUYA 1G8HA 4CG0A 1HE8B 2A84A 3ZLTA 4XWYA 2HCRA 2IF0A 4AD8A 4G81A 4EVQA 2W2MA 2XOKD 2ZZGA 1NVGA 3DMTC 3AFMA 4CIVA 1IBCA 5DEOA 2WJIA 1W6RA 4URFA 4DC1A 3DLBA 4IBOA 1EUCA 2B1RA 2QYHA 3FWHA 3CIOA 3K5IA 4ADSG 3BZUA 5IVHA 2ZUUA 4BLSA 4EYQA 2OCIA 3CN9A 4RA6B 3DE3X 1K7FB 4NMXB 1XDZA 4CMJA 1DT3A 1ORDA 1VJSA 1G3UA 1MQAA 1TU4A 3RUDA 3WR5A 3SFVA 4MQLA 3QNMA 1DUSA 1II8A 2I3BA 4E46A 2VCYA 1IOWA 1E5VA 1VIMA 3ZGXA 1A27A 3D2BA 2O2DA 1E63A 1UODA 1XZDA 5BR1A 1E2HA 3CEPB 4ZYLA 4RD2A 3DDUA 5CVTA 2R8BA 4XVQA 1PP4A 4MLCA 3FTCA 4OQMA 1HEIA 1KK1A 3C6YA 1JFRA 1G19A 2HQ1A 4FYHA 2AZDA 5AJUA 2CWDA 1OKKA 2XECA 3H8VA 1VI6A 1E1DA 2ZITA 1N7IA 4I6EA 4I1SA 4NEGA 3UQYS 4C0SA 1V6CA 2ENWA 3IPYA 2Q4RA 5GONA 4GXTA 2FG7C 1Y6FA 2F6RA 3K09C 5BN1A 4M4SA 3VUFA 4HDSA 4JUBA 4E08A 4HPWA 3ET4A 4N5HX 1BLIA 3AB7A 4NEHB 3TTUA 4PYKA 4BTEA 2FEMA 1BEUB 2HSZA 1U7XA 3MLEA 3GXOA 4KPEC 1JEDA 4NL4H 1Z4PX 2YUTA 2OYNA 1J0EA 2YBDA 2ZIZA 1O97D 4TWAA 4Z4EA 1UBLS 4BFSA 2WJHA 1EYZA 4RJLA 2ZVDA 3OZWA 2WIFA 5LCXA 3TTTA 1K7CA 1RCUA 2JBAA 3CSDA 3MVEA 5E2AA 2BFNA 3DLPX 4XCVA 3TOCA 4YRMA 5C35A 2C7VA 2OHJA 4Z4WA 1YS4A 2HSEA 5HRUA 3AYXB 3DYVA 3W3AH 5JFGA 4F3KA 1CXZA 3WKEA 1JN0A 3HI4A 1DS6A 4XYBA 4EB0A 3EG9B 4ZYYA 3HS3A 1SC3A 2G88A 3VSEA 4Y1RB 1UOQA 2JRLA 3VZPA 4YRGA 1BGXT 4JQSA 4FR5A 4QLAA 4AMZA 1ECCA 3OIDA 3WIBA 3GEMA 3BJZA 1NXPA 3QTTA 1CZUA 4RZQA 4UJ3A 3SVZA 3H6KA 4BEVA 5BWOA 4L4YA 3R2JA 3TE6A 4RPCA 4N0MA 1TT5B 3GUVA 4HX9A 4M0FA 4IVRA 4MUXA 4CV1A 4FKMA 4TLAA 4L7QA 4L0QA 3SZ3A 2Y68A 3W5JA 2A2ZA 3O83A 5AI9A 1FTNA 3GJ8A 3QVVA 5EPUA 5J2UA 1QQTA 2V7EA 2PA3A 3O8DA 1E58A 1G6KA 1GGVA 1V9CA 1PQWA 3NO4A 4LRQA 1NBAA 2L69A 3JQBA 4J0FA 4TSRA 1CB0A 2H17A 1EUDB 4M37A 4WAUA 5KJ6A 1KDVA 3HQ4O 1HDOA 1RYHA 1ZH2A 1KFKB 5K3EA 5BQ3A 1VFPA 2BEVA 4N8DA 3RFCA 1DRVA 4EOGA 4XZ3A 3K0SA 4GM1A 2P9CA 2FSVA 4ZMRA 3C41J 4FSHA 3BT7A 4DDKA 5CLJA 4LIPD 2GNOA 1F8GA 1LQUA 2O9JA 4IMJB 5EWJB 3TOZA 2HO4A 1WHTB 2XMSA 2GCEA 3EIFA 3RUIA 5AESA 1OB2A 3CZAA 4BN0A 4ZI7F 5HYVA 2NAPA 1PS9A 1Y42X 3BERA 4EABA 2WG2A 2B3TA 4FDTA 2FSVC 1HDZA 2VNKA 1SXHA 1XELA 2QUAA 2R1ZA 2FSIA 3DTVA 1GRVA 3EWIA 3K53A 1N2GA 4JEIA 4EMBA 3KKKA 3V4ZA 5GM1A 5INTA 3ZGLA 4UBOA 3FPHA 4W8HA 5IT9A 4CTOA 4C88A 3SIXA 2BR3A 4J75A 1EK5A 1K4YA 2NZ2A 1KVUA 2C3MA 4G0OA 4U4AA 5K0ZA 5EZYB 2XH8A 4HB0A 2VO1A 1SD2A 5FHRA 3R3SA 2PS9A 3JALA 3GIWA 4XXHA 2IYLD 2WZNA 2PRYA 1OSNA 1MGOA 3LCRA 3TPCA 2FUEA 2VL7A 1OYYA 3R5SA 2XBUA 1YKGA 5CU7A 5BN3B 3Q8LA 3X0DA 1ZZGA 2HUPA 4BGIA 1BCRA 1PGNA 2CCJA 1JWAB 3ILSA 3TE7A 2XCRB 2ORED 4PLHA 2BH2A 2AR9A 3PF9A 5BVGB 5IYNA 5FFNA 4OHKA 4HGNA 4PZYA 1J0DA 1X8XA 1C8LA 1VOTA 2HSDA 4WKGA 3QUSA 2M6SA 1FSFA 2E1RA 5FI3A 2GPJA 1SXJC 3FMFA 4AZVA 2PRIA 5ECYA 1ZC3A 2DKFA 1AMNA 1YLOA 3COVA 2G17A 2B2XA 5AHXA 3HVJA 1OXMA 1NUQA 3O0TA 1M74A 1SH7A 2IU6A 3BY1A 2HA5A 3CXRA 3DJFA 3QELA 1KF0A 4KAJA 2I78A 4EG5A 5DW0A 2JLYA 2E48A 2ATXA 2WE7A 3G7NA 5G2OA 4IDBA 1SZDA 3V7AA 5CJJA 2HIHA 4BQOA 1AJEA 3O90A 3C7AA 2PXAA 4D41A 3DV9A 2JIBA 2YV5A 4EMTA 2CE7A 4IAOA 3TLEA 1ORHA 3IIMA 4A8HA 3KEGA 2ZL5A 1ADJA 4FQ5A 3SGLA 3ZX4A 5K8TA 4ILEA 1K92A 1YZGA 3KEFA 3KTDA 3BXOA 5JSZA 1ZH0A 4XORA 3LLUA 3A6JA 1UXOA 1JBEA 3IVRA 3PJRA 3D8NA 4DABA 4R54A 2OM2A 3VR6A 4DAEA 3EG5A 3K5WA 3SJBA 4QUZA 2IHUA 4GBGA 4M9UA 3GNLA 3V32A 1S8FA 4WRRA 4JI3B 2OQ2A 3GA0A 4P3YA 5LUBA 2AXEA 3BD8A 1M73E 3KKPA 2GZHA 1GSIA 1QGED 1EQUA 1YDHA 1DX6A 3M6FA 4RUKA 1YRAA 2WQ7A 1AXEA 3H5LA 1O9BA 2FWAA 4QT0A 2LKDA 5G3YA 4ZOAA 2P0YA 1SA0B 2O5RA 4F8EA 2FEOA 1YS1X 3DH0A 4PPQA 2QP9X 5BVHA 1JWBB 4GI5A 3URMA 3UF0A 2Y2UA 4CLHA 1NN3A 5KWVA 1MZPA 1EIZA 1MD9A 5EKTA 4L4UA 4RTPA 4ZCLA 1T5TA 1YRBA 1HORA 2W98A 4BX2A 2HWUA 3HEAA 5DM4A 4RKFA 4RQUA 1T6XA 4HB4A 1FTWA 1YXMA 2J3LA 4HDNA 3EWAA 4DM3A 1DEHA 1JDZA 1F8UA 1P4MA 1CUAA 1TUBB 3GPIA 4LQLA 3RH0A 1Y98A 3B9BA 4WBNA 1CVLA 1OA0A 1ZISA 2O4CA 4HQNA 4XA8A 1KJQA 3IIIA 5HMMA 3KJQA 2RKWA 4DMHA 4EIWA 3ZDFA 4AF8A 4F3TA 3R3UA 5A4FS 5B36A 1M1NA 4XLHA 1ICEA 2PPVA 2Q2WA 3R9IA 5SZKB 2DETA 1U4NA 3FCAA 3MJFA 4L3WA 3SR0A 2OCGA 3EYAA 4E15A 5CNMA 2A4KA 2D2FA 2Z83A 3GA5A 3MJCA 3SKYA 3VJKA 3VYWA 4YRFA 4V3BA 4LBYA 3WDSA 2Q9AA 4BQPA 3RR2A 2JKVA 2PFKA 4EVRA 4WESB 4BFUA 4DMLA 2MR6A 4I1VA 4NMLA 1P2TA 4TL8A 1IEVA 1V3UA 3VR5H 3P4XA 2O8CB 1A9PA 1I3LA 2C07A 4GF5A 4XB1A 4KDRA 1Q44A 4DNRB 1EFHA 4UD6A 1HYQA 4GOXA 3OZIA 5AMXA 1X1RA 3BXHA 3RNLA 2ZJZA 4JJ6A 5AM4A 5EKUA 4JJEA 5AJVB 3BMQB 4CKWA 2RAPA 1PO7A 4KWHA 4WNYA 4PPGA 2G0AA 1EJ0A 1GZVA 1NLYA 1E0DA 2FPIA 2IPXA 1P0MA 1IPEA 4FP9A 3ZZUA 4QXOA 4A1FA 1A4IA 4IGKA 2FRVA 4CL3A 1F9EA 4DQXA 4RTLA 1D3AA 3ICQB 4OYYA 2WM3A 4OP7A 3QVMA 4PXSA 2PVPA 3OJOA 2E21A 2GN0A 3K1AB 1NP3A 5DF1A 3FZGA 4IMIB 5M5BA 2V6BA 3V2HA 3KPYA 4UKDA 4YRLA 3VR5D 3ZQUA 1NF8A 1JRLA 4DIBA 4YAWA 2VHJA 3Q2KA 3ESBA 2GCGA 4NE9A 1C7ZA 1D6JA 1DOHA 5JG7A 4EY7A 5DB4A 4CTJA 1DMRA 3MUOA 2R1UA 3WGZA 2XNDA 1VLOA 2GM9A 4D0GA 1I4WA 2WYOA 5CT9A 4BFYA 1BDIA 3V80A 3CF2A 4I5DA 2PUBA 1HG0A 1UD4A 3R0QA 2NUTA 4DBLC 1OFHA 1NU8A 1KI2A 2J07A 2CNOA 1GPLA 1FLVA 1L4LA 2QGFA 5E6UA 5CJ2A 2P78A 4BKPA 1E3IA 4MV4A 1G55A 4QHSA 4ZCTA 1AF7A 2CLLB 2AK2A 2RGUA 2FMFA 1CETA 1NY5A 2HU5A 5F1KA 3ZTTA 1PJQA 1WDKA 4PTLA 5IARA 2P7HA 1RWMA 4LEIA 4G89A 3UXEA 1UBUS 4P2NA 1JV2B 1RLMA 1KI8A 1SVIA 1E6UA 1KJ9A 3OHSX 4I3GA 1JR6A 2YV3A 4R7ZA 3I23A 4QVIA 1PR3A 4CR8A 1SQ0A 5LOVF 4NPAA 3INNA 2B8JA 4JU9A 4XJSA 2Z5LA 3B5EA 3NV9A 3GX1A 5CDYA 6LDHA 3UUEA 3GFRA 3WNZA 2HIAA 1E43A 4XN0A 3DAFA 4U7GA 5KYYA 3DNMA 3HA2A 4Z9AA 1I4TD 2DJ5A 4RNCA 5F1OA 4HEA6 3ZU6A 5JSZB 1NATA 3A25A 3GG2A 5E1DA 5I7HA 1BVRA 2RIRA 1SXQA 3P0RA 4AJLA 2G0TA 1TUIA 1RNLA 2C9OA 3M5CA 1Y48E 2PS3A 3KUKA 1GU7A 2FKNA 2IX9A 1DKPA 4UEWA 5EIOA 4HNAA 5H9VA 5IDWA 2A0KA 3M33A 5CFNA 2VG8A 2JG3A 2RGBA 2WWFA 1YHYA 1Z0ZA 3RS0A 3W0LB 1WUTA 3R09A 5BV7A 1X80B 2CT8A 2D3LA 1OTYA 4HAWA 3MS7A 1YZ3A 4B2LA 5EVJA 2OXTA 4BLWA 4E94A 2IW1A 3ZY5A 4YV7A 3D6VA 4LOKA 3ZV4A 3LT0A 5FO1A 3JQEA 1PHPA 1U98A 4H31A 3RANA 4IHAA 1OZGA 1E0KA 3CUUA 3GRVA 1L5OA 4EA6A 1FLAA 5A0VA 4GWKA 2VJPA 4MOWA 4PFQA 5J4VA 4J1QA 4DLZA 1FFWA 1VP3A 3PYLA 2E5FA 3GOHA 3MGBA 4RSRA 2HDOA 1B8OA 4WI1A 1GO2A 3GLRA 5EWMA 5DWQA 4UCFA 3O92A 5BPFA 3WGNA 3V7YA 5FPSA 1O89A 1ZIXA 2V54A 3IQXA 3MYRA 2JK0A 3B38A 1QPGA 3CX4A 4B3BA 4YCNA 3OAAA 2JI6A 1FRNA 3FOZA 2HF8A 2Q3BA 2R4TA 2HK8A 1KPHA 4RCZA 1V41E 3K0AB 3H4VA 2GZ2A 3HRIA 5A06A 2UZ0A 3GBPA 3ZZ1A 1KNQA 4Z2AA 1AD2A 2Z1DA 2ZRKA 2I29A 3GMDA 3HYCA 3JQ8A 2Z8YA 4PZPA 2WJAA 4GKJB 1U80A 2AGVA 2I6TA 2O7QA 4V0ME 3RROA 2UZIR 4CUJA 4TV8A 1H4QA 3EIOA 1B0UA 1AY0A 2ZJFA 4K86A 4Z3KA 1USVA 4ALNA 5JANA 2VDPB 2Y6VA 5JQGF 1X7WA 2AQKA 4R84A 1BXRB 4KQGA 3U3RA 4KXNA 3HYTA 5L6LB 3NBZC 2GJ8A 1G9XA 1RPAA 3OBIA 2G7MC 4R1TA 3VBEA 2Z6BD 3C97A 1IVYA 5EWJA 3WXMA 3K9FC 1Z74A 5K0TA 4NAUA 1Q77A 4B43A 4R5MA 5AP9A 1FRVA 1WOOA 3DP9A 2E7ZA 3SM3A 1Y1RA 2IF2A 4HT3B 3ZDYB 4L4SA 3TBHA 3PP8A 4N5LA 4ESVA 3EZ2A 1BWPA 4J91A 3BJEA 4LYDA 1N0WA 2A78A 1TC1A 4PGMA 3PX3A 3VO2A 5F5LA 3NOOA 1JAYA 3NHLA 4WZZA 4I3HA 1E79A 4LJYA 4QELA 4DY4A 4OXXA 1A9YA 3FSGA 3ORQA 3ED1A 1VLZA 3CPWB 3CMEB 1GU0A 2NPFA 1QIEA 3FPLA 4IW3B 1DWPA 2ZU0C 4BJ5A 3NI2A 4FIDA 5ILOA 4RKWA 1G2PA 1X7DA 4OO3A 4WFKA 1XQYA 2PU5A 2NZWA 1JUDA 3I9MA 3DL0A 5AJYA 2WT8A 2WA2A 1TJ3A 1TE2A 2BGNA 1QJCA 2ZWAA 1IHMA 3ONWA 3OZEA 4YXFA 1JJ2B 5EIXA 3SJCA 1NHWA 4DZTA 4XOIA 4R1LA 2Y3IA 4US0R 2I4NA 3R5KA 4R1SA 4C4ZA 2YWFA 2VK4A 3ULKA 5HIAA 4QRHA 4JBXA 5JD5A 3CV3A 3HZHA 2ZETA 5DNAA 2N42A 2VZ8A 5E7QA 1II8B 4DQKA 3RYFB 2EKQA 2IZ7A 1STOA 3S1AA 3W4IA 4F5EA 1CUVA 4LGCA 3NKLA 1IHXA 3F3KA 1OE0A 3OIUA 1MXHA 3ZD7A 2ST1A 2F1MA 3GIRA 1FFHA 2C5LA 3T9FA 4D0NA 2I22A 4F4CA 1U94A 3MHTA 4I50F 4E0FA 1V8FA 3GFFA 4LJ5A 2P5TB 4B3JA 3BWDD 3FSRA 1LPBB 4F04A 2XOKA 1NZDA 3DP7A 1UADA 2GZDA 1ZCAA 3DDWA 5KU7A 1P1JA 3K9GA 1SU7A 2X1HA 4Q4LA 5BQ5A 1GQFA 4DVGA 4B7XA 1RZRD 3WWCA 1VQLB 1GRCA 4MYUA 2NX2A 4U63A 5D7BA 5LIPA 2A35A 3GEGA 2RMKA 3OQPA 4HQLA 3SYTA 2QTAA 1Q16A 5I5GA 2XXJA 3ZY6A 4GPD1 3FTQA 4X05A 5IMBA 1GZHB 4NOKA 3WSTA 1ZLXA 2WQ6A 3AWIA 3CH6A 4YC7A 1ODSA 2OCXA 2QTMA 3GG9A 2OSVA 2Y9MB 1V3VA 3JWJA 2ZRBA 3M6LA 2WLSA 3BZWA 4HAIA 1ZNXA 2LVBA 4HQFA 2XOEA 4KSBA 2PX8A 3ND5A 3R40A 2XUHA 5DOZA 2H4YA 4N6GA 4MQFA 5FFMA 3AJEA 2NU8A 2X14A 3BFXA 5KQMA 1U0FA 3ZTYA 1QBGA 4PX3A 1VHQA 2YHSA 5DCLA 4NZZA 4Q21A 4W9NC 2R7LA 2MYPA 2ZJ2A 2C4NA 4JCOA 1FMJA 4IG9A 5J43A 1WP4A 2PTHA 4CDNA 3HKCA 4LHVA 1E9RA 5A3SA 1C1YA 2D0PB 4LZJA 4Q3DA 3LC1O 4RHTA 3WHPA 1CR6A 3TG8A 4Z0PA 2DHDA 2XXAA 1CRLA 1PFVA 1VL1A 5DGDA 5SYNA 3TVDA 3EY9A 4KIWA 4EF6A 2J4DA 5KMGA 4FN4A 4K2AA 2TMKA 3RSOA 1XCOA 3EE6A 3C6BA 3L4SO 5TVKA 3RCBA 1ZMTA 1C2YA 1NI4A 2POQX 4EEZA 1VQ7B 2EKDA 1I13A 2EBWA 2Y9PB 1KGDA 1Q1ZA 2GRUA 5KNBA 3PENA 2W6NA 5CVDA 1PJ6A 2R751 4NCHA 1RRKA 2XA1A 5DN6D 4IL5A 4HNHA 1GA4A 4MDEA 2PT7A 1YBVA 1ZICA 4J43A 3NHBA 5K0CA 4ERNA 4FWIB 3O8QB 3PVZA 1E1CA 1MC5A 2OKGA 4GWGA 1C3XA 1PTKA 3ICWA 4CLRB 4OXYA 5CRIA 2ZL6A 3N05A 1VBMA 3FWZA 3K4PA 4M8LA 3ZD6A 3PA8A 2QRQA 3SOPA 1FFXB 4JENA 4LHYA 2FPMA 2JS7A 3DZ8A 3K9LA 4UAVA 1JL3A 1EB8A 3PFIA 3WJ2A 4NHOA 2WTMA 2GASA 3WLRA 5IFLA 5CVCA 2H7YA 1GNPA 3T3NA 2O8DA 2JAOA 3SNHA 1TZMA 1WA5A 1NLUA 1U7WA 4K87A 3VPGA 4DDHA 1NR7A 1T15A 1QZZA 5A9SB 1I14A 5DHAA 2CYBA 1EA5A 1JHMA 1QZ3A 3WGHA 5F7ZA 4F7DA 1N2ZA 2GHIA 5BN5B 2FG6C 3KZNA 1PGOA 5EY5B 4RK1A 3KXDA 3JWIA 2Z2ZA 4BU0A 1IQ0A 3W5BA 4FVTA 3BMCA 2QE6A 3IUNA 2JLSA 4YUZA 1XRSB 4RKQA 2J3HA 4AN4A 4ZA2A 4NZ9A 5BSYA 2WF8A 4W1RA 4BNKA 1C1XA 1YTLA 2VAXA 2VJNA 4BRSA 2XWBF 1YDFA 2TSYB 4ZCRA 5GIOE 3ZZTA 4OX9B 1QYCA 4Z4UA 1T29A 1T91A 2Y2VA 4PIMA 3WNVA 5CB4F 4X91A 3WNQA 2J9FB 2RHCA 2JIOA 4LSWA 2VFAA 1E8DA 1YR2A 4KVAA 4RD4A 3A6ZA 1QHHB 3QEAZ 1IVNA 1CY2A 4AYTA 1QR2A 2VJJA 1KU0A 1WCYA 2QX4A 4IH1A 1J0AA 1E7RA 1Q17A 3KKOA 4JOQA 5FHQA 1NY6A 4LTMA 2ZCUA 4HAXA 2WABA 4PCUA 2FG5A 5COBA 3ZKWA 3EGDA 3ZJ5A 1R27A 1SKMA 3IXMA 2CV0A 3ZWVA 4KPYA 5D86A 5G0VA 1JG3A 1AQUA 5HJ7A 1VE5A 3LA6A 2ADMA 2VTBB 3DO6A 3O4GA 1H93A 3QEKA 4MW4A 5KYVA 3U4DA 4HN2A 4E7PA 3PTAA 3G0DA 3DZJA 3S1AB 3Q8MA 2GEDA 4KBYA 2JHPA 2GWHA 4KAXA 3AHFA 2ZG6A 3U7QB 5GOZA 1LDEA 3D6JA 3ZW7A 4B17A 4EY3A 4F12A 4YGXB 5K8JB 4GYWA 3VC2A 3VPXA 1U3FA 4KGZA 1RI1A 5JJBA 1MT3A 5BW4A 1M5RA 3DXXA 4YRSA 1J5PA 3MLBA 5AI6A 2O2XA 3UA3A 1UPBA 2IXEA 3MEQA 1OHHA 3HWX1 1H23A 6REQB 3D3WA 5EIHA 5FBLB 5ICFA 3MXOA 4TMKA 4N7RA 2GQFA 2I5PO 1LRKA 3OICA 2JGEA 1XTSA 1JG7A 1T3GA 2OLKA 3ET5A 1QH9A 4JOSA 1SFRA 1C50A 1TO2E 3FYTA 3TQRA 5IVKA 2XE6A 4PG5A 4KRXA 5EHXA 1RXCA 2JIDA 2Q7XA 1XTRA 2ACVA 2AB0A 4E11A 4RDJA 1B8PA 3JU4A 1IC6A 3ACCA 3L3BA 2QRVA 1Y4AE 2RB4A 3NEAA 4ITRC 3RUHA 3BRWD 4A91A 5I9TA 2CXXA 3ZBTA 1L3IA 5CGZA 1Z6QA 2KE5A 4KN6A 3G8AA 5CK4A 3K4QA 4HDMA 4JLUA 4O63O 3BFKA 2GPYA 4FW9A 3NC1C 4M0MA 1H8EA 2YFYA 1PL8A 3EXIB 1M1NB 3VC7A 3WP0A 2ZCJA 3R4CA 5ALJA 3R7LA 4HAZA 2FSPA 3UGQA 2QRGA 4PC2A 1PT8A 5DM1A 2AXQA 1VQ4B 3C4JA 3A1TA 3E9RA 2O2JA 1XTVA 1I0ZA 1E66A 4PGHA 5P21A 3DTNA 3ICPA 5KVQA 1HL3A 4EHNA 5JXGA 1YJQA 3JASA 4DKXA 1G6HA 1M7GA 4S05A 1CUWA 4PO3X 3FVTA 2QQ0A 3E7FA 3G2JA 4FFOA 1E2PA 4RDCA 2VF8A 2EBUA 4M9XA 1S8OA 5CBPA 4XR4A 4ZCMA 3PHJA 3HMKA 4XVHA 3UMCA 2LKCA 2EW2A 2IDMA 4FJ0A 3AUYA 1BCSB 3EFHA 4BFLA 1KZLA 1F0NA 1SB8A 2QRHA 4QBIA 2XQIA 2J6CA 4MRAA 5K5EA 2WJWA 4ZYVA 3HCPA 2NO1A 3C5WP 4AX8A 2BFDB 4RTSA 3H4MA 1SOUA 2MOKA 1C9YA 4B6OA 2LV8A 2H52A 4WA7A 1R64A 2VI5A 1P33A 5KHLB 3NM5A 3RAGA 4K9LA 1E2KA 1JDVA 2FCRA 4LMPA 4MKXA 1PLKA 1K6IA 2WKPA 2ZYSA 4QUKA 1XZKA 3AY3A 3IGFA 4KLCA 1K5PA 5DI9A 3U62A 1P8JA 5AVUA 3WK9A 3RVRA 1ZXLA 3O1IC 1S0UA 1PWHA 1QUEA 5LP6A 3V1KA 1KZ7B 1KMIY 4QAJA 4XUGB 3SPXA 1W25A 3LDHA 2J45A 5H68A 1QCCA 2KVOA 2WD7B 3MGGA 3GJ7A 3CVXA 1GWNA 4B81A 2MSCB 2ZBEA 1CHDA 3MB5A 3OZAA 4GRIA 4TYMA 1FYVA 2OBYA 3RK0A 1EDEA 5H02A 1P2GA 2XB2A 4DPKA 2QSYA 1LF5A 3D5EA 4D9IA 4NEQA 2XYGA 3SZRA 2YHIA 1MORA 2JFGA 3L1HA 5SV2A 4JP3A 4R2MA 5JY1A 1EM6A 3T6KA 2I6QA 1Y1QA 1L7BA 1HY3A 1MG5A 1F6WA 1UJBA 4OQ4A 4EHHA 1A9ZA 4UM5A 1SD5A 2AEJA 1Y7PA 2X0RA 3K8QA 1U9JA 3ZS8A 2A1IA 3ZVRA 3ER8A 4WCDA 4AUMA 3WLJA 1CNFA 1QRSA 5H59A 1K6JA 1W1WA 4IDHA 1LDGA 3ITEA 1P4HA 2WZPP 2JFQA 2JI8A 4LCEA 3NE5B 3P9KA 2VNAA 1V5IA 3VC3A 1T8SA 1WE2A 5I4BA 2RH8A 1EDOA 1BQEA 1IQPA 1UZUA 3AH8A 5KNDA 1ZI9A 2HMVA 2O07A 5H16A 4F1WA 2HLDD 3CKMA 4NHEA 3B20A 4UVGA 5REQA 1HE3A 4GSKA 3NYIA 4QNNA 3EPJA 1ZC4A 5AIAA 1GFZA 1X7XA 4MUBA 2ZQZA 4X7MA 1VJ1A 4PVDA 2VWQA 1W581 1K2WA 3HFRA 3TR5A 3ZHOA 4BNYA 1XEWY 5ER6A 2PH1A 4ZODA 5CA1A 3OT1B 3B8HA 4PG4A 2CVQA 5K8CA 1NE2A 2O2CA 3H1PA 3RT7A 2QW1A 3T7JA 1QIJA 4XM1A 1DJOA 1J8FA 1GUYA 2ZUTA 4AQDA 1MO2A 4PXAA 1PGPA 3ZW9A 1LX7A 1T4CA 2X5JO 3GJ5A 3EGIA 4B6EA 4TS9A 3HDTA 2RC5A 1ENZA 1JEEA 3U1TA 4C43A 1VQ9B 1GADO 2Y1XA 3KU4A 1LDNA 3PXCX 1CZLA 4E1BA 2WAXA 2X9LA 2CXHA 3QXSA 1N7JA 2P11A 3I9JA 1XPOA 3F6PA 4KE7A 4PSUA 4LF5B 4AY3A 3NHMA 3DDYA 2WINI 4BLUA 4F21A 4DR2B 1Q22A 4MPDA 4QJ5A 4UHJA 5DHPA 3U40A 1Z0FA 4HJXA 5LMNB 1BDBA 4ZJYA 2ZT8A 2C4WA 1Y1TA 4JROA 4QU9A 4DCCA 3WADA 2X85A 2I4TA 3HBAA 4IOKA 1K8QA 1V2HE 5TF4A 1DZ3A 1I8TA 4FKZA 1MX3A 2XNKA 1J2RA 1B1AA 2O2ZA 2VJOA 3ER6A 4J7AA 3CNLA 2WJGA 1UM9A 2YWJA 1KI4A 1PIWA 1ES9A 3NLLA 4JSTA 3ZIUA 3ZCRA 1E4YA 1VKZA 1QP8A 4PBTA 1DXOA 2O06A 1AT1A 4PPYA 1B0PA 3ZV3A 4KLZA 4YXWA 1LI4A 3C8ZA 3FNIA 4JZKA 2M6LA 5JNSA 4IDDA 3S8EA 1GYPA 2GEFA 2ZUSA 4FMPA 4PGFA 4QQKA 1WUHS 4D8XA 4GMDA 5KNCD 2Q62A 1RJDA 1KHTA 1VQOB 3ETJA 4J1NA 3G49A 3TLKA 2ZYUX 1DINA 3UKOA 2O8CA 1IBRA 3B6ZA 3HAGA 2OSBA 3K6KA 3W2EA 4B74A 1HLGA 2QJRA 3DLAA 3A1CA 1Q0RA 1E1MA 1KO8A 1BXRA 3T38A 1G21B 1Q7BA 2UUPA 2LW7A 4EY6A 2O54A 1RI2A 1RXSA 3P96A 3WRYA 1L7OA 1TM7E 1KORA 4JT4A 1UBHS 2PYZA 2CMHA 3VA7A 1NIPA 2LCIA 3N6XA 1PF7E 2Z2IA 3W8EA 3TVTA 3L2OB 3CWCA 3LBNA 4IXWA 4ZKDA 1CS4C 2JZOA 1MDBA 3KVNA 1T3TA 3U5TA 4NONA 3H9GA 4W7IA 2PJRA 3K70D 2EQ5A 1HKUA 2PYDA 4MYCA 2PCLA 2Q2NA 4NF2A 4Y6RA 3QKTA 2E4XA 1T1GA 4OAQA 2B82A 1F6DA 3BD7A 3WFJA 5JD3A 3NRCA 3VNRA 1RZ3A 1BJRE 2P3SA 3L7JA 1UMBA 4C07A 1RRVA 3OW7A 1VXOA 1CIPA 4XX0A 4MS4A 5IH3A 4F96A 3GMIA 4X20B 4BFXA 4UNRA 4EO9A 5L4SA 1ADYA 2DY0A 1ESCA 5KYTA 3ONUA 2CJWB 1GJRA 1POXA 3D4IA 3B89A 3DO8A 2G76A 4YRRA 2AKEA 3L46A 4YPVA 2OHOA 2VPQA 1NJ6A 2I2AA 2WWRA 3OTGA 3VAYA 1EE9A 1AHIA 3SJ7A 1FYDA 4F2GA 1QV9A 2CLHB 3KSDO 4HWRA 4BNZA 3AUAA 3NIWA 3FKSA 3Q15C 4ZU6X 3K9WA 1KOGA 5AK4A 4GX0A 1KO7A 1YIOA 1IN7A 2X1VA 3H8SA 1G64A 4JGBA 3WB0A 1E18A 1W8DA 2FMUA 4JFRA 1NHGA 4BEWA 2B7LA 2WWVD 2WTUA 2P9HA 1Z6AA 3QPAA 3DNPA 4KC0A 1JQEA 1KIMA 3FN4A 1XLTC 3F78A 1J42A 2YC2C 2RGYA 4YTEA 4RZUA 3W8NA 2PRSA 2Q1UA 3B3GA 4LCBA 4CUZA 4YR9A 5KOYA 1JTEA 1MPXA 2LDXA 4ALJA 1O94C 2B6HA 4P93A 4WKBA 2ZWOA 3PG5A 1L3BA 2N9UA 3P9XA 4FEYA 3L84A 4OQYA 2FF7A 1J1ZA 3H9JA 3MWJA 4TL9A 5BVGA 5JDCA 3OZGA 1NFQA 2B6NA 5ES4B 3G0CA 1I33A 4E14A 3ZHYA 2DBVO 1S2NA 1GGJA 3UMSA 1XQ6A 2GN2A 4XPIB 3L9WA 4NENA 3SOZA 1ND5A 4EB6A 4E5PA 2PJDA 2NADA 1JJVA 1X7XB 4F5WA 2I80A 2UZ1B 4F56A 2MSEB 3RVNA 2Q5OA 3DWGA 2P2ZA 2OOSA 3F90A 3I83A 4B7UA 3WQZA 1QHXA 1PEYA 1HOTA 2YMLA 3JQ9A 2BHSA 4PQEA 3SSOA 2PMKA 1SHJA 1SK9A 2P9EA 4G26A 1P91A 2EQAA 1TRKA 3VH1A 3MWDA 4XCXA 2Q3JA 2NLOA 4F5YA 1MJGA 4UE3S 1J39A 4UEKA 3HCEA 4CBVA 4FDMA 4F1KA 1XXHA 4DJJA 1L4NA 2M1XA 2GWRA 3SQWA 2G0NA 1NFFA 1WB4A 2GYVA 3JRXA 5K6AC 1HSOA 1EWKA 5IN4A 1PQYA 4PS1A 2QEQA 5IYPA 1JJAA 2I8CA 1NVXQ 3UICA 2XVMA 3AY0A 3BA1A 5M29A 3OIFA 2VBUA 1OROA 5K3DA 4JHLA 1U8CB 3IHLA 1OXBB 2VOJA 2AWNA 3L1IA 3BUSA 4IGIA 4OJQA 4RY9A 2FZGA 4ML3A 4DA0A 2VRCD 4ZHQA 2GRJA 1RFLA 2X2PA 1EXMA 5KYKA 1K8YB 1WZCA 2MR5A 4DV5B 4BLRA 2OV3A 3NEPX 1KJIA 2O8FB 3ISVA 2GB4A 4TMXA 1SXJA 3I55B 1E6WA 3OLCX 2FN4A 4MAAA 1IWBB 4Z7OB 1T43A 3MJVA 1OVMA 2DTDA 1PI3A 1ZN9A 1KJZA 1V16A 4YO8A 2RI1A 4M1QA 3I6IA 3GY0A 2ILTA 3FYCA 4GNKA 4X90A 4CKZA 3QKRA 2X7XA 2P8SA 1VHJA 3EBPA 3T61A 4QM7A 4F84A 3ZK9A 2R7KA 3GRKA 4WZBA 5LFAA 2C20A 1JKFA 2B8NA 3HCNA 3U44B 3NTQA 1QTNA 4S1PA 4N54A 2REBA 3GC6A 1U99A 4GL2A 3E27A 4CKYA 1W4AA 1UWKA 1WOMA 2JASA 1XCGB 2PV0A 3EFOB 1Q0PA 5EP2A 5K3FA 4EW1A 5CB8A 1HQYE 2IYAA 1JYFA 3GFBA 2R8EA 1K08A 2VJKA 4Q6BA 3KVOA 1ZKDA 2FSGA 2Z09A 3PFKA 4JX9A 5EE0A 4KRGA 3BE6A 4TKUB 3HYRA 2HDNB 5J35A 3JATA 3SAJA 2VLIA 4HYYA 2O2EA 2VN8A 4INJA 2OO5C 4UTZA 3GCGA 3AKCA 3CEHA 2FR8A 1HNWB 4LJRA 4G1CA 1H6DA 5FFFA 1HE5A 3OPYA 3RKUA 1DWUA 1I51A 2BZGA 5KHAA 4ZI3A 3L01A 4CIWA 3BHJA 4URYR 2B2NA 3IDQA 4KEAA 2PL3A 3OP1A 4ZZ1A 4ZVQA 4QJ3A 3KFLA 3VNBA 2ZZQA 2ATCA 3VR2A 5E4YA 2FWPA 1TIPA 2IWRA 1MAWA 1K1EA 1Y3IA 4U39A 5D84A 2C8VA 3KT0A 4B79A 4CDGA 3UHJA 1H8ED 1MX5A 1WLSA 2O05A 3L02A 5ITVA 2JFOA 3ADDA 2N75A 2P4HX 3L1JA 2V96A 5AUQA 5FJJA 3DHYA 4QBFA 2YQZA 2BONA 4Y9DA 4RDXA 3EGDB 5JPCA 2VK8A 4GR5A 2FUG6 2G4LA 1FDWA 1ZVKA 5J2TB 4ZV4A 3WJ7A 3I53A 3L49A 3WI7A 1YVUA 1YS7A 1G20E 4ROXA 2NZYA 1YU6A 3PPYA 3GFSA 1PN3A 4M0KA 4FUTA 3HVKA 2EFYA 3NBUA 4JVOA 4RGVA 3FTFA 4ZHQF 3D7LA 3G8DA 2FJ0A 3DEYX 1JKJB 3GYGA 4Y8VA 3OVMA 1ZR2A 4E09A 2Z2XA 5AJZA 1J2TA 5KIAA 1JT9A 4IIJA 1H69A 4FM9A 4AF7A 4DQLA 1RAIA 1V1RB 2O0HA 2VHCA 1GCGA 3R7AA 2WZQA 2L0XA 1QS0B 3W7VA 2RGAA 1Q7CA 3ROFA 4BFWA 4KAFA 1CC1S 2AJDA 3QLTA 4AWXA 4M1YA 4KWEA 2PVSA 5JYBA 4GQIA 4DIFA 1P39A 2Z04A 4PNEA 4URXR 2XADA 3QUAA 1G8FA 3AP1A 4AZTA 5LZ4A 3M0EA 1L1EA 2IZ0A 4RBNA 1OC2A 4FZ5A 4XIJA 4EYGA 2FA9A 2J30A 4B46A 4Q4AA 4EPWA 4P4GA 2QJOA 3QVGA 5C8VA 4GXNA 4W1QA 2DWQA 1G4HA 3A3BA 1KR5A 3SZLA 4J1TA 1NI5A 2B21A 2VBFA 2XA2A 3O38A 4Q15A 5FT9A 2RHRA 2P2SA 3A32A 3HUEA 4JCCA 3OM9A 1E2BA 1MDFA 5AD1A 3VOAA 5A4IS 2PYIA 2ZWPA 3UYKA 1KOFA 1HNZB 3LO5A 1F7VA 2GYYA 3H94A 2XI4A 4QOHA 5EQDA 1PGJA 2D3NA 5DYTA 1M7HA 2H2FA 1DRJA 1JBQA 1XA4A 3FMVA 1CCWA 3OT4A 5AO9A 5IKPA 1H1DA 1C3LA 3ZWDA 2AN5A 1Y34E 4MW2A 1Q95A 2P9TA 4EBFA 2Q4TA 4OFZA 3GEBA 3R8CA 4A5OA 5K4HA 2FN7A 3I5AA 1ZH8A 1UJMA 3PDCA 4BN4A 1QVAA 1UP4A 3PXUA 2MU1A 1NUHA 2A7XA 4X97A 5IBQA 3CPSA 4XTRA 1D6SA 3B13B 4H6PA 3TZHA 3HY6A 5A2QA 4KTTE 3CJQA 1Y63A 3UJAA 4ZGGA 4BJHB 5B30A 3RVLA 1E9CA 1CYEA 3AI2A 3FHOA 4RD1A 2CVPA 4MQUA 1N9KA 1LX6A 3DOJA 5HCIA 1SQ5A 1NBMA 5F12A 3FCUB 1NW8A 1QTIA 4MI1A 1QONA 4R31A 2E4UA 2I8LA 4KHZA 3RVOA 4MWBA 3RKSA 1OXXK 4G5HA 2RK3A 4IGAA 1AA9A 3Q3HA 5M34A 4JUFA 3WMWA 1P0IA 1E1CB 2SBTA 2H06A 5G53C 4FOSA 1U9IC 3G5TA 1RXVA 4XIIA 4KIGA 1FA9A 2QAJA 3F5DA 4NBRA 1ST3A 3CUEF 2H5JA 1P7WA 1U9CA 4J6FA 5YASA 1WO8A 2Y76A 4EO4A 5DHQA 3CONA 5HIIA 3CW2A 1L6RA 1QFSA 3UMBA 4LY3A 3HRHA 4RXUA 3SF8A 3V1YA 4CG2A 1JHYA 1O94A 2A58A 2EG9A 4FBLA 1OXKB 5CCXA 2V97A 3A9RA 4H17A 4M60A 3VAZA 1K5HA 2IXTA 1J2JA 1IMOA 4OH1A 3M2TA 3T7AA 1ONPA 3IO5A 3WXBA 2X4DA 1TTTA 1NJ2A 1GRRA 2CFRA 2OP1A 1ZBDA 3OMXA 3PTLA 3VNAA 3K71B 4MI9A 3ZGOA 3I09A 4HE6A 3WIDA 4AJEA 3PUMA 3N5KA 3OX3A 1HZEA 1XSEA 2BMAA 3HGQA 3M34A 4QTZA 5EJMA 5FPHA 3RS2A 2OLJA 1VB5A 3LFTA 2GLUA 4RY8A 4LBVA 2OQRA 3SEJA 1DV2A 4LKOA 4FILA 1YOVB 3ISXA 4YV2A 3CVUA 1NDHA 3QBEA 3D4NA 5EVCA 3MGAA 1E7QA 1KYIA 2JVJA 4YP5A 3RSSA 3HLKA 3UBTA 1GG9A 2OFXA 2IFTA 1VTKA 5IDYA 2CNWA 2ZI9A 3UW3A 4PN7A 3H1AA 2OZLA 4DSAA 1NKVA 1U2GA 4INAA 1UOOA 1P5HA 1P2DA 3GBVA 3LNCA 4M0CA 1C1DB 1WSWA 1YS2X 5EZSA 2BP7B 2VUIB 1DKRA 2QMHA 1K27A 4DUGA 1SCJA 1KI1A 3AL3A 4ROSA 4DL9A 2FW6A 1M8KA 1MTOA 3I42A 4CDRA 1XKQA 2XMCA 1GT6A 1XG5A 5B2FA 1Y6QA 2YZNA 2OD9A 5FOXA 5KKCA 3ROXA 2QYTA 3S99A 2PGNA 3EODA 2HSJA 2C61A 4KH1A 4PAMA 1DAHA 3JVEA 3CU5A 1O96A 3DMYA 3T0FA 1NP6A 4AJ2A 5HTOA 1AUOA 2QRKA 1W34A 4JXKA 1PNRA 5KTKA 3P2MA 4HEJA 3RPEA 3TQOA 3K6JA 1RHQA 4PSDA 1SQFA 3KR1A 4PWZA 3JQAD 1N8TA 1OQAA 4G6IA 1E1YA 1RKQA 4HH3C 1KJJA 2OZEA 4Z54A 3MTEA 5DXAA 2BD0A 4GGPA 4D2IA 4RWZA 4UDOA 4TUYF 1XTKA 3KDAA 2AYZA 5DM70 1EESA 4KUGA 1YR3A 3ZLVA 2H65A 1U81A 4O4LA 3W3ZB 2W58A 3JQFC 1M0WA 1Z82A 2G5CA 2OXEA 2OBMA 1YT5A 1RPJA 1GUZA 1PT5A 1SN7A 2RAFA 3AJDA 1R4NA 3T7EA 1F2UB 2NW6A 5ANRB 4YYZA 1E1LA 2C0CA 4P4SA 1AUXA 1MO5A 3RGGA 2POCA 4J3JA 4YS6A 3P20A 1F2TB 2JGMA 2Q5LA 3GW8A 3WAKA 4L8WB 5HCUA 3ZZNA 3E2MA 4FYIA 2C00A 4X3CA 3DONA 1W59A 3MOGA 4RPIA 3D8UA 5CHEA 2B30A 1IXYA 1MIOA 3GVKA 4C05A 4QA9A 4L72A 4JXXA 2AA3A 2AI2A 3DDOA 1RRMA 2I7TA 4U2BA 1N78A 3RRZA 5KREA 5JNWA 3ZJUA 4UJ5A 3LBAA 4OAOA 1K89A 1BROA 2VSNA 4HS4A 4BMXA 3HE3A 3IVAA 4CG3A 4S04A 1O6ZA 5A04A 2C83A 3H11A 1WETA 2IA5A 4H2DA 5CDTA 1PJBA 1Z5PA 4X0CA 3IUPA 4FHCA 4RJKA 4Y2TA 5FR2A 5BMVA 4Y2QA 4UARA 3KYCB 1DVRA 4E2WA 1ENYA 3CX3A 3WLNA 3AVYA 1IN6A 2VBTA 2CSUA 3H5AA 2H16A 5EHZA 1V5EA 4BXOB 5E7JA 5CPBA 4UM9D 3UK0A 3OOSA 2Y92A 5K09A 4NV3A 4JJ7A 4JB8A 4LMAA 1W88B 3A36A 1ATZA 2H1WA 2IHTA 3S2IA 3U37A 1T0HB 1NW7A 4YYEA 4BVEA 5CFQA 3CTAA 1NV8A 2HQOA 4INZA 2ID9A 3N3BC 4BU1A 4I5EA 3USCS 5MHTA 4UUPA 4ECEA 3O94A 4R3WA 4KSYA 4RXMA 1FDUA 1ISJA 4Y2UA 3W06A 1X0XA 4DY6A 5K6AA 1NMXA 2B4QA 4RENA 3GFTA 3ACBA 4DWOA 1ZHFA 2FKAA 3CT6A 4OGWA 3RU9A 1RYMA 4EPYA 1TZJA 3DMRA 1X3LA 3ELYA 2X22A 4QWMA 1XTIA 4XGIA 2GPWA 3UJ8A 5CT4A 1MTZA 3IQEA 2YWHA 3O31A 3KQQA 3ABZA 1V11B 2QU7A 1UPFA 4FFVA 5EKSA 4R40A 4H6XA 5CA0F 3A8TA 5UKDA 1VHEA 3UT0A 5BSEA 2XAAA 1U0BB 3H9QA 3NKVA 1BWSA 3LDGA 4QBTA 1PG2A 4GVLA 2Y4OA 2I62A 3JQGA 1ETHA 1KYQA 3FGNA 1GPAA 5EWLB 4EVSA 1EWVA 1NB0A 3RWOA 721PA 1OX4B 3AUSA 4D3XA 4HLUC 3COJA 4KZKA 3IR7A 1TK3A 1OBOA 5H3HA 5SICE 2ZPUA 3VHRA 2QAGB 2BH9A 3HM2A 3ASTA 3OP4A 4ZARA 2YN4A 1C8BA 1TYCA 3NM6B 3OLWA 3Q88A 1Y3DE 3W3AA 4MYTA 4DV2B 4KDCA 1N5DA 9MHTA 2AN4A 2G5TA 2PBRA 2OV6A 2GJ9A 2Z5VA 3UFBA 5K99A 1GRNA 1N7GA 3EXHB 3PZBA 4PZ0A 1A8IA 4WBSA 3ANTA 5CH8A 2X77A 1S1MA 1A50B 3GAAA 2FPWA 2VR1A 3AEQB 2A3RA 1XHEA 2ZR9A 4K6KA 4NCXA 4Z9FA 4U3JB 5EZYF 5J40A 2HHHB 3P97A 4Z4FA 1N3BA 1A3CA 2B36A 2R00C 3KTAB 1MF7A 3WB2A 4HNRA 4ZYZA 5I9NA 4X93A 1HOXA 2JC3A 1GXSB 2P2DA 3OPOA 2C2HA 3T5TA 1O8BA 3VV2A 1LBTA 2AOTA 1W46A 2R60A 1IY1A 4R41A 4WXEA 4DQDA 1M2OA 3OKCA 5TMPA 4G5YA 1KWGA 4RZIA 1AZSC 2GGSA 3CX7A 3DYBA 3QBTA 1UC8A 4J2TA 3MCAA 1W0KD 1NMZA 1TZKA 2XUJA 3DOFA 2C4UA 3BHIA 4G4SP 1VF7A 3WBFA 4IIDA 1A71A 2ECFA 4IIJB 2REXB 4NENB 3UC9A 521PA 2OZKA 1LU9A 1NVTA 3QVOA 2QD2A 3HBJA 2IV3A 4QVKA 1IMJA 3TLCA 4BFTA 3DBIA 1GCUA 1O54A 4L95C 4NYIQ 2AOXA 2PX5A 4NS1A 1AG9A 1N2HA 1UXGA 4GP9A 3MT7A 4OQZA 1Z4NA 4MLZA 3UAYA 3VNVA 2XB8A 3OURA 2ZTUA 4ZZ3A 1ONNA 1EX1A 2ZKLA 2QDKA 4WW0A 4Y2VA 3SS7X 3ZIAA 1D5CA 4QOEA 5A9TA 2FR1A 3LC2O 3PD0A 5FWNA 5I7AA 2QNIA 1M34E 2TMGA 4OYLA 2ZIVB 3F1KA 1XCBA 2VTEA 3ENQA 4PIVA 4Y2JA 5E9AA 4KNYA 2FPLA 3H8WA 1CU1A 2ZVPX 3I34X 4LGMA 3FBGA 3N76A 3SQMA 4AUEA 4ZEXA 1UK8A 4EGFA 4EDFA 3PJGA 1FDIA 2VWHA 2ZUDA 3AT1A 3G0OA 4GHWA 4ZVUA 4AMBA 1APBA 1U11A 1G8KA 4URZR 3BDIA 4PGGA 2VNIA 1P9LA 2PXCA 4BQRA 4BZWA 5KJCA 1WLYA 2AC2A 3U48A 3QUQA 4IHQA 2DUMA 4AJOA 2G71A 1SRRA 1XRLA 3QKSA 5EJGA 5LA6F 2R1VB 3BHNA 1NQUA 2WFZA 1A9RA 3L9XA 4YN3A 1E5TA 2HIMA 5E8JA 1QQ6A 1I6LA 2EP8A 2DOKA 2XJ4A 1U0TA 3UWMA 1KRXA 2GKSA 3V4SA 3WX0A 2KLBA 1VZ2A 4RA9B 2RHMA 4RMJA 5J2TA 3P26A 3OJXA 1W52X 3BMQA 4R1NA 1XR3A 2TYSB 5A6SB 3TZCA 2VPXA 3U4QA 1LS6A 2FNAA 3F6RA 2SKEA 2GKGA 4E51A 3L5KA 1HXHA 4GI2A 1AKTA 1YQXA 5K3SA 3U7HB 2QMYA 3LAWA 2LRHA 3CEMA 3ORYA 4UHEA 3TMKA 4EKEA 2VPIA 4QU0A 3RFTA 1D2NA 1Z3CA 3ZHUA 1A5AB 1JIVA 1XP8A 2EJUA 5C5DA 3OQMA 1SIUA 2BHNA 3DL7A 1FSZA 1K6MA 4J0JA 1Y4ZA 3HU3A 1D6MA 1YCGA 2W8BA 4LJSA 3DUWA 3T99A 3M1AA 3ECSA 3JCZA 2Z3ZA 3C3PA 1VE9A 2HRZA 3W6PA 3NHRA 5LKAA 1YCFA 1WXGA 1U6JA 4A6PA 3ITKA 1O03A 2EQBA 2GUGA 2J87A 2Y6UA 4IKEA 1VYVA 4AO8A 3BEOA 3I1YA 4ZO8A 1YQEA 4QYWA 2PT9A 4EGQA 2K6GA 5JPIA 4BGDA 2DR0A 2IOQA 1MOPA 5JBQA 2C7OA 4MKFA 2Z56A 2KBFA 4FS8A 3U3JA 1KEEB 1P9OA 2PQMA 1Y3HA 2PZJA 3FPKA 2UYQA 3IJ5A 1NSFA 4WZBE 4YJDA 3VR5A 3G2OA 3KEWA 5E8RA 2C0QA 3FFXA 3P4YA 3LQYA 1N8KA 1EINA 3NU1A 3OLVA 1J49A 2XGMA 5F4MA 1JSCA 1K6XA 3SEQA 1AKVA 3AIMA 4YQYA 3JAMA 5HXAA 1YJXA 2OUIA 4QUGA 2ZQYA 5ER9A 3Q72A 1XCJA 2EJBA 3E9CA 2XE4A 4P5PA 3HN6A 4W9MC 3VYUB 2YWGA 3AF4A 4G7XA 1ZNZA 1NMSA 4AB1A 4LSMA 4PR0A 1W29A 3CCLB 5FEUA 1T1JA 3IHWA 1E3ZA 1M2HA 3H04A 4RV5A 4C4SA 5KNLA 3OCCA 1I24A 4E5SA 1PEDA 3T94A 4M3NA 5AW6A 4ESEA 3QVKA 4UBIA 3IQDB 4V38A 3RTEA 3EXHA 1QGAA 2NXCA 3KZOA 4P5DA 2Q0HA 1UMCB 3RW9A 2DWCA 3LX4A 5LLDA 5ARDA 5HIMA 3TAHA 1NOJA 5KYNA 3KM0A 2ZBPA 3N7TA 2BKAA 1KC1A 1Y89A 4MVJA 2QAGA 4AULA 5JXWA 2I6SA 1R4MB 5HW0A 3OFVA 4ZVSA 2BGIA 1VPLA 3BMOB 2JFXA 5KPJA 2G25A 3CEJA 1U02A 2VK1A 3NYWA 4YLYA 1UOEA 1J90A 3HVHA 4WLFA 2P69A 2HK7A 4YRQA 5JOQA 1CUUA 3BQ9A 4I50B 2MJLA 1XKLA 3G0GA 2YJ6A 1GZSA 5JYDA 2PKQP 5LQMA 4JC0A 4RIGA 5JT1A 1WZUA 2CLMB 5D3KA 4RIEA 2ZDQA 4NX2A 4I55B 3LZ6A 2ZT5A 3GUUA 3VPDA 4DUZB 3SC3A 2WAYA 5LYJB 2II6A 3BFPA 2YFHA 4HAVA 4GW3A 1YUNA 4X92A 2BMEA 2WY2D 4ABYA 4BO2A 5KJ1A 2OG1A 4XLAA 1RWPA 1U2GC 5EGNA 3QLJA 2FLVA 2V59A 2W93A 4M86A 5A4KA 3ZTWA 5K4GA 4UOEA 3PXEA 4QDOA 2M98A 4PO9A 3UUWA 4MTLA 1D1TA 4MS1B 3A31A 4NZPA 5ULLA 3RASA 4BKOA 5JI3E 2M9MA 4AKIA 5DMHA 3JALB 4R6XA 3F2VA 4AROA 3WNBA 1LTHR 1RM5A 2JIRA 2NTEA 2TMDA 2VLBA 2JCBA 4LGVA 4WEQA 3TW8A 1IHOA 3DBVO 3TQTA 2OGTA 3DFFA 4MHSA 4Y2XA 3UJ7A 3V8PA 7AT1A 3IOBA 5HQTA 3DAGA 5D3MA 1PWZA 4C4YA 1G2QA 3TQCA 4O4IA 4E13A 3KHKA 4RE5A 3BEDA 5I48A 1L3CA 1W1IA 2KM1A 4PBSA 4BB5A 2VP5A 1VLYA 1W0CA 3CH5A 4UVDA 1KY4A 1WV0A 1FVHA 3W5HA 2ZB7A 3UWPA 5B1HA 3N8DA 3FUXA 1M2EA 1Z62A 2QA5A 1EJ6A 2VIIA 1QFMA 3TD9A 4IQ4A 2Q45A 1P6QA 3B78A 4PYMA 3CNQS 3KUDA 3WZ2A 4FWTA 5CG1A 5KQLA 1L5SA 3O5AA 2VF2A 3HXQA 2PSFA 4FHDA 4HGQA 5KAPA 4RMNA 2NO5A 3RTGA 3EFBA 4BO4A 4YECA 3AL2A 3BXZA 1R8YA 4O4IF 3E8MA 1G7TA 2RJNA 1P1BA 3AF0A 4TX1A 3REFA 1K7EB 1KKUA 4E5MA 1KZYC 5A7HA 3KDSE 3OQIA 3BIJA 1M9NA 4HXYA 5IVPA 1M83A 5JYEA 5BSKA 5FOSA 1XQVA 4UMFA 3BIOA 3QJGA 3S7ZA 1TLFA 1J9GA 3I01A 1HE2A 1L4YA 3PCTA 4YBRA 5E4FA 2Q0QA 5DP2A 5KYXA 2R6R1 3BL8A 5D5PA 4LX8A 3VI4B 4YJHA 4L22A 5TLSA 3VZDA 1L8XA 4BVLA 3LPAA 1K3UB 3AUKA 2PO5A 1RJ9B 4F4JA 3DVSX 4F4FA 1TAUA 4JJAA 4NICA 1FRZA 4CIBA 4NRDA 1IOZA 3K4HA 1MGPA 4B80A 4LHWA 1U2RA 2CHGA 2VAWA 3DOIA 4FMDF 4H7JA 5L40A 3A7EA 1Z2OX 4MAMA 2B34A 4X1IB 3T5MA 4A0GA 1W36D 5FBZA