4AF7A

Pea fnr c266m mutant
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
296
structure length
296
Chain Sequence
b'HSKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVYTNDAGEVVKGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMMGLKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN--NADP REDUCTASE, LEAF ISOZYME, CHLOROPLASTIC
molecule tags Oxidoreductase
source organism Pisum sativum
publication title Structural Backgrounds for the Formation of a Catalytically Competent Complex with Nadp(H) During Hydride Transfer in Ferredoxin-Nadp(+) Reductases.
pubmed doi rcsb
total genus 86
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4af7A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4af7A02
2HCJB 2VYQA 1ZUNB 2QA4B 1TUIA 1E62A 2HDNB 1N8RD 5GV8A 1OGIA 2XEXA 3CC2B 1KC8D 3WBKA 4FN5A 4LC0A 3MHPA 1EFTA 3CCSB 1YJWB 1F60A 4ZGNB 1F20A 3CCLB 1W34A 1IJEA 1QFYA 1QVGB 4B43A 3FPKA 1M90D 1AIPA 1OGJA 4HE5A 3CXCB 4NCNA 1H85A 3FJOA 3I55B 3CD6B 1VQMB 5EMNA 3V76A 3B82A 4LBYA 1K8AD 2OK8A 1Q81D 4C0SA 1KK0A 3OJXA 1QVFB 1KTVA 1QGAA 3QFCA 1FNBA 2QTLA 2DCUA 3OZVA 2E1RA 3WY9A 2VNHA 3OW2B 5TR9A 2QDXA 2QN6A 1XB2A 4B3XA 4M2LA 2D74A 4P3YA 1CNFA 1QUFA 3W2IA 5AN9A 3E1YE 2YWHA 3VO2A 4TMTA 3W2HA 3AVTA 2GQFA 4DQLA 1A8PA 4N3GA 4Q7JB 1GAQA 2FX3A 1R5OA 4PC3A 4QHYA 1SKQA 2YWEA 4U9UA 5GV7A 1OB2A 4B48A 3AVXA 4K1XA 1TVCA 4UAJA 5DSZA 4FWTA 3W2FA 1BX1A 1N0VC 2BGJA 4R71A 3CC4B 3OZWA 3PENA 3AVUA 4PC7A 2AHOA 1G7SA 2BMWA 3I1FA 3AVVA 4DQKA 1D2EA 1IB0A 1G7CA 4M1KA 3CCJB 2EIXA 3WNCA 1QX4A 3VMFA 3P27A 2R6HA 3AGPA 1G7TA 2BF4A 3U6BA 1FNMA 2BM0A 4TMWA 4QFMA 1DDIA 3WNDA 1QGZA 4NBSA 4P6VF 4AF6A 3WXMA 1U2RA 4Y7CA 3QFRA 1BJKA 3JQQA 3ZZ0A 4RJLA 1S72B 2PIAA 2B5OA 4ZCIA 1VQKB 3JQPA 1QH0A 1VQOB 4PC2A 1BQEA 2YWGA 4PGOA 2BGIA 3CCVB 1SM4A 4YAWA 3W5UA 1KD1D 5H5JA 1AMOA 2RC5A 4ZV4A 1ELOA 1QGYA 1Q86D 5TY0A 3CB4A 2CRVA 3QSYA 3W5HA 3WYAA 1N0UA 1GJRA 1QFZA 3P26A 1GVHA 5H59A 3OJWA 1QFJA 1K73D 4J0QA 3QFSA 3AGQA 2OTJB 4PC1A 1E64A 3QFTA 1JJ2B 3CRZA 1VQ5B 1S0UA 3CCEB 4Y9UA 4PC6A 3ZC3A 4M0LA 1YJNB 2J7KA 1YIJB 4ACBA 1OB5A 3VNVA 4G5GA 2PMDA 3ZZUA 1EFCA 1WDTA 3JQRA 1GO2A 2BVNA 1R5BA 3G6EB 3CCQB 1IJFA 4IW3B 4ACAA 3WBJA 1R5NA 3LO8A 3MCAA 3VO1A 1HA3A 1W35A 1J9ZA 1ZM4A 5HXBA 4EH1A 3MMPA 3QE2A 4N3NA 4ZCMA 4FK8A 4BPRA 3CPWB 4M4SA 2BSAA 1FDRA 2B7BA 4RD4A 1DARA 2ZITA 2CNDA 2C78A 1ZM3A 1KRHA 4YAOA 3E20A 1KK2A 3U6KA 2VZLA 4RCYA 4C43A 2VNJA 3CMEB 4RD2A 1JA1A 4YAFA 2VNKA 1NJID 2OTLB 1FNDA 4TMXA 1FNCA 2DEUA 2RC6A 1YITB 1YHQB 2C77A 4RCZA 1DG1G 4Y9RA 4YAUA 1UMKA 4RD0A 4TMZA 1Q7YD 4ZCLA 5JBQA 4MYUA 4LBWA 3SJZA 3CCRB 1I7PA 5TV2A 3LYUA 4G1BA 4F7DA 3CC7B 3ZBTA 2QMUA 1TLLA 4YHBA 3CW2A 3J81k 3LRXA 1B23P 2BN4A 1KQSB 2BPOA 1ZM2A 1VQ7B 1EP3B 3AVWA 2NPFA 1NDHA 1QG0A 5FA6A 3A1FA 1EP1B 1EFUA 1M1KD 1KK3A 1W2BB 4RD6A 4H9GA 2B7CA 5THXA 4RD3A 2X3UA 1D8TA 2XNCA 4G1VA 4WQMA 1DDGA 1YI2B 1FRQA 3ES9A 3ZZTA 2DY1A 4B44A 1D1NA 1H42A 4LBVA 4TN1A 3CCUB 2YWFA 1QUEA 1CQXA 2BV3A 1BX0A 1CNEA 1YJ9B 4AF7A 2DERA 1TTTA 2QTZA 3I56B 1GR1A 4RD1A 3W2GA 1KJZA 1FRNA 3OZUA 3W2EA 1VQNB 1XE1A 3VNUA 2QEXB 1B2RA 3W5VA 1EWYA 2XNJA 4B47A 4M53A 1JA0A 1KK1A 1JB9A 1VQ9B 3G71B 4YALA 1JNYA 1G7RA 3B8HA 4TMVA 4B4DA 4ZGQB 1W87A 1VQ4B 2HMAA 3U2QA 1E63A 1Q82D 4HE6A 3CMAB 1VQLB 2EFGA 2DETA 4LBZA 2PLFA 3CCMB 1K9MD 4AC9A 3B78A 1VQ6B 3ZBUA 4MYTA 1VQPB 3G4SB 5KSWB 2OK7A 1EXMA 2VNIA 2GPJA 1GAWA 3AVYA 2BM1A 3LVBA 1ZM9A 1VQ8B 1EP2B 3WNBA
chains in the Genus database with same CATH superfamily
4ER3A 4IIJA 1RNLA 4WDRA 4OHBA 2YVKA 4RYDA 4AW9A 2HCJB 3CLUC 4KIUA 3F46A 1PUIA 1T24A 2X8AA 4LA4A 4LNUB 2WYVA 4B1FA 4WL0A 4FDAA 3QV1A 3F0TA 4DXDA 5CLFA 4L4ZA 2IOFA 3OTHA 1ZLYA 1MKYA 1N8NA 1NTOA 5FADA 5HG0A 4BMDA 2W8BB 5JYCA 4DB2A 4JJAA 1TEXA 1ZX1A 1L5RA 2RFLA 1DQRA 4PRLA 1QZUA 2UVDA 3UWDA 3ELWA 4UM7A 3RBZA 4WNYA 3IVMA 1NJ8A 3UHJA 4DY4A 5KYKA 2QMQA 2HLHA 4MS1A 4HDOB 1ND6A 3KEGA 2FHPA 4HYTA 1RXSA 4K9LA 2DB3A 1FFGA 1XF9A 4P6YA 2ZXIA 2O0MA 2V03A 2O0HA 3F90A 3LYHA 4IIHA 1AUOA 3WYDA 5IYQA 1QVGB 3KJGA 3O92A 5J63A 4YI3A 3RFFA 4DR3B 3A6JA 5BPFA 4QHSA 2JLXA 5EMKA 1Y8ZA 4AJHA 1YTUA 4ZU3A 1QO9A 3A6PC 1U0HC 3HB4X 2XT6A 4HVAA 4LCJA 5D85A 4YMIA 3H87A 4B6PA 4Z1MD 1Y0YA 4OXQA 5HDQA 3CD6B 3LBHA 3R3UA 4YJKA 4BNFA 2DT8A 3WMEA 1G64A 3OU7A 4I7EA 2CYBA 1QHFA 2R8BA 3DVRX 3R9IA 4ZYYA 5JRDS 3Q1KA 2PUGA 5KJ1A 1NP7A 4W5OA 3GZJA 5IKPA 3JQDA 1N34B 3ETNA 3KTOA 2WKWA 1CW2B 3ULKA 1CZKA 5HJ5A 1BMQA 2O3JA 4L4RA 3I04M 1H2AS 1I6WA 3UANA 1WMEA 4G5QA 4XMYA 5AKYA 2IYSA 2XB4A 1W85A 2XUJA 4W6ZA 1DIGA 1Q0QA 4KB5A 1RXVA 4HBZA 5FOTA 2IU6A 3BTUA 4HWOA 4XW2A 1OW3B 4IGFA 5EZ6B 2ZTHA 3G8CA 1J6UA 2XADA 4M9SA 2H9YA 5IAJA 1JMVA 1ZRMA 2VYNA 2D74A 3OQVA 4P98A 5J1TB 2HC9A 4NZ9A 3BY2A 5L3RA 5IM4A 3KZNA 1JHAA 4Q82A 4WDQA 3ZWMA 4GW3A 1E7RA 1KNQA 1ZNXA 1T91A 1I1OA 2F1IA 4HQ6A 1PR1A 2AI1A 2VH5R 1X3LA 4K03A 4JYBA 1SOVA 2OENG 3W2IA 3HBAA 3IVAA 3D6AA 1J9GA 1JL3A 4HAIA 3QG1A 1R0ZA 2G9NA 1GCAA 1NYQA 5EZSA 3RIXA 5AN9A 1J00A 3K1AB 4RTNA 4XLFA 2QMHA 3QE9Y 4F4JA 2RBEA 2J41A 2PE3A 3EUWA 2H0QA 3SFVA 4B3MB 3P9SA 2NTJA 4TKVB 3FOCA 4ZJYA 2JFNA 3A1UA 1J2YA 3G49A 1JHVA 3N8HA 4CM8B 1CXZA 2NLOA 5AVYA 4RM0A 3R0QA 3OMXA 4LTDA 1BJTA 2I4NA 1T34A 2CE7A 2Z6VA 4KWEA 2PD3A 1U3UA 1KYWA 2Z1MA 3LXMA 4BP3A 3PXXA 3N07A 4H1TA 2E4AA 4OH7A 4EYOA 1GNSA 2QWXA 4X91A 3LZ6A 1SBCA 2RGCA 3JATA 2GETA 3R0VA 4CL2A 4NH0A 5JATA 1UEXC 2H1VA 1NVVR 3P97A 1C3XA 1N8SA 4KYTA 3HCDA 2H2DA 2FK8A 1VKRA 2FFHA 5H3HA 4QTYA 5JZOA 2Q1WA 4IEFB 2AKYA 1EX6A 3Q40A 4C6RA 5I4IA 2J9RA 4YJ3A 2IUSA 1BH6A 4MGZR 1R3UA 1JXOA 1U9CA 4M0EA 3SQDA 2CLHB 1HE2A 3EISA 3PTZA 4W9MC 4D3SA 5LDDC 2QRMA 1DPFA 4XOPA 1PWZA 1TUBB 1TPZA 3U3JA 3J80A 3PR3A 1VDMA 2OFOA 5DGTA 1LBSA 3TSAA 2BOVA 1UFQA 3ITDA 3AVUA 4PC7A 1Z25A 3LVFO 2IWRA 2APJA 2O52A 3O5AA 2DX7A 4L8JA 3SHWA 1Y1QA 3M81A 2FMFA 3ROXA 3C0KA 1P1HA 4NAHA 4Q18A 3OSZA 4QPPA 3EQ2A 3L8EA 4ZOEA 3DHNA 1BKSB 1A2KC 5E7JA 4LXYA 1CYDA 3L8CA 3QE3A 2E5WA 2BCJQ 3O4GA 3WNCA 4A3SA 4NYJR 5IJAA 4L5JA 3WTBA 4Z4QA 3HHEA 1T9GS 2FVXA 1HTWA 1AUVA 1I2CA 4ZOLF 3DM5A 3NYIA 5DHAA 1LDYA 2AJTA 3AM4A 2CMKA 1UD3A 2IDMA 3CUTA 1BWSA 1UXHA 2L69A 2BKEA 3BA6A 4V2IA 4A0GA 1E9RA 3R5FA 4FJ0A 4Q05A 1YMVA 3E9MA 1T36B 1K3TA 2JBHA 2X9GA 1U04A 2QJRA 2BFBA 1NN0A 4LHVA 4BN4A 1U0OC 3TZKA 3VPFA 1PZEA 1K5HA 1OH8A 4UJ5A 2X85A 1S72B 1SHTX 1Z35A 2VDNB 3FBTA 2Q4DA 1UBJS 4EPYA 4Z4TA 2V4MA 4JJGA 4XD7A 1IBCA 1M1NA 2J3LA 1USKA 2C5BA 2JBAA 2N42A 1PEYA 1ORTA 3HU3A 4HOYA 3UOWA 2ZSJA 4U7FA 1WPQA 4Z86A 1MNQA 2X42A 4L9RA 1OFHA 3EZLA 1ZM7A 4AL4A 2X9NA 2CXPA 4MR9A 1QFMA 4NARA 5HNKA 4WSOA 5BV1A 4HWKA 3O31A 5EJAA 4YJHB 3CWQA 3HRIA 3L41A 3HY3A 1XZCA 3IUQA 2E4VA 2YXNA 3M0EA 4MO9A 4YIHA 1BTOA 3H4TA 1DC5A 2HHLA 1GD1O 4I5DA 5P8WA 1AJEA 1O94D 4JOBA 2R84A 8MHTA 1XDBA 2XGGA 3A1TA 4MWEA 4P4SA 4JQCA 4QOIA 1FDIA 3AG6A 3CZPA 4FR5A 3WOVA 1JJIA 3IHTA 1M66A 5DBFA 3B6KA 1WPGA 3SXUA 4D4LA 1YTLA 5H59A 1O96A 1CRWG 1PUJA 4M0DA 4IIXA 3TSZA 1LQTA 4E15A 5LQCA 1KMHA 1T9BA 4DIFA 4RZ3A 1L9KA 2P2NA 4GMKA 1E3IA 5J5VA 5DFAA 3L7BA 3NI2A 2GBIA 4E1AA 5IASA 1NMYA 1Y5NA 4RA9B 3ZN2A 4ERNA 4XWAA 2QM0A 1XL0A 2EBUA 4RU1A 5CX1A 4JH0A 1KKLA 2ZCVA 4HWGA 3RAJA 2WD8A 4HPWA 4LY0A 521PA 2CV0A 3HBNA 2ATIA 1NY5A 4DNTB 2HMYB 1SUEA 5I9MA 1OUMA 3BBPA 1ZGJA 5HS6A 4IJ6A 2F3SA 2GHTA 5JMPA 4DW8A 5K3DA 5CFMA 3P32A 1SQGA 2BR4A 1Q9SA 1B7GO 2H0RA 1CJBA 3R6JA 1HZZA 5K6RA 1UMCA 5ICGA 5JTUA 2DFPA 2FCRA 1KO1A 2XZOA 4Q1VA 1NYRA 2Y66A 3CWCA 5L40A 2H2FA 4GM4A 1YBMA 3WADA 4JP1A 5FF9A 1LX6A 1PX2A 3L8HA 3CRQA 4X1KA 2Z56A 1V3TA 4K28A 4IGEA 1GM5A 2AZXA 1G6Q1 1EQ2A 2O4CA 3BYZA 3CHYA 1A9OA 3FMGA 2OHFA 5TDHA 2J45A 1BO6A 3WZ2A 4JUBA 2YJGA 2EFDB 1C5KA 2CF6A 4KWTA 1BE0A 2C5HA 3WWEA 1E6KA 4GDFA 1W35A 2JFFA 4DSOA 5HXBA 4AM8A 3F5MA 4KH0A 2IGBA 5CLHA 3KKLA 3QHQA 1DQPA 1MEJA 3C2QA 2HMWA 2Q07A 5REQA 5LYJF 2VJBA 4DPMA 1F38A 5IZCC 2BR3A 2WB4A 4EG7A 2J0SA 4J0GA 2K7ZA 3AY6A 4TXNA 1YDMA 3N8KA 3TZCA 4RPDA 3CRNA 3CSDA 1FDRA 1YWGO 2J48A 4U2EA 3K6SA 1NL3A 3TGPA 3CJQA 2UVQA 3M83A 2ODBA 2WVAA 3EDQA 3IAS1 1FF9A 1CUHA 4FGZA 2AOWA 2QHXA 2XOXA 2QLNA 2VPXA 4HN2A 2IDJA 1YJCA 3L7CA 3CS3A 1KJNA 1YQUA 2IRWA 1NBWB 3D3WA 3CZ9A 3LNTA 4H0NA 3D4LA 2GZDA 3COPA 4A15A 4OQYA 3LQYA 2FMTA 1EAMA 2DFTA 3S81A 3IPYA 3BKXA 3LY5A 4IV0A 4E32A 1QXSA 1T3LA 3DKPA 2ZRFA 2PV0A 3WGHA 1DBIA 3IUYA 2WJGA 3AFMA 3TECE 4WLEA 1LBQA 1UDRA 2NNWB 2ZT8A 3SLDA 1TYAE 3EZYA 4BO2A 2ATXA 4IZ6A 2I8AA 2JFZA 2RHCA 3RG2A 3CH5A 2FEXA 4M9ZA 4B71A 1UJMA 4N5IX 1IZ0A 3K5IA 4ZJZA 1SUIA 2XB9A 4EG1A 1TIPA 1UMKA 3PGLA 2QVXX 3GPCA 3DE2X 1GQOA 2GD6A 3D1VA 3N3AC 4HX5A 2ISQA 4QTXA 4DYDA 4BY9E 1IOZA 3E6AA 1LSOA 2JEOA 3I73A 4RVUA 1DP4A 2ESRA 4P4SB 1GPUA 2YHIB 1QIDA 1NM5A 2VRNA 2D13A 4F4CA 2GZSA 2Z5VA 1KIAA 2C96A 1GFZA 4WI1A 3P9IA 1XPUA 1YACA 2NSDA 2BCEA 2O8BA 5DM4A 5DTEA 4ZO6A 2CD9A 5DNUA 2GPSA 5FUWA 1BCSA 4P82A 2RBKA 2XUHA 1B23P 1KJJA 1ZJ4A 2Q3CA 1I4OA 1J8YF 3CYFA 4R41A 3RV3A 3CLTC 3IA7A 4PLGA 3O1IC 1KFKB 2C2BA 1DPGA 2IDZA 4IHJB 4MRAA 4R1LA 5JFGA 1GG5A 1C7RA 1DAGA 4Q7LA 1UOPA 2WM9B 1N0WA 5D3MA 3V3KA 2V7QA 3N2KB 4AN4A 2XMSA 1TC2A 3A8TA 1Q1BA 2JKVA 1F2TB 3K70B 3KAJA 3A6KA 3ICQB 3GZNA 1CQJB 1ZW1A 4RVHA 1EK5A 1D2RA 2QE6A 2EJUA 2EEZA 4X45A 3D7RA 1UUFA 3ILXA 4KO3S 1AK9A 5AM0A 5KNDA 4LZWA 4E1BA 1W2BB 2GXAA 3PZBA 2D7DA 1S01A 3HGMA 4KQFA 3OP1A 1KI4A 2I22A 3CPJB 1J70A 4L74A 2B92A 4I2VA 5FR1A 4C30A 4EB6A 5I7SA 1XYGA 5L7TA 4IFEA 3V4RA 3PUHA 5EZQA 5HTKA 1DWQA 1SA0A 3CZ5A 4IZHA 3INTA 2WVGA 3T7KA 5TIIA 4BXOA 3IUJA 3SQWA 2C9DA 4FYMA 3S6JA 2JIOA 1SOUA 3QKTA 1L7QA 4GPAA 3SEAA 1K0FA 2HSDA 1I2DA 4TS4A 4DLLA 3RRMA 1QUEA 2X4GA 3IB6A 4JT2A 4DJAA 3EIEA 1Z47A 5K5EA 3R9WA 1K97A 1IWBB 2B99A 2BUAA 1BX0A 2QZ4A 2QRVB 1S4MA 1KJ9A 4LCBA 4WFQA 3RBXA 2MSEB 1V9SA 3FZNA 1JHMA 2B9VA 4JI0B 3GLSA 4OL0A 3D7SA 2FPGB 3GB9A 4MLZA 2HMTA 4NBUA 4UM8B 4FGKA 2W48A 4IUBS 2YCBA 4TWZA 1H9BA 3UWPA 1J8QA 4PABA 3DLTA 3DDCA 1SEVA 3EVAA 2ZYGA 3BH0A 1T29A 4D82A 1XLUA 1N1DA 1MW9X 4XB6B 1YQWA 4JI4B 4ZAXA 1Q17A 1KTIA 2R8PA 2HFJA 1QV7A 1S2NA 2ZUVA 3ED5A 4PZZA 1G9XA 3IHWA 4X8MA 4D96A 5J2TB 4E51A 2VP5A 2JVKA 3GJSA 2UZ1A 4IH9A 1EDBA 3BCDA 5K0ZA 3HVUA 1FS4A 2XNJA 1I14A 1SBNE 2R60A 1U2DC 2W2QA 3PB3A 1UBHS 4L8GA 3VU8A 3TO5A 1H2BA 3TLGB 5IJ9A 1YHZA 5BQXA 3RIGA 4EPWA 2IITA 3SI7A 5HWSA 3A06A 1BWRA 3EODA 1XLVA 4WZZA 4AO7A 4CEIB 1XMSA 1HORA 4D9MA 3TTSA 1IULA 4XN0A 4OBXA 1KSJA 3V9PA 2GK6A 3G71B 1NT2A 5JAUA 1HVXA 5JXHA 2ZOSA 3O38A 4GVPA 1PT5A 1BAPA 2XLBA 4BQQA 3D8SA 1L0BA 3K8ZA 4BX8A 3CNHA 1G6KA 1D2HA 1RZUA 2DAPA 2X4LA 3GDHA 3KB8A 1XTRA 4IIEA 3CT4A 5CVEA 1E0AA 4WIAA 3PSAA 5AI6A 1V9CA 4C76A 1U5BB 1Z37A 5HW0A 3LOQA 1E63A 2P9GA 2HH9A 3LA6A 1RQXA 1UAGA 1KJYA 2EFYA 4R8KA 1I18A 1ESMA 3I2IA 2M6RA 1N2CA 1VL2A 2PLFA 4L5BA 1QKJA 1W85B 2AEEA 3E5MA 1J5XA 2C9BA 3LFTA 4JYMA 4CL8A 3WGGA 5D7NA 3DMPA 3KDPA 4RKYA 1T4GA 1C8LA 4YBZA 5ISMA 4RLFA 1JR4A 3PE4A 2HA0A 1VQPB 2HXGA 3E53A 3CMCO 4JT8A 4EVSA 4NEGA 4W8GA 2DUNA 2K4MA 3SR0A 1JLHA 3I72A 2H8KA 4IHJA 1PR6A 3ICEA 3KVNA 1XR3A 3CIFA 3B3AA 3WNBA 5IH3A 2ZVQX 1VHEA 5JS1A 1U31A 3VVBA 2VYQA 3C4QA 5GZ1A 2BELA 2GKOA 1DC3A 2XYHA 4RQBA 2Y8EA 3CGGA 5AK6A 1BXGB 1K68A 2XNSA 2ZJ3A 3HWWA 5DK6A 3NHPA 4R1MA 3TMAA 1IEQA 5JQWA 3TDKA 3KZXA 5EA2A 3ZXYA 5JS7A 2F8LA 4NS4A 2VT6A 4A03A 1BXKA 4UVGA 1H3FA 1HBJA 2Q9CA 3IE2A 4S24A 5LUAA 3Q3AA 1G66A 1H3NA 1RHMA 4B0PA 3TOCA 4AUKA 1L8LA 4PS1A 1AX9A 5GZ3A 1XAJA 2X41A 1HQCA 1FP1D 3MWGA 3RS8A 4BQRA 4CM9A 3OPYA 3ZS8A 4ZJUA 3P7MA 1WE2A 5KTRA 2PBFA 1L5VA 1SXJB 1XVLA 1QAOA 2ORIA 3BUSA 4JP8A 3JSXA 1NQ5A 2HRBA 4AMYA 3TAXA 2V8BA 1QG2A 2BIFA 2R1UA 4PLCA 4FDVA 2V9CA 4OY3A 1T9HA 3BGIA 4YJ3F 3MMSA 4NMHA 2PAFA 2IYTA 4RZHA 3LDFA 1AIPA 3ADKA 5DBOA 3SX4A 4CMJA 1SKUA 3O8BA 1WQ4A 4HFNA 1B74A 1G20E 2HPAA 2CF5A 1VI5A 2DH5A 4MUJA 2F6RA 4DIDA 2JI9A 1AK2A 5AW6A 4NPCA 1GUAA 1JAHA 5BQPA 4BNZA 5IDXA 5AJYA 1G0NA 3MT8A 1Z4OA 2XWBF 5ICSA 2A5FA 5EWLB 1TQHA 2BFBB 2I2WA 2X5XA 1OCEA 1J24A 3DFZA 4CGYA 4QYXA 1Q1AA 2F64A 2HUNA 3EVFA 3L7IA 3UAXA 3P96A 4WJLA 3DTVA 2O3SA 4D74A 2QOEA 3SKVA 2OPHA 4N6NA 3IXLA 1G59A 2HU8A 5KKAA 3D1LA 4C07A 3P0FA 5TR9A 2JW5A 4EPRA 3HKEB 1PYOA 2GD1O 3K4HA 5KAPA 3D4IA 4YMUA 3ZW8A 4H3KB 4O08A 1TQ2A 4QREA 5AW8A 1ABFA 1Z38A 4WGFA 4Y2JA 4B09A 2PUWA 1OKKD 2A5YB 4EKNB 3JWPA 4KI7A 5ALRA 1Z7EA 1FQKA 1P44A 4J2HA 4Z7OB 1AE1A 3R5JA 2O48X 5M34A 1TVMA 4EJMA 2HNKA 4TV9A 1GSIA 2AFIE 4B82A 2O1SA 5B6IA 1ZSYA 2WKSA 2WJVA 3LLMA 5HA5A 2W6OA 3RYHB 3IVCA 1KMIY 1R8SA 4U2CA 1TLFA 3D8TA 4HB3A 2GJAA 3VO2A 1RLTA 3FGOA 3K0BA 2QBYA 2X23A 1IOLA 3SYNA 4D4KA 4IUDS 1CUDA 4NMXB 4NNOA 3HUEA 3T3EA 3A3PA 5IYPA 3ZKWA 3ZNOA 5DNWA 1AUPA 3H2SA 2WJJA 3VZCA 4BVFA 2M2IA 4GWLA 4PHFA 2O8FB 3G68A 3K9QO 1P1CA 2HHCA 2XZLA 4HQNA 4TWJA 1W6RA 4BVKA 2W90A 2VP0A 1DX4A 1NZDA 1JLLA 2G8LA 1ECLA 4MQUA 1Z0AA 4J0FA 1Y4AE 1F9EA 1E8NA 2OSBA 3L4BA 3N39C 3PHCA 4IWXA 4LDRA 2UYHA 2F3RA 2YWEA 3C8ZA 5JJKA 1SK9A 2ZYSA 2VTDA 2ZRHA 3NYQA 1RQ7A 4J4BA 1I13A 4YH1A 4MP8A 2O2CA 3OPMA 3TQSA 4YDHB 1BE1A 2HHAA 4D0LB 4EB8A 3I5UA 1A2OA 3AU9A 1MB3A 2C2HA 1FC0A 1TKCA 3JQBA 4UAJA 1IB6A 2LGJA 2VHUA 4Y2TA 1A5ZA 1J33A 1TJ4A 3DOFA 2JGJA 5C7OO 3BWMA 4YCCA 1N1MA 3ESBA 3OT1B 4R2MA 2IJGX 4PPYA 2DJIA 4NCJA 1E3XA 3HNOA 4BIMA 2PGOA 1G5RA 3PJGA 4JEMA 1CB7A 3NBAA 4DR2B 2IZ1A 4E09A 1NI5A 3UK6A 5DS0A 4H6WA 3CW8X 4AS3A 2VHXA 5INTA 1CY1A 2Y0EA 3QKUA 3S0JA 2G36A 4DQKA 4Q1EA 1UPAA 3EW7A 4TROA 4C3ZA 4YDRA 4R4JA 5F2EA 5KPJA 1WBDA 4M0KA 4JVLA 2XCRB 1UD6A 2YYAA 3CU5A 1BHSA 1LLDA 3AOGA 1FYVA 1P7PA 5DT2A 4BQEA 5CLJA 4HC4A 3E8SA 4LSWA 2ILVA 1AV7A 3W5CA 3IDOA 3VMFA 4MIOA 4BAGA 1NV8A 2WHXA 4L4SA 4YREA 4IDGA 5AKGA 4EI2A 5C1OA 4F5DA 1HKHA 3DDZX 4IRXA 4RHEA 4LZPA 3R0JA 2CMFA 1ZI8A 4ZRNA 5JD3A 3CZAA 4BNTA 4WBNA 4P0QB 1A69A 3HLTA 2YR0A 1XJCA 5B3JC 1E9CA 1JXAA 1Z6TA 4ZN6A 3QVVA 3G0HA 3AY7A 4YDQA 2HOQA 1SUDA 4NBSA 1G3QA 1ICEA 1UT6A 2AFRA 2GEBA 3AHCA 2R8ZA 1HNNA 3EZ6A 3WXMA 3L1HA 1WSDA 3LGAA 5EZYB 5FFMA 1R9NA 5TGTA 3V4OA 1OH6A 1JAIA 3RG8A 3TCKA 1MDFA 1TM3E 1U94A 2ZLBA 1LW6E 3BH4A 2DHCA 2F1RA 2ZWAA 3FI0A 1Z22A 3HYNA 1PWEA 4KQKA 1YLOA 5DXAA 2VBCA 5F9MA 2FF7A 3ANTA 4IOMA 1GZ3A 1Q83A 3FBGA 3V48A 5EXPA 4IHAA 4CMIA 2BI7A 2UDPA 3S3TA 3FKSA 2V3WA 5K4AA 1GITA 2FTKE 4UMFA 3O21A 5CCDA 3UG7A 4CLDA 4QEDA 4ZZ2A 5K8JB 2D2IA 4YCLA 3E4DA 4KC0A 1FLVA 2VL7A 3SDBA 3RJZA 4CM4A 1EFRD 2GKSA 5HF5A 2C4MA 4IVRA 2DZDA 1G38A 2XJ9A 1IONA 4JJ7A 2ZJ2A 3ZLVA 1XAGA 4ZPJA 4ZAVA 1KMNA 2R2AA 3IMKA 5A3SA 4RZSA 4AKIA 3WLTA 1CRQA 1S7CA 1XYYA 1DC4A 5JDCA 3AOEA 3G3EA 4RFLA 1Q44A 5ANRB 3MTAA 3OCWA 4R9NA 1I8DA 2BEVB 5HM6A 5K3OA 1PLKA 2G3YA 4GI3A 4FDUA 1R0WA 2DWUA 4F38A 1M1YB 3A9TA 1YBFA 5FT9A 1J39A 2WHYA 4E4YA 2AD1A 4XRRA 1RR6A 2PL3A 2ZT6A 5DWDA 4YQEA 2P9BA 2RAUA 3CEAA 3OCZA 4CRWB 1P0MA 2VEDA 2H29A 3U49A 3QEBZ 2BDTA 1XCGB 1N32B 4PBRA 3OESA 1MLDA 3IAUA 3JATB 4PC6A 3OY7A 1FXWA 1BYUA 1TM2A 1X8LA 1E9FA 2HGZA 1THZA 2VQ3A 4P54A 1LTKA 3NZEA 2GHRA 2XOEA 4ZI2A 2A4KA 2OOSA 3RJMA 4B17A 4DV7B 3NVKI 2VHJA 1V1MA 1AMNA 1VG8A 5BN5B 3OETA 3N0TA 3FFBA 2R4UA 1LXCA 1SG6A 3QX8A 4KVAA 1U3TA 5K6TA 1Z8FA 3OKAA 3DB2A 4I4TB 4TKVA 1T9KA 3STWA 3ZLJA 1NR1A 3H5AA 4PZEA 2OO5C 3AUSA 1C2YA 4QO8A 4A4DA 3LDAA 4AAYA 1Z26A 2V31A 3EDCA 1VZ3A 3GQVA 4KH1A 4FP9A 3RRXA 4Z3DA 5JY6A 2ZIZA 4GRIA 4NEHB 2GJRA 2V7QD 1EWKA 3D7LA 2GD2A 4WXHA 4CG1A 3N1UA 5ERGB 3LO8A 4C05A 2DTEA 1UD8A 3PQ3A 1CUZA 5AUPB 1N9GA 1NJ5A 2QAJA 2CNKA 4HDMB 5FPKA 2PSDA 1ZU5A 5FBQB 3TVDA 4J9VA 1QYCA 1RD4A 4LE2A 5DHUA 1V6SA 1TPYA 2ZATA 3OIFA 4PEVA 3V7YA 3LC7O 4FHZA 3MC1A 1YJAA 2ZGVA 3L0BA 2RONA 1PJ2A 2KSQA 1CE8A 4EUHA 4A10A 2YS6A 2ZJOA 1W0KA 1DINA 4X3PA 2BSAA 4XARA 5T41A 1J1IA 4BFWA 4IWYA 4BZWA 3CX3A 1Y9EA 2COUA 4MQEB 4GPTA 3KHUA 4LOLA 1G21A 4C7KA 1KWKA 1E1RA 2NUAA 4U2FA 1E2DA 1YX2A 3DXZA 4MJ3A 3IV9A 3SJCA 3NO4A 4C1BA 2D8MA 3EXEB 5BW6B 2GZ3A 1TZ2A 1IVNA 4OLJA 2HYIC 4M1ZA 3T1HB 3KLOA 2A1UA 4RO0A 1WSAA 1WDMA 3BVPA 2Q5OA 1M8KA 4KE7A 3AI2A 3I05A 2CEKA 3H1EA 3RT1A 3ZWWA 3KHKA 4RA9A 3OIDA 1BG6A 2HJHA 2DQYA 3GCGA 5ENVA 1A9RA 4ZEVA 1WBBA 2ZJZA 1ABEA 3KAPA 1MT0A 4LRQA 3R44A 2D3WA 3H5OA 3HTXA 3CO0S 2DEUA 4XFDA 1KMHB 1U6JA 2Z2ZA 1ONOA 3KOMA 3JQ8B 5IBCA 1X70A 2VFAA 3FFXA 3TQHA 1ZGGA 3JQ8A 4R84A 4HDNB 4A0QA 1U0BB 1XRNA 1WKVA 1Z0DA 2Z8ZA 4ZT5A 4EF6A 2XUDA 2YZMA 5C53B 5LLTA 2DWCA 4KXYA 3T7CA 4RD0A 1M34E 3PFWO 4KXWA 4NYMR 4URUR 3U7JA 1SQSA 1RYEA 2EARA 3OPOA 5B4TA 1IQ0A 2HPHA 1WY5A 4I14A 4M9RA 2QW1A 2PY6A 2Z9BA 3AI7A 4WLFA 1DAFA 3MBKA 3ZH9B 4EHDA 4I55B 5HYVA 3JD3A 3RBAA 1U5CA 4ND5A 1YK0A 2EF1A 1DIHA 2O07A 3DDUA 1F7UA 2ZJ8A 5AW5A 3WMWA 4B5KA 1NFQA 4OB6A 2ZG6A 3GLIA 1R12A 4YP0A 3N6RA 2OYNA 2Y4NA 3JYHA 1YZUA 1MOSA 4WEOA 2Q5IA 3CW2A 4DUYB 1KP9A 4P25A 3TD6A 1AHIA 5CNJA 5TF4A 3NC0C 2FEOA 3MQFA 2BPOA 2Z1NA 4JP5A 4X20A 5KNBH 3ZJYA 1OX6A 1PL0A 5AW0A 1Y82A 5ALUA 4HXYA 3VJLA 4W8OA 1LBIA 5F1KA 2FPRA 5EYPA 3TSWA 4DTCA 3KBOA 1GGHA 1FFDA 2G71A 4FYVA 4D9JA 1E8DA 2FYTA 3CR7A 2ATEA 2H1FA 3RGGA 5GJBA 2ZAYA 4XB2A 3CP8A 5SY6A 1U7UA 1CEEA 1MO3A 4H1WA 3O8LA 1N5LA 3AI1A 3RVLA 1YMUA 3HS3A 1XO1A 1SHJA 2JJ1D 4QUZA 5BUSA 2HWXA 3KOYA 3WL5A 1Q1QA 1ACMA 5JQGB 3TW6A 3ESYA 2ZS8A 4Q93A 1Z5WA 1QH1A 5E6UA 3UN1A 1I4WA 1H9CA 1QMGA 1T0PA 3AVPA 1Q57A 3OW7A 4D5EA 4AG5A 1FVHA 1WLSA 3CF2A 2MR5A 4KOEC 4B84A 5D5HA 4NCAA 2H2GA 4M8NE 4A0SA 4IMRA 4UVEA 4IVNA 1DO0A 3DUFA 1RRKA 1MCZA 2IA5A 2OHXA 3GWGA 4MKFA 5FPQA 3WK5A 1FTGA 3OEWA 4TT3D 1TGVA 3I42A 2J85A 1ADCA 1P9NA 1YJ9B 4IDBA 3RC3A 4DKXA 3CRMA 3LGSA 4PWYA 2NU7A 4DCUA 2PA3A 3H42B 3UHAA 1HYEA 4J1NA 1I4EB 1H4SA 1CVRA 1Y8CA 2O7SA 4YO7A 1HG1A 2H4WA 1OYOA 3NV7A 1N33B 4JITA 5TXGA 3WIUA 2XAUA 2QY6A 2RHDA 2PX3A 4EL5A 3L49A 4M8LA 2Z57A 4S1PA 4Z99A 4F8JA 4ZCTA 5MGBA 4N41A 2C58A 4EW3A 4DXHA 1HY3A 2F67A 3V4LA 4BJ5A 3K96A 1GNTA 2BEKA 2PIDA 3QENA 4O1HA 3WRYC 3ZQ6A 4QWMA 2V74B 4B3RB 4U2KA 3JQ7A 4DA8A 1IXYA 1EB9A 1KS9A 2JJQA 4OQFA 5F2KA 2WTXA 4AJEA 4DQVA 4WKGA 4YJFA 4MI9A 2FSIA 1G8GA 5CTJA 2J3KA 5KX5B 2AWOA 3G2PA 2AN9A 2AZ4A 3C8HA 1R4MA 2Q27A 2WD9A 3S2ZA 5JPCA 4LJSA 3WIOA 4CQLB 4L78A 1PZXA 4NZMA 1KZ9A 3H2IA 3ETHA 3M6MD 4GF5A 2B3TA 2OHJA 4YV2A 5AVQA 4KQ6A 4QBIA 1G8JA 1VJDA 1YDEA 2YS7A 2HTEA 3KELA 5G4KB 4WNCA 5DHSA 5I9BA 5IBQA 4DCVA 3DZCA 2DPLA 3DHEA 3HFRA 4KX5A 5HF8A 4ZGWA 2W6NA 1S1MA 3C6MA 3AESB 1D09A 2PMFA 3TFOA 1I4DD 2OBSA 2A0KA 1V5WA 3PFIA 3KKZA 3CPSA 4XLAA 3KOUA 4BVLA 4DG5A 3PFCA 3HYTA 5KYWA 3NE5B 2PMBA 2D06A 2WWFA 3OEEA 1J0XO 2ZUDA 3TNLA 3FGZA 3UGTA 3WYGA 4Z4ZA 4EJSA 3I5XA 2R86A 2V0GA 4BNYA 1XXLA 4MUHA 3GLUA 5MGNA 1MX5A 2EEPA 1VQLB 3IQFA 4X8HA 4IQ0A 1PR5A 3GRKA 2UYGA 4I36A 5EFZA 4K40A 5JO0A 2CK3D 3LXXA 3OIYA 3HJRA 4PO8A 5J2UF 1DU4A 2WNSA 2SCUB 1GQSA 4LE0A 4OIFA 2QRPA 4AWBA 1WW2A 1YS2X 2FUG1 3KTAA 3V7NA 3RS0A 5AI9A 4AY3A 4ITRC 3ZU3A 3S8MA 3QW2A 4U7GA 1WP4A 3F73A 1J0AA 2RE8A 2BKUA 2VI5A 1WPCA 4TTSA 4MWDA 4J16A 5H4HA 1PFUA 3KPYA 4HEA6 1PHPA 1NY6A 4IDPA 2AW5A 3H19A 4NK4A 2WJ3A 3HACA 3FXAA 3AJEA 1XFAA 1CJTC 3WLKX 4YACA 4OHUA 2FSHA 2D7CA 4K9OA 1JBKA 1LLUA 4ALKA 5ED4A 5DMXA 4M0CA 1EUQA 2PKXA 1B16A 1UBTS 3MSXA 2GEFA 4YA6A 4MYDA 3SQNA 3KQKA 5AVSA 1U8FO 3B8EA 3DMTC 3V6MA 2HUPA 1BRMA 1CKEA 1GRQA 1U7HA 1MH1A 2BHNA 1NP3A 1S2GA 1X39A 2PH1A 2DWOA 4D99A 4HB0A 1AO0A 5EJMA 5HCUA 4DMLA 2ZBPA 2A1UB 3EDYA 1YJWB 1CZRA 4XWKA 3M82A 1EWRA 1PS0A 1FU7A 1K6IA 4JGGA 2WT8A 1W34A 1E18A 1IJEA 1P2GA 1Z8HA 1M34B 2AQ8A 3EA5A 4G4SO 1Y4ZA 3F6YA 4QU5A 2VNSA 4Q9AA 2P7HA 4Z9AA 1PKXA 1KI3A 5EE3A 3ZWVA 1VBNA 1M90D 2F1HA 3DTVD 4H1UA 4ER6A 3KYDA 3OE4A 4PS0A 1BD4A 4JLDA 3CUEF 4JAVC 1Y6ZA 1O95C 2FA9A 1E6LA 2I4RA 5ICFA 3MS7A 3QM1A 4GSKA 1EXDA 4F1WA 2YV3A 3IDAA 4TLDA 5M5BA 4RTKA 1D5WA 1QPBA 4NFSA 5EWJB 4ZC1A 4AICA 1SU8A 1YL6A 3BXZA 3LVQE 3RYFB 2Q4OA 1L8QA 1LQ2A 3C87A 4IP0A 4HDMA 5TPZD 4C0LA 1HT3A 5KNBA 1IBKB 2NSYA 4KAAA 4TLEA 5DHQA 2BEWB 4BS9A 1W5FA 1GZ7A 1NUHA 2R47A 4RFSB 1YZYA 2YZ2A 2KBFA 4B3SB 5AMXA 4FUQA 4FBGA 3ICVA 3KTDA 3RVNA 5K0TA 1J8FA 4ZOAA 4ENSA 3BRSA 1IN8A 4J3JA 4Z4UA 3C4VA 3TOVA 2X8JA 1RHRA 3IQEA 3C5VA 3PRKE 3W34A 3NM5A 4BX0A 1HG0A 2IYWA 4HEA1 4BUJA 1UQUA 3ZHZA 2QF7A 1ZBDA 4YMTA 3FWKA 1R5JA 1O89A 4UCFA 3AHEA 2O8NA 3IHKA 2Q0HA 4FR0A 5FRDA 3K94A 3LHIA 3PDCA 4I0WB 4JU8A 4L15A 1GIAA 4FDLA 4O4LB 1U7WA 1HSZA 2BGRA 2P9HA 4L0DA 1P5FA 2X1LA 3BMOA 1GVNB 5EWJA 4BMNA 4O59O 1EUDA 4B4UA 3UGJA 3OF3A 3TL6A 4HZUA 5JR3A 4IY1A 3Q2OA 5CFRA 2FPMA 3SVTA 1LI7A 2YDYA 3KYDB 4KR3A 4QTUB 1DWUA 3UAGA 4X94A 4E0BA 2O4UX 3R6TA 3S2UA 3FPCA 5E6TA 2V7VA 4RZIA 1WTCA 4XOUA 4I9UA 2QX9A 3PIIA 5CVDA 5EQFA 4CFYA 3DAHA 3VA7A 1KOFA 3FWHA 2WOOA 2IUFA 1U4OA 4CDNA 2H2IA 3ND8A 3ELYA 2R9VA 5D51S 4N3BA 4D46A 1SNYA 1UBCA 1G8FA 4CR8A 1E58A 3H0EA 3IULA 3PNMA 3U9TA 3ZYCA 5BQ3A 1U7DA 3KYJB 1A8PA 1EP9A 2O6HA 4ZVTA 2E18A 2IHKA 2JHAA 3PL5A 1E1YA 3BMXA 3K9WA 2R62A 3ELUA 2RGGA 3DKKA 2PKRA 4L6CA 2QL9A 2EKPA 5F5NA 4BO4A 4EMUA 2VRCA 3UV6A 1ADFA 3OAAA 1JZTA 2D2FA 1QRTA 3BWDD 3EJWA 4DA9A 5JFTA 2CXQA 4H7IA 3RU7A 3UUEA 3O1HB 3L5KA 1Y5LA 3RROA 2AI2A 4RA6A 2GQ0A 5JAZA 1Z56C 1PFKA 2JFYA 3OA2A 1VE9A 2NACA 3MOIA 4HNUA 3PENA 1J49A 3O3OB 4GUAA 1YRHA 3C7AA 1EVEA 3D31A 4YT5A 1SY7A 4HQRA 1T5OA 2RGDA 5BSFA 3HL4A 1QV9A 2JZOA 4GGOA 4OHWA 4PLFA 3I2KA 1JWLA 1YR2A 1A5TA 1ISSA 1Z8DA 3I09A 3NDPA 3VR1A 4KRYA 1G2QA 4F45A 1LTQA 5FQOA 4D9EA 1BFDA 1URPA 1VYHA 3UV3A 4RIFA 3WAKA 5ICMA 4QPJC 5FD8A 2AMJA 4MMZB 5FOQA 3PHGA 1RAGA 3B3GA 3ETEA 2JJYA 1KAQA 2HRQA 3MB8A 4DUZB 1NJ1A 1ZYUA 3IBSA 3R4VA 1FJGB 3KZ1E 5C32A 5IT0A 2P0EA 4MQ6A 5DRTA 5EP2A 3AGPA 3V1UA 3TR6A 1X7YB 3UXYA 1L7PA 1NBMA 4HQLA 4MQ4A 4A6DA 5F7XA 1NSTA 1ZMTA 1MH9A 5AK4A 3AHJA 2KYRA 4RF3A 1PQ4A 3SDZA 1P4SA 3PUXA 3KLBA 3EGIA 2UYCA 2H06A 3KD3A 5JANA 4CQNA 4YRQA 2O23A 5LYYA 3JQGB 4G5HA 1WTHD 1C1HA 3TJZA 5LVAA 2PANA 4PYNA 1Q7EA 5JD6A 1FMLA 2ZXHA 1SOWA 4AI6A 4A73A 1OBFO 2FW0A 2GO1A 4XQCA 5ARDA 3WGOA 2B1QA 1JR2A 2Q45A 1QU3A 1VHJA 4ZCIA 1VQKB 3B5EA 3QOYA 3DOCA 1VKOA 3STVA 1V0EA 4KUHA 4E2YA 4LYGA 5ITWA 2QVLA 2VWQA 5IJXA 5BXYA 2WZPP 2PFKA 4KK4A 4XWWA 1OBOA 2RGAA 3GJ5A 3A31A 4RV4A 3WHLA 4NK5A 1J0DA 3VZSA 1AF7A 4I9GA 4MVJG 3DNMA 2CLMB 3NC4A 1XQYA 2WAOA 3D4OA 3BREA 2PXCA 4YNBA 2H1IA 4G26A 4E22A 2MOKA 4CLOB 1UMBB 4OKIA 3AHFA 1YE5A 2CRVA 1XFDA 2FDXA 4JOSA 4Q4HA 2Y1KA 3ZK8A 3ZNQA 1WNTA 5C8DA 1FSFA 4ZODA 1NLUA 4P08A 1NQWA 2PGJA 1N4DA 3DDNA 2UZ1B 2QQ0A 1SUCA 1ZD5A 3BWYA 3K05A 4R1QA 4RJ2A 1OHHA 3F9RA 4FEYA 1O77A 3PUIA 2A0XA 2BW0A 2GAIA 5K3FB 1ZSNA 2ZYHA 4QAQA 5H0IA 1A9ZA 3P26A 2B9EA 2JCBA 2XVYA 3F7NA 1A2BA 1NJSA 2TMKA 3JQFC 1TCBA 3DB1A 3OJOA 1XHFA 1NR5A 3K6JA 3LTNC 4ZTZB 3OBIA 2BF7A 3IODA 5IUNC 4MWSA 1AQNA 5TPZA 4H3VA 4RVSA 1T9DA 2H1WA 3VPDA 4DR6B 4BUCA 4GR4A 2ZM6B 2QBYB 3EEYA 3AR9A 4F4DA 1JJ2B 1D7AA 3QPDA 4AZTA 1U2ZA 1ISFA 2XY4A 2Z43A 2ZRPA 1WKBA 2JLZA 1QX3A 2BP7A 2E5LB 1HGXA 4GGMX 1LF5A 1A4IA 5BN4B 4OPSA 1JHPA 1E43A 4R7ZA 2JZCA 4MR7B 4CF3A 2XXAB 5LMNB 5KNCD 3UH0A 1D4FA 1KOLA 4CUZA 3JAMA 5K01A 4WT7A 1VLLA 4JI5B 4JI8B 1I1QB 4JBWA 3T3MB 4MKIA 3IUBA 5AHKA 3HU5A 1N57A 4I66A 1EIWA 1WDTA 4WZBE 4YEDA 2DXIA 2J0VA 1ZI6A 2BVNA 4F5EA 1GLNA 4UNQA 5ALMA 5B30A 1G3MA 3DT8A 2WTEA 2PRYA 3FPBA 4IIFA 1TKRA 3IJRA 3Q3CA 4K87A 3MWDA 1KVQA 4XFKA 3RUCA 2Q4EA 1GTSA 3B6ZA 5DKFA 4E5VA 4O3MA 4LF7B 3W8DA 3WK6A 3WLMA 1IFXA 3E35A 5E0KB 4UNRA 4F84A 3QUSA 2BHRA 3O84A 2NYUA 2JGEA 3OQ6A 3P0EA 2XKAA 5EJ2A 2W6PA 4ZOCA 4AVYA 1QQTA 2EQAA 4RF4A 4CM1A 4JVMA 3QKRA 3V33A 3M9LA 3SBEA 1OA1A 3WRWA 4JB3A 5HF6A 4KQGA 4D9FA 4Y0VA 3JZDA 1PNQA 2QN9A 1DIBA 3NUZA 2VYVD 3QWHA 2FRVA 2C78A 4DMKA 4PAAA 5B7NA 3KR9A 4FINA 4NG4A 2CUNA 4DCNA 1EGQA 3KRTA 2IVZA 4LV8B 1GWNA 4I4TF 3FUTA 4YCBA 1XTPA 3ZG6A 5LXTB 2PXXA 4C43A 3GVLA 4EG5A 2OZLA 2VNJA 3OBBA 3AT1A 3PCXA 3D81A 4L2IB 4YEJA 3KFXA 4HS9A 2GEVA 1M1UA 4KMOA 4ER0A 2AXQA 1Q0HA 2W2KA 3WHPA 5I9IA 3PPIA 4QDUA 1UWKA 1XI2A 5DOVA 3DBLB 1JH9A 1Y7PA 1FNCA 3RSHA 1QHIA 1DKOA 1ULUA 2I4OA 3CFYA 4ROXA 3HVHA 4F12A 3I9OA 1YHQB 2Z8YA 3I1IA 4O4IA 3TWOA 1Q77A 2L2QA 1XALA 2A57A 2JI7A 5L8VA 2ATCA 1WDLA 1JT2A 1C8BA 2Q8PA 2I65A 2HWYA 1QCZA 2VHQA 3M7IA 1MG0A 3BGSA 1GNLA 1N5RA 2G4VA 2HNBA 3IO5A 3KTFA 4MYUA 5C4IA 1YB6A 3KJEA 1QQAA 4XM0A 2GAFA 4B83A 1MMFB 3N2GA 4RLQA 3PQ8A 3LF2A 3N75A 3L06A 2RG1A 4KN5A 4DIKA 4B3IA 1ZR2A 4F1JA 3HKBB 4U02A 3S8EA 2AFHB 1U0GA 3B7PA 4AWAA 4OHZA 3WBBA 2VJOA 3F2VA 4HNRA 3A6EA 4OFZA 1QVWA 3VGPA 3GPLA 4J91A 4RY9A 2R1VB 2FLKA 3N6XA 3GO4A 1H2WA 2JFHA 1EPUA 1KQSB 1UDXA 3B70A 4HDKA 3QXHA 1V5IA 1SXIA 4MAAA 1ZM2A 1MIOB 3L7OA 4RORA 5JI3E 4WNAA 4EJFA 3GI1A 2GREA 1QG6A 2CL5A 4JHXA 1TIBA 3BSWA 4MV5A 4C6TB 2CNWA 2CGEA 3NEJA 4GR5A 3FOEC 2I4TA 3O4RA 1CUYA 1AGXA 2FB9A 1O6ZA 1DRVA 3BDIA 2JIRA 3LDGA 1J90A 1N36B 2V97A 3L43A 2F3PA 4MUKA 3JQCA 5JYDA 3VU9B 1IHOA 1SCUA 1QP0A 2QX8A 1ZVKA 2H1OA 3FPPA 3GJZA 2FZKA 3KALA 4MW6A 4Q3LA 3ZH2A 2DHRA 4D2IA 2WLTA 1KH2A 2NTNA 2ZTUA 3MWEB 4N39A 4Y6QA 2X3UA 1NX6A 2ZR9A 1FEZA 4OBEA 4TYPA 2G72A 3MK31 3L1KA 4Y67A 1YI2B 1QYWA 1QHNA 1RLMA 3ZGLA 2YWXA 4RWZA 2AVNA 3UJNA 1C0IA 4EW1A 1Y81A 4HV4A 3AB7A 1D3AA 1BW9A 2VDWA 3N8GA 3INGA 3BHJA 2AFHA 2YMLA 4GRDA 1HL3A 3CG0A 3UOGA 2PHZA 5ALSA 4YRIA 5AUNB 2D00A 3PD7A 1IQRA 1T6BY 3PC2A 2YWBA 4JR1A 2CVHA 3HU2A 4ERXA 3Q7TA 4Q4AA 1KXJA 5HGJA 3SK0A 1PJ4A 4FDMA 2J3QA 4TLMB 1O9HA 3MRSA 1Y37A 5FFNA 4QEKA 2V7UA 1WMSA 1GR0A 3PC6A 1V3QE 1E79A 1CEQA 2B61A 1EB8A 2D0IA 3EBLA 1TZBA 5CVCA 3RSZA 1O2DA 3VPAA 3NBZC 5FDFA 3KL2A 1LY1A 3HP1A 4H3HB 4M83A 1FVOA 2Y6VA 3C1TA 3TLYA 1O5TA 4UPEA 2IKSA 4KVZA 3NGMA 2WSBA 4O4JA 2P9CA 1FLDA 1T2NA 4KRGA 1IPFA 4L2IA 3KZOA 3VOTA 2WZDA 2QEXB 4CU5A 3OPNA 1B2RA 2WMDA 2PR7A 3E7DA 1QDEA 2ASEA 3LSTA 4TV9F 4XDGA 2FPPB 1FSPA 1IN7A 2JIBA 2P7IA 4WK4B 2QV7A 4B6RA 1VPLA 4AJ4A 3IPRA 4FGWA 1SC9A 4FZRA 5JYEA 3DL0A 2BFFB 5ICEA 2J87A 3T9FA 4ZICA 4HZGA 4NBTA 1E2MA 1YGYA 3LP6A 3P2KA 5ICCA 1GA4A 4FW8A 3T3HA 4L95C 1HM5A 3DV9A 4I5GA 2HF8A 3EA4A 3FAKA 4JCOA 1BDIA 3GARA 2SKCA 3THOA 4DXAA 1LDGA 2OWEA 4CM6A 3R8FA 1SC1A 4RKEA 3B3JA 3QUAA 2J5BA 4PQGA 1MVLA 1Y8QA 5J59A 4I3FA 3WDKA 4HZUB 4DCTA 4DLTA 4OK5A 1AS0A 4UU7A 4JI2B 3GZNB 3B8HA 4BN0A 1KYZA 1TM7E 1XOIA 2JBWA 1W5AA 1YB1A 2QN7A 4I1VA 3GGJA 3P94A 3NTOA 5K4HA 1VQ4B 1PNOA 5HBGA 4YC7A 4KXUA 2JIMA 4LJ5A 4DM3A 2GCOA 2W2PA 1ISRA 1H1TA 2J6CA 3FOAA 3ORYA 4V0OA 4WLOA 1QRDA 3AEQA 1P7YA 1VKJA 2FMXA 1ORWA 2V4UA 1TTHA 3HADA 4UUBA 1X9GA 1BA3A 2HAEA 3EK2A 3TZ6A 4IDEA 3CCMB 3GRFA 5LU9A 3JD4A 1ZAYA 3P2OA 3PXUA 1PDWA 4NYJQ 4LW8A 3OZCA 1VB5A 4RHUA 4DUGA 1B6SA 2VP9A 4UDOA 1OAOA 1QNLA 3G5AA 1KGSA 2CVPA 3KNZA 3RS4A 3THYB 3HLKA 3O1LA 3OJCA 4MUIA 4OATA 4UXHA 1ZJWA 5TVKA 4O2BF 3SR3A 1RJFA 3GDGA 4I4CA 3WLPA 4C6TA 1FX0A 5BQFA 4MV0A 1EXMA 1AKRA 2GJ8A 3AJRA 1THGA 3JASA 2BM1A 1CVLA 1YXMA 2DWQA 3ZD8A 5ALQA 1A7KA 3PQDA 1J42A 1EP2B 1DB3A 1VPEA 2X76A 2DUWA 3GDOA 3PGKA 2AOXA 2EATA 4J2OA 4MKXA 4F04A 3ZV4A 3MJRA 1P0QA 1HQDA 4R5HA 2C4TA 2RJ3A 4ATNA 4CMBA 4FB5A 2AKEA 3I5YA 3AILA 1RAEA 1Y1LA 2BMVA 2E4YA 3ND9A 1SBHA 1OGIA 2WJ6A 3A0RB 4KSCA 4PGGA 5ULLA 2Q3DA 1GGFA 4AECA 5C8ZA 4DV5B 1KC8D 4IXNA 5U9CA 3JTEA 3FVRA 1E6EA 4KRXA 1EDZA 2YYSA 1P7ZA 5GZ6A 4N3AA 5LDGA 3F97A 5AD1A 1WMAA 4HEQA 2ZBEA 1ZGBA 4HLNA 5CD1A 3DMHA 2MINA 1AGPA 1IIBA 4FFLA 3CE6A 4QU8A 3AF0A 4QXRA 4WACA 4FW9A 3RM3A 4B80A 4TZ6A 3WKCA 3IJEB 4EYQA 1LRKA 2Q49A 4HDAA 2J9YB 3UCEA 4W5QA 3VO8A 4P12A 2VSOA 6YASA 1FOEB 5L3QB 3H9EO 5JIBA 2FPGA 3FR7A 2QW0X 1QAQA 1RLOA 3RS3A 3RRJA 2ZRGA 3UB4A 1XA4A 3DMTA 4KQXA 4N65A 3R7DA 4KO2S 4PVCA 3CWZA 4HG2A 1L4NA 1L7RA 1FX0B 2FW9A 4TTRA 3T5MA 3E9RA 5BURA 5EIEA 4PFQA 1C4OA 1VQMB 1TQDA 1JYSA 3NBQA 5EAIA 4DLSA 1MOQA 1YCGA 3QY0A 3G7UA 1ZR4A 4XYMA 4BGVA 4RHCA 2NXCA 4F3RA 1G291 2FU5C 4S35A 2AB0A 3A4YA 3H5VA 3D6TB 1K98A 3GBSA 3NM6B 4FQ5A 4QDOA 1QVVA 4EI9A 1SKBA 1Q0SA 1U3VA 3O8QB 5TQ2A 3VHXB 4ZYUA 2H59A 3IIMA 2IY9A 4MV7A 4W5WA 1R0KA 3KPWA 4OU4A 5H81A 2F3UA 1PP4A 1K88A 2IC5A 4Y2HA 2RI1A 1X7GA 2WU1A 3QX3A 2XE4A 4V1CA 5FI3A 5K8CA 1AO3A 3HSYA 4MGKR 1II8A 2HJGA 3CZRA 4G4JA 3ZD9A 1QRRA 4DY6A 1PL6A 3H3XA 5G2OA 3PKJA 3KFVA 4XKWA 1SBYA 3IBTA 2ZSKA 2O7QA 4OMDA 1V4VA 5TARA 2A9PA 4MYRA 5ADHA 5KBYA 1KPIA 2C7QA 1YIOA 2GFQA 2Y68A 4FUTA 2BCGY 3DO5A 5E9QA 3FMVA 2XF8A 1ZK1A 2RHOA 1QHHA 1VIVA 2A3NA 1LW7A 3R9XB 1WP9A 1B8OA 1ISIA 2AS0A 2QKYA 3GWZA 3K1YA 3MLAA 4J0HA 4RW0A 4FMDB 5D3KA 3S99A 4EY7A 3HI4A 2E1PA 5F1YA 1ORRA 3H2ZA 3SZRA 1QHEA 4PPGA 1BCRA 4TMTA 2P0AA 3DWFA 1IQUA 1VGRA 2J08A 3DYIA 3PXCX 4LHYA 4P33A 1MTZA 5AOBA 3MF4A 4NE7A 2YXPX 4M7OA 4KBYA 4DM7A 5F3WB 6Q21A 5JRZA 3FGNA 2EKQA 2WIBA 4ESHA 1CJVC 1GRVA 4L4XA 4MS1B 5E0OA 3HBJA 3L4KA 5ALXA 4N0DA 3N2LA 3H6GA 2FN9A 4LJ7A 1SKAA 5TT0A 5KC8A 1RXEA 1P5HA 2J9FA 3W8RA 4MPTA 3AUAA 5TS3A 2WE8A 1VIDA 4HEHA 2W8BA 3FNBA 3WA7A 1USIA 4EFMA 3R3WA 1TVCA 2XWJI 1LBHA 3JZAA 4MLPA 3UMBA 4Q9NA 2DMRA 2NQTA 4P3IA 1KDRA 2PGXA 4V2UA 3UHFA 1FUUA 2P27A 4F06A 2UU9B 1QZZA 4NPAA 5G3YA 4LHEA 3QIAA 2DECA 4C21A 2JBAB 2M9MA 4YCJA 3OZWA 4NZYA 4JVSB 3UEOA 3GQBB 2WPDA 3MAGA 2BTQA 4EB3A 3PLAE 3IAAA 5DN6D 1KOJA 4OI2A 4DYHA 4AYWA 5K8UA 3I1FA 1TMOA 3FPHA 1ULTA 1UMBA 2OYCA 1JHQA 1IB0A 4I1SA 5DYWA 3PJDA 1T2UA 2WJ4A 2WHQA 3FSGD 3Q4GA 3SDSA 4BNXA 4CN8A 2XGOA 3H9GA 4EABA 4C0KA 4G4SP 4ARAA 3AF6A 3H94A 2X6WA 4A23A 4XKVA 2HFKA 4O0MA 1M2EA 3NTVA 2J3HA 3NX4A 1Z3CA 3OFSA 4KSBA 1EHYA 2BF4A 1Q14A 4TL7A 4R1OA 5CH3A 3UIEA 4XGRA 3E7XA 2RGEA 1T0JB 2H57A 3F4BA 3HBFA 1ESCA 2I6GA 2JGNA 3TNFA 3EXAA 3L7YA 1QGZA 2HDOA 1E3JA 1RWOA 1WHSA 1EGHA 2CJPA 3HCRA 3V1LA 1OAKA 4JFRA 4QFBA 4RKFA 4Q4JA 1EGMB 2D0PB 2C2WA 4EGCB 3QVOA 4BVBA 4CIBA 3N53A 3ZKAA 4Z9YA 2OBRA 4FFNA 4TLCA 4PCUA 2PIAA 2C4VA 3BXOA 4KPEC 3K0FB 5K9ZA 4X0CA 4OQDA 1E79D 3Q11A 1B6TA 2XZPA 1O54A 2P5TB 1E1DA 5SZKB 3SIPA 4DUGD 3G5MA 3FBWA 3O7WA 3R3SA 3M9WA 4UTZA 4JI7B 4YAWA 1FNNA 2J9ZB 3W5UA 1T4CA 5IYZB 3T1QA 1GCIA 5DM0A 3A70A 2X1MA 3IKVA 5E1BA 4TUYB 1D2CA 5P21A 1H5UA 4BEJA 2FR0A 3D9QX 5KQPA 1JDTA 1DBPA 2BJVA 3H8WA 3V6LA 3LU1A 1F6BA 2J3EA 4POOA 5L7WA 2X0FA 1RSZA 4MCJA 4BO0A 3K0KA 3LQ6A 2GD0A 5KC9A 3MPOA 4B3GA 1QGOA 4YGXB 3T9BA 1JA9A 2JIDA 2OCGA 1PTJA 2RH4A 2VN8A 2V6JA 3FB4A 3M8KA 3VDXA 1E9VA 3FLAA 3Q6IA 3OJWA 4R8SA 1IJBA 3IAM6 1V8ZA 3IPLA 3L7KA 3ZWBA 3H2BA 5JNTA 4FM9A 1DCFA 1M2WA 2BEJA 3DMRA 5HIMA 1EMDA 5K6AC 5CNIA 4DHEA 2IODA 2IYQA 4I5EA 2E55A 3MXOA 2QRVA 1PLLA 2ZSBA 3FROA 3G2JA 2XD4A 2E6UX 2E5FA 5BVHB 1O7JA 2NU9B 4ETNA 1S0UA 2C4NA 1ULSA 1MB4A 2ZUSA 3VFDA 2Z2XA 4DK0A 3D8NA 4HY3A 5CBPA 3EPKA 1M2FA 7REQA 3I76A 4EECA 3LCMA 3PQ5A 4FQ8A 4AU1A 4IDHA 3DVQX 4ZOBA 5FTKA 2ZQ5A 1T5LA 4LK3A 3UMJA 2SICE 3WLLA 5I3CA 3ROFA 1NAHA 4AUEA 1P2VA 2JCGA 1ZJ5A 3GFOA 3N3BC 3OWOA 4H4CA 4MR9B 4PHHA 5HFAA 4U5XA 3RD5A 3BF7A 2A7QA 3LHSA 4QBGB 3SZOA 4FLMA 1OPXA 4BKRA 1TU3A 3CNLA 3LC1O 2I6QA 4X93A 4BP9A 3GYGA 3MM4A 4EYGA 5EJFA 5C80A 1K3FA 1FUKA 1M1NB 2DRIA 4F1KA 1JDPA 3EBOA 4MRPA 4DV6B 5GVRA 1GO2A 5HCIA 2AG5A 2KWIA 1T5TA 4RIHA 3CP2A 1EHCA 1FJ2A 3BBLA 1ZI9A 1I7QB 4BIIA 2VT3A 1Y3AA 5IVPA 1UFOA 4BECA 4RK6A 3NAQA 2FEWB 2I3DA 4I6GA 5E6RB 1BXZA 4CG2A 4JLNA 5DT9A 4TLBA 4RPCA 5AK3A 4ZA2A 2FUCA 3GJRA 3QE2A 5JH7A 1ZWLA 4CCSA 1GSHA 1LX7A 1QOPB 3B89A 6ABPA 2WHRA 4GBED 4GNRA 2GCNA 3ZDZB 3RSFA 3SYMA 2A5GA 1RQNA 2O8BB 4LSGA 1KBOA 1ST3A 2WA1A 1Y1SA 4A0RA 1U5AA 1Z17A 1RYHA 2L19A 4ZDIA 5FV7A 2JGMA 1DFGA 5CXXA 4ZXFA 1RPNA 2QT0A 3K0AB 4NZNA 2WP8J 3D8HA 3MCUA 3RKUA 2GFHA 5JBNA 4YJFB 5L3SB 1QV6A 2QG6A 4X7RA 3K53A 5GGYA 4NNPA 4MA0A 1JEQA 4II7A 2OSVA 4FNGA 3U1BA 4QPNA 1VIAA 4LTMA 1VSTA 1JSLA 4EUEA 5JAIA 1ZXBA 2DKOA 1QYDA 2VA8A 4K9DA 4MVJP 1JA1A 1PJ8A 4PR0A 1TJNA 4BDTA 3ABQB 2ZXUA 1SVUA 1GUBA 1UZNA 2X6QA 5CB4A 4JXXA 1XZLA 2ORWA 1OZFA 4O2LA 3MMNA 4N7RA 1SK8A 1C3OB 1PL7A 4OOXA 3BCRA 1GPMA 3Q3GE 3SU8A 1IHXA 2Y2VA 2CL6X 4XASA 1VG1A 4KMMA 4DZTA 5KOHA 4R1PA 5K0SA 4HH1A 2CFOA 1OBCA 5AUOB 1WRBA 3ZJUA 4ZQFA 4DYVA 1YC2A 4S1OA 5IN5A 4YV0A 1CR6A 2WFLA 2GM3A 4HGYA 5CAEB 4EFKA 1WOMA 3SJZA 4M9QA 2LZ0A 3NAGA 1M2KA 4AZ0A 3LYUA 4CCWA 4LN1A 4Q1DA 4RLHA 2EVWX 3BGWA 2QN8A 1T5HX 2IYEA 3W3AH 4C0HA 1CU1A 1L4MA 3GLFE 1VE3A 2IS4A 1RABA 4R54A 1H8HD 1NLYA 1QK3A 1XDSA 1JLRA 1G5IA 1M75A 2YOFA 3LCCA 1RT9A 4YRLA 5JAMA 2WNHA 2Q3BA 3WLQA 3NTXA 4JB8A 2EP5A 4NNJA 4ND7A 2WQ6A 1EP3B 4MPPA 2WYHA 3ESXA 4OAOA 1W88A 1AZTA 1L1EA 4I55F 4N54A 4X9XA 3WRXA 4DJDC 4I1IA 2LE0A 1ECBA 3MCWA 4P34A 4ND1A 3GT4A 1D6JA 2MR6A 3SKXA 5IBRA 1GPAA 5FYDA 1FUYB 4WZ6A 3E84A 6GPBA 3C1OA 2ASVA 2UUPA 1ENZA 3NRJA 2QL7A 2DT5A 2RHGB 3VJMA 1QYIA 3W3ZB 3OLWA 1K66A 5D8DA 2PUHA 1CUXA 5DN9A 3V2IA 1V11A 4QQRA 3SC3A 3CINA 1U11A 2ADOA 3IEIA 5DHRA 4XGKA 1P1JA 2G6TA 2AX3A 3QJ5A 2VYVA 3EG5A 2IBSA 5F4ZA 4BGEA 2OUIA 1GU1A 4LHWA 4G1VA 4N4AA 4EAQA 4F46A 4PG8A 2VBTA 4UNSA 5LQAA 3PIDA 3K9BA 1ZN9A 3JU3A 3VU1A 1N0HA 5B58C 2WJAA 3JQ6A 1V48A 5F78A 3ESRA 1HNZB 3AESA 1E99A 3IDSA 1P74A 1SVSA 4KXXA 1DO2A 3AFOA 3FLEA 2MJLA 2ZPAA 1C8VB 3DMFA 3KYBA 5E6SA 5CA1B 5CMLA 9MHTA 3TW8A 3OQIA 1F8GA 1RMTA 5KCZA 3BL5A 1RAHA 2QYSA 4RHYA 1ESDA 4GMFA 8OHMA 1AHNA 1K4KA 1F06A 2EWWA 1T3SA 1A8IA 1NVMB 4TM8A 3VXKA 1XRMA 3KLPX 3T12A 1VLHA 5AJUA 5GY7A 5LMUB 2OAQ1 3U3MA 3R7BA 3GCXA 3M89A 5KUTA 4QGBA 4L28A 3VH2A 3C1AA 4KDRA 1CY0A 2NM0A 1LFAA 2VDOB 1Q15A 3C3KA 3GLRA 1OZHA 4XIIA 3ASTA 1KEUA 2CHEA 5AHOA 5KOJA 1IUPA 3LHDA 3TIFA 1Y7LA 1XKQA 2FHSA 5CFOA 3VNUA 4CMGA 1KDYA 5IAGA 3RYCA 4YECA 4MDEA 1E2FA 4Y2XA 3RRNA 3GA7A 3HUUA 2FWJA 5MN4A 3LCJA 1ZS9A 4MEBA 3VPSA 5CB8A 1KP2A 1WEHA 2LD4A 4DTIA 4B47A 4ZMSA 1W30A 1ESZA 4PG7A 3T0GA 2DM6A 4WZTA 4B85A 3CVXA 1AK1A 4YAJA 2E7ZA 1CR2A 1DAPA 2JFPA 3HMQA 2WJYA 4JWTA 3CR3C 2NU7B 3EC1A 1V1JA 1JAXA 2XVMA 1V0FA 1U2EA 1YKGA 3ABOB 2F43A 3C7KA 3OOEA 4QUJA 1L4EA 2W5UA 2AL7A 2HLDD 4N7BA 4Z4WA 3RK0A 2LZJA 2P6NA 1AKTA 3TDMA 1MRZA 4XM2A 2VQEB 4BVGA 1W75A 3SYTA 2GGSA 1UKEA 3E4CA 3GJ6A 3IVXA 1DDOA 3VM6A 3B38A 3ZVKA 2W2OA 2KLHA 2Q2OA 2IV3A 4EJ6A 5LOVF 4RF5A 2PK3A 2ZIGA 4YHHB 2BTOA 3B6IA 1TCCA 3MERA 3DBOB 2HR1A 3DMYA 4R81A 4KN8A 2MSCB 5KTMA 2EQBA 2ORED 3L92A 4MV8A 4CF4A 5KYUB 3TNDA 4K1LA 4K9QA 4G7XA 1B1CA 1F2VA 1QSGA 4OYRA 2IYFA 3V2GA 2XDWA 3HL0A 5IF9A 3DBHB 4OB8A 1HNXB 2Q3EA 1ZG3A 3KEMA 1TA9A 2XA9A 3VVMA 5IXSA 4BEVA 4OX9B 1CF9A 2PE5A 1Z5PA 4BV9A 1WXQA 1PK8A 3RF6A 4UATA 2O8DB 3IDZA 2C4WA 4GM0A 4URYR 3RASA 3HVIA 1NXPA 1CF2O 3K0EA 3S2IA 2EFHB 4QUKA 4DBZA 4GH5A 4CQMD 1A8UA 2E3JA 1FP4A 1G4UR 5EYPB 2D54A 4MGIR 2RHHA 1OFVA 1MEOA 2G07A 4D3DA 2ZE8A 5TQJA 1VSVA 2XF2A 4ZANA 1N5JA 5KVAA 5CAEA 1UZAA 1XD2B 3KC2A 3C97A 1IC6A 1ETHA 4BU1A 4LJRA 1G18A 4HYEA 1CRPA 3RC7A 1YC5A 3P0HA 1T1GA 1H2EA 3BX1A 1VLYA 4OGFA 1DRJA 1YQXA 4HLUC 1VFNA 5D5PA 3OCJA 3CVJA 4BJ6A 2HDNB 3LBFA 3JYOA 1E5DA 2P4QA 3IQZA 4MWBA 2I7TA 1GPH1 4CKXA 2RARA 1BDMA 2ZB3A 3OOHA 1SCJA 3PUNA 2QD1A 4HADA 1I7LA 4NOJA 1FQOA 4TV8A 5A0FA 3MT9A 4EW6A 4EZBA 1HLDA 1F5NA 3P45A 3MHPA 2JIZD 5ALJA 1JEQB 2V7PA 3HM2A 3LLSA 4X92A 3GGGA 4G1UC 3Q6MA 1N2ZA 3NOXA 5I9NA 3T35A 4YMVA 4FFSA 3IMEA 2IW3A 2GA8A 2C5EA 3F6SA 2W11A 4M3NA 4TOIA 5H16A 3T34A 4F93B 2AK2A 4OA5A 2ZJFA 3KVVA 1X9HA 4GQAA 3I32A 5DYNA 3REOA 1NHWA 2VH1A 3BL8A 1UQRA 2BKAA 2WKRA 1M54A 1IM5A 2BBSA 4RMIA 3TI7A 5JNUA 2OCIA 4OX9Y 5KQLA 4OGWA 5F21A 3C14C 4HNHA 4ALNA 4OXKA 3DXXA 4L16A 1GUZA 2IPMA 3EWNA 9LDBA 1QLJA 1ZCZA 4LMRA 5DWVA 3M9XA 1UH5A 4XXHA 1RYYA 1JNXX 4LBYA 5FPHA 3TRHA 4D3FA 1MBZA 1UANA 1ZCAA 5GOTA 1RWBA 4PPQA 3ZYZA 1O03A 5A5FA 4C0SA 1Z33A 3FUVA 4H6XA 4LK2A 2YMPA 3OC6A 3QQPA 1T2AA 1T8PA 4M89A 3THSA 4TKMA 5BMVB 2P77A 3BXXA 2DOKA 1UJBA 1W0JD 3DLHA 4XSGA 4BBJA 3FNGA 4HVCA 4V0MA 5KWVA 4TUYF 3KQUA 3FTDA 3GAFA 3KZVA 4LXQA 5BSVA 1RZVA 4XVQA 2A30A 1N3YA 1E2PA 2QRUA 1GQFA 2WM8A 4B2LA 2CMDA 1XTQA 4JX8A 4YB8A 5FWXB 3AR8A 2HBQA 3IUEA 4XLLA 3RSLA 4E5PA 3LBNA 2IL1A 3RKSA 3EQ9A 5CJPA 3FF1A 1XTIA 4AXXA 4DC1A 1CP3A 4C2AA 4B6OA 4UNNA 4ED9A 4EHNA 2CDRA 1P91A 2HB6A 3HA2A 4DS3A 1Y1RA 5HIAA 2LCFA 5FJIA 4NRDA 1AZSC 1BPLA 1ODIA 2O2DA 3F7MA 3UTCA 1QR2A 4UMEA 1D7OA 2Z4SA 3KR2A 4UCQA 1WOSA 2GK4A 1ECGA 3C3EA 3SM3A 2D1YA 1KY4A 2P3SA 5JSZB 5GVSA 3HJCA 2GQFA 2QMZA 3G0IA 3OLCX 4D9BA 1BIFA 3G23A 3LV8A 1ZSVA 3KQYA 5KAMA 4DJJA 4DRYA 1EVYA 2D1TA 3L77A 2JAPA 1UXKA 4GEKA 1JWAB 3RIEA 1YCDA 4G0UA 2IHVA 3WLFA 1LBEA 1QOQB 1AQJA 3GLGA 7MHTA 3KD2A 1JAZA 1L3BA 1N7GA 4G8BA 2CDNA 4KDFA 2IUEA 3VYVA 3KXPA 3QPBA 1DEKA 3Q88A 3FFAA 3A6HA 2WFLB 4WY2A 2R1TA 3WYBA 3UJ7A 5ITZA 4X65B 3HSKA 5J4KA 5J1SB 1P2TA 4RZ2A 2RGWA 4CLEA 9LDTA 2NO7A 3MTJA 1ZIYA 1E5XA 2JFXA 4LNUA 5KOHB 5DHTA 1OLXA 3OMWA 4IJKA 4D9IA 1WETA 3HCCA 2H7XA 4IIJB 1XQ1A 1SZCA 1FP7A 2R68A 1PKEA 1X80A 2XA2A 4N18A 4BKMA 2AZDA 2V6MA 5EMLA 5IZ4A 2O2XA 3S8YA 3HFJA 4ZYXA 1BEEA 2VPPA 5JZBA 1X0XA 2FSSA 1OH7A 3W5AA 1EZ4A 4AZ3A 2VDVE 3K0FA 2NADA 4TL6A 4UUOA 4BWGA 1L4KA 1FYFA 4MWGA 2WYWA 4NSNA 4YP5A 1DOZA 1Z82A 4KKVA 2BMWA 4P8RA 4BLUA 2WABA 3QOXA 2CNWD 4XEHA 3TFWA 5HVNA 1W9HA 3RTAA 1Z4NA 2FUKA 3IB3A 5ALOA 1LBTA 5FTMA 3CCJB 2C2MA 3DL4A 3GLHB 4JJZA 4KNVA 1FDWA 1TCUA 2HQOA 3IVGA 1GNRA 3JQ9A 1GPJA 1YCFA 4OYHA 3M33A 3H9QA 3TKAA 1OPRA 2C7GA 3V8RA 2GLXA 3BD9A 3HKEA 3H4MA 1M6WA 1T0BA 3MILA 1L5FA 2A88A 2MSNA 3RIYA 3FOFC 4C4PA 1X94A 2Q7XA 5IT9A 3HJFA 4WK6A 4HN4B 3JAWA 2Q28A 1JB1A 4GEGA 4ZOLB 1BDBA 1U2RA 4ER7A 1WX1A 4EJ0A 3G9UA 3ZCXA 4A6XA 5AR1A 3KHSA 1UXGA 3PICA 4O2AF 3S70A 5LIPA 2CMGA 5L51A 1V5VA 5KOYA 1U63A 1X9IA 1VM6A 2HSGA 4INAA 3IERA 3I23A 4S05A 4WADA 2BTQB 4UBKA 2AGVA 4CMEA 2AG1A 2FSPA 1OR8A 3EEOA 5KKNB 1PQYA 3OTIA 3IPXA 4K6GA 1QH0A 2KLBA 1N6NA 3C3YA 1M67A 3TL2A 1AF4A 2P67A 1OXUA 4OAPA 3TNJA 1IBRA 2PN1A 2PYZA 1XX6A 2CVQA 4D4IA 5I7HA 4JBNA 3U3KA 2JIZA 1JBQA 1KD1D 2ZZFA 4Y2UA 5C5CA 4BQPA 3CVOA 1MXFA 1G5HA 1YJ8A 1ZESA 2PBLA 4LEIA 3SSNA 5CB6A 1S2IA 1N05A 4XQ9A 4CT0A 1TAHA 2I7VA 3PV0A 3FJYA 5TY0A 4NCKA 5DDIP 4BRWA 2OAP1 1ZNZA 1VL5A 4U39A 2OMKA 4DR1B 3Q8XB 2R25B 2RB4A 2GKGA 2XPCA 3NKFA 1OLOA 5K3SA 4EW2A 4RM3A 1Z2DA 2NU6A 2BGNA 4P9NA 4RIIA 4XUDA 2GPNA 4E14A 4IIYA 2FOXA 2J6HA 1I4TD 2VHYA 3ML1A 1EEXB 5FLYA 4CEIA 1YVRA 1A9TA 3Q5GA 5IAEA 2ZWVA 5DBIA 1HZZC 3HXQA 1BLIA 2ZROA 2QM7A 3WAJA 4XAQA 2JGIA 2ODTX 2Z5FA 2FWBA 4X1IB 1YSCA 4QC2A 3L7MA 1ZY2A 1FRZA 1GGNA 1U65A 4KTVE 2O5EA 1WDKA 1I9GA 1T1RA 2CLLB 2GMWA 2YINC 3E3LA 4I1RA 5LB4A 3OQIB 3N6VA 3HHPA 4ENQA 1MC8A 1I5RA 1M6VA 1YJNB 1J8VA 1DI0A 2OGUA 3A9SA 3DEFA 3PNYA 1HT0A 3GVHA 2VYCA 4FVTA 3WGKA 2AN1A 5HUJA 1U8CB 2J7KA 1E1KA 2EX0A 2YJ6A 5FOSA 4PN7A 2REBA 1SIBE 3TD9A 1OX5A 1N1GA 2H54A 4WINA 1GN8A 1OB5A 3KQOA 1XXHE 4IQGA 3VC7A 2P1DA 3U5ZB 4BHTA 1R6UA 4F21A 4GX0A 2YQZA 2FSUA 4K8RB 3O8CA 4YMGA 1VJ5A 3RIMA 4BO9A 5JCOA 2IW1A 5K8IA 4GWGA 3A2NA 3RRYA 3AF2A 3ZUGA 4IR7A 3O94A 2DHDA 3QVKA 3ZGZA 4WLVA 2C82A 3ADDA 1ICIA 2V7EA 1O3YA 1HQKA 2PUFA 3ZWXA 3GEMA 1MU0A 3VKVA 3MGBA 4D4MA 1IJFA 3V8PA 1HDZA 4ACAA 1XZJA 3ORSA 5L45A 1Z6XA 1HA3A 2BMJA 4CCAA 4NJMB 1XKTA 2BMFA 2CVOA 2EKZA 4FC7A 3Q0EA 3SSMA 2ROQA 4F3TA 3K92A 4IHQA 4WJKB 3GMDA 2HJRA 2F1JA 4PO3X 4O1MA 3I9JA 3NVMB 3NWOA 2ONYA 1GGKA 4GMDA 3IP5A 3BCHA 5JAHA 2OO5A 3WRVA 2B82A 3DEIA 3OT4A 2BMAA 1M6HA 1L6IA 3GFTA 4MS4A 2NVUA 5KPDA 5T7BA 3FZGA 1BGXT 2CXUA 2NPIA 1DMSA 3IEPA 3DMGA 4JXZA 4JMQA 4ZT2A 4UOEA 3DDSA 1H2HA 5EE0A 1X15A 1UD4A 1Y42X 2I78A 3ABZA 2EGHA 3E20A 3AWIA 3CBQA 3LHFA 5HGXA 3E15A 3SP1A 4HNQA 3F5DA 3TLAA 2PL1A 1CULC 3MOGA 4P3PA 4IWNA 1HE1C 3CF4A 4EARA 2VBUA 4L08A 2A7XA 3FD8A 5JNWA 1O97D 3C8DA 2P5UA 4XYBA 4EATA 1NVFA 3KWMA 4CZ2A 2VCYA 3OT5A 5CITA 3UUFA 2I54A 3E58A 2JG3A 4I1UA 4MGYR 1M1XB 3TTTA 5B6PA 3NLLA 2LCIA 2I4LA 5FJJA 2NMVA 4PSDA 4FYYA 4M98A 2VHVA 2FQQA 3GA5A 1UJ2A 5BWCA 3EX7C 4QYSA 2VDKB 2CCGA 2QP4A 1T2CA 2I6SA 2ZRAA 3D6FA 5C3UA 3TQCA 4XL9A 1FLAA 1UK9A 3MAJA 4JBIA 4RVNA 3SXUB 4BLPA 2VUIB 4DZZA 1DXQA 3DWEX 1U2GA 1PJBA 2Z2YA 3CCRB 1PD1A 4J6FA 3BMNA 3HXKA 1I7PA 2PMWB 3DKIA 4HAYA 5CT6A 3LK7A 3PDIB 2WP0A 4F7DA 3MRVA 4FHCA 4GFDA 4OB7A 2P4UA 4WK0B 1Z08A 1XNRB 1UP6A 4EMBA 4XYGA 1SQFA 2WYUA 2BWJA 1X7XB 3FA2A 4NYIR 4FGLA 5PNTA 2W58A 2VAPA 3E1KA 3DFMA 5F4JA 1KPHA 1TA0A 2ORYA 3AINA 5COAA 3UKDA 4PNEA 5CCBA 1CDDA 2DUUA 4RPKA 1OU4A 2ZFUA 2ZJ1A 2AG6A 3KSUA 1DCTA 2ZSAA 4GLOA 4PYKA 4OXNA 5EMJA 3VNRA 2IHYA 4O8ZA 2DFNA 2GCEA 5EKXA 3GGPA 2IP2A 1ZVVA 3KUDA 3BCFA 1Z83A 3AF4A 3GGCA 1Q84A 3PYLA 4HKTA 3P2JA 5EPUA 5DGIA 3VVLA 3OIUA 2NT4A 1MOZA 4BNGA 3WISA 5M04A 3H17A 5TQ0A 2DF8A 1V16B 4MW2A 1M1KD 3GP8A 3IQHX 4Q47A 5DCUA 4H0CA 3VTFA 1Y0BA 2PSJA 2FRDC 4LNAA 5B3LA 1IHPA 1MB0A 5DM70 1AQUA 1GP2A 2WAAA 5EGNA 1QPZA 3QLTA 3ETDA 5AHXA 4B40A 1EU1A 1QAMA 4P7BA 1JIQA 3NBYC 1KR5A 3DPUA 4PIVA 1U6IA 3AXTA 5TGZA 5IEBA 4UPVA 2ODNA 1P4AA 2AT1A 1E7WA 4NVRA 4ALLA 4XQFA 3HJBA 4D6PA 4AK9A 2JFBA 2O2HA 2OP0A 3DQPA 3TBKA 3QPAA 1J2UA 1BHJA 2P6RA 5DNCA 1H42A 2EFJA 3V2UA 3DT6A 3PD0A 3V1MA 3MNFA 1N2XA 2C3OA 2I2DA 3M3DA 3E48A 3E9QA 3GNTA 3PCTA 2Q6LA 4LVOA 2RGNC 2BFDA 3RVMA 4E2ZA 5JMTA 1JW9B 3A25A 4AURA 1XVIA 1XAHA 2GRJA 1VL1A 5ENZA 4C22A 3NALA 2EWMA 3NOQA 4YUZA 2Z09A 2ZSIA 2XECA 4FBLA 3U37A 3RODA 2WPDD 3F9IA 3QKSA 3G8DA 4D57A 4D8UA 4NWIA 5FAKA 1V9LA 2HIHA 1PFYA 3P5SA 3L8DA 4OEHA 2UUBB 1ZCBA 3NXSA 4FS3A 1NUSA 3GX1A 2OP1A 1TDJA 1Z6GA 2BEUB 3DTNA 2GPWA 4KXQA 5KSZA 3HDJA 3IESA 4QYIA 3R8CA 3DZKA 3AKZA 3L1IA 5BSXA 5KWSA 1GTMA 1VCMA 3FZQA 1OZAA 2PGAA 3NG1A 4HD8A 1OZ0A 3CY6A 4OOSA 1EM6A 3DULA 4HPJB 2F9FA 1ZN8A 2WFMA 4KPGA 4URVR 4WAUA 2OV4A 2DTXA 3JYPA 4G0ZA 1SJ9A 4YXFA 1M2VB 3O8NA 3QMVA 2KM1A 2C04A 1TD1A 2IKQA 3OA0A 1JHDA 1XQ9A 2OAGA 2EG9A 4IKPA 1IY0A 4KYVA 3QEMB 3I83A 5B7PA 4XWOA 1C4XA 5CYPA 2XNHA 3K6SB 4KOAA 4YFVA 5I7OA 1P73A 1KMCA 2Z2JA 3GAZA 4OKSA 3SHOA 2F1KA 5DVZA 4ZI5A 5IMSA 2GEJA 3HB0A 1WCIB 2DY0A 3VVCA 1GFWA 1E1QA 2XXBA