4AF7A

Pea fnr c266m mutant
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
296
structure length
296
Chain Sequence
HSKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVYTNDAGEVVKGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMMGLKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN--NADP REDUCTASE, LEAF ISOZYME, CHLOROPLASTIC
publication title Structural Backgrounds for the Formation of a Catalytically Competent Complex with Nadp(H) During Hydride Transfer in Ferredoxin-Nadp(+) Reductases.
pubmed doi rcsb
source organism Pisum sativum
molecule tags Oxidoreductase
total genus 86
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4af7A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4af7A02
4P3YA 1JA1A 4RD4A 1KK1A 4NCNA 4HE5A 1IB0A 5DSZA 5JBQA 1IJFA 1KRHA 2YWHA 2AHOA 2VNHA 3AGQA 4MYTA 2OK7A 4F7DA 5H5JA 5AN9A 3LYUA 3G71B 1IJEA 3ES9A 3JQPA 3AVVA 4RJLA 1VQMB 1QUFA 4TMWA 1G7SA 3FPKA 3ZZTA 4AF6A 3AVXA 1ZM9A 1D8TA 3MHPA 4MYUA 2BVNA 3W2IA 4B43A 4Y7CA 1YIJB 4YAWA 2RC6A 2J7KA 4Y9UA 4PC6A 1DDGA 2QTLA 4RCZA 3B78A 1Q86D 1JA0A 4AC9A 1YJ9B 3P26A 4ZCMA 2R6HA 3I1FA 3OZWA 1G7CA 1HA3A 3CC2B 2DETA 1AIPA 1FNDA 4H9GA 5TY0A 3VNUA 1EFTA 1TUIA 1FDRA 1S72B 4PC2A 1WDTA 1KC8D 1FNBA 5TV2A 1R5BA 3AVTA 3CRZA 3AVYA 2VYQA 3WNDA 1W35A 2XNCA 4B48A 1NJID 2HCJB 1QVGB 2PLFA 2PMDA 1JB9A 1E62A 1YJNB 3V76A 3ZZUA 4FK8A 3W2GA 1Q82D 3OJWA 4QFMA 3P27A 2XEXA 3FJOA 2BM1A 1U2RA 1VQ7B 2OTLB 5HXBA 2FX3A 2HDNB 3CCQB 3CCJB 5EMNA 1VQNB 1GAQA 1F20A 3G6EB 1VQPB 4M0LA 1QH0A 4Q7JB 1QGAA 2B7BA 1YHQB 3CCLB 1N0UA 1N8RD 3A1FA 4J0QA 1J9ZA 1XB2A 1QFZA 4M2LA 2GQFA 1FNCA 3CCUB 1QUEA 1R5OA 4RD3A 1VQ8B 3CCVB 1GAWA 2QN6A 1AMOA 1QFJA 5TR9A 3CD6B 4LBWA 1GJRA 2VNKA 1QFYA 4RD2A 4Y9RA 2YWEA 3WNCA 1D1NA 1VQ9B 3QFCA 3CPWB 4RCYA 3CC7B 2D74A 4RD0A 3CB4A 2E1RA 4IW3B 5FA6A 1VQ4B 1YJWB 4TMVA 1VQOB 2OTJB 1EXMA 1QVFB 1H42A 4AF7A 3QFRA 4R71A 1CNEA 4K1XA 3W5HA 4N3NA 1VQ6B 1OB5A 3CC4B 1B23P 3U6KA 1E64A 1KK3A 1H85A 3ZZ0A 4M1KA 1DG1G 2QTZA 1VQLB 2ZITA 2VNIA 2GPJA 2X3UA 1DDIA 4PC1A 1ELOA 2BV3A 1ZUNB 3WNBA 2QMUA 3W5UA 4WQMA 2RC5A 1EP1B 3JQQA 3W2HA 2C77A 1N0VC 3CCRB 3E1YE 4YHBA 2CNDA 4BPRA 4LBYA 3VO2A 4EH1A 3U2QA 1JNYA 2EIXA 1KD1D 1QG0A 3QFSA 2CRVA 2BSAA 1KJZA 4C0SA 1ZM2A 2HMAA 3JQRA 1W2BB 1CNFA 2DY1A 1YITB 1GR1A 3MMPA 2B5OA 4YALA 1B2RA 2DERA 4PC3A 3QSYA 1DARA 4LBVA 1Q81D 3CCSB 3I55B 2C78A 1G7RA 1EFUA 1OGJA 2BMWA 1A8PA 3W2FA 3B82A 3WYAA 5GV8A 4ZV4A 1QX4A 3W2EA 3CMEB 5THXA 3W5VA 1TVCA 4NBSA 1UMKA 2B7CA 2VZLA 1BJKA 3OJXA 1SM4A 2DCUA 5GV7A 4QHYA 2OK8A 4LBZA 4U9UA 1JJ2B 1K8AD 1ZM4A 1NDHA 1EWYA 1K73D 1GO2A 4C43A 4YAFA 4B44A 3CCEB 1EP3B 1D2EA 1I7PA 1F60A 1YI2B 1TTTA 1W34A 4ACAA 3WY9A 3WBKA 2YWFA 1EP2B 4G5GA 4PGOA 4ZGNB 1M1KD 4PC7A 1BQEA 4B3XA 3WBJA 1ZM3A 2BPOA 3OZUA 4RD6A 3OW2B 3CW2A 1E63A 3AVUA 1VQ5B 1KTVA 2PIAA 3I56B 1KQSB 3CXCB 4YAOA 2BGIA 1W87A 4RD1A 1GVHA 2YWGA 3WXMA 4TMXA 3ZBUA 4ZCLA 2QDXA 4M53A 4DQLA 3J81k 1OB2A 1M90D 3PENA 2EFGA 4HE6A 4TMZA 4B4DA 1OGIA 4FWTA 1QGZA 2DEUA 3LO8A 3ZC3A 1Q7YD 2BM0A 3QFTA 3LRXA 1EFCA 1BX1A 3AGPA 3B8HA 4P6VF 3QE2A 1XE1A 4ZCIA 1VQKB 5KSWB 1BX0A 2VNJA 2BF4A 3MCAA 3ZBTA 3VO1A 4DQKA 3CCMB 2XNJA 4YAUA 3CMAB 4TN1A 3SJZA 4TMTA 3G4SB 4FN5A 1FRQA 4B47A 1R5NA 1G7TA 2QA4B 1KK2A 4UAJA 1FNMA 1KK0A 4LC0A 2BN4A 4ZGQB 3AVWA 1FRNA 1K9MD 4ACBA 4M4SA 3LVBA 3OZVA 2QEXB 3VNVA 1CQXA 4N3GA 1QGYA 2NPFA 2BGJA 1S0UA 3VMFA 3U6BA 4G1BA 5H59A 1TLLA 1SKQA 4G1VA 3E20A
chains in the Genus database with same CATH superfamily
1K7SN 3L6RA 3SNKA 1H65A 4BKUA 1U99A 4UNRA 2NYAA 3BULA 3P9YA 1AMNA 5DEIA 5JG7A 3BERA 4KAFA 4LPKA 1BDHA 1LTHR 1X38A 4LRWA 4MHOA 4LK3A 2W0SA 5COQA 3IBCA 1JVSA 3USZA 3V4FA 5CDSA 3BH0A 1Z4PX 2VDNB 3NKVA 1IOLA 2FSFA 2Q6TA 2XCIA 3L1UA 2O3JA 4GX2A 4KLRA 4A23A 3WO0A 3KJEA 4F38A 3ZR4B 3V1MA 2PGOA 2P6OA 1GGNA 4XLAA 1N6PA 2E49A 2P65A 3DE3X 3H4VA 3CVOA 2ECPA 3M1YA 2CXHA 3DKIA 4PIVA 4ZTBA 3VTAA 1RZ3A 2OO5C 1M7HA 2WD9A 4UPVA 3H9JA 4MGYR 4ZT2A 2PD3A 2FWJA 1YB6A 4CCAA 3H9EO 1U1IA 2CE2X 2QE6A 3IP8A 4PGAA 4RYLA 5ECWA 3RVRA 3VU0A 5HSGA 4UFPA 3ZIUA 1N8NA 4EMBA 1GNRA 1RJ9B 2Y92A 4MYSA 3NFYA 4AZ0B 2AZ4A 1HKHA 4IHAA 3S44A 4AECA 5BPHA 4QO8A 1LPOA 3A1SA 4ML3A 4X61A 3ZK7A 4TQUS 5DMXA 1I5OA 1E18A 4RH3A 1RP1A 3AJDA 4ICIA 1QYDA 2P27A 1T5LA 2GFHA 2QTWB 3RFCA 2Y9PB 1RRKA 1HI9A 2PTGA 3JQAD 4Y9UA 5HCNA 4QT4A 3G85A 5DP1A 1ZIYA 2XDQA 1VC2A 1F4LA 2FXVA 2WZDA 1XV5A 1RXEA 2Y1FA 5JRDS 4KZPA 4LHYA 2CFTA 4HV4A 3MBIA 1RJDA 4DLXA 5JJLA 2R00C 3ZZNA 4RTSA 1VL2A 6PFKA 3EAGA 4YRIA 1RWVA 2GFQA 4G65A 3G9UA 3TLBA 2R6HA 2JLWA 3ZJ4A 3SYLA 4NDZA 3KR1A 1TEHA 6NULA 3G1TA 3EY9A 1N6OA 1ZQ1A 4G5FA 4WK0B 2QTAA 3QTBA 2ZPAA 3FZNA 3NLLA 4NOLA 1Z6GA 2F3QA 2X5XA 1MIOB 1C7ZA 3ENVA 1ZMRA 1GKLA 2OZVA 3KEQA 5JTTA 2BW0A 1ZY2A 4JFAA 1KDTA 2I2WA 4XOPA 1DLJA 3G17A 1KZYC 3DMHA 3K4HA 1WOPA 1A9XA 4DMUB 1S8FA 2FPPA 1DC4A 1KSFX 3CGGA 3CWQA 3NANA 3UHJA 4C03A 1OFIA 4I4TA 2VRNA 4GDFA 2JLVA 4DCPA 1H9CA 1WXWA 3EW7A 4RKFA 4RL4A 1BGVA 1TA4A 1D2MA 2I4IA 4JLNA 2H4HA 4BJ3A 2PX4A 2E87A 3WB1A 2ZR7A 4CCSA 2KI5A 3QVJA 1IPEA 5KTYA 4O3FA 3D4BA 2PQMA 2QKYA 3WL3A 1PO7A 1VL0A 2DT5A 3VPSA 4QBHA 1JFRA 3AEUA 1KA9H 1R4MB 1EFRA 3ZIDA 3PQ3A 4DUYB 4IUDS 1TAQA 4LCBA 3R74A 3IKVA 1QV7A 2E4ZA 1JLLB 1NDUA 5K3CA 1MEOA 4DLKA 4KH0A 2ZM6B 4EZIA 3RABA 2HZ7A 1GUFA 1G18A 4X64B 2RJ3A 3KQWA 4TV9A 5JYDA 3QXGA 3L6EA 4ND5A 3TOSA 1EGVB 1J5EB 2VP5A 2BM1A 4PICA 5F7ZA 1U2RA 4DLZA 2Y0CA 4KK4A 5HQ3B 1MORA 5ARCA 2RSLA 4QM7A 2HLNA 5AICA 1QC5B 3GOHA 2EJTA 1Z82A 2VTDA 1G5IA 4JHLA 1GZSA 4GC9A 4PGFA 1S8AA 5P21A 4H31A 1ZD1A 2V7QA 3HZHA 3WG9A 5BR7A 5I51A 3FUTA 1VQNB 1VBNA 3R8XA 1F20A 3PNQA 5ES4B 4RY8A 1G3MA 5HE9A 1RWKA 4QVIA 4W5TA 1RPJA 1IXYA 3P4XA 4TLDA 3A6LA 1N8TA 1RMTA 4PLWA 2FUG6 3LECA 3E5HA 3Q7SA 2I55A 1WA5A 1X74A 1KBZA 3DH0A 1OD6A 1XL1A 3ZHVA 4HJRA 4INZA 1XF1A 2OEPA 2XZTA 1X7XB 4LDQA 2YBDA 4XLLA 5JCZA 1VECA 5IC6A 1GUZA 3IAUA 1QB7A 4F71A 3DKKA 3LUAA 3QLUC 1QUEA 3I1JA 2O07A 4GVPA 4HJXA 5LP6C 5P8WA 4EPRA 3L4JA 3HEMA 2PLAA 2OBXA 2VPXA 4R1QA 1IY0A 9LDBA 4EQ6B 1KF0A 3ZKWB 3ASVA 2UDPA 3VR1A 4U00A 2EBUA 2FZLA 1G20B 1QO7A 4X7BA 5EUBA 4RY0A 1TIKA 3PQ7A 5D86A 2I3AA 8ATCA 1Z18A 2E3JA 4TLLB 4UTPA 1QFSA 2Y1EA 4JL5A 3TMAA 3TQHA 1M2OA 2WINI 4V0LA 4F8EA 1XNRB 3HKBA 2GAAA 3AP3A 1RYMA 1CUYA 3ASZA 5DASA 2X9VA 4RKWA 1Q1GA 3ZD9A 2J9ZB 3A11A 2E1RA 2CNLA 2Z57A 3QUTA 4OPSA 1RPZA 3UMBA 4L57A 3VZCA 2PG3A 3FPBA 4P5DA 1KORA 1HT1E 2ZSJA 3EEIA 4N0QA 3H18A 2FR1A 3OHSX 5DISB 2QORA 3GROA 4JB0A 4TS9A 4EGCB 1XLTC 1NZFA 4CU2A 3PLAE 2F3SA 2WYVA 5TRTA 2EATA 4KQJA 4OQMA 2BI7A 3QHPA 3JPYA 1IBSA 1R6DA 4JIGA 2D0DA 3MJDA 5U4XA 4BLSA 2Q50A 5JCOA 4XRGA 1Z4KA 3ORYA 2I66A 3G0GA 2VC2B 3LDAA 4HNVA 1MC8A 1FP7A 2YS7A 2GSWA 2L42A 2QMYA 3K09C 3CC4B 1ZOLA 3X1DA 5B2ZA 4X7EA 2YXBA 4ZALA 3KUCA 2AOWA 3PVDA 2FG7C 4NEHB 1YFZA 1N2OA 3ONNA 1NLYA 3L8DA 1WSVA 4ONEA 4P2BA 2YJGA 4KP7A 1RM4A 4BDSA 4E4RA 2Q62A 2HF2A 1J1UA 3MGKA 1GYQA 4CTNA 2BEUB 3OJCA 2J4DA 3AU9A 3OQ6A 4KWEA 4R2LA 1L1QA 3EC1A 3W7AA 2ZOSA 1OXXK 3H8JA 2XDQB 3SU8A 3TMYA 4QU0A 4LE1A 2VHVA 4DKXA 4R1MA 4L08A 3O6VA 3HCAA 1I51A 2XLCA 5SYNA 4BB9A 1A1SA 1VQLB 3WJ7A 1QO0A 3DM9B 4QGGA 2H2AA 1H2WA 1RWOA 2HHCA 3KO8A 2DUNA 4MR7B 1GKUB 2HU5A 3A35A 3QHAA 4KMOA 4M60A 4RE5A 3SDSA 3BIWA 3DFUA 2RGGA 3KQNA 1I01A 3AYXB 2P4SA 3OD1A 4NZMA 2ZZGA 3Q38A 3IRVA 4UXIA 3WNBA 1WTAA 1PV2A 2PD4A 2WMYA 3E9NA 5I4CA 2FDCA 1NW6A 3GCXA 2OQRA 3DEFA 4PG5A 2WHQA 4XMYA 1WB5A 2QTMA 4MUFA 2J0EA 2QM7A 2OCGA 3PICA 4X5OA 5AVZA 2C77A 4JBHA 4ZOLF 1FF9A 4MKXA 4V0QA 2FVXA 3ZOZA 4EENA 3NIBA 4EHIA 1PFYA 2CBGA 2RGCA 4OEHA 2FPPB 4Y2HA 3GEHA 5LQJA 4LNUA 2I22A 1N33B 3FLMA 3RSOA 2A0YA 3FFAA 3AESB 3DD1A 3JW8A 3RTDA 1YJXA 4QM6A 4I4NA 2J3IA 3EGXA 1M8FA 3FGPA 4MEBA 1NPDA 2PRZA 2B4KA 3F7OA 4JR1A 3EA4A 2B4RO 5F51A 2NX2A 1W52X 1ANKA 5DX1A 1Z6AA 3M4NA 1QG0A 2WNIA 1C9YA 1F0KA 4KXQA 4YNBA 4MUBA 2QT1A 3AEUB 3DE0X 5DPMA 2VP6A 3AVQA 4FVTA 5A7FA 4C0SA 3QVUA 3GGJA 4MVJG 5J1TB 2IUEA 3S29A 1G20E 3SC3A 2GBFA 2VWHA 3PPIA 2C7GA 1KKLA 2VTBA 3HUEA 2VP0A 4D26A 2ERYA 1K97A 2I2BA 3VKWA 2V65A 2XTZA 1BKDR 4S3MA 3RK1A 3PNYA 5DN9A 4XB6B 4DDMA 4RKYA 4F86A 4JGGA 1ILEA 3ZU3A 1BLIA 1D5CA 7ADHA 4O2BA 2DLCX 4LZOA 2XBUA 2Q6KA 3GZNA 1YQ9A 1PIWA 3RHZA 3AHCA 5KVSA 1G7RA 2ZI6A 3LOUA 1EFUA 3BB1A 3TRHA 4D9FA 1C8BA 3SVLA 2GXQA 2XGGA 3KLOA 2C0PA 4Y9SA 1L5HA 1QVZA 1BA2A 3KOMA 1K8ZB 3TM5A 2PCLA 1AUXA 2VJLA 5LQKA 4JASB 2XGJA 3A6PC 1J8DA 2HO4A 2Q6OA 4BUCA 4DWWA 1UK9A 3PT5A 2HUNA 2W90A 5H0IA 5LPNA 2CFCA 3EISA 3K70B 5ALZA 3VUEA 1PTKA 2PXCA 5BXQC 1VLLA 1T4CA 1VB5A 1WRBA 1ZIXA 3GVLA 4GX0A 1OV6A 5IAJA 2L18A 4IEEA 1OTHA 1S2DA 1JR3E 2N3ZA 4FFNA 4JLAA 3T7AA 3L7IA 3GFGA 4DF3A 2QGGA 1KDPA 4I1PA 2G6TA 1JJ2B 5L53A 1XRPA 1K8AD 3EGIA 5E3JA 4ILEA 1DQZA 2JLBA 4ZI3A 3ZCPA 1SUBA 1GCIA 1HEYA 2CXUA 2YIJA 4YEDA 1MZPA 3BE8A 1LUAA 4YAFA 3VYRB 2VP2A 2X6XA 4IVNA 2IY8A 1DRWA 4RZHA 4ZU3A 4XYMA 2NV6A 1Z3CA 3A6FA 4EA6A 4DDKA 3S2IA 3HG7A 3ETNA 2CB9A 2OOSA 4DNFA 3KEOA 3GH1A 5AMXA 2D2VA 2FMKA 4MO9A 2CXQA 2ZROA 3PRHA 4XOIA 5JDIA 5A8AA 1S1CA 4HVTA 4J0JA 2R2GA 4QBKA 4TLCA 3ZI7A 1QRUA 3PT9A 4RULA 4MJ3A 5F2NA 1LDEA 1E9BA 4PGOA 4YS6A 2OSVA 1P80A 3DEZA 4C76A 3LC0A 4XA8A 2NU6A 4GI5A 2NZVG 3OQBA 3K96A 4LV8B 3CNOA 4B3XA 4J90A 3WK6A 4XSVA 5EP2A 1ZL2A 2CFIA 3NH9A 3PTZA 1SQGA 2TSYB 1S2NA 2WT4A 1ZM3A 4XGRA 5K2MA 5BSTA 4JC0A 4D9JA 5CFNA 4L2IA 3OZUA 5B1IA 3UW3A 1E2BA 1T91A 2QT9A 3B53X 3DT6A 2G8LA 3MOSA 3OLXA 3STWA 3VDMA 2EFDB 5LQAA 4LDNA 3NS7A 4RKQA 1V4BA 3WQSB 2JIQA 1KARA 1UPTA 3NTXA 1O95D 3GEPA 3U60B 1DRKA 3CKYA 3C4VA 4K86A 5AW5A 1OH5A 3PGJA 4FYJA 4NMHA 1TF2A 3GBVA 3PG5A 1DHRA 5DKFA 1QHHA 4BBPA 1HQKA 5IAKA 2G71A 2RBEA 4LI0A 1YGYA 3TJZA 4Z3KA 1J42A 3ZHCA 5JLAA 3BE5A 4WVLA 4JDPA 4QGHA 4BMNA 4AMGA 2A3RA 3ONDA 2DU8A 1SEVA 2DH6A 3GEMA 1LBEA 1DKRA 1EK5A 2PSSA 4HLUA 5ERXA 2IU0A 4DQLA 3V7UA 2QRHA 2VBCA 4L5YA 1P9RA 1RXCA 4PQFA 1SK9A 5EXSA 4L4YA 5IUJC 4JYPA 2M32A 2IPXA 2N0SA 4KO2S 4U7FA 4G23A 2R7MA 1DHTA 4FU0A 4BZQA 5BN5A 1NTOA 3L46A 2Q5LA 3ED5A 4UOZA 3TH5A 5C35A 4Z1OA 1XMSA 2Y8EA 4JOQA 4ND2A 5IJ0A 3M5CA 3SDZA 3F6RA 3FB1A 4Z7OB 4X41A 1CNMA 1UJCA 3PNBA 1XTZA 1WUHS 2PIDA 3M6AA 3I04M 3SBXA 4D3DA 3UG7A 1GQ2A 1WD7A 2JGIA 1KMIY 4M9QA 4ZRMA 4LAFA 5IDXA 3UGJA 2NYVA 1SXQA 2ZJFA 3LT2A 3I92A 5KEIA 4LNUB 2QDKA 4DIBA 3EZGA 1BJTA 2GETA 3AUSA 4TT8A 1SA0A 2XB8A 2OB2A 4YRLA 2VNJA 2BF4A 3WNQA 1AXGA 4P83A 4KXWA 1YR1A 3OIUA 3WQZA 3AO0B 2OO7A 1EVZA 1NVKA 4DSTA 1TU3A 1K06A 3BTOA 4E5KA 3B13B 5A3QA 3ZLJA 4HDQB 1NVBA 2XNJA 4TKVB 3ZDZB 2PZBA 2E4YA 2NVWA 4QVAA 2EW2A 3L7DA 4UVEA 3RFFA 3CZRA 1IDN1 3MG9A 2IVFA 3ZNPA 2QE7A 1A97A 1PTJC 1W59A 5CVUA 2VTBB 1OAOC 2B7LA 3CISA 4MPTA 3KXIA 2CXOA 2R84A 3AHIA 5C8XA 1FNMA 1Q6YA 3G5UA 2G08A 1U5CA 3L1IA 3AJEA 4HOYA 3DBVO 4O2BB 1FL9A 1R15A 1U6IA 3KJIA 3ZCUA 3GZNB 4BAUA 2GBPA 3MCZA 1U80A 3FY4A 3OESA 1M5TA 3UT5A 3QVLA 3T06B 4C1BA 5AK3A 4UEQA 5IYPA 4X3CA 3S55A 1KOJA 3QMVA 5IAOA 3COJA 1HFKA 4NU0A 5LZ4A 2X42A 2XNHA 2IS2A 1MO2A 4KE8A 2C92A 1WPCA 1FX0A 4R1LA 2RKBA 1USUA 4TZ0A 2ZWMA 1WP9A 1U3UA 1QVVA 4KBYA 1CJUC 1VHDA 4HB3A 4DJTA 3IKJA 2HJSA 2FZ4A 4G2TA 3T1OA 1T4CB 2N46A 1B8NA 4YR9A 5LKRA 3ANSA 1G60A 3V8BA 1KVTA 3CX8A 3K2EA 4URHA 5H59A 4EB3A 3TJRA 4O29A 1YZVA 4F96A 1LC3A 5DNAA 3JD3A 1ZI6A 2Q4TA 2WB2A 4G1VA 2PX6A 4CG0A 4GGPA 3MB8A 1YDEA 2X0NA 2YN0A 3OJ0A 4J1TA 4QRDA 1R8QA 3PHCA 3PUYA 4EYOA 1ZG3A 3ZDCA 1SIWA 2IYAA 2OAGA 3ZE0B 2P75A 4E2YA 5BV7A 5CFQA 1U94A 5CB4F 3LLVA 4QBTA 4K7JA 3GGCA 3AL3A 1RRPA 3FSJX 3HMQA 4G7XA 3C2QA 4YP1A 1KRHA 1FYXA 4QXOA 4CIYA 4P4UA 4MB6A 4PXSA 4Q7QA 4II2A 3LUKA 2OK7A 5KWEA 1E79A 3TQCA 2H11A 3HP1A 1SC9A 5KO2A 2FW9A 1PS0A 2Q27A 2XA1A 1XQ9A 3C3PA 3FJ1A 4HADA 5DCUA 3MQFA 1WB4A 4TLEA 3ENWA 4D98A 2IV7A 4A8PA 3QU4A 3OECA 4GQIA 1P1CA 4IIXA 4BNDA 2NU6B 3EASA 3DE5X 1Z5GA 4TVOA 2ZSIA 3R23A 5BSHA 3KZOA 1P91A 1YBMA 3WQQA 2JFHA 3OEED 2OFPA 2O8CB 1TNDA 4UDYX 4L2IB 4ZAZA 1ZM9A 3QOYA 4NYIR 2IS6A 1IXRC 2VHCA 4Y30A 1Z45A 1YJ8A 3HPQA 3TGWA 5MN4A 5DGHA 3W2IA 2PNFA 3C3YA 3FNFA 4LWPA 1U3CA 2VPTA 4BMZA 2RGRA 1P33A 5E38A 2PZMA 4G0MA 4V03A 4CEHA 5C1OA 4DNXA 2IX9A 4FUQA 1DDGA 1XXLA 4KWCA 5LBTA 2PD6A 1CS4C 1KMNA 2O3QA 3K31A 3A7DA 3FOAA 4KZKA 1IIRA 4PTZA 5K4AA 3RM3A 1QHHB 4PXAA 4OAPA 4ID9A 4QU5A 3UMJA 4B84A 3UTCA 2G0NA 3P26A 3RHFA 5HS4A 4PHFA 3CZ9A 4IUBS 4C4PA 1AG9A 3RJMA 4CTJA 4BB5A 4BUJA 3DMGA 2YVAA 4YRNA 1O94D 3PKJA 3VR4A 3N8KA 2GTIA 3GJ0A 2YICA 3L7MA 5E6UB 1PT5A 1SUEA 1V8PA 4N39A 4I7EA 4XOUA 4CUJA 1VL8A 1OFHA 2XB4A 4G5HA 2FSVC 4OK3A 3WMEA 3KETA 1VJDA 4F5DA 4FXPA 4NENA 5HRUA 3C70A 2FSHA 4G4SP 3I05A 2YBEA 5BN5B 1K0UA 5TV2A 2G9QA 1A7AA 3AERA 2JGLA 3GPBA 1JWBB 2O20A 2YXEA 4LZLA 2PYDA 1K6XA 2W2VA 4XVRA 3RS9A 5IJ0B 5K5EA 1BCSA 4LNAA 2ATXA 5DGIA 2NM0A 2HM7A 3FWZA 3RAJA 1ID8A 2FPIB 2DFPA 4RENA 3K9HA 3E9EA 3MTQA 1R10A 5BWCA 3SC4A 5K05A 3TXYA 3QOFA 3ZXYA 2V5AA 2W2OA 1QKJA 1RIIA 4LSMA 4Z8XA 2ROQA 2K87A 4YCSA 5EJEA 4L9SA 2GF0A 3C0KA 2CL7X 1SG9A 5FCDA 5FF9A 1SQ0A 5I7VA 1LVUA 4NCAA 3VKHA 1SA0B 4NAVA 3GJZA 3JYOA 3G79A 1OX4A 2HPAA 4HYEA 4E6PA 4M1OA 3KL2A 5HUHA 1X1BA 1UBRS 1CS0A 3IHWA 4ZRNA 4MX8A 5F35A 2I2DA 1TT5A 2F17A 1Y3FE 2BBWA 3AEKA 3AW8A 4U7HA 5AO9A 3QX3A 1ABEA 2E4AA 4E70A 1FSFA 1E3MA 1TF5A 3ZU2A 4E46A 3S68A 2H4XA 1GRVA 5IJXA 3ET4A 2XYRA 3CEPB 3ND5A 1SCDA 2WJZB 4NABA 4RTPA 4S2UA 5DCYA 3TNDA 1G0NA 2BFNA 1MX5A 3IAM6 2OBTA 1HLDA 1LA2A 1YR2A 2FRXA 1SUPA 1DAPA 2GA8A 4N0DA 5BVHA 5C51B 2JLZA 1H5QA 3GJXC 4EBFA 2IC5A 2ZGVA 2WABA 4G5SA 4INPA 2GPYA 1BU8A 1UBJS 4QUAA 3UT5B 2TRSB 1YHQB 4FIZA 3WR5A 3WRXA 4B34A 1K7FB 1HM5A 3R3JA 4D3SA 1ZVQA 4CCYB 4E6EA 2PPLA 5LLSA 3ZOKA 2HEGA 4IDNA 1ADJA 1AS3A 1W1WA 1FX0B 2W6ID 4OM7A 3QRWA 4PYOA 1CYEA 4MV7A 4M2LA 2CMDA 1FYEA 3KQOA 2DPGA 2O05A 4J03A 4D4HA 3S3TA 3AF3A 5FO0A 3CPEA 1XL0A 1Z8NA 2YVUA 2G4CA 2I7CA 2OLEA 1EINA 2VJMA 4CLEA 2PWAA 1U7WA 3TCXB 1OT3A 3LYAA 2CKDA 4EFNA 4E03A 5G02A 1CQJA 3SM3A 1F9EA 3BRQA 1GV0A 4YECA 2ANCA 3MUFA 5TR9A 1O2DA 3HACA 5EIBD 1C7EA 3HUDA 2MTBA 3DO8A 3HXPA 5FLKA 4C1NA 3RH0A 4G67A 3C39A 3IEMA 3Q3AA 1P3JA 3X1MA 4XM3A 4B2YA 1FJ2A 3N7UA 1BDBA 1XU4A 2ENWA 4ZEWA 5JCXA 3LOPA 3CT6A 2CWWA 4RD0A 4IW3B 3LCCA 4CKWA 1J49A 2GLXA 3H9BA 3FI9A 4ZDJA 2FEAA 2OCBA 2OO5A 1MJFA 4BKMA 3TRIA 1XTIA 2CNWA 5J4VA 4Q3DA 3M70A 3FE2A 1D07A 1Y9AA 2UYYA 3NTUA 4KFRA 3LKBA 3N2IA 1XK7A 3LVRE 5DT2A 1D0IA 2VTKA 3C3EA 2GI4A 3LHKA 4N54A 1X1SA 3B1XA 4HEHA 1DWOA 4C7OA 1ZN7A 2VDOB 2VK2A 4TL8A 1TAGA 1E1CB 2FYTA 3TGLA 3WFJA 5LMCA 2AVDA 2BLLA 1B0PA 2C5EA 4RDJA 3OHPA 4DZZA 5HA5A 2R9VA 2FUCA 1GFWA 3QBVA 4JLWA 2L82A 3EA5A 2AUTA 3IP1A 2QMEA 2X9GA 2NYUA 3MEQA 4FHCA 4JVMA 2EW8A 2V55B 4KBGA 3OMLA 3IHTA 1H66A 4QDZA 4BMYA 5A5GA 1ZSYA 4AYTA 4QNRA 5AI0A 3GUHA 4F84A 5C8DA 3F67A 4PNZA 2AG6A 2TECE 3U7QB 1HQYE 1IY1A 2E4XA 4C2AA 2R00A 1FFHA 1QK3A 3DEAA 1WXHA 4RHEA 3EBPA 3OJEA 4IVQA 1TUBA 1C7RA 2FQXA 2X8KA 2XMQA 1X7WA 3SXUB 3GLTA 3DKRA 1JMVA 4IDHA 1GN9A 3GCZA 4JY7A 4ZMRA 1C1HA 1N5JA 1GT91 3AJ9A 1PQ4A 2FW8A 13PKA 1X1DA 2IUYA 4CETA 1Z3IX 3HCBA 2PUBA 4CKEA 8MHTA 3GRPA 4NOMA 3ICEA 4HSEA 3HTXA 1TM4E 2Y0PA 4TVKA 4FC6A 4DTCA 4GO1A 2R97A 2BMEA 5JSUA 4NENB 3AJAA 1EP1B 4JBWA 1BYUA 5DHQA 1C41A 1S3GA 3HVUA 1N0VC 1ZXXA 2ZVPX 4FHGA 4IZIA 3FXAA 1D6NA 1KOLA 4D25A 2NP7A 1ZK2A 2H31A 1J0EA 1WCIB 3AERB 2JATA 1ECBA 3B85A 2R86A 3A4YA 4BO3A 1E94E 1BCSB 3FNQA 4QQNA 1JNXX 4CLRA 4PFQA 5GJCA 4IINA 1U8YA 2W2QA 3FPAA 3LU1A 3R5TA 4XYLA 3EVAA 2AMYA 3G9XA 5FL3A 2EOAA 2FRVA 4JUBA 1J97A 5BWOA 1UUFA 2N42A 2V7EA 4DYDA 4V0SA 3QQ5A 2OFFA 4IOLA 4BFWA 5ALFA 4HDAA 1CEYA 4R8SA 2VP4A 4M87A 3BUSA 2XCQA 3ZWVA 1OX4B 1N7IA 3IVGA 4J2OA 4DLNA 2EWMA 5A4FS 2E4VA 1CS0B 5DNVA 5A4MS 4GPTA 1TT5B 4RM3A 2GK4A 3KS9A 2FJ0A 4Q47A 4UBJA 2DR0A 3FF4A 3GXBA 1UQUA 4GNKA 1BS1A 1FXSA 1RCUA 2X4DA 1Q0PA 4I1IA 4G84A 4H3HB 1B2RA 2X7XA 3QKUA 4EPYA 2RJNA 1MHTA 1QKKA 3PKZA 2D00A 1E6WA 2HQOA 2OCXA 1Q14A 1SOAA 2GEDA 1HDRA 3BX1A 4UUQA 3ZU5A 1IOVA 2C4NA 3A25A 3CN7A 3SJCA 4P93A 5C53B 4J3JA 3PIIA 2XNSA 3NC1C 5LMUB 3WLLA 2A58A 3DHYA 3GRAA 4TVBA 5BVHB 3S8EA 1ZISA 1E7YA 4BLQA 4ERNA 1JDPA 4RK0A 1I6MA 1JQJC 2GBGA 3G5AA 1UBLS 3HFRA 2CHUA 3HR7A 5D5QA 1B74A 3VO9A 2DYIA 3WGJA 1GQRA 1NVMB 4HDKA 5ABPA 1LLDA 3EQ8A 4MA5A 3OC6A 4BLVA 1P2VA 2JCBA 3T5TA 4U7GA 5LJIA 5AT1A 1GGVA 3GFTA 4DQXA 4AKSA 5KBYA 3CXRA 5HF9A 2ZBRA 3ND8A 4MRPA 4QBGB 2Z43A 1E2IA 1NN5A 5M3BA 2WE8A 2XQVA 3QLUA 3WA6A 3V4ZA 1KPGA 2XRFA 4CG2A 2OZPA 4MS3A 4QHYA 5LP6A 4FT2A 1EBFA 2RKWA 3KOZA 4ZD6A 3ZK9A 2VJMB 1X8XA 2VYFA 2YN2A 1E3TA 1ISFA 1TI7A 3R5HA 3FH0A 1EWYA 2OHOA 4YQZA 5FYQA 1BW9B 3VVLA 1E4VA 1CQJB 3CX6A 1Q1EA 4KDEA 4OB7A 4XFJA 4A82A 4CIXA 1N2BA 5WRFA 1UK6A 1RADA 3B3GA 4PRKA 4RFSA 5C81A 1XVTA 1BEUB 4ED9A 1S1MA 1RI3A 3OZIA 1Y6GA 3EAQA 4XWWA 1GG8A 2Q0HA 3DV0A 2IYXA 4YPOA 1BOFA 2H4JA 1C7IA 1K4YA 2MMGA 5FI3A 4B33A 1GSOA 2CJXA 4EVQA 5IKOA 4C7VA 5C3UA 3V2GA 4EYGA 3T5PA 1L4FA 3LT0A 4RLFA 2GPTA 1VL6A 2C98A 3NJ4A 1JQDA 5AW0A 4CKWB 5JVDF 1BGXT 2P4UA 4KYVA 4GGMX 5KSOA 3SYNA 5K45A 1XLTA 1P3DA 1C8KA 1WW3A 2FV8A 2P3OA 4MPJA 1UMCA 4KXLA 4Q5IA 3GRUA 5CLGA 2JRCA 2NTVA 3IIJA 3IA2A 4N5HX 4AZ3A 2ZSUA 3HU3A 5CVTA 2IYNA 1HF3A 2ADOA 3LYHA 3DAGA 4J0FA 2ZYWX 1RHMA 2VSNA 3T7IA 4C7OB 1FE8A 3K09A 1GILA 3OZGA 2WZCA 3PC6A 4N03A 4G0UA 1ISRA 2XPCA 5NLLA 1D2GA 5TS2A 4CF4A 2GAFA 3MT0A 5FFMA 1GTG1 4I8IA 4RMIA 3EA0A 3ZJYA 1I6LA 5J3JA 1A5AB 1B43A 4O4HB 5ALNA 2OQVA 3I56B 4BZWA 3CXCB 4QPCA 3UOAB 4F12A 3NDPA 1SBZA 4IOJA 2WQ7A 3NUQA 3W6PA 1TKCA 4RPHA 3WXMA 1JXMA 1T9BA 3ANYB 3HA2A 4LE0A 2ZT8A 4H60A 4NWIA 4EFMA 2OHVA 5GOZA 4B80A 3TUZC 4IKOA 4JCOA 4BP8A 1P4SA 2DLNA 2EFGA 4HE6A 2XOXA 1X80A 1U2GA 2DG2A 2H63A 2OV6A 4I1RA 5EAIA 4ZVPA 1H2HA 5TJHA 3W9SA 3VSCA 4B3SB 1A8QA 4CKEB 3CH5A 3EXFA 3NUZA 1GA4A 1AUPA 3RFTA 1OXBB 2JI6A 5IJWA 3D8SA 3NP7A 3K0CC 3VC1A 3GLHA 1T2VA 4DR6B 2B30A 4XONA 4EX6A 4RV4A 1I9CA 2VAWA 2EZ4A 3PEYA 2QS9A 3DDSA 5SYAA 4FGLA 3R4CA 2MSKA 2WIFA 3IMEA 1U02A 1MV5A 4LOHA 2YX1A 4HB0A 5IH3A 2RCNA 3FZEA 5SZKB 4Q9AA 5THQA 1XDZA 1YRAA 4CLRB 2IZ5A 4FKZA 3ZGOA 5HIJA 2C7VA 3NATA 1NXTA 4JJIA 4F9TA 2QRKA 3CZQA 4G81A 4M1SA 4YT4A 4G89A 2EZ9A 3N5CA 4BVHA 4E0FA 4TV8A 3K05A 1UBFA 4GXTA 1MVOA 3GJYA 1I3OA 5LWQA 1QRTA 4FKMA 2O2CA 4P7FA 5DW0A 3DFFA 1JG1A 2VEOA 1QPZA 1ZJYA 3OX3A 2BFCA 4AVZA 1NAIA 3HWRA 4E11A 3HCCA 3GWZA 4LOLA 5TT1A 2VHEA 5HBGA 2LDBA 5EIBC 4YMHA 5IJ9A 1JEAA 2AR0A 3DWFA 4D9HA 2CNKA 3O8LA 3I8XA 4E4TA 1RRVA 2WVJA 4IWXA 3TIVA 1TX4B 2OUIA 4ZN6A 1REQB 4UVHA 3WLAA 3OQIA 1P18A 4Y2GA 2JDIA 4IFBA 5EMJA 1KP3A 1OYVA 4Z7QB 3UAGA 1VJSA 3BA1A 1GYPA 1XPOA 2AE1A 1IMJA 2WV9A 1PAUA 2ZUUA 3Q5DA 3O8QA 3M8KA 4N3GA 1SULA 4HDKB 1XN1A 5JEDA 3H6GA 4R5MA 4L7VA 3DWEX 3WP0A 1ICIA 3JQ9C 2VPZA 1KJIA 5ALQA 1L4LA 4RLSA 3WWYA 1PGOA 4BX2A 2J3LA 1KE1A 4E7PA 2AW3A 1UZMA 3JYNA 3R7WB 3OQMA 2QLJA 1LQTA 1PJRA 4BU0A 5I8WA 5EEGA 3UHAA 1LQ2A 4PLPA 1X7DA 5AVQA 1G2QA 1V7CA 5E7MA 4Q01A 3ZWKA 1QGUA 1TZJA 1U28C 3TQFA 1TLLA 2QZSA 4MS3B 1K7XB 1GNPA 1L5KA 1SKQA 2WU1A 4AMYA 5GIOE 2O8NA 1YCDA 3JQAA 1C4WA 4PRZA 5DF1A 3L02A 1A95A 4RJKA 2M6KA 3EPLA 4L78A 2PMKA 4YRAA 4BRSA 2PAAA 3ZI0A 3GLUA 4JXJA 1V16A 4NCKA 4PYQA 5ETJA 2AZXA 3A3PA 2YC2C 4RFSB 3VR2D 3CWCA 3OTQA 1IJFA 1FDOA 1O6CA 3DV0B 2YTZA 1VKJA 5AUQA 3AGQA 1U04A 4AICA 4P0QB 2NZUG 3KIPA 1EVJA 3JQ8A 4J75A 1RRCA 4O63O 3O92A 2C29D 2DFLA 4MVJE 1D7AA 3KUDA 1NF2A 4RDHA 2FDRA 1SVSA 1IJEA 4DANA 1C4KA 1EXDA 1CULC 3ETGA 3E7XA 3QELB 4YH1A 2D0PB 4L07A 4WD3A 3NX4A 4EFLA 2YJ5A 1C9MA 1UMCB 4OTZA 4CM7A 1V11A 5F3DA 3MIZA 5ITZB 5CD1A 3I0ZA 4P1ZA 4AZ3B 4ZVUA 3H6HA 3MWFA 3QU2A 4V38A 3UAOA 3SQWA 2ZSEA 2EJUA 2FZCA 1S01A 2G1PA 3OIWA 2O8FA 1DCMA 4IVRA 1GNLA 5TQ2A 2Z9DA 4EELA 2EJBA 2WU3A 4MYUA 1P1HA 2PKQP 3D6NB 1GQFA 1UJ4A 1XZNA 2P11A 2WHPA 3EUAA 3TL2A 3BC1A 3HLTA 3V6MA 1SOVA 4LVOA 4BV9A 3T53B 1T15A 2BLNA 2WEKA 3DOFA 3D7MA 5FKJA 5M04A 2QGFA 4RNCA 2NTEA 5K8JB 4MK4A 1P0IA 1FDSA 1VM6A 1YCFA 2NWQA 3M6IA 3IUJA 2QTRA 3O4VA 3DDUA 1UCFA 5ILGA 3RVPA 3SKVA 5A1JA 1VMEA 1T5OA 2YIVX 4K40A 3AIIA 2V74B 5LQCA 2QVYX 3O26A 2VJOA 1G7CA 2W6OA 3Q87B 3F9CA 1CR2A 3QUAA 4BWGA 4UKDA 1NVEA 4DABA 1GYRA 5I5EA 4KU4A 4EUHA 1QYIA 4R8MA 5GTDA 1RJEA 2LNDA 1X80B 1R0KA 3HBMA 3PNMA 4GPD1 3A36A 3P9PA 5H1YA 1M10A 5IW8A 3SYKA 1HL3A 1MO4A 5D8DA 1PX0A 4EW6A 3V55A 3QEBZ 5FEMA 1D04A 1DV1A 4G0QA 1UBSB 3B6MA 3MXOA 3IURA 3ULKA 2EEPA 2EERA 3GLHB 2OGTA 1I3MA 1DKLA 1M8KA 2LWIA 4JJFA 4MJ7A 4F8YA 5K0SA 2NO7A 3H1BA 3IMGA 1A4IA 1KU6A 4MUEA 2O8CA 1FUIA 3I23A 1NJID 2G67A 1MT0A 3R0ZA 4NYMQ 5G4LA 4BVKA 1CUBA 3JV7A 4KKUA 2GM3A 3DGFC 3ESDA 4YRRA 3RS5A 3HVHA 4G09A 4HX5A 3IUSA 4NAUA 2I1WA 3USCS 4BATA 1JEEA 2JAPA 1PYGA 4M0DA 2QQEA 2SHKA 2WUWE 1H94A 4G41A 4GPEA 3VU8A 1NRXA 5KYGA 1KXJA 1KAEA 4TMFA 4TV8B 5ELLA 3OJWA 4AULA 5JZOA 2WVGA 5CNMA 1Z7BA 2QU7A 1WQ4A 2QTCA 2X9LA 4KX5A 1COWA 1J70A 5KPJA 4BCBA 1WM1A 2JKVA 3MCUA 4G9BA 1PTJA 1PNVA 2XW6A 4MVXA 1VQ7B 1OAOA 3SIWA 2IHVA 1KYWA 3MAJA 4G56A 4DA4A 1AQJA 3UJ6A 3SPXA 2FX3A 1BROA 3OJLA 4RAQA 5C80A 4HI0E 5HW0A 5IJ9B 4NCBA 3IQDB 4K9DA 4FDLA 3BRSA 2JLCA 5CXUA 3UCFA 4ESVA 4QQRA 4I6EA 2V3WA 4CL0A 1DO0A 1U1CA 2VHUA 4I5FA 3CE6A 1BVRA 1UDCA 2IIVA 2HUPA 3OQIB 1DAHA 4WZBA 4D8UA 1DXQA 4A1OA 4YAKA 5B58T 2FMFA 2WYOA 5AKXA 3CSDA 3VDXA 3DPUA 3X3HA 2W2XA 3GA5A 1AY0A 1T29A 2OILA 5EKUA 4D3YA 4LWQA 3DWIA 4QG3A 4QBFA 1NN1A 4KWHA 1Z74A 1H1TA 2OHGA 2XQKA 3K6RA 4I3FA 4MS1B 4WFJA 4YRBA 1MOPA 5AVVA 4TYYA 3S4YA 2Y68A 3B1JA 3SS8A 3PP8A 5TMPA 2NSHA 1ADCA 5G2OA 1J0BA 4CNBA 3E3OA 4DMMA 5B55A 1VGVA 4F56A 4BFYA 1EE9A 1F14A 2WUGA 3GCGA 3RSGA 4F5YA 2M1ZA 4F5ZA 2MJLA 5MF6A 1QGUB 3UICA 1V6CA 3WLJA 4CZ2A 1SH7A 4HK4A 1NURA 3JQAB 3K92A 4X85A 4YP0A 5L95A 1NJ6A 3OG9A 2XCSB 1AKMA 5ALSA 1K6EA 2J46A 1ETUA 3DUFA 5KWIA 1DPGA 1JSLA 1RI2A 3RG2A 4PZZA 3ZYCA 4BS9A 1V16B 1XZPA 1WQ1R 3I58A 2P4HX 3IDQA 1D1NA 4GOMD 1D4ZA 3P52A 4LYJA 1FFCA 3SFVA 5JNVA 5DM70 3G2NA 5BNZA 1XTBA 4ZPJA 2F4NA 1Z16A 3CC7B 3VPDA 4ZOBA 5KYYA 3HP4A 1Z63A 221PA 3IPYA 3N5KA 2IHNA 3ENNA 2WM9B 4E2ZA 1DC3A 4WY5A 1R0CA 2IYVA 3KQSA 5DI9A 3AZQA 3DXXA 3K5WA 3LLUA 5AW8A 2V9PA 3EVBA 4HO1X 4R41A 4C29A 1TFRA 1WW2A 1L9KA 1P2TA 2JS7A 5KYNA 1UOOA 5TSDA 1GUBA 3SYRA 5KU7A 2H54A 1V11B 2P1RA 2VXYA 5ITWA 1JEJA 3AY6A 3HL4A 3W5HA 3TSAA 3WB2A 2ZDHA 3BTUA 4ZK6A 3U39A 4MR8A 3VC2A 2XUJA 2ZRJA 4QICA 2GZ3A 2YUTA 3K9NA 4M6WB 3STVA 4TTJA 7MHTA 1WVGA 2O8FB 2CLDX 4QL3A 1XEXA 2NXEA 4CG3A 1TYBE 4HAWA 4DA6A 2G9RA 1U3VA 5ALDA 4DFDA 4DUPA 5FBKA 1P31A 3BDAA 5EI5A 1OCEA 2ZTHA 5ALMA 3QNMA 3SSOA 5FDFA 1G1AA 1CUCA 3HHPA 4ZOLA 2C2MA 5CHEA 3UFBA 2NV2B 3PEUA 4AQ7A 1R0SA 3R7DA 2I33A 1JHYA 1JN0A 5IH7A 1RMYA 3A31A 3L7BA 2J9FA 5JMOA 2HU8A 1L7NA 3EDOA 3CLVA 2CV2A 3CW9A 5HCUA 3QJ5A 4Y7DA 5TDHA 2BEKA 3F71A 1ONBA 4MPPA 1J06A 1JGTA 1ZAKA 3O4HA 2H1FA 2WKPA 3BD8A 4IF6A 4FW8A 1R37A 2GPJA 2FSVA 2GZMA 3X43A 1R27A 2D1YA 1XD2A 1ELOA 5B4UA 1ZX1A 3WYFA 1YDGA 4MV0A 1JTVA 1NUQA 4FCTA 2RCYA 1JALA 5K3SA 1EVEA 2NXWA 5ISMA 2HC9A 3FOBA 5CVEA 1VHJA 1VIVA 3GZJA 3UB4A 4XB2A 1CUSA 1YWGO 3T0IA 3U1BA 1R6TA 2O57A 4GE3A 2Q29A 1E5LA 3R6JA 1JF8A 2VF7A 3P32A 2MOKA 5BSXA 4XWTA 5AKKA 5CGQB 5DTRA 1RZRD 3PBKA 2GJRA 2CL5A 2ZIFA 3DBHB 3JAWA 1OFUX 1L5NA 2OXIA 2WYUA 1RXSA 1ACLA 3D7RA 3LP6A 4D4MA 2DKOA 3H86A 4KYUA 3WZLA 5A2QA 4PYMA 3KAKA 1Q5PA 1MB0A 1DVRA 1HGXA 1R4ZA 2H3EA 2XWPA 3CS3A 1NXOA 3OUZA 5FQOA 3DL4A 1YU6A 2GK7A 4MQ4A 1P5ZB 3U3ZA 2W6QA 1HT3A 2A86A 1UC9A 2X86A 3F90A 4QUJA 2XBMA 3MN1A 3U48A 4IJUA 3IDSA 1E1QD 2ONZA 3IESA 3M5DA 2EFYA 3RS3A 4GW3A 3N8DA 3EFBA 1FUUA 4MGZR 2WR8A 5TMDA 5DGDA 5KIAA 1F17A 1E3EA 3M6FA 3NRBA 1KAHA 3FLEA 4OXKA 1BOOA 4JT9A 5IDWA 1FLNA 1XRNA 2XCOA 4IR7A 4FOTA 5AW4A 1VKHA 1EQAA 3T94A 3T54A 2P9HA 3HM2A 4KAJA 4LKRA 3HZZA 3U37A 3ZHUA 3TD2A 9MHTA 1B8VA 2A94A 4JWTA 5CNJA 3PA8A 4IBOA 2X0DA 4C22A 4FGWA 2C9DA 4E5VA 5I7UA 3NHYA 2IIQA 4J1SA 4WZBB 3UJPA 1XHFA 4E7OA 1GZVA 1PT8A 3OLWA 2IZ6A 3UWDA 3SR4A 5F7XA 1OW3B 2AS0A 3VZPA 4AS1A 4XLHA 2Z3VA 2G1AA 2O0JA 3CSSA 4U2GA 3NEYA 1JJVA 1I36A 4W6QA 4DV5B 1YBAA 1YQTA 4BDTA 2JHPA 1HG0A 2VZLA 1HNNA 1YQGA 2DCUA 2ZI5A 3GGDA 5DSTA 4WXRA 5JZVA 2R79A 4XUCA 4DTIA 2XT0A 3PD7A 1O95A 1N57A 1U2SA 1YDHA 2BUCA 3SZUA 1ZHFA 4NU6A 1ZN8A 2M1XA 1BG6A 4LY3A 1KETA 4TPKA 5GOTA 3O47A 1LBIA 2PMBA 5DXJA 2QG9A 3M7IA 4C43A 3OAAA 3F46A 3PZRA 5FHRA 1XZJA 1PD0A 4H7JA 1ZMBA 3ZWNA 4B5LA 1SN7A 3S2EA 2ZZMA 2FF5A 3EWAA 2NUAA 1U1DA 3IPXA 3KVRA 3FYHA 1P2BA 3NGXA 5A3VA 3W8NA 3MRTA 5JXIA 2ENUA 3UMGA 2B8JA 2C0CA 3FDZA 1K1EA 2UYGA 1M8GA 1VG1A 2WYIA 3HXLA 3PDHA 5KYYB 2ACEA 3KWFA 3RPEA 4ANFA 4ZVTA 2YW9A 4DE5A 4P12A 1M1KD 1T2EA 3N2KA 3M3PA 4YWJA 3VAAA 3O3OB 4WZKA 1XRQA 1XNJA 3LQ4A 4HLCA 3FTDA 4PANA 4XVQA 5REQA 1N2ZA 3D5QA 1K6IA 3A37A 4Q9KA 3QWFA 1UPUA 5CM2Z 4B3IA 4ZJYA 1U7DA 1C3OB 3Q72A 1YS7A 3T3GA 1AJEA 1UJ6A 3PUVA 1Z6TA 3FETA 1ADGA 1NOJA 2NIPA 4RO0A 1YUBA 2OC4A 4MR8B 3TPZA 3I6BA 2YHUA 4QASA 4G5QA 1PR0A 2ZPUA 4NVRA 1GCUA 1XEXB 1VQ5B 4J0IA 1GIAA 1HDCA 4D57A 3BGDA 3DVRX 3ZX5A 1KTVA 3KL9A 3G2LA 3TLCA 2PIAA 3BVPA 1DU4A 1GR0A 4ZOLB 4C4ZA 4P54A 1W87A 2GZDA 2QXYA 3D6TB 5EIOA 5HZKA 4LF8B 2XOKD 3D8NA 2J9FB 2ZBGA 1QIJA 1OIVA 3LC7O 4RHFA 3A4NA 1FTWA 1YULA 3ZCSA 4JI5B 3O4JA 4RIGA 4WXYB 2PQ6A 2J7PA 4J29A 1DINA 1VIDA 2BE7A 1VHWA 2I2XB 4FFLA 4HH0A 4CMIA 1EK2A 4L5IA 5JMPA 1HRKA 1Y7PA 4IIJF 5IVPA 4FWTA 1QGZA 1KZGB 2CMGA 1ISMA 4KO3S 4MB2A 4YRGA 1GSAA 3ME5A 3PHIA 4MUIA 4FFBA 2L69A 3AR7A 3FTNA 1W29A 4DSUA 1KO4A 3DP9A 2JFQA 4IJ5A 1MB3A 3Q3VA 3SQDA 3MMSA 5AK0A 1DJQA 1JECA 1UFVA 2P8JA 3R6DA 1XQ1A 1Z5UA 1X94A 2OY0A 2ZE8A 4XM2A 2VXBA 3SIPA 5AJUA 2FUG1 3NTLA 3ZD7A 3HLKA 1Z38A 3B8HA 1QIHA 4GNRA 4BNFA 2D59A 2C7QA 2QQGA 2C61A 4MYDA 2NU7A 3DW3X 1NBIA 4R1OA 5ECDA 1MJNA 1AKNA 1CY8A 2NXCA 4X54A 5JS8A 1AH2A 5J4HA 6GPBA 1UZLA 3ANXA 3JAWB 3QE9Y 5HF5A 2JI8A 3HCEA 2ZT6A 1Z4JA 3TZHA 3O94A 1WE2A 1YDMA 3PWTA 2BDEA 3GJ3A 4ZCRA 3BXHA 2HQRA 3EN0A 4DWVA 1RAFA 3H2BA 3O95A 2GTHA 4G4SO 4X1OA 2AJ8A 1IG0A 5AUPB 1XZ8A 5A4KA 3OJOA 1Y6JA 4JC8A 2OZEA 3E3AA 4OSOA 4UCFA 1T2AA 3EOZA 1N6LA 3QI2A 3NHBA 4DLWA 3DHNA 3C45A 1SUIA 3SJZA 4HH1A 1KH2A 3IUYA 5BQXA 4KQIA 3H8VA 3UJBA 3TMKA 3U7IA 4GPIB 3ZHRA 1SQ6A 2VDQB 4QPPA 5K99A 2EBHX 3RFVA 2QF7A 5I3ZA 5LDDC 3LQ1A 3HB7A 1P61B 3OX4A 1KK0A 2EYQA 5LZ5A 2FUKA 1A04A 2XEDA 5L6LB 1XZFA 5EGSA 3LGXA 4PZ0A 4ZGQB 2PJDA 2WP8J 3D3KA 2WM3A 4FUTA 2W2NA 3E0QA 2FVGA 1SKMA 4CM4A 2OLKA 1X14A 3GAAA 1Y5MA 4AY5A 1E58A 2X0EA 3B1ZA 1QRRA 3L06A 1QHSA 5CB4A 2UVDA 2W58A 5D2CA 2HK6A 1ECLA 1LPPA 5IXSA 2D1RA 1QJCA 1J4AA 3KPJA 1LD3A 2GESA 4NICA 3Q7PA 4WLOA 4XCVA 4CYMA 4EGAA 4Z7NB 3C3KA 2C1EA 2JGNA 2O1XA 1PGJA 3IVMA 4LC9A 4Q4DA 4R69A 4EA8A 3OEEA 1GZ7A 1C2YA 1P45A 2JFOA 5JAPA 1AMUA 4L4RA 1JFVA 3A6EA 4X06A 1DQPA 2CDAA 4LW8A 3R3UA 2Q2WA 3QPCA 4UEKA 2ZS8A 4IIFA 4F3KA 5JPCA 2V1UA 4YBZA 4MW0A 4PFKA 4US0R 2R48A 3DMFA 4W9MC 2CBXA 2Q07A 3D1JA 1OYYA 4PZAA 2R8PA 5JPIA 3DTNA 1PV1A 5AFSA 3PJDA 4BKOA 1TF7A 1JL3A 1L3IA 1FB5A 2GJSA 1UBGA 4R6XA 1S5PA 4QUZA 3LRTA 3MJFA 4H7FA 4OYLA 3THYB 4FYHA 2QP3A 2BTEA 3TVTA 5A4AA 4UE3S 2C03A 3ZI4A 3FDZB 1PR1A 1QH8B 4KQ9A 3HSKA 3LVFO 5E6RB 1Y8CA 2TMYA 1Z68A 5C8VA 1QYXA 4Q4JB 2QX9A 3ES9A 3V8QA 2WJ3A 1WY5A 2O1WA 4GOND 1C30A 4WZAE 1E2FA 5BV8A 5F7OA 1JKFA 3AVVA 2G9VA 2RIRA 3PHJA 3VU9A 2GT1A 3N2KB 5CA1F 2GVZC 4RPDA 1K86A 1AKWA 3NAQA 3NALA 2XE4A 4CM1A 1OX6A 2QZ4A 5J23A 1G7SA 3OOEA 2QL5A 2HMYB 2IU3A 3H4IA 5LD2B 2XXAB 3OSUA 4G1MB 3TBKA 1CUUA 4HGZA 2QVZX 4B3BA 2I71A 3HHEA 2ZVJA 1R8JA 3GCDA 4I66A 4JX9A 3TIFA 4COOA 1SU7A 4PSAA 3CJRA 3UAVA 3ZEAA 3IP3A 1DKOA 1GTMA 1OQAA 3UXHA 4MVYA 3SKYA 1XTPA 1JHDA 1YZTA 2H1HA 2ST1A 3MS7A 4JLKA 3OWOA 3P94A 3DFIA 4XD7D 3TLKA 2C1ZA 4HGRA 1C0LA 1E2DA 1YMUA 1FBNA 4XSHA 4BYGA 1VJRA 1AQNA 1H93A 2MWMA 4U6NA 2HMTA 4G0YA 2JANA 1UBHS 2NZXA 4MR9A 4AUMA 2IY9A 1M1NB 4NU5A 4BB0A 4FBLA 4JP1A 1XJ5A 3UV3A 5M2QA 4ES6A 2WHRA 3IXQA 3S8MA 1ZZEA 2ID9A 5FI1B 1ZL0A 2VKTA 4G0XA 5DTIA 1EFTA 1TZKA 3PC8C 1HZJA 5ICFA 2Z6VA 2VT7A 4C5AA 4CMIB 3BS4A 4HS9A 4A15A 4TYMA 5KTMA 3K0CA 4G1FA 5IWAB 3FIUA 4E94A 4FFBB 1Q16A 1ESDA 2IP4A 2ZKIA 3LUHA 4J0GA 4C2UA 2XTJA 4OXIA 4KO1S 3BICA 1ZH8A 3ODGA 3DZKA 3V7YA 2AKEA 3EXG1 4JOCA 5AJWA 4B3MB 1FU7A 3OZTA 4ZVSA 1V25A 3EH1A 3VV3A 2NU7B 4AL4A 2W6IA 3TLZA 1C0EA 2YN4A 2NT4A 4JDUA 3WIVA 4OA8A 5LQDA 1A5SB 2FCRA 3C14C 3N76A 2FPOA 3HUUA 4C4SA 3L01A 1N36B 4FK8A 3WK8A 4JR0A 3ASQA 2D1TA 3CWZA 4NI5A 2Y1OA 4OQPA 3N1UA 3UUGA 4GR4A 2G36A 1UBEA 3H97A 2APJA 1YJAA 3L7AA 4YVFA 4DILA 5ULLA 3GYBA 2C2HA 3VDNB 2R6ZA 1UPAA 1YB7A 2A5FA 3FJOA 1VBFA 1EHYA 1Y1TA 2D13A 2I4MA 4U9HS 5CAEA 2HHHB 3PGLA 1L4KA 1RHRA 2FX5A 4M0PA 3JALA 5LA6F 3AKEA 4ZCTA 1L8OA 2CSUA 3DG9A 4LEIA 1Y1LA 2D4HA 4AJLA 1WB9A 1GLNA 3NNNA 3NC4A 5IBCA 4Y1FA 4YJFB 1YJ5A 4NESA 4NXMB 2DWOA 1P2DA 3OQVA 4MW6A 3QP9A 1VXOA 5FWYB 2FN9A 4WOKA 4ALIA 1XAHA 5SICE 1WUJS 1MXFA 4MZXA 4YAGA 2NMVA 1V9CA 1W88A 3FSEA 3L8ZA 1XWFA 2IEIA 1QWOA 4CM4B 2WJVA 5ALTA 2XMDA 4R0NA 2Y0DA 4BNKA 3C3DA 2Y0EA 5E1DA 4JEHA 4EUKA 3EE6A 5CB4B 1OC2A 1GQQA 3A1FA 4C7MA 1J0CA 1K7YA 3JQ9A 3SE7A 2V45A 4QLBA 3KLMX 5LXTA 4F45A 1QVAA 1JHMA 3AYZB 3E05A 2C4UA 3I09A 4WERA 4DXAA 4B3RB 3ROTA 2GQFA 4QXQA 4QHSA 3QNWA 3WL7A 3RUFA 4BFUA 4X65B 2PMFA 1JJBA 2DB3A 2HNBA 3Q40A 3DOJA 3PXAA 4U02A 3WGTA 3UK0A 1BXRA 3NOQA 3AB3A 3LUGA 4IV5A 1I18A 3OM1A 1UBTS 4RNDB 2I6FA 3WV4A 1GAWA 1NV9A 3CKKA 4DIUA 3ZWQA 3KHUA 1DWPA 4A6XA 1NVVQ 4OXNA 4A0RA 3MLAA 4TT3D 3C8MA 3TZBA 4FFPA 4WCFC 2OYSA 2YWEA 3P0FA 1JILA 3WNCA 1DIHA 1GL6A 4JUAA 8AT1A 4OX9Y 2OR3A 1JEYB 2VJAA 5E95A 1VQ9B 3QFCA 2AA3A 1LEHA 2SNIE 3RIXA 1TLFA 4DCSA 5LQRA 1Q21A 2C96A 5JTUA 2CHQA 4RTJA 3MXTA 5HPYB 3FCUB 5FA6A 1VQ4B 1DZIA 4QXAA 2VBVA 3SEAA 1XGKA 4NZYA 2FY8A 6LDHA 2DHDA 4AY2A 3K0KA 2Q4BA 3KU1A 5AIBA 1H42A 1T5BA 1V43A 4B6EA 4RANA 4OMFG 2W70A 3R9KA 1YS2X 4G26A 2RHLA 1Y6ZA 4B2IA 1LLUA 4ZYUA 4KAXA 1V9SA 2CF6A 5F4JA 2CVFA 5C9ZA 4I9HA 2FSSA 3BXXA 2ZJ4A 3AR9A 1NUHA 2ZFUA 4P33A 1Y1RA 4K9LA 4DL9A 5EHZA 4JJZA 4ZAFA 2MHCA 1G5TA 1CUJA 1ZC4A 4PVCA 1L7QA 5F52A 4IAOA 3T4UA 2IZ0A 1EGHA 4XQFA 3U6KA 1IM8A 1G16A 1U0EA 2XIQA 3W5IA 1CDDA 2BT4A 3WB0A 1T9ZA 3X1ZA 1XA3A 2G7MC 1XMOB 3AB7A 3H17A 1BFUA 2BSQA 3H83A 3U7HB 4BRWA 3EGOA 1PR6A 4GH5A 4JJEA 4E5DA 5FPHA 4BC0A 3PB3A 2EFHB 5IF9A 4O3MA 2F4VB 5AH0A 1NM5C 4PQYA 4D9MA 1DG1G 1WHTA 2ZANA 1IM5A 3FRIA 3MERA 3NYRA 3SP1A 4EHJA 2GK3A 3VH2A 4MR9B 1I1NA 2XNKA 1X1TA 3T6KA 3UXMA 2A6PA 1PYDA 3PDIA 1S02A 1XDSA 2XB6A 4C0JA 4KGDA 1PGPA 1L1FA 3RT9A 3PGMA 2OVFA 5KTKA 3W5UA 1WF6A 5IFKA 3BJEA 2IA5A 2Y1WA 3ZX4A 5JANA 2E5LB 2J5BA 3UVEA 4RA6A 2PX8A 1Q83A 1Z4LA 2WWFA 1RQLA 5LLTA 3ZTWA 2GXUA 3GJ5A 2AEJA 4KDFA 4BTVA 3RUHA 4X6YA 4TM7A 3NIGB 3ONVA 3M9LA 1K7EB 3F9RA 1UBNA 4G4GA 4GEGA 4F3YA 5HUQA 1KPIA 1ODCA 2VDLB 3MMXA 1MQ9A 4EJ6A 1R0YA 2MCFA 3FMVA 5U9CA 1G8KA 3I8OA 1GZ6A 4E12A 3WLSA 1U81A 2P9FA 1JEDA 5T5QA 4AG5A 1YRWA 4EI8A 1HURA 5BUQA 5HHTA 5LZ9A 4GG1A 1QQ5A 1GA6A 5B1YA 1WDWB 2X22A 1SPBS 2XDWA 3G8YA 3MOGA 4K87A 4KJXA 5FJIA 1QCCA 1PWZA 4GD3Q 1JS1X 2O06A 3OQJA 2YZKA 4I1OA 3UYLA 3E03A 4GYKA 4X0EA 1WLYA 1V5VA 3ZY4A 3ND6A 4F4HA 5K0EA 3SVTA 3KOWA 1VE6A 2NACA 4HZGA 4RGQA 1WXQA 2PCJA 3PNKA 3E8MA 4ZO6A 1TCUA 3C8HA 1KFCB 3NZEA 1Y8RA 1U1EA 2JGFA 2VDPB 4MS4A 1OILA 5AVYA 3QPWA 2RHJA 3V48A 1KWGA 1GDTA 1FDWA 1M67A 1NP6A 4F92B 1NASA 3MMPA 4RTNA 3FTCA 2CK3D 1UJNA 3W06A 4BP1A 4JL6A 2GILA 3JALB 4HN2A 2V6FA 2QRPA 4MWTA 2A4KA 4R8LA 3L9XA 3VBEA 4AJIA 3MD0A 1PLLA 3O7WA 2HRDA 3RKSA 3M1IA 1O5IA 3QXXA 1PNQA 4IOMA 1AV7A 5CJPA 1HE3A 1Q0TA 4IJQA 2PJZA 4ADSG 3BK7A 4DM4A 2MYNA 5A03A 3HFJA 1TYAE 3LJKA 3MPOA 4L0CA 5AJYA 1ZAYA 4N41A 3BFVA 3CZCA 1MNQA 3LUPA 1W88B 4HDCA 4L5JA 3U4QA 4NG4A 1N2EA 3L8YA 5BSUA 1WP4A 4TOIA 3IIMA 3KKKA 1M2VA 2Q1YA 3R44A 1J8MF 2BKAA 2VG8A 4R05A 5GONF 5KREA 1GGFA 1L7OA 2Y2VA 4C0WA 1BDIA 4ZJUA 2CYBA 5B6JA 4J49A 1BA3A 5JHGB 2QR2A 2LTAA 4HL6A 4XM0A 3BWMA 1ZGCA 2VQ3A 3H9QA 4YJ2B 4GSLA 1A72A 5JXHA 1R6AA 4KFSA 2IY7A 4PO1A 1BXRB 1ZM4A 4UCQA 1CUZA 1CUDA 1WD5A 1NULA 4QFCA 5EJFA 3L4KA 4NK4A 1VLVA 1L3BA 4J6FA 2IYLD 1OB0A 5JDCC 1XQXA 1CF9A 1P2GA 3HC7A 4TKZA 1YIDA 3HXKA 4HHEA 5FI0B 4RM0A 1UFQA 5AHRA 4HZUA 1FU8A 2VRWA 2PA0A 3KZ1E 2IEYA 4YREA 5J40A 1S4MA 4ACAA 2J5RA 1GN8A 2GERA 4ON9A 2AXQA 3DVSX 4WKOA 2GRAA 2QM0A 3MWDB 2AFHE 4B6FA 3B8EA 3NHUA 4DRZA 4E32A 1QPBA 5K0GA 2AN3A 3OO1A 2VUUA 3QXCA 4WBXC 5DVZA 5IYZF 5C4MA 4PO8A 5CFPA 3UA3A 1N5OX 1IZZA 1OX5A 3FRHA 1BX3A 3BSSA 4GVLA 4R1PA 1B76A 1WZCA 4YFYA 3BZBA 1QHIA 1UP7A 3Q2OA 3DVAA 2QJOA 5IPFA 1CK4A 2O2ZA 1LGYA 2GMWA 3DMNA 3O82A 3OPMA 1SZPA 3OW2B 4TZTA 4W7IA 4GZ6A 2BY4A 3VPBA 3AI7A 3ILYA 3WP1B 2QM3A 4X3OA 5FD8A 3ZV4A 3OP1A 3N75A 1DBSA 3AHGA 4RF2A 4W1SA 2DBQA 2LCIA 2PEYA 2CLEB 3ZKAA 3AVPA 5IASA 2WFMA 5FLYA 1UXKA 1U2EA 3DPIA 5AHOA 2R751 3P9NA 1KQSB 2GPBA 4IPTA 2Q7DA 1OPRA 2P9EA 3IP6A 3LWNA 4N0PA 3VSDA 3LSYA 2XT9A 4M76B 2QUAA 4OI0A 1RQNA 2WUFA 4PHTA 3C1OA 4TGLA 2H7XA 1CEXA 3TX2A 1ISIA 3V2IA 4BJ5A 4GKVA 4OB8A 4JVOA 3ZBUA 2QDXA 1D2RA 2B9EA 4LGCA 1CQPA 4J43A 3E22A 1OB2A 4XDHA 1WHTB 2JFXA 3RIEA 4COKA 1XX6A 2HSGA 2W4IA 2WIBA 3RSFA 4E2WA 3S8YA 4RMHA 5GJVC 1T2NA 2PKQO 5AKGA 1RCFA 1ZJ5A 3IAM1 1OGIA 2EKDA 1II8A 3FPCA 4J8PA 2FEWB 5CM8B 4F0JA 3QBTA 5D6OA 3K7EA 1ZUHA 4ZYWA 3LO8A 1QP4A 2CSXA 1SB8A 4KH1A 1FSPA 1JHZA 4Z99A 4M1TA 3JQGB 4CR7A 1WSBA 3SSNA 5CDHA 3ZLBA 4BHTA 1Q7YD 3QJGA 1IN5A 1T0UA 3TKYA 2EQ5A 3D0KA 3X1JA 4Z5XA 2BFEA 2QG6A 2Q8NA 3F6YA 2NUTB 3O3MB 1DC8A 1YXMA 2V1XA 2W5UA 2ZIGA 3CH6A 1NMSA 3G0OA 3HN7A 3W9UA 1M1YB 3FR8A 3EVFA 1KI4A 4L4XA 5I7FA 1TCVA 4AJ2A 4O8CA 3L0BA 3L79A 3WOVA 4F4CA 1R4AA 4QV2A 3MT7A 1FDVA 5IK2D 4TXNA 1E61A 3IAEA 5DHUA 3IV7A 3L5OA 2E4UA 4WVFA 4DMKA 3WHPA 3A14A 4NYJQ 1WV1A 2Q5OA 1YS1X 4KO8A 5HOEA 4CM8A 5B5SA 4KYIB 1FQWA 1ZD3A 4UHFA 1G5QA 4RHXA 4WA8A 3TOZA 4LHSA 3C87A 1QCYA 3N2LA 2Z3WA 4Q4HB 5AIAA 4A73A 2R1VA 3ASUA 4BNUA 4TWAA 3ZWYA 1T6NA 5CA0F 3OI7A 1FVXA 4X7DA 5JV5A 1OA1A 2NU8A 3ZS8A 1E3DA 1FW6A 3PQFA 3JU4A 4H77A 4TMTA 3BGVA 3GDGA 4G5OA 3A1WA 1SR8A 1Y8RB 3I30X 1CQWA 4MS4B 2REQB 3QLJA 4MVCA 5EC8A 1AE1A 3VYTB 1M34B 5IZCC 2GM4A 1HE2A 2VP9A 4G3XA 1EP9A 1MJ5A 5EKDA 2AZTA 3VR2A 5A4IS 3DA8A 3L0SA 4LC0A 1NLMA 3T5GA 2V9ZA 4CODB 4N6GA 1QQ6A 1VLZA 4BX3A 1X7HA 4FONA 1H2BA 4X84A 5F3WB 1ZUIA 2D8AA 1DDOA 2WWXA 4ILKA 3V9AA 3KLPX 3RC7A 4F6LA 4YELA 2OHJA 1QGYA 4MMXB 3RU9A 4A2WA 4WCVA 4AS2A 4WXHA 5FBLB 1GZ5A 4EG6A 4NLLA 3AIOA 4Q66C 1E9VA 1M2VB 1NTRA 2K7FA 3IQXA 1D3AA 2R6CA 4G01B 3U6BA 5D1NA 1S4QA 4AIRA 4EW3A 3HRHA 5JVDB 5KCZA 4RK5A 2ZTVA 4EMTA 2X8WA 1RPTA 3N2ZB 4N18A 4QHTA 4HN9A 3WDLA 4GYYA 3HS3A 1PVOA 4XTRA 4CQJA 3GEGA 3VKGA 2IYZA 4CW7A 5E3IA 5JNUA 2GCPA 5FX2A 4Z9FA 4JMPA 3RJ9A 4NK5A 3KWMA 5L7TA 4R51A 3WJ1A 1BFKA 1CB0A 4YP9A 4URXR 1U0SY 4LNHA 3UUEA 1E2JA 1JMYA 2BFFA 4H3KB 4R2WA 2B4TO 1T25A 1ZH2A 1W1IA 3FYTA 3EGCA 4Y98A 3TYXA 4HYQA 2FFHA 2FW7A 4BMOB 5KNDH 1K6JA 1EUYA 3GPIA 4HZUB 4WK6A 1WPXA 4PPNA 2GF2A 4MYTA 3ZPNA 3EDYA 4M46A 5HIMA 2D06A 4TLAA 3ZK8A 3NT5A 1L7EA 5H4GA 3FB4A 4H7EA 3LT5A 3FZGA 1IOZA 4XXHA 3SCZA 4BJ1A 1CEEA 3K0SA 1TMYA 1NB9A 2IQ5A 2PUWA 3IQHX 3M2TA 5CM9C 4XWAA 1M83A 4YT5A 5BP7A 1VBMA 4UZFA 1W93A 5L45A 1H0SA 4UBNA 5JS1A 3PUKA 2QB5A 3QG5A 5FOXA 1M1YE 1XA4A 1YOVA 4Y2JA 1P2UA 5H4HA 4B6OA 4CR8A 4QE3A 1E5TA 1R6UA 4EA7A 1GNQA 2H2GA 2C5SA 3DVAB 1YO6A 5IMBA 3HVIA 1GZDA 1U7XA 2PX5A 4AF6A 5B64A 5EFZA 3E84A 2X8AA 2WKWA 5AK4A 4CL3A 5A4JA 1M8JA 1E8MA 1IN6A 4NOKA 3C24A 3RUPA 4M8KA 1OIWA 1ORHA 2II6A 2E37A 1XRSB 3BJIC 4CF3A 1XTVA 2IW1A 4ZA2A 2IJGX 4GZLA 5GM1A 3WL6A 3AZPA 3S2GA 4HF7A 5JIBA 2OG2A 2X1LA 4XUGB 3M1LA 4XR4A 1EVQA 2WP0A 3PXDA 3ZW7A 4A3SA 3HK2A 1V8BA 1KYZA 3WLFA 2A9QA 5FWDA 4DRXA 2ZAMA 1Y7TA 5A02A 4L02A 1Z5VA 2F3UA 3AIMA 1TEVA 3C7CB 3LLMA 5FO1A 1M34E 2DUUA 2PKEA 4LGVA 2V4DA 1SMKA 2QIPA 4JNKA 2Q9UA 3E22B 3IDOA 3NNSA 1SCNE 1SWVA 4K46A 4HNRA 4A8JC 1RWXA 2EHJA 4QUIA 2PUDA 3CUUA 2Q2NA 3NG1A 4PYLA 4AWXA 4C05A 3T3DA 3DV9A 3NT2A 4GZ3A 4KRXA 4X90A 3ND7A 2PL5A 4ZZ1A 5LKAA 4EI7A 3UH0A 3WQRA 1D1PA 1KSJA 3LPCA 4OYRA 4X8OA 3HFGA 1JIIA 2XDAA 4PAQA 2CLIB 4DDHA 2JB9A 3W79A 2VAXA 3CFYA 3AVYA 3WC4A 2AX3A 4LTNA 2BFEB 4QOFA 2IOFK 3TLMA 2XNCA 3WYCA 1E2PA 3E7WA 4X6XA 4TWIA 3VKVA 1EVKA 2A59A 3WYNA 1GV1A 4CT0A 2O0HA 4UTOA 2EJCA 2NGRA 3LNCA 4KX3A 4L9WA 3UATA 4L85A 4E33A 2IGBA 5A2GA 4PR3A 2EJVA 4EJ0A 2E48A 4CGYA 5KNDD 3IVCA 3CRMA 3J7AC 1KYXA 2HZBA 2ZWVA 1UF9A 4QPDA 3WYEA 3QEJA 1EZ1A 3A1VA 4IRMA 5JWRA 3GD5A 1LK5A 2YY7A 3KWJA 4CM8B 5KAMA 2ETVA 4H08A 3ZW8A 3KQYA 2XVMA 4Z4VA 4EFDA 2H4WA 1DCFA 1G5PA 3ZQ4A 2CF4A 3ZXUB 1FTNA 4EEZA 4CBVA 4MWBA 4W4TA 3OE7D 5DX0A 4MHTA 3I62A 4D8YA 2WJ4A 4FLMA 1VLOA 3GT7A 1D4AA 3OTHA 3DFMA 2B1GA 3DE1X 5KW9A 2P35A 3F3MA 3R6WA 4TRJA 2PSHA 3ZGLA 1QBKC 2OBNA 5ADHA 3WMRA 3LUFA 4EVIA 3CCJB 4NYMR 4Q1EA 4A6PA 1DGQA 5AKZA 2I0FA 4GOOD 1DLIA 4F3TA 3BY2A 1IVYA 2P9JA 4DREA 2VNSA 2P67A 1E92A 2I4RA 2XQFA 4Q7JB 4QRHA 5EZQA 2R7KA 2FETA 2GPAA 4Z4TA 1L6IA 3RWBA 4ALMA 3H2HA 4K6CA 4L50A 4D45A 2HF7A 3IO3A 4P3XA 4KB5A 3HPRA 1K63A 1B0UA 4DCMA 4RA9A 4BZZA 4HGNA 2ZZKA 4FYKA 3RRJA 4JP8A 4YJGA 5ERYA 4EATA 5A6SA 1XB2A 1YR9A 3A6KA 3EZ6A 4BO9A 2ZYVX 3UBTA 4EJSC 4LJ6A 3GT3A 1TFUA 1GHTA 2FJUA 2HBQA 1T9AA 2QX7A 1ZITA 3C8DA 1SRQA 2GWHA 3KJXA 3SX0A 1LPAB 3DLAA 3ORSA 1NUTA 1X9GA 3C74A 4XYBA 2QN6A 1VDZA 5KQMA 1AZSC 4V0NA 3FHJA 3UQZA 2VPYA 4CI9A 1TQ2A 4PW0A 4PAMA 4TTIA 1JFFA 1CP2A 4L76A 1GJRA 2ORYA 2HWKA 1AU9A 2A1TS 3C8UA 3VXKA 4CF5A 2CNNA 4DY6A 2ATIA 2ZRMA 5G0VA 5C5EA 3A04A 2PXAA 2X14A 5E1MA 2FEOA 2OYNA 3OA0A 5EWLB 1GPMA 4PCVA 2B6NA 2BFPA 1IZYA 3SLRA 1CY7A 3DNPA 5KNBH 1AOXA 1MC4A 1WX1A 1ONPA 4HRVA 5J9FA 1HO3A 6ADHA 2UAGA 2OD9A 4XEHA 1O57A 4PFJA 5IZ4A 4TMVA 4KFCA 1EXMA 3WA7A 1ZXBA 5EIFA 3WGMA 3F96A 3GEEA 4UHHA 4EG0A 2H1LA 2XD4A 2Q5FA 4MW5A 3K6SA 3CLHA 3JCZA 5D87A 4BVJA 1LK0A 4PU0A 4CRWB 4HNSA 4C7KA 2W11A 1KR5A 2DFVA 3LH5A 3ZZ1A 4FFWA 4K1LA 2ZVDA 2O6LA 4M1QA 1YOVB 1RZRA 4TKUA 2ZTGA 2KVOA 4RADA 3UXEA 3WS7A 1EHCA 2YV5A 3M6LA 4RJJA 3HDGA 5CLHA 1XPUA 3AFNA 3OICA 1R6XA 2N9UA 1A9YA 4OXYA 4PLCA 1EKXA 1WUTA 2FAXA 4EO4A 3CXUA 3LT1A 4KE7A 3T12A 3IBFA 2YVKA 3RYFA 4O5OA 3TVDA 5K0LA 3MGGA 4BWYA 3DZJA 3MJRA 3NBMA 3P0JA 3T1VA 3RANA 4MLDA 4FQ7A 1JR2A 3P4YA 1PNTA 4KL8S 5UKDA 4LXGA 1J7KA 2C4MA 3GRKA 1E1QA 4FGUA 4MCAA 4NOJA 3CINA 2QTZA 5I48A 4GWGA 3SX2A 3KL4A 1HLGA 4R68A 2IIBA 3UC9A 4U7JA 1WOOA 2IL1A 2VI5A 3HJBA 3NTRA 3IUPA 3PPVA 4MQ6A 3WGNA 1RNLA 1Y42X 2BR3A 3PC8A 2X3UA 4DPMA 4GVXA 4ZMSA 1YBVA 3D6JA 2RI1A 4E2XA 2WKQA 1MH9A 4PN7A 2XWQA 3BCDA 3EF1A 2QMUA 4B3GA 4UAGA 2WTMA 3LBNA 4TZKA 1ISHA 2J3DA 2OCPA 4Q1AA 4FDAA 4Y0NA 4DA7A 1RYDA 5LYJA 7MDHA 1LDGA 2J32A 1H2YA 4ZARA 1WF3A 4PVDA 2EAUA 2HIHA 2AMJA 3M49A 4ZTZB 3RS2A 3GNLA 2CEKA 3L49A 5IBQA 5JADA 4PRYA 2GPSA 5AD1A 4MO2A 4B0PA 3K2QA 5F5NA 4BRUA 4C87A 4K9NA 2G0AA 4TRRA 4UM7A 5ICEA 3OCVA 2NTYC 1HSZA 3JARA 1JU3A 4RHUA 4OBBA 1I32A 2ZDGA 4HTFA 4DWJA 1ZH0A 1FIUA 1PEYA 1XG5A 2WOOA 1PFKA 4XM1A 3Q7IA 3H99A 1P8JA 2C84A 3L82B 3BWXA 3TG8A 1CVRA 1N6RA 1U8AA 5KNBD 3KSDO 2FA9A 2R8EA 3GRVA 1D7OA 1N5DA 1QOPB 3LQYA 5A6VA 3AR8A 4BN4A 3G9TA 4KV7A 4Y1GA 1L5RA 5B3LA 4N65A 4PZLA 3WK4A 4R9VA 2R62A 3VTZA 3JQRA 4EIWA 4GIBA 4Y1EA 1A5TA 2DECA 3RY8A 1Z0UA 2XGSA 4Y2RA 5BSWA 5IF3A 3V33A 4XQ9A 3FNHA 5CU7A 4FB5A 4AT1A 3QE4A 1VG0B 3WGZA 1CRLA 4N7BA 1NVAA 1AD2A 4Q6WA 3OA2A 2IYYA 3IT0A 3D31A 1SUWA 3WGLA 5IYNA 1A27A 1B42A 2E18A 3VMMA 3OFSA 4ALLA 3KFVA 4HWOA 4PQGA 3SHWA 3CIOA 1ZCAA 1FMLA 3TR0A 1R16A 3R9IA 4LV6A 5FUWA 5I9IA 4EKIA 3LFUA 3HJFA 2OPHA 3RHSA 4D9KA 2ZI3A 3O1HB 4IFTA 1YZQA 2C5GA 1VKNA 3A7EA 3BREA 3VZDA 1H2RS 1NQVA 2C04A 1A71A 5KQSA 5THXA 1V0FA 4NBSA 3WK7A 1J24A 5JXWA 1Z88A 3BILA 4OKSA 4RA9B 5AK5A 3V32A 2I99A 4K88A 4UULA 4Y6QA 2WLTA 3GQBA 3LXMA 4YJGB 5A6SB 4B3HA 3MWGA 4OH7A 3IAS6 3GAZA 3ZDFA 2A2ZA 1N7GA 2IBMA 2J07A 1E2LA 3NBKA 1AUQA 2IOQA 2W6PA 2ZU0C 4MARA 4PYIA 3ZHQA 1PWEA 4URZR 3THSA 2MIIA 2QLBA 4W1RA 3DEKA 3A9RA 3QUCA 4CQMA 2Q6VA 1Y9EA 1K73D 3CO0S 4Z4WA 4RVCA 4WCFA 1W8IA 5BUZA 4B44A 3V8NA 3NYIA 5E6SB 5SZHB 4DGSA 4MUAA 1NPYA 2HDHA 1AGYA 2MT9A 3MYRA 3WYDA 4R2IA 5FOSA 1PJ7A 4HLNA 1QIGA 1A9OA 3WK5A 1W34A 4W8HA 1YVEI 1VE7A 2WD8A 4HY3A 1XEAA 2DKNA 2R65A 4YRTA 3JRWA 4RTKA 1EUCB 1YVRA 4J07A 1QQAA 3KJQA 4ER0A 1BU5A 2ZIZA 4J0CA 5C8YF 2WZNA 1MB9A 2XTNA 1YTLA 3Q1KA 4W8OA 2HWUA 4XWOA 4UNQA 3BMXA 2CXRA 4H0CA 1USKA 4G0WA 1P29A 2GRUA 3IMCA 5T8KC 4Q03A 2DE0X 1QHFA 4Q1VA 2CF5A 3R6TA 1FYDA 5KHLB 5AP9A 1GPBA 3HKEA 1JIVA 2ZXUA 4G8BA 3UJ9A 1HRDA 1XLWA 3IBTA 2HQ1A 4IIJA 2ZPTX 2IXGA 4FEGA 4TKUB 4QJ3A 4CIDA 4M99A 1M73E 5SY9A 3RWOA 4KE6A 1G38A 1X1RA 3BL8A 2O0KA 3S7TA 1CQIA 1OLOA 3CEJA 1VE5A 3K0EA 3MAGA 4KIGA 1RW4A 5C0OE 3HJCA 4JLUA 2C99A 2JBAA 4QUBA 5MDHA 1SQFA 1YHYA 4YAOA 4FB4A 4GM1A 2BGIA 5GQSA 1QLJA 3H5TA 4FNMA 5FTMA 3A05A 1UXOA 1O6GA 1DQRA 4KNYA 4HNUA 3KJZA 4Y1RA 1II0A 3NO4A 1WCWA 4XL9A 3TQQA 3ZD8A 3HB4X 5F4OA 1T0BA 1ZHOA 1BH2A 4CQMB 4DPKA 4IIBA 5ICMA 3V4VB 4CFYA 4AJ4A 1IHYA 3KKEA 4PCLA 4LOAA 2V7BA 3QLTA 1C0KA 3K30A 1HFWA 5AKJA 3N53A 2H9YA 5FWAA 3VNSA 3WLQA 4MRSA 4OJQA 2GNAA 3DHVA 3UK7A 4AJHA 1PHPA 4FJ1A 1Y37A 1YAHA 5L51A 4KR0A 4MPRA 2V0NA 1NXSA 2HL6A 2B6HA 4JEUA 2I76A 2RHGB 3RJ5A 4YY3B 2VNAA 2BR4A 2NAFA 5FULA 1GSHA 3OVMA 4M49A 4JI2B 1UANA 5G0SA 3QE2A 3KZKA 5HKBA 1AQUA 1GQOA 2GFIA 3A8IA 1VBKA 3FCOA 3I39X 3IVXA 4E5UA 1GPNA 5A5EA 2ZG6A 5AM4A 5AVJA 2TMGA 3EUWA 5H81A 1N5KA 2IKSA 4ER7A 2ZB7A 3BH6A 2LD4A 4WNYA 1I4LD 2YWXA 1IATA 1ESZA 2PMCA 2OMEA 1RBQA 1W4CA 3ADOA 4HTFB 2Z5LA 1CJMA 2I2AA 4EB0A 3CH7A 4RZ2A 2GXAA 5F9FA