4AF6A

Pea fnr l268v mutant
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
296
structure length
296
Chain Sequence
HSKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVYTNDAGEVVKGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGVKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN--NADP REDUCTASE, LEAF ISOZYME, CHLOROPLASTIC
publication title Structural Backgrounds for the Formation of a Catalytically Competent Complex with Nadp(H) During Hydride Transfer in Ferredoxin-Nadp(+) Reductases.
pubmed doi rcsb
source organism Pisum sativum
molecule tags Oxidoreductase
total genus 91
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4af6A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4af6A02
3MMPA 1E62A 1BX1A 3WXMA 3E1YE 3QSYA 4B43A 1B2RA 4M53A 2PIAA 4RD0A 4YALA 2C77A 4N3GA 1TVCA 3OZVA 1FNCA 3MHPA 1QUEA 3OZUA 1TLLA 1D1NA 1FNMA 3ZBTA 3AVTA 3W2GA 2HDNB 1Q7YD 4MYUA 4ZGNB 3WNCA 1VQMB 3QFSA 4MYTA 4B48A 1QFJA 3OZWA 4M2LA 2BPOA 4B4DA 4R71A 1VQ4B 4TMTA 3JQRA 1JJ2B 3QFRA 1N0UA 3CCRB 4B47A 2RC6A 2EIXA 1CQXA 3QE2A 1KTVA 3W2EA 4ZCMA 5GV7A 1EP1B 3U6KA 3W5UA 2VNHA 4G1BA 1VQ5B 1YJWB 1M1KD 4WQMA 3WY9A 3VMFA 2VNJA 1I7PA 2DY1A 4PC6A 4J0QA 4RCZA 1VQNB 3CCSB 2J7KA 3CD6B 4LC0A 1ZM3A 1BJKA 4G5GA 3ES9A 3CCVB 3AGQA 3W2IA 1Q86D 1GR1A 3WNBA 2DETA 5HXBA 1GO2A 4YAFA 2QTZA 4M4SA 1A8PA 3W5VA 3CMEB 4ZGQB 1K8AD 5TV2A 3FPKA 2YWEA 2YWFA 3ZBUA 1KK2A 1KK1A 4RD4A 4Y7CA 1KJZA 3AVVA 2XNCA 5GV8A 4M1KA 1VQ8B 4FK8A 1BQEA 4TMXA 1GJRA 2VNIA 1KK0A 1XE1A 1ELOA 3CXCB 3CC2B 1VQ9B 1JB9A 3SJZA 2YWHA 4TN1A 3W5HA 1KC8D 1IJEA 3I1FA 2VNKA 4TMVA 1AMOA 1VQ6B 2VYQA 3AVXA 3CPWB 1YJNB 5EMNA 1BX0A 3B82A 3U2QA 1KK3A 3J81k 3OJXA 3CCEB 1FDRA 3LVBA 3LYUA 2BF4A 4DQKA 5FA6A 1VQOB 4C43A 2QA4B 2OTJB 4ZV4A 4RD1A 2OK8A 3PENA 4N3NA 4HE6A 3WBJA 2RC5A 3AVWA 4QFMA 1DDGA 1KD1D 2BM1A 4QHYA 1K73D 1KQSB 2BV3A 1QFYA 2XEXA 1S0UA 2HMAA 2AHOA 1R5NA 1CNFA 4PC3A 4TMWA 1G7TA 1QGYA 3G4SB 3QFTA 4B44A 3B8HA 1VQKB 1DARA 2GQFA 1ZM2A 3AVYA 2E1RA 1IJFA 1YJ9B 3W2FA 1W2BB 2OK7A 1J9ZA 1G7RA 5DSZA 1Q82D 1QG0A 1E64A 2HCJB 1ZUNB 1DG1G 1U2RA 5AN9A 1F20A 4PC7A 1DDIA 4RJLA 4H9GA 3P26A 4ZCLA 1AIPA 4PC2A 3VO1A 5KSWB 1EP2B 1EFUA 3P27A 1F60A 3ZC3A 2BGIA 4B3XA 2GPJA 1Q81D 4AF7A 4HE5A 3WBKA 1W35A 3I55B 1K9MD 3A1FA 2C78A 1QX4A 3E20A 2X3UA 1XB2A 2ZITA 1GAWA 1QGAA 4M0LA 1ZM9A 2EFGA 4RD3A 3G71B 2QTLA 3CCUB 4BPRA 1HA3A 4IW3B 4FWTA 1QVGB 1N8RD 2NPFA 1YIJB 3CW2A 1EWYA 3ZZUA 4PGOA 1QGZA 4P6VF 4YAOA 4LBWA 3FJOA 3JQQA 1M90D 1VQPB 2R6HA 3CRZA 4PC1A 4U9UA 3CC7B 1D8TA 2QEXB 1N0VC 1W87A 1FRQA 1WDTA 5H59A 2BN4A 1JA0A 1SM4A 4LBZA 1JA1A 4FN5A 1FNDA 1H42A 4ZCIA 2XNJA 1UMKA 1R5BA 4F7DA 2OTLB 3VO2A 2VZLA 3CCJB 1FRNA 2BSAA 1H85A 1QH0A 3JQPA 5H5JA 4EH1A 1SKQA 2FX3A 3AVUA 4LBVA 2DCUA 2B7CA 1NDHA 2BGJA 1QVFB 2B7BA 1B23P 4LBYA 1ZM4A 2BM0A 3B78A 3OJWA 1EFCA 4YAWA 1R5OA 1CNEA 1QUFA 4NCNA 3I56B 4Q7JB 3V76A 3CMAB 2DEUA 3LRXA 1GAQA 4RD2A 1EP3B 2BVNA 2D74A 3ZZTA 1YITB 1TUIA 5TR9A 1JNYA 1W34A 3AGPA 4TMZA 5JBQA 4DQLA 1EFTA 4NBSA 4G1VA 1YHQB 1QFZA 2BMWA 4AF6A 1E63A 1OGJA 4Y9UA 3VNUA 1S72B 4YHBA 4AC9A 2QDXA 2CNDA 1OB5A 1NJID 4ACBA 2QMUA 4RD6A 3CCLB 1OB2A 1TTTA 1IB0A 3LO8A 2PMDA 1VQ7B 1EXMA 4UAJA 4YAUA 3U6BA 4K1XA 2B5OA 3WNDA 5THXA 3OW2B 1KRHA 3G6EB 3CC4B 2DERA 3QFCA 4ACAA 3VNVA 4C0SA 3MCAA 1FNBA 3WYAA 4Y9RA 4P3YA 3W2HA 3ZZ0A 2YWGA 2QN6A 3CCMB 1OGIA 2PLFA 4RCYA 5TY0A 1VQLB 1G7SA 3CCQB 1YI2B 1GVHA 1D2EA 3CB4A 1G7CA 2CRVA
chains in the Genus database with same CATH superfamily
4NABA 1VG0B 1W36B 2XWPA 5FWYB 5H70A 4C22A 3V1LA 3OZ7A 1RJWA 3PNBA 1SUIA 4RFLA 1DC6A 4FNMA 4UCFA 4WKOA 3N8NA 2FX5A 1CZOA 4JC5A 4AMGA 1YE8A 4AZ3A 1NXTA 2AZTA 4IM7A 4D9GA 2Y6UA 3KE8A 4QD3A 5KBYA 1SCQA 2G9ZA 2VYNA 2P2LA 2FZLA 3EA5A 3EX7C 4KNVA 3GCDA 4FBLA 3RSQA 2MIIA 2I4MA 1PJQA 5A1TA 3HA5A 1LDBA 4EUEA 4Z3KA 1DLJA 3AF5A 2OD2A 2ZJAA 1FK8A 4LQDA 1R6BX 6YASA 1P3Y1 1LJUA 2QX6A 1MN6A 3IBFA 4AJ1A 3ESDA 4BFUA 1KYVA 2I62A 2O4UX 2PDAA 4X7DA 3D6MA 3PEUA 4M8IA 3TW0A 5AM1A 1CUYA 4FXOA 1X1DA 2NSHA 2WJVA 3A1SA 1JIXA 3J80A 2A94A 4BNIA 1RI2A 2ACVA 2QORA 5BURA 2QX7A 1N34B 1X7ZA 2Q5FA 3REQB 4YO8A 2ZIFA 4RTSA 4C7OB 1EZ1A 1OJ7A 5D86A 5AH0A 1NB0A 1TD9A 3U9LA 1YHZA 1F1JA 4A0HA 1Z5UA 3LK7A 1FMTA 3IUBA 2O1WA 2NN3C 4JT2A 5DHRA 5B55A 1Q7GA 5IJ9B 1BCSA 1CJUC 4J75A 2IUSA 1MHPA 4GGOA 5BSFA 4D98A 4X6UA 3R6TA 2QD4A 4JMQA 1G5PA 5JJKA 2ARKA 3G7NA 4RK7A 5CK4A 3C7TA 5AVRA 3GAAA 4XGRA 4C0JA 4FKMA 1KC3A 4NMHA 2VJYA 3OZXA 4D25A 2JH8A 3IT1A 2IOFK 3IQXA 3ED1A 2E1BA 4INJA 1E3QA 2EW8A 2PZGA 1UJMA 4CL2A 3SK0A 2J41A 4ARUA 4DDMA 2PMKA 2B83A 4C78A 1G2PA 1KOFA 1KP2A 1PWEA 1U4SA 4C7VA 5U1PA 1IN8A 5F7OA 1IY8A 3KSUA 3BAFA 1JIQA 3DKRA 1T8SA 7AT1A 3NATA 1JPJA 4XPZA 5L3ZA 2D0IA 3EUFA 5E6RA 3FTEA 3CKMA 1BE1A 3TX6A 2E18A 3VMFA 2VCHA 4CM6A 1I7PA 4XFDA 4UE2A 3OICA 4OU5A 4EKNB 5HIIA 1BQ4A 1L5VA 2YMLA 3OX4A 3SBEA 1MV8A 2IL1A 3MW8A 4M83A 4EB3A 1PR9A 4XORA 4UVDA 4EHJA 2UUOA 2GF2A 5C8YB 2I4NA 2ZI5A 1EWRA 1LXCA 1Z5WA 3HCWA 1SOAA 3VH1A 4BJ5A 1WXWA 1J8QA 2RJ3A 3RCBA 5LDDC 1YRBA 1RLOA 2C7GA 3IMKA 4Y2GA 4YCCA 3EIUA 1PWHA 5K8VA 2DHEA 3W2IA 3ETJA 4ND1A 1DCKA 1PJAA 3UF0A 3LXMA 1ANKA 4REMA 3DNFA 1QG6A 3AF1A 1NUPA 3N53A 4YMWA 2M1ZA 3B9RA 3HJUA 5IAOA 1EXVA 1MABA 5FB3A 5KYNA 1GU7A 3FVWA 4BE7B 5L7WA 4S05A 1GQSA 3QNWA 4C07A 1E5DA 2UZ4A 3H2BA 2BTQB 3MNFA 5G0VA 1ZVVA 3UW3A 2J4CA 3EZXA 4OHMA 3HLYA 3K0AA 3ODGA 3FYCA 5FFFA 3HVJA 5D2CA 4K3VA 1SXHA 4AS3A 2BJHA 3QUTA 3ZJTA 4QQ8A 2XUQA 2Z57A 4MVJD 3O92A 5TJHA 4HFRA 4G5RA 3SQNA 1ECFA 1KMIY 1GP2A 1F2UA 1K7CA 1HYBA 1VQ8B 2PRSA 4CKEA 1IQRA 1OYOA 1RQNA 5JWRA 1GJRA 1O2DA 1KK0A 2ZREA 5LMCA 4LOHA 1YIOA 3T9CA 1GTG1 1ZCZA 2HMSA 1RZRD 1MDFA 4AS2A 1AKWA 3T5GA 3U3MA 2ZIVB 3P4XA 1D7AA 2RGBA 3B70A 3N7UA 4M1MA 5ULLA 2XOEA 3Q5EA 2XUGA 1DIGA 1OSNA 4KDRA 4U0KA 4BV9A 2NSJA 2A9OA 3T54A 2N1BA 5KQLA 3VOAA 1K4YA 4Q4CA 3FSGA 4MW9A 1MJ5A 2R44A 4E5YA 3T8YA 5F3RA 2B1QA 2O59A 1DQYA 1GTMA 1RLUA 4LSWA 1FQWA 3U4HA 5K01A 1X86B 4YEJA 1N9GB 1HT2E 3GGCA 4L5JA 4P9NA 3WLJA 5TGZA 1MA3A 3I34X 5K3BA 3TBKA 3CLSD 1IBCA 4ZFNA 4GOJA 1M0SA 2ZR0A 4M8KA 4QKQA 1XRRA 1OXTA 5BOVA 6AT1A 3U1BA 4UBKA 5F1KA 2ZRJA 3P9NA 1OZHA 1Q7TA 5JG7A 3PI6A 3VR5A 2NU9B 3PX7A 2IYTA 3CZAA 4K9QA 4B17A 4MVJH 2LVBA 3GD5A 3NWBA 4QWMA 3PE4A 2ZJ7A 3VC2A 5DYYA 9LDTA 3SBOA 4D4KA 1YJQA 1YTUA 4U2FA 2QUJA 3U9TA 4RPLA 4OQFA 3UXMA 4BBAA 2OORA 2PX2A 1WCIA 1JVBA 3K16A 3OHSX 2E49A 2BHNA 4TS4A 3RIEA 3SS7X 2C82A 2RI0A 4JFRA 1FFAA 1A50B 4DMCA 1ZPDA 3EN0A 2E7ZA 4Y1EA 2GYVA 5A8AA 2DBZA 1UPBA 4LXTA 4YIKA 3K1TA 2AN5A 3B2QA 3KNZA 4IGKA 3I83A 1MX9A 1OI4A 1IOWA 4JENA 3W8FA 4D26A 4TRMA 2RGGA 1F06A 4UEWA 1QH1B 3GLVA 1HL3A 2E9SA 4KXVA 4NMXB 1CFZA 4LOIA 3IAM1 1QFYA 3GXBA 2ABWA 3LUGA 1W6UA 1OOEA 1ULBA 2WF9A 3OIDA 2WWYA 1G59A 4O59O 3RI3A 2N46A 3R7BA 3K0KA 3TN7A 4BLUA 1Z0IA 2W2KB 3I39X 3PXGA 1KA9H 3LWBA 2WU8A 3LWNA 4HFJA 5CPBA 1RKUA 5DO9A 2CHVA 1FFBA 1ZH6A 1EHCA 2GTHA 2UVPA 2R8PA 2P9EA 3N39C 3B8HA 1C7ZA 1VKOA 2W4MA 1U90A 3C2QA 1MJGA 1PJ7A 1QGED 4LWOA 1RXEA 1YGPA 5JAZA 2BP7B 1Q91A 4NDAA 2G5PA 2JFQA 4MGYR 1ZM2A 4HTFA 5B3JA 1CQJB 4TV9B 2HPZA 4B75A 2JFZA 1BH2A 5C52B 2ZIZA 3JRXA 3M4NA 3HJRA 1RXVA 4IIFA 1EFPB 1ZR4A 4MQ4A 2PTGA 1WY7A 1XP5A 1LDGA 2J4FA 3O4FA 3QBEA 3TL6A 3W2FA 1E61A 3CVOA 3KL4A 4IOJA 5JD6A 2NW6A 2VZ9A 1U7TA 4BMCA 2XYPA 4HVCA 4TZ0A 3OQIB 3QXCA 5IWAB 3VKVA 4Y1RB 4NBRA 5DNAA 4OGKA 3QVOA 4DA9A 4R2JA 3ITNA 1YTLA 5E9QA 5FUVA 2ZKIA 2XYRA 4CV0A 3FROA 1F38A 1CUSA 3VSCA 1ULHA 1M2VB 3PIIA 2ET6A 2XXBA 4XWOA 2PUEA 4CQLA 4H9GA 2W98A 3G2IA 4C30A 3UANA 3NYIA 4G5FA 1DIAA 1UMBA 1KJIA 2P2ZA 4XLHA 5D1HA 1FMJA 4CU5A 1HYGA 3QU5A 1EFUA 1BMDA 2EJCA 4YUAA 3G2MA 2VIIA 4HAYA 3KOZA 4Z4YA 3K70D 1U3CA 3FGPA 3LAWA 2BGIA 1LBQA 1NW6A 3FTQA 4B3XA 1M72A 3ESYA 4LJKA 4PGFA 1J56A 3PVZA 3L8GA 1R8XA 5EZ5A 3BJIC 2PV7A 5IBPA 2WYIA 5KVQA 5G4KA 4DSOA 1C1XA 1OZFA 2ID4A 3VXKA 4QHSA 5JAPA 1LZLA 2CJPA 2UXCB 5FDFA 3C3CA 4HEA6 1Q74A 3OHPA 1E18A 3F0TA 1HYQA 1JU4A 2XA2A 2C9OA 3GAZA 3QPUA 1CP2A 3MOGA 3V55A 4O3MA 3K9WA 2WV9A 3PUVA 1IQUA 1P0IA 4ZRMA 1GILA 3ILHA 1AQUA 4AICA 1MH1A 4HRAA 1QHHA 2OLJA 1JJAA 4OB7A 1T4CA 4CV1A 4LS3A 2Q5OA 1WD5A 4E30A 2QSJA 3V8PA 3MLEA 3PXDA 2V4UA 1KTIA 3TZLA 3OF2A 1NN3A 4AO7A 3FN4A 2W8BA 5K1ZA 1GTSA 3ICOA 2R8YA 2XLBA 4N7MA 1WDLA 4G0ZA 1Z6XA 1DFGA 2XYVA 5A1JA 2IE8A 3P2MA 2VHJA 4Q39A 2XVZA 1THTA 4QJIA 4U2BA 4ZC1A 4QG3A 5CNKA 5GVSA 4EDFA 2I76A 2H16A 4KQGA 2ONJA 4GZLA 1M8KA 2B8EA 3BFVA 3COSA 4CV2A 3SHVA 1UC9A 1PNRA 5HIMA 3CC7B 3JQ8A 1RKBA 1E43A 1VPLA 3IPAA 4ZMRA 1JLRA 4RVDA 5KI6A 4D9BA 2WYHA 5HHTA 3V7UA 3E81A 3LL7A 5KOHA 3KXLA 4EPXA 4MQLA 1IYZA 2DYIA 2VF5X 3JWEA 3KUKA 1XTTA 3AOEA 3DSRA 2E82A 5G0UA 5I9BA 4LBZA 1HNXB 5JWHA 2QTMA 5TEWA 4B3DA 1USUA 2XTJA 1EESA 3PXBA 1UMKA 2G06A 4Q02A 5CFMA 1CY8A 1M2WA 4O8CA 2EATA 3ENZA 3LQFA 4J0EA 2GJKA 1UXOA 4E2WA 2O20A 2XZDA 4PLTA 4BIIA 3ACDA 5JPDA 1I7QB 3H5IA 3KX2A 3MWDA 1T9GS 4Q24A 4R69A 3T38A 5TQ2A 5KKAA 4CIWA 5B1SA 3VZSA 4JBXA 1WEKA 4CL0A 2OCLA 5TQ0A 3RHSA 3SIPA 3MAAC 1YD7A 2CFRA 3KSRA 3P1JA 1ZJ5A 3I2YX 3I5MA 3O03A 4GW3A 4M8NE 4MRRA 3WQRA 4DS3A 4HHEA 2HHHB 3GLRA 4D02A 4G41A 4RHTA 5L4LA 3Q3EA 4GUDA 3SZRA 3OSZA 5BXQC 4V02A 2BGNA 1C0PA 2YWBA 1JLKA 4JQZA 4QTTB 1UBHS 3BZBA 1ZYUA 2RBEA 3FBTA 3KZKA 5TEVA 2ATCA 3TQSA 2ZWMA 4CZ2A 2G82A 2OXFA 1G6OA 1BCSB 5SZIA 2DR0A 4TSFA 3SEQA 2I99A 4JY7A 4EEKA 1PNVA 2CGEA 1G1MA 3LUPA 3GUZA 4BFSA 4BO2A 3EXFB 3QEKA 2B36A 2ZYTX 4YRPA 2CV1A 1NYRA 4PQGA 2BH9A 3OQ6A 2EFJA 4FD2A 1IEVA 4WADA 3RSCA 3FCSB 4CTNA 1GAQA 3EVCA 2FWIA 2QQEA 3UVEA 3QRWA 3L1IA 4JXJA 3S1AA 1J0BA 1BOFA 5B7NA 3PTAA 2GM3A 2I87A 3F67A 4RK6A 4UVEA 2BFCA 2BZ0A 4BZPA 1CUWA 2VPIA 3TEFA 3E4CA 2PEZA 1BXGB 3E84A 3FFBA 5B5SA 1REQA 2Q50A 4GPTA 1ZA1A 4RF4A 5KYXA 1QDEA 3MCZA 2NU6A 2Q3EA 3RAEC 3GN2A 1C1DA 3C5HA 4L74A 5FBLB 3DYVA 5B4VA 4EEZA 4YJ3A 1RIIA 1V8BA 1D1SA 1WBDA 1FX0A 5LZ7A 4L4XA 5HP4A 3SBXA 3ABOB 4NOJA 4FFLA 4PAWA 4FQ7A 1FS4A 2HCBA 2ZTGA 4ACBA 1Q77A 2IGTA 2Q4OA 1E2MA 3ZVNA 2R68A 2ZIWB 1ZNXA 2G8LA 4MO9A 1EK5A 1YZUA 1W0JA 1T43A 2EGGA 3I64A 2IK8A 1LWOA 3UWPA 1RADA 3O84A 2AG6A 4PYRA 1CR2A 3QOWA 2JW5A 2P9CA 4XSGA 3RVDA 4E7PA 4UPDA 3CKYA 4GHWA 4ZO8A 3L05A 1BRTA 1L9XA 4UAJA 2FEAA 4NBKA 4DJEC 3KR2A 1H9BA 4Z4CA 2V1XA 1XALA 1FL9A 3H83A 1E2EA 2CWWA 9ABPA 2ZYGA 3KEOA 3I05A 1DBPA 1K9SA 2CWDA 3ASYA 1KRHA 3K0AB 3ZWVA 3G6EB 2C0QA 2OPBA 5B36A 4TL6A 3LPLA 5EKUA 1LK7A 4ZU6X 1NQOA 4DMGA 1R9JA 1SXJA 2HXYA 3U56A 4B7UA 1PT6A 4OGWA 2R6FA 2ZSHA 5KQMA 2P8JA 2R00C 4RDHA 1DWOA 4B3JA 2C4HA 2Z5VA 5CNIA 4D42A 4OGLA 3EGVA 2OENG 1I5RA 3NHMA 3ZHRA 4OHXA 1O96B 3TVDA 1SKYE 1T6NA 3KE9A 5IDYA 3WFJA 721PA 5IFLA 1NNI1 4ZT3A 3LQRA 3BGSA 1ODLA 4X71A 1UEJA 4HDAA 5KPJA 1QQBA 3W79A 2ZT7A 4GE3A 3ZD6A 3IDFA 3LO5A 4P31A 3NAMA 5AMXA 4C05A 5KQGA 1NU6A 1WXQA 1SUBA 1MEJA 3L4BC 1S8NA 1GEEA 4IXNA 1W76A 4Q6BA 3INYA 4O4JB 4RLHA 1R4NB 2JGAA 3EZFA 4UU8A 5IAAA 2C31A 3SQXA 5KKCA 1JMYA 3MM4A 3P5SA 1PEKE 4I0WB 2EW2A 3MMNA 5DHQA 3QXXA 2RHJA 1V2HE 3BULA 2NUBA 3GDGA 3VGJA 3ZK8A 4K9LA 4TLEA 1Y0BA 1C2TA 1N05A 3CY6A 1EQAA 4ETWA 2MTBA 4BAZA 1RJEA 1NSTA 121PA 1YRYE 2H2WA 2BGMA 1M34A 2JF0A 4BLQA 2QKYA 3PC6A 3BDIA 4XN0A 2MWMA 1E4OA 3AKDA 2J85A 1XZDA 2VYND 2J8ZA 4LXQA 1TCUA 4W7HA 4XWKA 4L4SA 1CUHA 4KOAA 4CR8A 1KP9A 3RTCA 3JR3A 1FNCA 1Q7RA 2VUHB 3I8SA 4ZN6A 4PXSA 1PV4A 2OB2A 2OV6A 2HLDA 1V5WA 1FNMA 1WCIB 2BEWA 3DZHA 3FAZA 4DCJA 1RCTE 2OV8A 2J6HA 1GTL1 1FP7A 1LBEA 5CCXA 2HV9A 2QEQA 2QMHA 1US8B 3RVBA 3BQMB 4RULA 1NRWA 3DBHA 3E2MA 3VAZA 3DPUA 5BSXA 1I3KA 1YU6A 1Y89A 1QCDA 1V5IA 3P32A 4RHUA 2B3TA 1TK3A 4G5HA 4DBZA 2ECOA 5GINE 1L4HA 3QFFA 4S0XA 4U0JA 1F0NA 3WL7A 4YV2A 4Z54A 1QRUA 3GJYA 2O2EA 4CVNA 3WL5A 2H3HA 3IELA 2OV2A 1I24A 4W8GA 2BFWA 1Z38A 3A9RA 2P65A 1P2DA 1THMA 3AILA 4BFTA 2WTXA 1WX1A 3MUEA 3ZYCA 4PN7A 2CK3A 1EVJA 1VBFA 2LV8A 3PUJA 3U40A 5I7RA 4JUFA 4IMPA 2HBZA 4TTVA 4GKBA 2RC6A 4RY2A 4B7AA 3IMCA 2UVPB 4FGSA 3R7LA 4K6HA 4EY6A 3N70A 3W2EA 4ZCMA 2AUMA 2EC5A 3OIUA 4KWTA 3GEDA 5CDFE 2GKOA 3OIVA 4YGYA 3V8VA 1P8JA 3RS8A 3QEAZ 1NVUQ 1BFUA 3H1AA 4QQKA 2OO7A 2OO3A 2Z6VA 4I55F 4M0FA 4ZRNA 4E51A 3KVYA 3T4PA 1Z12A 2COKA 1KI4A 1RR6A 1XHLA 2HSGA 3R7DA 4RTPA 3O9ZA 3FNHA 1YNSA 2RGXA 2PWPA 2QF7A 5GM2A 2LWIA 4EW3A 2VNJA 1E2LA 2FZKA 4QV2A 1AKQA 5FUYA 4TV8A 5KVVA 3ZHTA 1LX6A 2AYXA 4TS9A 4ZYZA 1IHMA 2Q2WA 3CNBA 4G0YA 3N2IA 4AIIA 5C1BA 1PV1A 4A0FA 1SHTX 3AFOA 5AVXA 3HKDA 4CMEC 4M86A 2ZJ4A 5IXYA 3KEQA 4LHYA 4TUYF 2HGZA 3SF0A 4XJSA 2P3SA 4G5GA 3TLGA 2PBRA 3M1LA 3M0EA 1Z6TA 4FR5A 3R6KA 3ES9A 1PG5A 1S6YA 4MAMA 3CCVB 2J59A 4JB2A 5MFPA 1ZK0A 3GJ5A 4URUR 4CQLB 3OM8A 1PG0A 1U2PA 4FUTA 4HKTA 1NDQA 4QYMA 5F35A 1ZIDA 4WLNA 4UHDA 2ZTHA 1UM9A 2YUIA 1R00A 2WNHA 4ZVKA 2OV4A 4GRDA 1UP7A 5CFLA 3ZD7A 4KH0A 4RLZA 4XQGA 4EB6B 5K8UA 2NU7A 1X87A 4NDNE 4ABYA 5CVCA 4KJZA 5KREA 4KN6A 1AGNA 1KDPA 4PTZA 1UD3A 1MQAA 1KK1A 1SBIA 5DXJA 4UXIA 5G4KB 1XZBA 3OTHA 1TGYA 4KGVA 3HFSA 4CN9A 2VSYA 2W6NA 1VBKA 2O52A 3E18A 3HYCA 1JTFA 4FD3A 3ZU5A 5EE1A 4FK8A 2H2GA 4PYOA 5T6BA 4CMGA 5TJ9A 2DFKB 5F33A 4YV1A 2VTEA 3R0VA 2CLFB 1PFYA 2GOYA 2HA3A 4BX9A 1FNNA 2FZCA 4F3RA 5JMOA 4WEQA 2JH3A 4D9CA 1Z36A 4Q48A 3KAQA 5DHPA 2XDWA 1O3YA 4CDMA 2CDCA 2YWHA 1L5RA 4V0RA 4HFNA 4W1PA 2FOXA 1P1HA 2BELA 4L9SA 1N2CA 3DEYX 2Q5CA 3L6RA 2ZVPX 5HK8A 4I1YA 4XD2A 4R3UC 2FEMA 1KSJA 2PU5A 3LNTA 3QVGA 1UKBA 3H99A 3IAS6 2VF4X 1LLUA 2HJHA 2B1GA 2W8BB 4G01B 4GR4A 4GX1A 5CLFA 3FF4A 1YS4A 3ELUA 2ODQA 4C7JA 4UVGA 1IG3A 4IO0A 3UJHA 2RCYA 1MX5A 1NC3A 3IVCA 4Q3AA 4PG4A 3W8NA 3T15A 4FXUA 1X1QA 3EXAA 3BD7A 4FP9A 1FVHA 3T1HB 1XDZA 2FPKA 4RTRA 3FKSD 3ZOKA 1A1VA 1VL8A 1UBTS 2BJWA 4FYJA 4OLHA 5HIKA 4LDJA 4U4AA 4YRJA 2Z6UA 4GVPA 1VHEA 3O2SB 4JEUA 1FDRA 3FPHA 4EY8A 3VR5D 1V7QA 2JAPA 4OAQA 4RQAA 3T94A 5KOHB 4CMJA 4QUEA 2Z8YA 5CVUA 5TPWA 2CLHB 3U13A 1XXLA 2X6RA 1U6IA 2I7CA 5G3YA 3OCZA 5ECYA 5FA6A 5E0KB 4BFYA 3TF5A 1Z3CA 3I2FA 1GQFA 2ZS8A 4V3BA 1X39A 2UUBB 3VHXA 4HB2A 2WG1A 4R0VA 2AH5A 1SR8A 2XIJA 5FPTA 4EENA 4JBYA 4ARAA 1MOPA 5AICA 3O8RA 4IJ5A 1KGSA 1Z2PX 3MS4A 3A1EA 3SQMA 1U28C 4R4JA 4QOEA 3O47A 1JDJA 4I1IA 2GPWA 2R8XA 3SDBA 2BR4A 4D3XA 1KQSB 2XEXA 3H6HA 4WNCA 2HHAA 4R8RA 1BAPA 4JT9A 1IZ7A 4LSZA 3SEAA 1RAAA 2D2VA 5AK5A 1WE2A 1CNFA 1ZK3A 3JV7A 4XEHA 4OKIA 5AHOA 5TQ0B 1RLMA 1KI9A 1Z68A 4DV4B 3LYAA 4EY4A 1QPZA 1OC4A 4XR6A 1J7KA 2D5LA 3AHJA 1ZSNA 2OBLA 1T1GA 3PNLA 3BS4A 4U7GA 4XIFA 3K8YA 3RV3A 1QXSA 3NBFA 4FGJA 1G7TA 2ENUA 4HQ6A 4J16C 4JLAA 4YFYA 1BVRA 3ESBA 5HA5A 5HRAA 5HRUA 4S2EA 2EARA 1R0RE 1UT5A 1MGPA 1TF2A 3L9XA 5KTOA 4BYMA 2W37A 3X1KA 3PL5A 4Y9TA 1PQUA 5JTUA 1B0AA 4J4HA 1Q0SA 1DG3A 1S8FA 1WKBA 1YR6A 2AX4A 2Q1XA 2XVMA 3V42A 3VR5H 4F4DA 4KI0A 4GDFA 2HF2A 4CM7A 4ESOA 4B32A 2OWEA 5A05A 3NCTA 4A2QA 4FGKA 2H00A 5KTPA 2X8JA 3H5RA 3WLIA 3DV2A 1UFOA 2AI1A 1M0WA 2SKCA 4NECA 3V8RA 4CKYA 5J4HA 1B76A 2MR5A 3T4XA 4OP3A 2OK7A 2IPOA 5DT9A 3VDQA 1Q7CA 5DM2A 1ENZA 5F7XA 3VAYA 3W2TA 5E4YA 2Z8XA 4Q18A 1J0CA 2PLNA 5M29A 3L2OB 4JBLA 1FVFA 1GLGA 1NIPA 3SLNA 3EAQA 3EBOA 4K0KB 3JX9A 1NXVA 3FMFA 2A9FA 2G63A 4TWBA 4AY5A 2IT1A 3UCFA 4HWGA 2WAYA 4IDQA 2P79A 4PC7A 4JI0B 1CZNA 1PJZA 1ZQ1A 2J9YB 5AK6A 5C34B 4ER6A 1T0BA 1DDIA 3L7OA 3SD7A 2V1UA 4K7JA 5H3LA 5HMLA 3PLAE 3W90A 1YQQA 5KYXB 1JLMA 3K7EA 3H9EO 1NY6A 2NU6B 3QPBA 4LXXA 1AMUA 1C80A 1CTQA 1RLTA 3VO1A 1QC5A 2JFUA 1DTWA 5H1YA 3C7CB 2Z0MA 4YJ3B 4ETMA 2VCEA 1CUCA 1AXRA 1FX0B 1L1FA 1YFLA 3DDUA 5IC5A 3DBVO 3O8OA 4DILA 3B3QA 521PA 5J4KA 3KXPA 2VOEA 3OC6A 1Q81D 1SIBE 4U6SA 5TPZA 1VHJA 1LVHA 3V2UA 1X1BA 4E07A 2QRPA 4QBGB 2X1HA 1CRPA 2C78A 3G5MA 3R4CA 5EZYF 5HS6A 3I6MA 1ACJA 4XZ3A 5JFOA 1YBAA 3AFHA 3DFZA 4K9NA 5IKXA 3Q88A 3U80A 3ZU2A 1F1BA 4RMNA 2V7PA 4YACA 4E46A 2JLZA 4GICA 5P21A 3CX4A 2XCSB 2ZI9A 5DIZA 1BDIA 7GPBA 4M0LA 1P7YA 4JSYA 2O2DA 3W1WA 5FLEX 5AVWA 3HBMA 4JB0A 1N2ZA 4GH5A 1JG2A 4MRMA 3HXMA 4G36A 3LKBA 3KBBA 1LFDB 5T4FA 3CCUB 5CK5A 1ESDA 4FU0A 3WGZA 1OZ0A 1QKIA 1SXJB 3KQUA 1N0HA 3MLAA 4DB2A 2O3UA 4ITRC 4CG1A 1TLFA 3GLGA 1Q3HA 3K0HA 3PRKE 4PZZA 1HE5A 4OUDA 5C7IO 2JIPA 3S2GA 1QGZA 2DFNA 2GZAA 4C1BA 2GJ8A 5DHFA 1U0RA 1V11A 2A0KA 3DZBA 2PSSA 3JQQA 5TQJA 1F12A 4P81A 2A84A 3DE0X 3ECCA 1VB5A 4M0PA 2F3TA 2XB2A 1VKNA 1D0SA 4FHGA 4DQUA 1W581 1YE5A 1TJPB 2BZ1A 1JIUA 2P1ZA 2NQTA 1PZEA 2ZIXA 3W9BA 4I9GA 5BR1A 3FX2A 3BGOS 2C5FA 2UZAA 3KJZA 4YELA 4KBGA 4X7PA 3A8KA 1NZFA 1Y6ZA 3AIIA 1FRFS 1YS7A 2UKDA 1BO6A 4MWTA 5FCDA 3GYGA 3HC7A 4Z4HA 2CE2X 1MHTA 2A1IA 4LYDA 1C0KA 2PBLA 1AMNA 1UJNA 4EBBA 1TEXA 2W4IA 2IP4A 4URHA 3JQBC 2BN4A 2MSWA 3T3GA 3I52A 5LQAA 3GZNB 5IT4A 1XBTA 3ZGYA 5EJ6A 1FNDA 3G5AA 2GO7A 2WHXA 2CLCX 1GSOA 2Q45A 3OZIA 4ENUA 4YRAA 2XCRB 3A3KA 4MUEA 2EZ8A 4MWGA 2HEIA 2VT7A 3J7TA 3T53B 3FB4A 3G0DA 2VZLA 1D0VA 1YAJA 3B3JA 3H9BA 3RS4A 1Q95A 4EKYA 3WIUA 1SBHA 3EOZA 4K6CA 3QQ5A 3C3PA 1J99A 1TJYA 1ADBA 2FSHA 1MO4A 2XR1A 3BMNA 3CT6A 3CUYA 3SF8B 5EQJB 5B1YA 4YCMA 2XYGA 1F51E 3NEAA 4WKGA 2O7SA 3RDPA 3RHFA 4BE4A 4UULA 2PX4A 5AUQA 4DRZA 2BEWB 4R1TA 4TRRA 2PX8A 2Y1DA 1SUDA 4AM8A 3LVFO 1A9ZA 4CDNA 3EISA 4MJ7A 3KOOA 1AN9A 3P0EA 4LPKA 5ALHA 2CL5A 1N2EA 3OPYB 4D92A 2AJCA 4KYUA 2V7TA 5G2OA 4CIBA 4HD8A 2CSUA 2FWRA 4PPFA 5EUBA 4EFKA 3QX7A 3HAGA 3PYXA 3L7IA 1ODFA 3DDZX 4CCYB 3ABRB 4QG7A 1IM2A 2YYAA 2J48A 1ONOA 3B9PA 3OJWA 2VQ6A 3QVLA 4KFTA 4UD6A 4I46A 4ZYLA 3PF8A 1M54A 4YUVA 4J2TA 3I09A 2UZ0A 3M70A 4G8CA 3HA3A 3QBJA 2DY0A 2XJ4A 2ZPAA 2J7PD 1R2QA 1K6IA 2A86A 2NOAA 3FM9A 4A23A 5B4TA 2PT9A 4TSFD 4EW1A 1LLCA 2H2IA 3TPCA 1N6KA 1YQGA 3TX2A 4BASA 1O5OA 4ZI7F 2D4AA 1EK1A 4K9DA 2MJLA 5EHNA 3RGWS 1DAEA 4M0KA 4C7MA 2OGTA 3GFQA 1HUQA 1DEXA 2OTCA 1C29B 3WL6A 1U8UA 1X7XB 1NVBA 3MGAA 1WUYA 4M9QA 3NLLA 4NPAA 2P6MA 3CNLA 4BN5A 1TCBA 2GHRA 2XHEA 4JHLA 4MVJM 4Q6WA 2QRUA 3MERA 4R40A 4WLUA 4Z9AA 4LZWA 5CDTA 1EFTA 1M66A 2Z2ZA 3LS2A 2B9EA 3T3NA 1I4OA 5EJ5A 1P5JA 2QJFA 2WTUA 2P2YA 2FFBA 3B7PA 1Y9JA 1NVEA 3FLEA 5BRAA 2WZDA 4RMIA 3CTMA 3U31A 1DOAA 4AJEA 4CIAA 1XJ5A 1LSSA 1BWQA 4CUZA 1SXIA 2X0KA 4OA8A 2CMKA 3TL3A 5M5BA 1AB5A 3CISA 5F1PA 4LZPA 4G8BA 3WL4A 3WDSA 3AHCA 4P33A 4F06A 2BEJA 2QR3A 3GVXA 5H7XA 3TLGB 4C5AA 4ZCQA 5FI3A 3L4KA 3WO1A 2VT6A 4EKDA 4K81B 3FJ1A 3PDCA 3L8CA 3LC0A 1TVKA 4V0KA 3AF2A 3L43A 3LCRA 3LT4A 4GOOD 4WFQA 1W0JD 4DMKA 4AI6A 3BHMA 2XMPA 3ESZA 5A9TA 3VU3A 2F17A 4J2OA 1ZHOA 4MS1A 1UM9B 3MC1A 4UARA 4C0WA 3G2HA 3PZRA 4FFVA 4MV5A 4URFA 1NB9A 3ZLVA 1JEYB 3WSVA 4G1FA 2RGCA 2PFKA 3AM5A 3TTWA 3WWOA 5IM5A 5GZ3A 9MHTA 1MNAA 2NU7B 1BEUB 3LA8A 3LSYA 2ZANA 5T6MA 3ROKA 2ZRGA 2FMTA 1FUEA 4OV6B 3H4VA 4HNTA 621PA 2E6KA 1A82A 3JD2A 4YI3A 4MW6A 3PT9A 2O2YA 2R86A 1KSHA 4RK0A 1Z22A 3RRXA 3SKXA 4B80A 2QZPA 1GGKA 1G8JA 1KAQA 1JFRA 1YRWA 3CLKA 3GDFA 3O4IA 1GTJ1 1XUOA 3Q7QA 4HMPA 4S12A 4PZ9A 3TJZA 1AH2A 4FOPA 2YHBA 3CGWA 5CR9A 1WRBA 4MS4A 4EHLA 3KPWA 3WKBA 5DM60 2KPOA 2WWIA 3OLVA 3T5BA 1NMQA 3QYFA 2PGLA 1WUKS 4B4VA 3IV6A 3AY6A 2Z5FA 2UZ1A 2O8CA 3K9CA 5B6PA 2QD5A 4J9VA 1XMOB 3FFTA 2IQ5A 3PFBA 2WR8A 4XEUA 2PK3A 3H7AA 1EX9A 1N8NA 5IAEA 2FWBA 3QVGB 4Y2PA 5ERYA 1E62A 2Q7OE 1T26A 2GK3A 4GKJB 4QGFA 1OLUA 4R1NA 2J32A 1QBGA 4CM9A 3O83A 4KQJA 5ILGA 3MEQA 1TM1E 2VDNB 1AKRA 1M2EA 4UCXA 2MSKA 5FPSA 1V8ZA 2H5IA 4J7CA 5H0IA 3PQEA 1M5TA 2QN3A 1R9MA 2GZ3A 5E1BA 1TDJA 2LDBA 4TZ6A 1ZDMA 1LEHA 1E7YA 3G2LA 2WB4A 4RD0A 4Q4JA 2V6IA 4JJ4A 5DTRA 1V7ZA 3WHLA 3WL3A 4E5SA 3ETNA 2VZ0A 4A92A 5AP9A 1L5WA 3EZLA 1AK9A 4L0QA 1WEHA 2QJWA 3FPCA 3OO0A 2P62A 3SYKA 3NO4A 2BGLA 2VHCA 2J3DA 2G28A 1NTRA 3OZUA 1PT9A 1F0YA 2BFDA 3CNHA 3GFRA 4K3UA 1JKJB 4P4NA 4W5HA 3INTA 6GPBA 2CF4A 2X15A 2PKCA 1X9IA 3F97A 1JHMA 5IUKC 2BBWA 2W2TA 3VHXB 5B53A 4EBFA 1U0JA 2HLDD 3OKFA 5ALPA 1KPHA 4OQLA 4E2YA 4P1ZA 2V7QA 2WJ6A 4I08A 4URVR 3AR4A 3GDWA 2OE2A 1VXRA 1RWBA 1GUAA 1N0IA 1V0FA 1XE3A 2VRCA 5F4MA 3TOCA 2PRZA 1HDCA 2QM7A 3H9UA 3H8JA 2AFRA 2EXXA 3KYDB 4F71A 2FUEA 1T2AA 1EWQA 4BNLA 1QFJA 1QLWA 3BXFA 3MJTA 1IN5A 2GI4A 4DA7A 5M3BA 1HEYA 1O5TA 1YDHA 2AX3A 3TXXA 3GZ4A 3WAJA 1HDIA 2HRQA 3BWBA 1PFUA 3GT0A 3N5KA 1X94A 5BWOA 2PJRA 2BFEB 2CHFA 2HXSA 3PX3A 4Y0AA 1QLHA 5L46A 2F8MA 5KUTA 1UP4A 2VBGA 4UXJA 1SB8A 2CK3D 3R2JA 4N9WA 1LH0A 3NIWA 4RSHA 1XRPA 2L0XA 1UJ5A 3GC6A 3GEHA 3N8IA 2I34A 4YT2A 1NE7A 3D5QA 1KZLA 3H5LA 3VYWA 4DDTA 3IX7A 3ZHBA 2GBFA 4C6RA 2ZFUA 4C3VA 2X2EA 3D0KA 4QTUB 3W5UA 1Z4MA 2Z43A 4NL4H 1RHQA 5GOTA 1WKCA 4F96A 5A04A 1SCAA 3E2IA 1DAIA 4PW0A 4F72A 4DXHA 1SA0A 1TTQB 4HRVA 4TLMB 1VJSA 1HV8A 3VZRA 3HNRA 1DEOA 1NUUA 2DY1A 3CZQA 1VQNB 2BKVA 3PFCA 3A11A 4TM8A 3ZGXA 3EXG1 4BQEA 3KETA 1WVIA 4GC5A 4MV3A 2PTHA 5JU6A 3QPAA 3AHGA 3QVKA 3SC2B 4RM0A 2E4UA 2AUTA 4X8MA 3BK1A 1W9MA 3NMUF 1FP2A 4LC0A 3NIDB 1K8QA 3V33A 4HUQA 1YVRA 5DYIA 5EJ7A 2RGUA 4IZIA 3QU7A 2PWAA 2PMBA 4Z8YA 1FLVA 4LZNA 2VSOA 2DSTA 4M88A 3OPOA 2BOVA 3C16C 3LW7A 5PNTA 4P26A 3DZIA 3O5AA 3VVLA 4AQDA 5AW1A 4HX9A 1O5IA 2WFLA 3EIEA 1PFVA 3LUAA 4QU8A 3W5VA 5DOZA 3UJ8A 1UPCA 4HPWA 1OX6A 3CMEB 2I9KA 2AD1A 4ZHQF 2NTYC 2BFMA 1C1YA 1QIIA 2Y2VA 3I01A 4XSVA 5SZHB 3JQEA 4BMNA 2G9NA 3TR0A 5AI9A 1JTEA 3QMPA 1GHTA 2X14A 2H59A 4QATA 2X53S 4Q7QA 5L3SA 3ESRA 3U7JA 3TECE 1H6DA 1MF7A 2BJVA 2QTNA 3EZ7A 5CM8B 3D1VA 1R88A 3EF1A 5KC9A 1BTOA 3O2QB 5GV8A 3D0QA 3R7NA 4IUCS 3I12A 3DMYA 3HS3A 2B4AA 3LQQA 3M34A 3Q3VA 2Q62A 3GARA 1KI6A 3GVHA 4M0MA 2XI4A 2H2AA 3CPXA 2KWIA 2Z83A 3G05A 3W4KA 3ZD8A 5JNTA 4HNAB 1E0KA 5KB3A 2PQ2A 3M81A 4BKMA 2V9CA 3BZUA 4JP2A 3WOHA 1FQOA 4E11A 1PFGA 5EP3A 4QOJA 1XOIA 3UPDA 4YUYA 1IM5A 1YB4A 3WBBA 1SU8A 3BIJA 4C4OA 1FZQA 1C8LA 3CVXA 4MQFB 2JN9A 3QF7A 1UK8A 3RTDA 4CLRA 2BEVB 4M60A 3ZW7A 2GRJA 2PZMA 2D2FA 2GXSA 3OFVA 4G5OA 1ZGCA 3HCBA 5TDHA 1GGFA 1V3QE 4HN2A 4Z0TA 3S2ZA 5AW7A 1BX0A 1K0UA 3G5TA 4D3SA 4D9IA 2TMKA 4CEIA 3IAUA 4IJMA 1NF3A 2I3ZA 1XF9A 1T0IA 2JIOA 2O3JA 2ZIXB 3OQHA 1GL6A 4ESVA 4Y9DA 2AMYA 1J24A 2D1YA 5J23A 2C7OA 5F64A 4HEA1 2NO9A 3HABA 3Q6MA 1FLDA 1UM8A 4N47A 4F38A 2CJWA 3PV0A 3ITKA 5WRFA 1QFMA 1VJCA 4CFZA 1F17A 2PE3A 1PGQA 4U7DA 1N32B 1KJQA 5BYKA 5IDQA 1TKCA 2QLLA 1S01A 4LVCA 4I55A 2PH5A 1FFCA 4N7RA 5AW9A 1XWIA 1XTSA 2G4LA 4DQKA 4MYCA 1PZFA 1VQOB 4U2EA 4ZWNA 4BB9A 2ZIAA 3H84A 4A8PA 2ZJ3A 3JZMA 2C1ZA 1I51A 3MILA 3D0RA 1W88B 4RTLA 4GKVA 4JLUA 5BSMA 3Q3IA 1BX3A 1JN0A 4MV9A 3LP8A 1F2DA 1EUDB 3D4NA 3NU1A 4H08A 4HNVA 3CYFA 5CIYA 4BVAA 4ETIA 4UATA 3ZE6A 1BHO1 4IYJA 2HA0A 3VU9A 2XNSA 4QHYA 1GG8A 2K4MA 3A32A 3BG5A 3SHFA 4MQEB 4OXQA 1VTKA 4WAUA 3RVLA 4YPVA 1IB6A 2WKQA 3G59A 3OX1A 4JVMA 4ZO4A 2H2DA 4CCAA 2OYNA 2JFFA 4MI1A 4RAQA 4TUYA 4Y7DA 4KOEC 5BMVF 2P41A 2AHOA 2C5LA 4RO0A 2OOSA 1ND5A 4HH4A 4I3FA 1MB2A 5JHHB 2LD4A 3IILA 4TMWA 3ZDAA 1D9ZA 3OEEA 1ODIA 1L7DA 1OI2A 2ENWA 3MGGA 1QVRA 4MIKA 4N6GA 1QP4A 2QSYA 1N5LA 1QZZA 1AT1A 2EX1A 5F9FA 2PD3A 5GJVC 1UWLA 2ZTLA 4UFNA 4GD3Q 4RH3A 3OI7A 4F45A 1I2BA 3V6LA 3TCNA 3F5QA 3PNMA 2YY7A 3LHIA 2YY6A 3KS9A 1S8OA 4LF9B 3AI7A 2YWCA 1I6MA 1QNFA 2OYSA 1KJYA 2QW8A 4MR9A 4C87A 5CA0F 2J0QA 2O8FA 4BMOB 1RXUA 1JR4A 1OAKA 1TQDA 2GZ1A 2JHFA 3IAAA 4TLAA 4D9MA 3HY4A 3RSLA 5HTOA 4FEGA 2VNSA 1A77A 4Z7JA 5GONF 5T64A 3HYSA 1BE6A 2G77B 2GPNA 3PHJA 1Z0KA 1X7GA 1GFSA 4AL4A 3V00A 3CLRC 5FYDA 3OTQA 4R9SA 2Q0SA 7MDHA 3TINA 3E4DA 3VR4A 1AXGA 2XKKA 2ZZEA 1W7AA 3E5NA 3N87A 2H2FA 2ORYA 2XHZA 2D8MA 3H86A 2XE7A 3M6UA 4PC2A 4CM3A 2IYRA 3P8ZA 1JXMA 5TIIA 1KYWA 5DHAA 2X41A 4PAQA 5CM2Z 1T6ZA 3C14C 3X3HA 3BIFA 3ENWA 2D06A 1AQYA 5CVVA 2AOVA 5L45A 4B45A 3V80A 1OBFO 3B1ZA 3KYIB 1A71A 4AF7A 3DVSX 4R05A 2I2WA 4RU1A 2F9FA 5DKFA 4DUGD 2AWNA 4B74A 2E4ZA 2OZVA 3PIRA 4P4LA 1I9GA 3GW8A 4M1TA 2OBMA 3AM4A 5TPZD 3V4VB 4WZBB 4ZYXA 4QX6A 3RU2A 1G5TA 1DP4A 1N3BA 3MWKA 2HTFA 2BSXA 4HGOA 2FRDC 1FFSA 3CNEA 3PXUA 3SFTA 3LK6A 1X7WA 5CIWA 4G7XA 4H1UA 1V0EA 4ZCPA 3RKUA 5HK9A 1VIYA 4RD3A 5B58C 3UV7A 1AS3A 3G71B 2C2HA 1RXWA 4PN3A 3QYPA 1I8DA 1L1RA 2I1WA 5D84A 4HK4A 4IJUA 3OC0A 4NHOA 3PICA 4HN4B 2DFDA 5EIOA 1CV2A 4H1VA 3TRKA 1DE0A 2Q4BA 3EDRA 5EG5A 3R4VA 1AD2A 3FSRA 3KEFA 3FCAA 1M73E 3F7OA 1V16A 4HF7A 2A5GA 3FHCB 4EDHA 3X2SA 5IBRA 2UVQA 3L0CA 5CEFA 4AJNA 3BCSA 4AXBA 4H18A 4FUQA 4YYEA 4D2IA 1KZ4A 1UPUA 3BNWA 2X9GA 5FOXA 4CEJA 1U2QA 3CESA 1B2LA 2JVKA 3RV4A 3F98A 1N8TA 2WD9A 4XLTA 5J58A 3L7AA 3VDNB 5G1PA 4US1R 2FW6A 3PQ8A 1WCYA 3NEPX 5T8KA 5KTNA 2ZJ0A 2Z56A 4GOND 2ZS9A 1L7BA 4KAJA 4IZOA 4LZJA 1JFSA 2Z98A 4NFYA 4ZCTA 1UC5B 2RHLA 4XB1A 2CJFA 3H4MA 3ELDA 5DISB 4KXXA 3KG2A 1YS2X 4Y2UA 3FVRA 5IF9A 1N2JA 4NJMB 3IH5A 4XOTA 1O7JA 2XB6A 4IXMA 3K4HA 3CSUA 2AN9A 4PBTA 3X1YA 4D3YA 1BDBA 3KUCA 1H42A 4KSCA 3RBVA 1RI1A 2WNIA 1BVUA 4MA4A 4MW0A 3V6MA 2X6WA 1KU0A 2BC9A 4EAAA 5C35A 3QEMA 3DFFA 4AB1A 3EVZA 3ONVA 4X3CA 2ZZNA 2WD7A 5CFZA 4Q4JB 2M98A 2ZXFA 4PAMA 5D01A 2QVBA 3A8IA 3W78A 1IN1A 1P1BA 2PH7A 4MA0A 3B1JA 3AOGA 3P2KA 2VK2A 3LKVA 3I32A 1SXJE 3G5LA 4AG5A 4BYGA 3KT0A 2BFDB 2B7CA 4FOSA 3UGKA 1XT6A 2RI1A 2QRVA 2VR1A 2AUNA 4OXXA 1PQYA 3PL1A 2NV0A 3NJ4A 2YWXA 3ESCA 3QYJA 3RTAA 4GL2A 5EHZA 4UMVA 3JYLA 4JQOA 3RE1A 2XB4A 1KBQA 1GZ3A 5KOYA 5K6AC 3OE7D 3P97A 2VHTA 4Q05A 1HLDA 4AUKA 1NBEA 3JAKA 3M9LA 4ZYYA 1WTHD 2YOFA 3A6LA 4TXMA 2ZZQA 3P2EA 5K03A 2DFTA 3RTEA 5DM0A 2CKMA 5K20A 1OXBB 2Q3CA 4RM3A 5DN9A 5EZYA 2A30A 2DHRA 4K9PA 3OEWA 2X0RA 4L8FA 2B20A 3SZGA 2PD4A 1FYDA 2PKYX 2SHKA 3IQWA 3HJAA 1Z37A 4Q7JB 3L7CA 2HLPA 3DAYA 4Y2SA 4I99A 3GX1A 1RIFA 1RI3A 3M4XA 4XCQA 1QHXA 3DUFA 4XOIA 5BSWA 4BFZA 4URZR 5BN5A 4N5MA 3HB1A 4WKBA 4ANFA 4EG8A 3ZZTA 1SPBS 1YITB 2HJRA 3IQZA 1CE8B 1HBJA 3AF3A 1VHQA 4R31A 4N8SA 4TXLA 3TRDA 2XUHA 4D9FA 5IRCD 1VSBA 4JL5A 4MWSA 2WTBA 1LV8A 1Q92A 4AN0A 1AS2A 5FUWA 1SA0B 2VUUA 1YA4A 2C07A 1T3LA 2B99A 4JB3A 1I1HA 1YUNA 1CF2O 4G63A 2R84A 1SQSA 1V25A 5BWLA 5LIPA 4AC9A 4AQYB 1U5BA 1EWVA 3NV9A 2GM5A 2GPSA 1O89A 2HMUA 2MSCB 4J3FA 4Q37A 2LCIA 3ZG6A 3S8EA 1JAZA 2KHZA 1NFRA 1ZIXA 2ZAMA 2AOUA 4N7BA 3T3OA 2AKYA 4KQ9A 4RDXA 2JARA 4HUQB 3BJRA 3DVAB 4UOEA 4ZXPA 1TJ5A 3SIWA 1YH3A 2I2XB 2X5NA 3SZLA 4LDZA 3FAKA 1IZ0A 2H8KA 1JDTA 4KREA 1XA3A 2Q9AA 4KB5A 3KKMA 2X0IA 1ZN9A 1OI3A 3GFFA 2ETVA 3NDPA 5G53C 4FFNA 5LR6A 5K0CA 1U0OC 1F48A 1U0FA 2JIBA 2I6TA 2XUOA 3PNQA 4X44A 1L7QA 1X1RA 2QP3A 1QV6A 1NF9A 1UJBA 2ZRHA 1P80A 1ZVJA 2ZTVA 2XW6A 3AL2A 3ASUA 1HZZC 1I3MA 2DPGA 4ACAA 2YDYA 3ND5A 4LC1A 5G41A 1KQ3A 3NDRA 1XQ9A 1HT0A 1A9TA 1E8DA 4KODA 5ESDA 4B3HA 3Q85A 3OJFA 1VCNA 3HXPA 3WK5A 1FP6A 4P3YA 1PSZA 3AR7A 3JALB 3K09A 4JWTA 4XIJA 2YWGA 3T3HA 3WP1B 1TK2A 4G0WA 5D8DA 1ZI9A 5TMPA 4RLSA 2XF8A 1KI6B 1K5DA 1H9AA 2RAPA 1XMJA 4B6FA 4ECEA 4Q9JA 3WMXA 2E89A 3GMDA 3EQ2A 2C96A 1YL6A 3G0IA 4IVQA 4OJNA 4UNPA 1SN7A 2CXNA 3D7KA 4JEIA 2A33A 2FMFA 3B1XA 2X0EA 5ARDA 4D0SA 1S3IA 2BISA 4U5XA 1AJEA 2CHEA 2R4UA 2W2QA 3KT6A 4EG0A 5ADVA 2HJVA 2QMZA 2HLHA 4DLRA 3WIVA 2QE6A 2CBGA 3MD0A 4M1YA 2JDIA 2WSSA 1XCPA 1YJ5A 2DQYA 1NQVA 4JEHA 4QXMA 5DHUA 3VPXA 4CLRB 1JKIA 16PKA 1CS0A 1NYTA 1JQEA 2JLCA 2DR2A 3OA2A 4D9JA 3QNUA 2R3SA 3DQPA 4O2AF 2X7JA 3KHUA 4U8GA 4TKMA 1Y1PA 2VJDA 4PCAA 1C8VB 4ZU1X 5FL7D 5K0JA 4HAIA 3KAJA 4NENA 5FI5A 1E60A 4KR9A 1IY9A 2V74B 1W44A 4QTYA 1Z5ZA 4CEIB 1E7MA 5HE9A 4JLNA 4ZI7A 3LF2A 4DWJA 1DV1A 2WKWA 3PRYA 1QIGA 1AX9A 1KZYC 2GNPA 3DPIA 4MWBA 3THRA 2A4KA 4PQEA 1GZVA 3RHZA 2Q9UA 3K8QA 4FNAA 3FSEA 4MGIR 3HWSA 2P4SA 2PUCA 4M38A 2O2JA 1SVWA 3OAAD 2PQ6A 3TSCA 1MRSA 2ZSFA 4JUCA 1OH8A 1MJGM 1U8YA 2ZRFA 3CXUA 2QY9A 4O0MA 2XMSA 3QOFA 3DOHA 3PC7A 4HPJB 5DPMA 4D43A 5I7SA 3BEDA 1J25A 3WYCA 4EPRA 10MHA 4MKIA 1V5FA 4IV5A 3UH1A 5AVTA 4F2PA 3CONA 3MAJA 1X1AA 5K4HA 2OQIA 3EDOA 3LPDA 1UBCA 1XCLA 3GJ0A 1MV5A 4IDCA 4EYGA 3E9DA 2J9FA 1SU4A 3GNSA 3QHPA 4KXLA 4WL0A 3WR5A 1VIVA 2WJHA 3DMTA 3JQAA 2V7QD 3MLBA 1SIOA 1GGEA 1KZ9A 2RIPA 4EGJA 2D4HA 3D2LA 4G5YA 2MU1A 1XDSA 3H2KA 1HURA 2VRCD 2C3UA 5EQTA 1W85B 3C7KA 2IV7A 1YDMA 1MVOA 3K6RA 1Z07A 1D2AA 1T9ZA 1TCVA 3WGOA 4TMTA 1QIDA 4BQRA 5CBPA 2IS2A 2YMQA 2FFAA 5HTKA 4EG4A 2CKDA 1IOZA 2UYOA 5DWDA 4ZMSA 4CF7A 1OXSC 3BKXA 1NUHA 3IJPA 4A03A 5A5VA 1QDLB 5KNBA 3MJSA 1ZK1A 3ZY5A 1QFXA 3D8NA 4HS9A 3FDIA 1HSZA 2P9QA 3FRJA 3GJTA 4R2WA 4XE5A 4CQMA 4ALIA 1AUOA 1BHQ1 2PUVA 3F5MA 2GBCA 2FSPA 2OC4A 1KAHA 5EVCA 5GADl 2Y8EA 1XCMA 1KEZA 1KVRA 1XEWX 1OFUA 1Z73A 3EJWA 3A3NA 1GUYA 4UM7A 3K1ZA 3PUYA 2ZVQX 3B6ZA 5CT8A 3R3JA 4YMLA 1WMEA 3NYRA 1OH6A 2AYZA 2V58A 2Z2JA 3EHEA 2JD1A 4OM8A 2HWYA 3U7QA 2VS1A 4WQMA 3WY9A 2B37A 3PE3A 1XDGA 3K0FB 5T3UA 1F2TB 1PUXA 5KYYA 1K98A 3SGLA 5IM4F 1XNRB 4MGKR 3T4UA 2W2XA 2JA2A 2PRJA 1TA9A 1K97A 1NUSA 1UT8A 3M4JA 1WHTA 1T2UA 3QBTA 1GUZA 2FRVA 3GA5A 3AL3A 3I76A 4IDAA 4OFBA 4WECA 1LSJA 3A1NA 1BA3A 2KLHA 3P5BA 2PJUA 4R81A 5HIJA 5HG0A 1P1FA 5TRDA 1JDNA 1GPMA 2XDQA 1LPAB 2I1QA 3CF4G 3WWDA 2AOTB 2Y9MB 1BJKA 1VLMA 1I14A 1YDWA 3L8HA 5IMSA 3UMYA 4LAFA 1H0RA 1RMYA 3N0RA 2BIFA 3U44B 3HEAA 2WABA 1LUAA 1CUAA 5AQEA 1KJJA 4CXMA 1E6CA 4CIXA 2JLWA 2MMCA 3O38A 3GRPA 4B87A 1G60A 3VKUA 3QI2A 4GBMA 3EEBA 1CZRA 2GF0A 1KY4A 4L22A 3M3HA 3RNOA 1WPRA 2C58A 3L49A 3ANYB 2IXEA 1PX0A 5TV2A 3CS3A 3ZDFA 1SVNA 5HZAA 1QE3A 1GNRA 1NQAO 2VJIA 3SXUB 3UHJA 2YVUA 1E3ZA 1ZJZA 3F8TA 4I4IA 1RQGA 1VJGA 4B3MB 1WV0A 3CZRA 1T5DX 4F1WA 2V5AA 4OJTA 4RD4A 2J30A 3WLHA 1A5ZA 3IAEA 4PSVA 4UOZA 3IUPA 1BRMA 1JE1A 3O3CA 4O4HF 3PEWA 1L4UA 2Y76A 1WTAA 4BJHB 1BFDA 5J43A 2BI7A 2OHHA 4D0LB 3GLQA 4G24A 4BRUA 3ZV5A 1ELOA 2EV9A 3GBSA 4NE9A 5BV0A 1SCUA 1IHDA 1FIUA 3H2GA 3AHIA 1H5QA 4L4RA 2RHOA 1T6YA 5HS4A 2NV4A 5IG2A 2AEEA 4Z9XA 4V0NA 5K8CA 1F4LA 1AN0A 1E2DA 1E3IA 2JAOA 4JJFA 5SY4A 3LBIA 4UQLA 1OH5A 4CQNA 4I4TF 3A3BA 3AF6A 4EJMA 3BGWA 3PQ7A 2CYBA 2HWWA 3TLJA 4GSLA 1AMOA 1V16B 3F1KA 4X6YA 1UP6A 5KTYA 1IUKA 3O7WA 5EYPB 1PLLA 3DMNA 4QNRA 4DLUA 1XF1A 2YHIA 1Y1TA 2CZGA 1B15A 1ZH0A 4GDMA 5EXXA 1TEZA 5I9MA 2O1EA 4LYFA 5JMPA 4WOCA 1SBTA 3T1VA 2F3SA 2FMHA 4CT0A 1X1TA 4IXTA 4BJ1A 2OXEA 1JP7A 4IJWA 4X1YB 5CCEA 3U60B 3BX1A 2RD2A 3C5CA 5CA1A 1DKUA 1G9SA 3F6PA 4EHBA 1I0IA 3GIDA 3KZNA 4FN4A 2WA2A 3TFQA 1UZUA 4ALKA 4AUEA 3HE3A 5ETJA 4QPCA 2O48X 5A4DA 4MH0R 1UD5A 1G38A 3HUFA 1Y81A 1CJTC 2X0JA 1FOEB 1FUIA 2IXGA 3TAUA 5IX8A 2O8BA 2CLLB 1A7AA 2QPOA 3QKIA 4FIDA 1L5HB 1D6JA 5C51B 4POAA 5LBIA 1ZINA 4AO6A 4LJ8A 4HE6A 2JCXA 4Q3EA 5DSXA 1CNMA 5BN3A 4X60A 5EIBD 5K8IA 1Z29A 3EZYA 1E9RA 4DIFA 1NVGA 1CUXA 3H0EA 4D80A 4G9BA 5U9CA 3K8OE 4P53A 4QUIA 1VE7A 1TNDA 1JR6A 1XTRA 4QE3A 1QDUA 1NXXA 3VTZA 1AK2A 4N76A 1K0FA 4JOBA 4HEJA 3MSCA 4HWRA 5J5VA 2A9JA 3TNDA 1RQXA 4XYBA 1ADFA 4C0QC 3ISVA 1R5NA 2B4QA 5CXQA 1GTRA 3L5OA 4WOKA 3EZ6A 2BFFB 1KFEB 3GF4A 3H9NA 3LPMA 4YQZA 4NOLA 4DDVA 5A2QA 3RYIB 1IBLB 1CEQA 2QRVB 3R8FA 4XOPA 4Z4VA 1EX1A 1MB3A 2YJ6A 5HBRA 2IEZA 3TQFA 4UEQA 2V0CA 3TNFA 3HGQA 1V6CA 4LECA 3WFIA 2WIJA 1XPJA 3MCTA 2O4CA 2YXPX 5D00A 4AY4A 3NTLA 5JD5A 1N36B 1P5FA 4Q19A 3R1IA 5AJUA 1B73A 4DHWA 4HX5A 4ZAWA 4ZHQA 3JAKB 1P2TA 3MTIA 1Z6ZA 2XMBA 1P9NA 2D0DA 3EA4A 3HB0A 4P35A 2YC2C 2V7XA 4UDOA 2CXPA 4QPZA 1UQUA 3AJDA 2HY7A 4LZZA 4J29A 4WZ6A 4RPJA 5ALYA 4C88A 1NYQA 1M6VA 3LD9A 2HQ1A 2GVZC 4IFIA 1NLFA 3IQHX 1K7EB 2G17A 4JLPA 1UK7A 1GARA 2ZYDA 3TBFA 3GFSA 2F9LA 5ADUS 3DWIA 4KBFA 3WG9A 1YL7A 2G4CA 3PQ3A 2XBUA 1XI2A 3DUFB 3AWIA 1B0PA 1SHJA 3O7MA 1IVNA 2OMKA 2P9HA 3VPHA 5FI0B 1ZGAA 2VAMA 1Y7HA 4Q1FA 3TKYA 1JT9A 1S2NA 1N9KA 3U16A 4D6XA 2R1TB 1OY1A 1TX4B 5ERGB 4J6EA 2BMEA 3IEVA 3EG5A 2C0CA 3CPEA 3WNZA 3FCXA 1E1QA 1EP9A 3KPJA 4ZQCB 1O8BA 3TOVA 4KQIA 1FXUA 2O2ZA 2Q3BA 3OD5A 3S27A 5CAEB 1L1QA 2RGEA 5DTIA 1MIHA 3D7MA 2LCQA 2FPPA 4TT3D 1NBIA 4X91A 2ZBDA 1R0SA 1R8QA 4Y98A 1SGWA 1WPQA 1YGYA 2WLSA 3EWSA 4PLZA 4RA6A 4U63A 3OM9A 2WSYB 4ZOLF 5LQJA 1GZ7A 2IPAB 3OQNA 4G0MA 3O3OB 4ENVA 1KZ6A 3B12A 5C1DA 2DKOA 3RT9A 1PS9A 4XX0B 2JRCA 4XOUA 3CUKA 3ZIAD 2X3UA 3QVMA 1R6XA 3EFOB 5AXCA 4TVKA 1ISPA 3IQGX 3FPBA 2NQ8A 4Q4AB 1JVNA 1SQ6A 4ZOAA 3ICEA 1A4XA 2O8VA 3QE9Y 1VBNA 3ANXA 1EJ2A 4MUJA 3FWZA 1JHDA 1HNNA 9GPBA 1KAMA 4EI2A 4BPRA 4QOIA 2HEGA 4N0EA 3FR8A 2EGUA 1JJFA 3VPAA 3ABZA 4DLKA 3F49S 1N1MA 3MMSA 4KUHA 5FTMA 1XZHA 1G5HA 3UOWA 2WTEA 4XQ9A 2VJOA 5JROA 2I6GA 3ADBA 2QE7A 4JSRA 1T9CA 3TFWA 2XRYA 2WHEA 4FYVA 4IYRA 4KQFA 3UA4A 5ELLA 3R7WA 5KNCA 4DV7B 2ESRA 4DEYA 2PGNA 1QE5A 3IHKA 1NPYA 4JYBA 3T99A 4JL8A 4B79A 1SU7A 4FKBA 4F4CA 2VDPB 2D1FA 4LRXA 1LPOA 1TLTA 2QRGA 3S68A 4DQVA 4BXOA 3GYBA 5JAQA 4E09A 3A3PA 3DE1X 3GH1A 3PXAA 1T9AA 4P0QB 4MNTA 3ZKAA 1MOZA 1ZFNA 4FEYA 2UDPA 2K7FA 1D0IA 1L5YA 1IBRA 3A36A 2W2OA 1Q20A 1CS0B 1EFDN 2OCIA 4M37A 4QXQA 2GFQA 5KAMA 1WDTA 3M8KA 1U0EA 2IRWA 2DJ5A 1I5EA 1JA0A 4AJPA 3IEPA 1K7YA 3DO8A 1RRMA 4WZBE 3UMBA 1RWMA 2YZMA 1FFGA 4TXHA 3ZGVA 1E2FA 4ZI7B 1YO6A 1SOWA 4X8OA 2Q29A 5SYAA 4C20A 3CRW1 1DXOA 1QH0A 5CA0A 3UMVA 1WZIA 3L0PA 1CEYA 4FQ5A 3OIWA 3L93A 4UKDA 1N1DA 2JH9A 1PO7A 1M7BA 2R66A 1UFKA 1Q0TA 3ZN2A 3CE6A 3OOHA 5FQNA 5GONA 4F04A 1V9SA 4GZ5A 3L0IB 3AI2A 3KLOA 4RH1A 4KX3A 4YECA 2P5TB 1YMVA 1GKIA 1LBSA 2A67A 3KM0A 2VPWA 4NP6A 4QRDA 4UEKA 5E1OA 1BIFA 3K09C 5JQGF 3PHLA 2FPOA 3RUAA 4TQUS 1G66A 3ETEA 2PNFA 3HU2A 1PL0A 2J9FB 1ZVKA 2GCPA 4ITVA 4RXUA 3X1WA 4LYGA 1JR3A 1T5BA 4YH1A 3JQAB 1Z06A 3CVUA 1M6YA 1QH9A 3BF7A 3U37A 4E15A 2EFEB 1U3GA 5ESXA 1L7XA 1GYPA 3URKA 5BYBA 4R2HA 4MZDA 1QGDA 3USZA 1JG7A 4CM5A 1JA9A 4XA8A 3GRAA 3LZCA 5E6TA 4RK1A 4TWRA 2FF7A 3WJ1A 3E7DA 3ACBA 2VSQA 3X43A 1Z7GA 4CE6A 4AMUA 2JC3A 3UM9A 5EJAA 1L4LA 3H2SA 4JT4A 3AIKA 1E3TA 4WXHA 5AK4A 5C7YA 4KR0A 1TZ2A 1PGPA 1ZI6A 2ZVJA 1U81A 4RD2A 2P3LA 3DAPA 3LRXA 4L0DA 5T7BA 2F1OA 4UZSA 5ER6A 2D00A 5IVHA 3Q5DA 2X9NA 3ZHCA 1VBMA 2B4RO 4EA6A 1BWPA 3ASSA 2QP4A 3I2JA 2Q8PA 3OCWA 4C7XA 5L3QA 5I48A 1JNYA 1W34A 3TOZA 4Z4UA 3VI3B 3LQ4A 4D4GA 5BSVA 5CHEA 3CZ5A 1Q6ZA 4UU0A 4TYMA 5KYYB 1OGJA 3P4UA 3M3DA 1S3FA 2O2SA 1HE1C 4FMBB 4O2RA 2R0QC 4BO8A 1BDJA 2X1VA 3FLAA 1KNXA 1WHTB 5CDHA 1DRUA 4MMZB 3OTIA 3A2LA 4HR7A 4P92A 3RUHA 2VJLA 3NHSA 4CKCB 1IHUA 2GFHA 3IHWA 3LYLA 5IC4A 2XDQB 1HK7A 3CURA 1KDRA 1GM5A 2PGAA 3MOIA 3ENKA 3SEJA 3ZS9A 4AZTA 4AX8A 4JK3A 3U61B 1MLDA 4EEXA 3TD9A 3UHFA 1Z34A 1NF2A 3AZOA 2P6NA 2FJPA 1RWQA 1ZRNA 3HKEB 3VVMA 4OQZA 3E70C 2VJPA 4AX4A 2ZUDA 4MGZR 1TIBA 3SPXA 3BDAA 2TSYB 3KJIA 5TC4A 2C84A 2B5OA 3HMQA 1W29A 1U1IA 3QH4A 3MTJA 3ONUA 4TMYA 4C4YA 3HM2A 1Q1AA 4TWIA 2BHTA 3GVPA 3CC4B 4F5DA 3R09A 4AJ4A 4XUDA 3AW9A 3Q8WA 3QXHA 2ZXIA 4Y18A 2PGOA 4L4ZA 3AHFA 3RAJA 1EPUA 5LQSA 3L1UA 1JHOA 2PEYA 5TB5A 3INRA 4C6TA 4OOEA 4NNJA 4Y9RA 3HFGA 3SS8A 4F3NA 1Z0FA 5AJXA 3T7IA 2IZ1A 4KQMA 2FTKE 4ARSA 1L2TA 4PZUA 4FE4A 4AJIA 1SCUB 5C8ZA 2I2DA 2Z8YM 3PDUA 4P5PA 1NI4A 5EWJA 4NU8X 3USCS 3OKPA 3P0HA 2XMGA 1DWQA 3S40A 4RQTA 1KYQA 3LY9A 1X8LA 2NYAA 4BNWA 4BNXA 2ZROA 2CVFA 2FWJA 2NO0A 1IK4A 2HZ7A 2P7HA 3PC3A 3FBGA 4ZAFA 3MMPA 2JVIA 4JCOA 4GI3A 2C2WA 3B7WA 4L6IA 4BTVA 4M1SA 1BN6A 1FDOA 2E5FA 4FR0A 2NO4A 3E1YE 2F3QA 2WSSD 2DLDA 4RORA 1VL5A 3B6MA 4BBZA 3U5TA 1HR0B 2KX7A 1GRCA 3RYHA 1N5OX 4WSOA 5EE9A 4EVSA 2V4MA 4HFMA 4O1MA 2EIHA 4ZARA 4MRVA 2IW3A 3D8UA 2H1LA 4GGPA 3DHWC 3IEXA 2QUBA 2XUJA 4DUPA 3W3ZB 3OFND 4EFLA 3ZNOA 1OXUA 1B4DA 1ECLA 4PYJA 2BR5A 5LZ9A 1XEWY 3GPCA 5DCLA 5DTQA 3S0JA 1KIAA 1QUEA 1U2GC 4I5FA 2PGIA 2QR2A 1C4XA 2QXYA 2O8BB 2AKAB 4AS1A 5K51A 1AO3A 3GRVA 3IFSA 4G9EA 3RK4A 1B3BA 4YQEA 4NAUA 4L15A 5TMEA 4KO3S 3LZDA 4OBBA 1I10A 3ESXA 3NHKA 2JHGA 1UBJS 2ZWOA 2Q3JA 4B82A 1YR8A 3HU5A 4E3ZA 4AJOA 1NVAA 4EGAA 1AE1A 1K8YB 4L50A 4TOIA 1JFFA 4CFSA 4IWXA 3LQEA 2IU0A 3QP9A 2CVQA 4BFXA 3MHTA 3D3WA 4YRTA 1KAGA 2YOGA 3PQ2A 3AFNA 3C6BA 1CDOA 4YXWA 4CKZA 3QUSA 3TIFA 4HLCA 4RJIA 2BPOA 3F9CA 2ZYAA 4F9GA 4W7SA 3MAGA 1E8MA 3HSYA 1UDWA 1OFHA 1Z82A 3IVRA 3TQHA 1X13A 3EAFA 4X8HA 1QG4A 3CCRB 1HDOA 2ZE5A 1GPUA 4RHEA 5SZKB 1WUTA 1OVMA 2BBTA 2H5EA 3GZTB 3NFYA 1NXSA 3WLPA 4CM1A 1EQUA 1N7IA 4W4TA 5FH9A 1ZD9A 4FDUA 4DKXA 5TX7A 2VK8A 4EMBA 3MTBA 5KNBD 4QQNA 1ZLXA 2QG6A 4MULA 3TH5A 2KYRA 3RVJA 4II2A 1YE3A 3ZTWA 4EYKA 3HBNA 3PITA 3U81A 4A9AA 4CQMD 3E27A 3TKAA 2XODA 2WP8J 1EG7A 1CQWA 5HVNA 1CFJA 3T5CA 3G8DA 2IF0A 3ABQB 3SIRA 3EXHB 1KY2A 1VE5A 4X8LA 2KSQA 3TB4A 3AEXA 3RRFA 4G8JA 2A1UB 3VRHA 1M6VB 3NOVA 3PNPA 3ZX4A 2JFGA 1JG3A 2HSEA 3PPVA 4EVRA 3HWX1 1UH5A 1Y7PA 3AESB 4FC7A 1J90A 2NPOA 4HLUC 1ZOPA 5LYJB 3ENNA 2J7KA 3G8CA 2GSWA 3I9FA 3RUEA 5HBGA 2BR3A 3LQ2A 3DDYA 4X7BA 3E5RA 1HFJA 4WE3A 4HWSA 3BSSA 3JYQA 1A9SA 1EHIA 3FNBA 3VDMA 4CQJA 3D2AA 4PXAA 3ADDA 4HXFB 1GR1A 4I7EA 4QBFA 4FMPA 2C57A 3RPEA 1B0UA 4EO7A 4J0CA 4PTYA 5CFRA 1QZUA 2CCJA 2DR3A 3UYLA 2PZJA 2IUTA 2VBCA 2W48A 3T3PB 3R0QA 1PYGA 1E92A 4L8JA 2WFMA 1BW9A 4H3HB 3DXXA 5L3RA 2Z6AA 1ZIYA 2A88A 5KNBH 1N1EA 4Q00A 4ZJYA 1RCUA 2FPPB 3OF5A 3DDWA 3RVNA 5AW8A 2BMVA 4NCXA 4ONEA 1E1RA 1PJ4A 4ENPA 3K2EA 1KK2A 3K2BA 5JARA 5JTTA 4F2GA 1N8KA 2VWGA 2YZKA 5JJ5A 5M7EA 2A6PA 1I01A 1XRJA 4DCUA 1EVLA 5KPDA 1RVV1 4WFIA 2FKNA 3SAJA 1R0ZA 2BTEA 4CGYA 1W2HA 2IYEA 1KYXA 4BWFB 1UBOS 3TNJA 1UDBA 3SJPA 3EXHC 1NHWA 3IALA 3D5TA 3EXEA 3DB1A 2GLXA 3NV7A 4RPIA 3VFDA 4OO3A 3QLTA 1RDFA 1R8YA 1ODTC 1N6LA 4DNTB 1WO8A 2VA8A 2WF8A 3F1LA 3L0DA 5A03A 5GZ6A 2QN8A 2I7TA 3F74A 4PCLA 1K66A 1MDBA 1LVUA 3HN6A 2RIRA 5ABPA 4L1KA 4RE5A 2M6SA 1N5KA 1L8LA 1M8JA 3VJKA 3ZR4B 5HRCA 3KQLA 3ZWAA 3CTAA 1XTQA 1J0XO 1E2BA 4LJSA 4D4JA 4E5PA 1OX4A 2FG6C 3MD9A 4RSRA 1SWVA 3X2FA 3AM1A 1E6KA 1H66A 1VYTA 2R4TA 3KRTA 3LW8A 4AU1A 4A82A 4RDCA 3DR3A 1QK5A 3R7WB 5BMVB 1JQDA 5JV5A 2Z2XA 1YC2A 4RHYA 1KAEA 1PEDA 1RBYA 2WYWA 2EEPA 3N6XA 4GMHA 2OFWA 2G04A 2HSZA 3NTVA 2CUNA 5J1TB 2AFIB 1L7RA 1R66A 4NIMA 2EKZA 3ZWKA 3DXYA 3OJXA 1T4MA 1VFPA 3RFTA 3G88A 2V6FA 2OBSA 3ISJA 3NT2A 3NANA 4U7JA 4P83A 1UIMA 3F5FA 2EQ5A 1K28D 2AZDA 4KMMA 4N0MA 3U26A 4PFQA 2C3PA 2VBTA 1GQYA 1W0KA 2E1PA 3OTWA 1Y5LA 4RV9A 4K86A 4ESEA 1T3HA 4FHEA 2H85A 3FVTA 1GG5A 3HHEA 1D5CA 4I3HA 4I6JA 3VH3A 4JV5B 1Y6JA 3JYPA 1CR1A 1DC3A 3SI7A 4KQEA 1R0XA 1YLOA 1RMQA 2QQ0A 1L7OA 2LE0A 1KVTA 3T95A 3AVWA 5FBQB 5IM4A 2HO4A 1CJCA 3DGFC 4P86A 5BT9A 3S8MA 3ZCXA 2C2BA 2CL0X 2G71A 1E1YA 4YFVA 4ZAVA 3CSDA 5ITSA 3FTDA 5CA0B 3ZQKA 4L0MA 5C5DA 1H6BA 4FNOA 4LJ5A 2OBNA 4UVHA 3ZLTA 3MIZA 4BBPA 4YMUA 4QYSA 3UA3A 3A14A 1L5QA 3IAFA 5KYTA 3H05A 1UPXA 2ZETA 3ZTYA 3B1FA 5FLYA 3W9SA 3JU4A 2WU0A 4QBIA 4R9NA 4FJ1A 3RGGA 1XL0A 3EMBA 2EJTA 4DV0B 4IRXA 2R85A 3FNEA 4IG9A 4LJLA 1BMTA 4Q3DA 1HE4A 4HB0A 4AYTA 1QK3A 5KTMA 2ZRMA 3RJ9A 4DQ0A 1V8OA 3CEJA 3FOBA 4CR7A 3JWHA 5EOVA 1U3WA 3MFYA 4R51A 3SLRA 1BYUA 3NC0C 3LT0A 5DP2A 4Z8XA 4B5KA 2WAAA 3SMVA 4IR7A 2A3RA 1EX7A 1G8GA 1ZGGA 4MICA 1D03A 1L5LA 5JD3A 5IAJA 2D5AA 4HNQA 1E9FA 3H8WA 4MSUA 4ON9A 1Q22A 3GO4A 1LW6E 5TS3A 1DAFA 1ECCA 1YJ9B 2Z4RA 1SZCA 1GV1A 1U0TA 3GELA 1D9XA 1Z7WA 5BUQA 1VKRA 2B4TO 3OCJA 2I6QA 3H3XA 1NMYA 3BM5A 2B7LA 3WGVA 2F90A 1BKDR 4FBMA 2O7VA 3N0TA 1ADCA 4O4HA 5K0NA 4D6YA 4YDQA 3C97A 2VJKA 5EIEA 3IDOA 1JZSA 5DDIP 2ZAGA 4AK9A 4IXDA 2H1IA 3UCEA 2FW8A 3WKAA 1GZ5A 4DA0A 4NCBA 3NONA 3HI4A 5AN9A 2E85A 2JLVA 1CRLA 4L51A 3IKJA 4R2XA 1JF8A 3SFZA 3K5IA 1PLKA 3OPYI 5FPQA 3ICPA 3JWPA 1JAIA 3D6FA 4GEKA 4L5AA 2Q0QA 3MBKA 3WWPA 3COJA 1ZW6A 3R0ZA 4YAJA 1OJLA 5CDYA 4X65B 4RE6A 3A1UA 4QQRA 3IERA 5IVIA 4I4TA 4MXDA 1PNTA 2W6MA 3A06A 2WU1A 4LXUA 3GLFB 1IQPA 2BKLA 4JLVA 3GEGA 5HSGA 3D6VA 4HSGA 4WV3A 2YXBA 4KBYA 4MINA 4ZAZA 4YPFA 3VC1A 2XTNA 4ZOCA 4IHKA 1E1QD 2BGRA 3HEBA 3EZGA 1JJIA 1SIUA 1HPLA 2QRHA 4XH9B 2B34A 5DCWA 2CFIA 4CHTA 1RM0A 2XZLA 2G7ZA 3LPAA 3VUFA 3VR2D 2QZJA 3QI7A 4NVRA 4WN9B 1K9MD 5D1NA 1RKXA 4ICIA 4B8WA 2D2XA 1HNZB 3F5DA 3ONDA 2IZZA 1BCRA 3P2OA 4PAAA 1ZUD1 4HNSA 1OLXB 4BV2A 4JELA 3ZXUB 4KV7A 3VKWA 4BNJA 1PGJA 4ZU3A 5BW8A 4WGGA 4LGVA 1IUOA 1QGAA 5EZSA 3PEVA 4DR2B 3E35A 4MYDA 4UM9B 1K6XA 4ROTA 2Z8ZA 3NUZA 2OHVA 2FN8A 4UTNA 1E9AA 1JDSA 2QM0A 1WXGA 3NBMA 2A0WA 2YINC 2YN0A 1YWGO 3M2TA 1TW3A 5J5AA 2GBPA 1QVGB 1QQ7A 2AEFA 4AKGA 3DQQA 4LJ6A 4FDMA 3T61A 3EJ6A 1PBNA 2NGRA 1U9YA 4DCNA 3BGDA 1EBBA 3G9QA 2ZJBA 3CCFA 4G3XA 4XB6B 1Y5MA 3T7CA 3BQJA 4B0PA 4B3SB 1KDTA 1JDUA 1A9XA 3VZDA 2QRNA 5EQDA 1Q0LA 3SZOA 2G0NA 3FE2A 5FEMA 5CDUA 1KH2A 4TYWA 3E7WA 1NI4B 5EWJB 5A3VA 3TB6A 5HJ5A 4WZKA 2Z95A 1ZCFA 4WDQA 3RJMA 4B5LA 8LDHA 3ZVKA 4WZEA 4MR7B 1TW2A 1MTOA 1XMXA 1GZ6A 1XKQA 2QUZA 1FC0A 4Q93A 4BX2A 2V3CC 3RRJA 2OV3A 1C14A 4W5WA 3A6HA 2WF7A 1IHPA 5IYZF 2Z58A 3H9CA 3I1IA 3U39A 4ZQBA 1MJNA 2J5QA 4JJ7A 5F5NA 4J3JA 4N5HX 5H59A 3M3PA 4MK4A 4ZVRA 1Y1QA 2G07A 3AI3A 2WU3A 2ATVA 3D9QX 4ZCIA 2XRFA 3DGEC 2XNJA 5E2AA 1X9GA 1N2GA 2HBQA 2YWRA 3AC0A 3KQTA 3JQ9C 5AJHA 3ZCPA 1VJTA 2H1VA 3JVUA 3PDJA 3KVRA 5FFNA 3V2IA 3CE9A 3PLRA 3V5NA 1IQ0A 3I0NA 2Q6OA 1OAOC 1DAOA 3AZQA 1PG2A 3I4LA 1W36D 4IOMA 2D3NA 2FX3A 1PHRA 1RQ2A 1HT3A 2HBRA 3IVXA 1QZ3A 4G4GA 2FPUA 3MYYA 2X0DA 5L7YA 1WV1A 4M3NA 4FLMA 5E3JA 1DI0A 4DIUA 4E1AA 2QTCA 3AUUA 3EW7A 1P6UA 1A97A 3O8LA 3GP5A 5I3ZA 4G2TA 2WB2A 4LWZA 2ZWPA 4UTOA 1FPQA 2B7BA 1P5RA 3H2JA 3I6IA 4PRZA 5EWLA 5KNCH 3STTA 4DY4A 2EWMA 2W6CX 3NTUA 5GZ1A 2P69A 1JFFB 2GBLA 2CHGA 3C3MA 2BONA 4Q9NA 4U3JB 4QVIA 1UL1X 1B6TA 3D3WB 3RS3A 4HXEB 4BPBA 4GR5A 4GXTA 3TUIC 5LOVF 1ZD4A 1EFCA 2HF9A 3LY8A 3VYVA 2POCA 1JR3D 4KGDA 1XTKA 1G5IA 2CLOB 2F9MA 2LCFA 3FHOA 3PVCA 4ZOLA 1UQTA 1MAVA 1SVIA 2EYUA 2VZ8A 4BWVA 5I7WA 3PQ5A 5LQCA 4TYNA 4GF5A 2FE4A 2GYWA 1HDEA 1X8JA 3E03A 3LF1A 4LHZA 3QHQA 5AJYA 3V3TA 3FHTA 3BWVA 3QX8A 2W6IA 1USIA 2FY8A 2P90A 4KQ1A 4X6XA 2IU3A 3CLTD 2FSFA 1XTJA 3BBPA 3ZWPA 2QGNA 4RIFA 3A1WA 5JYEA 1V3UA 4DBLC 1DCTA 3T7RA 2IP1A 1JG6A 2DIEA 2EAUA 2GUWA 1RHMA 2IX3A 5F2KA 5K3OA 3U7GA 1YNOA 1L9KA 1PW7A 1WJGA 2QTAA 2ISQA 4JR0A 4DGSA 1E1CA 4AJLA 5LBUA 2DAPA 3KQVA 3BRQA 5ESRA 4XGQA 1XYGA 3CZMA 1PYOA 4RHXA 4JYAB 1X2EA 2I22A