4AFAA

Crystal structure of subtype-switched epithelial adhesin 1 to 2 a domain (epa1to2a) from candida glabrata in complex with glycerol
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
227
structure length
227
Chain Sequence
SKDPTTFPLGCSPDITTPKKGLSMELYSYDFRKKGSYPCWDAAYLDPNYPRTGYKSHRLLAKVDGVTGNINFYYHATKGCTPQLGHLPASYNYPKPLTMTNFTMLLYGYFRPKVTGFHTFTISADDLLFVNFGAGNAFDCCRRDSSADHFGNYQAYAIWGSKTAKDELTVHLDAGVYYPIRLFYNNRDNNGALSFTFKTESNENTVSDFSEYFFSLDDTEEGCPGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Promiscuity and Specificity During Candida Glabrata Invasion of Host Epithelia.
pubmed doi rcsb
source organism Candida glabrata
molecule tags Cell adhesion
molecule keywords EPA1P
total genus 60
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10528 GLEYA GLEYA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4afaA00
2XJQA 4AFCA 4AI0A 2XJSA 4CP1A 4AI1A 4AHZA 2XJVA 4ASLA 4COWA 5A3LA 4COUA 4A3XA 2XJPA 4COVA 4AFBA 2XJTA 4GQ7A 2XJRA 4AI3A 4LHKA 4AHWA 4AFAA 4AHXA 4AI2A 2XJUA 4LHNA 4LHLA 4CP0A 4AHYA 5A3MA 4AF9A 4CP2A 4D3WA 4COZA 4COYA
chains in the Genus database with same CATH superfamily
3VDAA 3S5AA 2HEVF 5T52A 4B1LA 1BBT3 2VUDA 2AGSA 1POV3 2FCTA 2P6HA 5J36A 1PMHX 3LIGA 3UETA 2V4VA 3KT4A 4JCKA 3OSDA 4FAGA 1NZCA 3O1MA 1IPKA 1GNHA 3PUHA 1S0CA 2HWD3 3M3QA 1OF4A 1GQPA 5CFCB 4FOQA 1GZ9A 4HOOA 1O8PA 1TVGA 4ES9A 1LHNA 5FO8B 2ETEA 1OC1A 4XOGA 1UOJA 2WZR1 1IG0A 1VAMA 3ZN5A 1VAVA 2XQXA 4HANA 2A6XA 4F3JA 3AP6A 4Y22A 1QKQA 2BJSA 3E6DA 1UPIA 1W9SA 5EXOA 4UXAA 3IIIA 3R4UA 5LA2A 2D97A 5H9RA 2P6CA 3RWKX 3R4SA 3ZKUA 5FPVA 1RVF2 1ENRA 4HVRA 1S2KA 1QU0A 4N7IA 1TME3 4KQ7A 4CUCA 3DEMA 4LITA 2LRPA 5LA0A 4XJUA 2W95A 5A7WA 2GNDA 4KL1A 1NCQC 4XZUG 1UMHA 2OW4A 1SLAA 2EF6A 3H7YA 4PDWB 1DZQA 3DPRA 3URFA 1Y9MA 2B8MA 4OQ9A 2VNGA 4JGZA 5F3GA 1Q8QA 3HVDA 5A7NA 4HK8A 3MW3A 4CDXB 5FZAA 3VBRC 4HKOA 3FHIB 4QDRA 1AR82 3LEMA 1SCSA 1HRI2 3WF0A 4M00A 2BRTA 2PA7A 4YNIA 5CBLA 4NRMA 5FUPA 2GNMA 2Y6GA 3ES4A 2UY8A 3SLIA 3ST7A 5A3OA 2DBNA 2JG8B 4FPFA 3U75A 2WDBA 3D4KA 1YLLA 1OPMA 1CZTA 1PX3A 1U5YA 4XHXA 3BOWA 2Y33A 2WFF1 2Q5TA 1YQ8A 1W2UA 2A3WA 5FWEA 3V0AA 2VMIA 1O4YA 4QX5A 2L9LA 4UFLA 4C0HA 4EN8B 2ZJCA 1AYM2 1DHKB 1OFSA 3CBNA 3NKGA 1B35A 3VZNA 1JOJA 2PHFA 5I0TA 4P9LA 3MF6A 1RMU2 2ZXQA 4XDOA 4AOCA 4HKWA 4I0AA 3WF1A 1FNZA 1XJAA 3HN1A 1VBD1 1ZBA3 2JICA 1GZTA 3DUIA 3JCIA 3EO6A 4LQRA 1VBB3 4QXHA 4FBFA 1O3SA 1W8HA 1PGW1 2R6QA 5B2GB 2G9GA 2YMZA 4TWTA 3J4UH 4UAPA 5JDBA 4A3XA 3AZXA 5BNOC 4RS5C 3NJXA 1X36A 2V09A 3AK0A 1R1A2 2JG9C 2D6LX 3ZX7A 4H2AA 2QTWB 1W28A 4LBJA 3NJYA 1MQTC 4QX1A 4AFAA 2FDKA 4HVOA 4XQDA 5J98B 3LD8A 3T2OA 4AVSA 4PQQA 1MACA 3VLBB 3IN9A 2D6PA 3AZYA 5LBFA 3K77A 1POQA 2D6OX 4GH4C 3WX5A 4BU2A 3VBOA 2A6YA 4XXPA 5FYSA 2XBO3 3B9CA 4IEWA 4JRAA 1V70A 2ZPXA 3VBOC 4MGSA 4GB33 3VDDB 1C8M2 4RR3B 1SEFA 1F2NA 2HWE1 2AR6A 2P3JA 4XDQA 1XQNA 2HWB1 1QEXA 4KGGA 3F2ZA 1HRV1 2JB4A 1H1AA 5JOXA 1MEC3 4RHV2 1LRHA 4CUAA 2W1WA 2FDHA 5LK7B 4NROA 1O4TA 4NHLA 4AE2A 1PGSA 4P5HA 2P37A 1L3JA 4LHKA 5E16A 5LY1A 3TEWA 5LZ6A 1KFXL 5A1FA 5BV6A 4NHXA 3SKVA 4JDOA 2VZOA 3HEIA 2JDHA 2EIDA 3C7FA 3DYPA 3LA3A 3KCCA 3Q8BA 3IDBB 3CZUA 1LESA 1V6MA 2XVLA 3OBZA 2OPWA 2N7GA 2VCMA 3KCYA 4KH9A 3ZN4A 5KXBA 3H1YA 4NRPA 4FP3A 1LOFC 2K46A 4MGQA 3WW2A 4F8AA 3LWCA 5C6CA 3I3MA 4PIZA 5IJRA 2SLIA 1WCKA 2DTWA 4FPLA 5GLZA 1D4M3 4ZY9A 4BXSV 4QDQA 2ADEA 3BTXA 1JOPA 3ME2A 3WNMA 1SLBA 3KGLA 3MI8A 4QPYA 1HX6A 1HV0A 5F3EA 4AHWA 1YC61 5ACA2 4LK7A 4NIIA 5BY5A 2JDZA 1TEIA 5LBCA 2BUKA 1MZFA 2V5DA 5IFTA 1K12A 1GP4A 4IE6A 3TWIA 2ZACA 4RHV1 1ENQA 1LNSA 4JKLA 3OPWA 1DIWA 3UNPA 5IW0A 4Y1VA 3O1OA 1X9TA 2XLAA 3ZYPA 3QH6A 4UW6A 2XKOA 2HWE2 1C8M1 3GCWA 1W8ZA 1KS5A 2E7AA 3JZVA 3FUOA 1WCSA 3OBRA 5BNNB 5F1RA 3BOPA 3OYWA 2VJXA 2IXCA 3LB9A 1FNYA 4PCRA 4UFMA 5IK5A 1RHI1 3CIHA 1CAXB 4H3WA 3SITA 5AFBA 4INDA 1EYBA 2PHTA 4UOJA 2IFRA 3BB6A 1HRV2 4FI9A 3E6BA 4KGQA 4XBQA 1YNAA 4PF5A 1K5MB 1Y9QA 1GWKA 1D2QA 3PJYA 5K0UA 3HOBA 4XXAA 5FQ0B 5A3NA 4L97A 2X05A 1OOPC 4Z8BA 2NYYA 5JXJA 1PGW2 2UY9A 1OLMA 2XBO2 3MIGA 3Q8CA 4PDWA 5LK5A 4N8MA 3ZFEA 3X29B 2X53S 2OT7A 4FPGA 3AXDA 2RJLA 1VBD2 2IC1A 3C7GA 1PO12 2QDRA 5E1RA 2VTFA 1QMJA 1UWWA 1O8SA 2VZ3A 2GZWA 4ZS2A 3PUQA 4GJYA 2JECA 4V2VA 5GLUA 2RR13 1H8TB 1XE0A 3KSCA 2XXZA 1N1SA 4IUGA 5AVAA 2WFF2 3UKTA 3AP7A 4FTSA 1NUKA 4MXVA 5A1LA 2RS12 2RE9A 5A32B 5FZGA 2XJSA 4D6SA 4QB2A 1QWRA 1QIQA 1QOTA 2IXLA 4IEVA 1O4ZA 5DUXA 4Q0PA 3B02A 4FFIA 1K5JA 2R073 1CONA 1RMU1 2XUEA 1PM4A 2WN3A 3QH7A 1OA4A 4CCCA 3KQRA 2W39A 1HRI1 3TNPB 4CDXA 1MVQA 1AR81 1GOHA 2ZCWA 1BXHA 4LUMA 4TZDA 5F37A 5IVCA 4GALA 1UY3A 1IZ3A 1QXRA 5DQ0A 3ZXLA 2D43A 1W0OA 5FK7A 3OYWB 3VD4A 2BTVC 1KXGA 2ZGPA 1LOFA 2Z2SB 1J1TA 2GC2A 1D4VB 1Q3EA 3VBFC 2HBTA 4QHBA 1ZRCA 4QQOA 4M4RA 1OLQA 2VY0A 4KU7A 3VBRA 1JUIA 1LGCA 1YHFA 2OQ7A 4AFDA 3WVJA 4BQ5A 4QKFA 5FYYA 4ZXEA 1PVC2 1BKZA 4LA3A 4E8CA 5KC5A 1IPJA 1QGLA 2VULA 1J3RA 4JGYC 5IAVA 5CAZA 1U0AA 2FMYA 2WZR2 1G86A 2JDNA 3MV11 2VNVA 4HONA 3MIFA 4Q29A 4YZ4A 1S1AA 1YI7A 2GN7A 2E26A 4LHLA 4IE4A 2DV9A 4LIVA 3HQUA 4M3CB 1B35C 1GICA 3WDYA 3NNFA 2PLV1 3A22A 1A78A 4XJAA 1RJ7A 5JSOA 1G9CA 3AMNA 2WO1A 2WC2A 3ENRA 5F3IA 4LE3A 5EHDA 4AI1A 2J1RA 5KHJA 3AVSA 1R082 4HSLA 5A6YA 1UCXA 4AEJA 5F8PA 3JD71 1UNBA 3WQ1A 2C5DA 1OLRA 3PTRB 4K6BA 1AZDA 2MEV3 4ATEA 4RS5A 4Y4YA 1PHMA 2VM9A 5CEHA 1E5IA 4LBQA 3CJIC 1BLZA 3KLSA 4MYEA 5FPZA 1KDMA 2CYFA 2Q30A 2RHPA 2XVKA 4A7KA 5A6XA 5EPAA 4P9IA 1X8EA 2OA2A 3VZJA 4JTNA 1RUF3 2EA7A 3PVEA 1LULA 3D0JA 2BNMA 1NAEA 4W6WA 5BUVA 1IS3A 3IMMA 4YW3A 3VBSC 4XFIA 4YM0A 3RGBA 4BYYA 1QNYA 1OURA 5J96B 1NLSA 5FZ7A 1UYXA 1XNDA 5CKQA 1SMVA 3H9AA 3I2HA 3J8F1 2FBEA 3FUQA 3H0OA 2VMEA 2A1XA 5FO9B 5ANQA 3U4XA 2WAAA 5JZGB 4YVSA 3LPGA 1C1LA 3VDCA 5KWRA 1OUSA 2ZGNA 5H9PA 1HRV3 5I0UA 1RUD3 3BTYA 1YFYA 1DGWX 2XWJB 3BN6A 5FZBA 4B4RA 4IE0A 1LCLA 5FXWA 5K9YA 4Q4Y2 5FZIA 2QQLA 1U5IA 2BVVA 5FY1A 1BVP1 1UZVA 2Y6KA 5EYYA 1RUE2 3N3HA 1XYOA 2QQUA 2R071 5KXEA 3W21A 3EQEA 4MX3A 4IERA 5FO7B 3EYPA 5FKBA 4BLIA 1V9U3 1DBNA 1CVNA 2G9FA 1QDCA 2JKBA 2QKDA 4KU8A 4WVMB 2Q0AA 3EXUA 5LBBA 4QHOA 3A0NA 1LEMA 2YC2A 2YU1A 3DKWA 4ONUA 4Q0SA 3K75B 4XF9A 3VBFA 5B4NA 4NHKA 2ZEWA 2X5IB 4LBLA 3OGVA 4R9CA 4CEYB 4DUWA 1AL21 5D8AA 4C8DA 1UL9A 1DZTA 4B7EA 1NLQA 3USUB 2TNFA 4NR1A 1IS6A 5EYXA 5FZCA 3MIBA 2W9XA 2JWPA 3GCXA 4YG3A 3ORJA 5BNPA 3KVBA 2RS13 4ASLA 3MW4A 4XABA 2J1VA 1FOD1 1ULPA 2DUOA 1ULDA 2X8KA 3HNYM 4MXWA 3NAPB 3WT3A 2PYTA 4RQPA 1VALA 1AYN3 1UYYA 1Y43B 2ZABA 4WBBA 5DXDA 1KGYA 3RMXA 2Q8CA 5A3TA 3DKQA 1QNWA 3LE0A 2XG3A 2NPIA 1ULEA 1KRIA 5CKNA 5IYYA 2UWCA 3KQ4B 2RMU2 4Y26A 1JYTA 1AYN2 4IV1B 1BZWA 3W59A 3FJSA 4DNYA 3KT7A 1RUI2 2WA3A 3H3ZA 5JAXA 1UY1A 3GGLA 2AACA 3ZFEB 1SBDA 3JBG2 5DDJ2 2TBVA 1NE4A 3I59B 4IEOA 4AI9A 1XU1A 2PHLA 2IZWA 3WEZA 1J3PA 4P14A 4AGVA 4Z1VA 5C4WC 4XPVA 1RUJ2 4CVUA 2A6VA 2Q4SA 3JBG3 2OXBA 4M0HA 5DDJ3 3BU7A 3SEPA 5C9AB 4N7UA 2KD7A 4IEZA 3TEYA 2DF7A 4Q4W3 3VBHC 5F9TA 3PDQA 5IWFA 1ENSA 1SBEA 4IGOA 5IFPA 1EAH3 5TSWA 1QJU1 1ZBE2 3CNAA 3PVOA 4XFAA 5IT6A 1SLTA 1S0DA 4CDUB 1E5HA 1Q8PA 2EXJA 1Z0HA 4YWAA 1W6NA 3RI8A 4CP0A 2IXKA 2VQ0A 1DYKA 2AREA 1VBE1 3WOGA 4KWLA 4KI5M 5FP9A 2CL2A 5I8SA 4YRDA 1RUG3 2C26A 3W20A 3BPSA 3TBDA 5A6QA 1KJRA 1W2NA 2WLPA 4HETA 4YM1A 3NAPA 1JODA 1RUD2 4N53C 2CDOA 2B39A 2K9ZA 4QPIC 4YW6A 5FLIA 3U1XA 1G7YA 1UD1A 5HXMA 2WJSA 4HN0A 5AC93 5LW9A 3I3QA 3N4MA 3DECA 2WA4A 5IVJA 5C8CA 1EV12 5A1AA 4XTMA 1UYZA 2MPFA 3VUOA 5T50A 1CPMA 2Q1ZB 5JXGA 1I5PA 1PIV3 1RUC1 4UFKA 2DBIA 5GKAC 1NCRC 2WQ8A 1UKRA 3HWJA 3VD3A 1UZWA 4QAWA 5EIYB 3RZHA 1ASJ3 4XAAA 3SH4A 4XQWA 5CNAA 5JR2A 4YVWB 4KG0A 1N3PA 4IV1A 1W9WA 2RS31 4B7KA 1EAH1 2LS6A 2RG4A 4N43C 3FLRA 4COWA 2XHNA 3E5UA 5L7OC 5C3QA 1W3XA 2VQUA 4O9GA 4BIOA 4DQAA 5L7OA 1JTZX 3ELNA 1AR71 4Y5SA 3T08A 4Q8KA 4ES8A 5EFUA 1QXJA 1RUE3 2D6KA 2W47A 2JJ6A 3RZMA 1R091 1H1MA 5DAWA 3ZDVA 2ZBJA 4NWVA 4G3YC 1HQNA 1ND3B 2YBSA 2NN8A 1SLLA 5GZEA 3VZKA 2ZX2A 1KQRA 4OI0A 5C7GA 4Y1UA 1DCSA 3L9JT 4FXKB 3POWA 2ZEXA 4YVSB 4D69A 1QOOA 3CEWA 1AHSA 2ATFA 2YYOA 3BTAA 2HWD2 2RMU3 1JI6A 4XBLA 3ABZA 1I6XA 1BEV1 1T6GC 5KR7A 2C0ZA 4GB32 4MLOA 4YG0A 4QKNA 5JLVA 1MS8A 1X82A 4JVAA 4P5YA 4K7JA 4UI9L 2WYSA 4XBNA 1SPPB 4K9SA 1PK6C 1NQDA 4B4QA 2GMMA 1DQ0A 1IGOA 4LOSA 1QJFA 4CDWB 3MUY1 1HQWA 4CU6A 3N7LA 3ECQA 1W9YA 4AZZA 1POV1 1YJLA 3WNKA 3O14A 3U4SA 4GWMA 3WNXA 4GD4A 3OY8A 5E89A 1WWYA 1BEV2 3LZZA 1FI2A 3PNAA 1UPSA 4XC9A 2HWD1 3WLUA 2E31A 2EXHA 4AGGA 1JZ8A 4GMP1 2IFWA 4LKDA 2JIGA 1SZBA 3J7LA 4OI2A 5FREA 1X8MA 4BLJA 3UESA 4A4AA 1ZBA2 4WVWA 2QFEA 3ILRA 1IOAA 4D7YA 3GJBA 5DG1A 2VVDA 5L73A 1DYOA 4NHYA 4A41A 1CX1A 3D5OA 3F95A 2WNVC 2ZX1A 3VBSB 1WLDA 2XL7A 3G6JB 4GWIA 4XMIA 1US3A 4QT6A 3TN91 1PMIA 2VGDA 4LHNA 2A5ZA 2VZTA 2B45X 2RVAA 1EAH2 4YVSC 4OUSA 2RS32 2OIIA 3OTFA 1UXZA 1F4HA 5E8AA 1WBLA 3U14A 4A3ZA 3ON7A 3WDXA 3E97A 4IEXA 4FXGB 4YW4A 3ZDSA 1SFPA 2CGOA 2J22A 1RUH3 1G6NA 2JIJA 3ACHA 2VW2A 1C5IA 2J1TA 1BHGA 2VOXA 5DAPA 4Y1XA 3UGHA 2XJRA 3P6BA 4L2NA 3WG4A 3P3PA 5DAQA 3N9NA 4NWWA 4CCDA 3BI3A 3KD4A 3H8RA 1FOD3 4LPLA 4IE7A 4MGKE 3POSA 5FZFA 4KBZA 3WNPA 4CTEA 3KF3A 3ZSEA 2EICA 3O1SA 4XYXA 1YFXA 3I3BA 1I1EA 4IETA 4BISA 1V9U1 1ACCA 2WO2A 2V4AA 5FZ1A 1U5ZA 3POJA 4BQ2A 2GU9A 1K45A 4FTBA 2RDNA 2EAAA 2UWBA 1G9DA 1D0GA 3POBA 3DV8A 4QMAA 3SNMA 2DVAA 4JKKA 1LR5A 4BK5A 3H8OA 3J7MA 3B3QE 1ZBE1 3ZKYA 3ATGA 3MICA 1S0EA 4CUBA 1IPSA 2Z42A 2BDRA 4ZONA 2C1FA 4X8PA 2CDPA 4N53B 2P5BA 3WCSA 3BPZA 2ORZA 1TMF1 1FYUA 1S0BA 4HT1T 5SV5A 1NCRA 3POYA 1RIRA 1JZ4A 1UY4A 1RUI3 4JRLA 5IK8A 3B5LB 2A75A 3ZYBA 5LY2A 1AR61 2C9KA 4LKEA 1RUH1 4XUPA 3TEXA 4K1ZA 1UIJA 2VL4A 1DU3D 4QGMA 3N9OA 4K3UA 5C33A 2VQTA 2W0XA 1RITA 3AMQA 3K2OA 2GNBA 4A2UA 5APAA 4BQXA 2JDYA 4XMAA 5D21A 4QPIA 1TE1B 1ZREA 3ZIXA 4Q4W2 1TME1 3ZPYA 3LGRA 4NIGA 4J1XA 2YUEA 2D3PA 2W91A 3NNLA 4YPJA 3FHAA 4ZPIA 4Q0VA 5FZOA 1BMV2 5FYMA 5C4WB 3MO4A 1GZCA 2PAMA 2RJ2A 2P34A 2ZGRA 1VBC2 3J7NA 1VBB2 3N35A 1WD3A 1QJX2 3NRUA 3CJIA 3NJZA 4XUTA 1OD5A 1A3KA 3AKSA 3E5QA 3N9QA 4BE3A 1W8FA 1JN2P 2XJQA 1H8TA 3HMYA 3RYRA 1OSGA 4JHTA 1WMXA 2OVUA 3RDIA 3VZMA 3ZR6A 4OI4A 1WCQA 4XFGA 3O1VA 2AENA 1UN1A 4Y24A 3IM0A 1DDLA 1VRBA 3PU3A 1QOSA 2W08A 1TG7A 1VRH3 2RM21 3FLPA 5FY7A 1J83A 3AKTA 4CPBD 1DGRN 2VTXA 3NAPC 3BCWA 3WSOA 2FQPA 3VL8A 3OPZA 1OOPB 5ACA3 3GALA 4AEMA 4I0WB 4YFWA 2OQ6A 1E57A 2E33A 1D4M1 5L9VA 4CEYA 2B46X 2W92A 2ZMLA 3BU0A 4QPWA 1HB2A 2BOIA 2HWC1 1F35A 2OUHA 3KV6A 3WP3A 2Y6HA 5A32A 5JOYA 2G19A 1QH7A 3JU9A 3MFAA 2CV6A 1VBA1 1WW4A 2BNNA 1US2A 2XDVA 5JPMB 1XOYA 2ZEZA 3FWEA 4LO4B 2QQJA 3O1RA 5IVVA 1MR5A 2LW8A 3CKHA 3J8F3 4ASMB 1J1LA 3KWVA 4P9GA 3FE5A 4H55A 3SMHA 3THDA 4AVVA 5SV8A 1V6NA 1UY0A 3U78A 1YIFA 4DRVA 4WVZA 4HN1A 1HJGA 3SH3A 2CGPA 3RG0A 1QJX3 4Q2FA 3H7JA 1IQAA 2AEZA 4CYDA 3PUSA 3O12A 1OF3A 5KHIA 3T09A 3JB8A 1L7LA 3B9IA 1OQ1A 5ANNA 4YYOA 3HQXA 4COUA 4CXYA 3O1UA 3RYKA 2C9AA 4R52A 1LOAA 5C5UA 1RJ8A 3VZLA 1NA1B 2IVJA 4PF1A 2ID4A 3RVHA 3EBRA 2W68A 5CG8A 3WF3A 2RM23 2DCYA 3AB0A 4P9JA 1FATA 1TQ5A 4AQ2A 4AVTA 1WBFA 2XLGA 5F3CA 2D98A 4CCKA 1L7QA 1SACA 2PN5A 2YBKA 4IL7A 2GALA 1MZ6A 5A3MA 4IEYA 1UU4A 3IT8A 4AVCA 1HN1A 1ONAA 4MGTA 3W58A 4FPJA 4OHVA 3B69A 3RWNA 3NV4A 1HV1A 1X33A 4YW7A 2O1QA 4LULA 2YV8A 3C8XA 4DFSA 4NIHA 2YZ4A 3WCRA 1O5UA 2VECA 2AC1A 2W1QA 2R16A 3BVCA 4LKSA 1G9BA 1LENA 1NZIA 3E1F1 2JE9A 3RSJA 1OOPA 3AYDA 4KMQA 2CU5A 1UOGA 1HIXA 1QXPA 3OOXA 3K3OA 3OG2A 1R1ZA 4HXCA 3T0BA 3G7DA 1H8VA 2B4KA 3LDKA 4EWDA 1HXS2 1O5LA 5FZKA 4OYUA 4UF0B 4Y1YA 1FMD1 5IVBA 4Q4X1 4QU1A 4NPLA 2K2SA 3VBOB 1WMFA 2Y38A 4C0BA 4B4PA 1ZZBA 4ZU5A 1QHDA 2JDKA 2YPJA 1UU5A 5M0TA 1FPN2 2WLQA 1KITA 1GOGA 4MV2A 4BHPA 4I01A 1YI9A 1Z7S2 4JX0A 4MXWB 2VCAA 4NAMA 2P2KA 3ZSLA 2W1SA 5BNQA 3J26N 1PK6A 2VUCA 4BPZA 2BEOA 3AL5A 1S0JA 5FZ6A 4BIFA 4JGYB 5B4XA 1XYPA 2J1SA 4XF3A 1AR83 3T1MA 3ZOIA 4MGIE 3IB3A 3THTA 3AMMA 3UT0A 2K0GA 2ZX4A 5LASA 2OYZA 1H1IA 3T1LA 2NP0A 1UMIA 4JDNA 2R32A 3DYOA 4MOAA 4NO4A 4YZ3A 3AC0A 1IG3A 2TEPA 3B01A 4ZS3A 3BKZA 1ASJ1 4EYUA 4XE9A 1LHUA 1ODMA 1WW6A 4AFMA 1F8VA 3USUA 4D94A 2HWC3 3VBFB 1GWLA 3LCPA 3ZR5A 4AFCA 1KDKA 5GLVA 1OVSA 1LKNA 1RMU3 1YIPA 5J1XA 2ZGOA 3MLKA 2WN2A 3AP5A 1V6KA 1G9FA 1UX7A 3DPRC 4O9EA 2JENA 2HWC2 4NJ4A 1GP6A 1OVPA 2GDFA 3V0AB 3AKQA 1GP5A 5FYCA 1XSRA 1IQDC 2VXJA 2JG8A 3HAGA 2QCSB 2VZSA 3O0XA 1VRH1 2BVBA 3PTYA 4K1YA 2VH9A 4Q0UA 4RYDA 1H0BA 4TSVA 1PO11 3ZO0B 2RDQA 1GBGA 1B09A 3A7QA 3B93A 4P9XA 2ZZQA 4MG2A 3SHRA 3WV6A 2VMDA 3P5BA 4DZGA 2YBPA 1D7PM 3GZAA 3VKOA 4F83A 5LCWL 2P4EA 3PHMA 4K40A 3EB7A 1ULFA 4ZZ8A 5JSPA 3BIWE 4FVVA 1BBT1 3VDBA 5FLJA 3WUDA 2G9ZA 5JI7A 1O7FA 3TN93 2OZJA 2H0VA 2H6CA 3DPRB 3NKTA 4PDWC 1NX9A 1Z7S3 2PXJA 3BGAA 4NMIA 3SKJE 5DZFA 5G05L 3V56A 1SQ4A 3PL0A 2ARXA 2UURA 1VBC1 2AZ5A 3PJQA 1W6PA 4R8HA 2VUAA 2ZGKA 5EWSA 1ST8A 1RINA 3WUCA 2HH9A 3PVBB 4YGCA 4AWDA 1NE6A 1VMHA 3PMSA 3NO8A 1ZZ9A 1RHI3 2ZHLA 5LB6A 1PVC3 1K3IA 4C90A 3SQOA 2LTNA 3UGGA 4RHV3 5DN2A 1HB3A 2V72A 2VMFA 2X10A 4EN9B 1V0AA 4E2QA 5LEJA 3ZFGA 5IATA 2DWRA 3T30A 2D6NA 3OD0A 2XWBB 4Q1PA 2VCBA 1UZ0A 4S2GA 3PIGA 4LJHA 4LLFA 4XIKA 2WT0A 4AAPA 4UBHA 3VHPA 4AW7A 1HLCA 4A6SA 1QJY1 2VZVA 3NNJA 4CCJA 1AR62 1VB2A 1UKGA 1ZA4A 4IEQA 4N9IA 4OZXA 4DUVA 4XIOA 3UKNA 2A3YA 2VD7A 4RA0A 5KXCA 5IVYA 3Q8EA 5T5LA 1C5HA 4Q4V2 3NMBA 1OI6A 1ZBE3 2GH2A 1OT5A 3DGTA 2D44A 3FBYA 2X09A 4PHZA 5CIRA 1ZRDA 4FOVA 4GMP3 5LBEA 4CZSA 4AHZA 2KXLA 1XSQA 2CAUA 5T54A 4G9SB 5CB7A 4UW4A 2FHRA 3I8TA 3CZJA 5K8SA 1ZRFA 1BK1A 5JOWA 2I74A 2OX0A 3FX3A 5EQUA 3UYJA 4MADA 5LWBA 2B5HA 1XPWA 4WVMA 4FFHA 5F5QA 1ZZ7A 1JOBA 4W4ZA 2CTVA 5L9RA 2UU8A 2YPDA 5JZGA 1YJKA 3HN3A 2BBAA 3NNMA 4YW2A 4M3CF 2LROA 3CJXA 3K48A 4DPNA 4CP2A 1I9RA 1S0IA 1V6IA 2PAKA 2WNVB 5CG9A 3N36A 2ET1A 2DDUA 4XETA 1NA1C 3D8CA 2CHHA 1YFWA 3MUZ1 4FTEA 5T5OA 1DQ4A 4RGKA 3WP5A 2HWF3 4XZPA 2BWAA 1KFUL 5CKMA 4P02B 2OUJA 1VR3A 2WSVA 4H7MA 2WZ8A 4UBGA 4KNCA 1OD3A 2XQRA 1DFQA 5F5AA 4BMEA 4CUGA 3QD6A 1RL3A 2HKXA 1REEA 1TNRA 3CU7A 5FYVA 5D2AA 4Y1ZA 5L19A 2YG0A 2Q1FA 2BERA 2R062 3ACGA 3ZMNA 4K8FA 2Z5WA 3C7HA 5FZ3A 4RR3C 3ZYIB 5F7UA 3SC7X 3U11A 1UW8A 3IDAA 3UK9A 2R041 1PK6B 1CX4A 2QUOA 1VBD3 1ZBA1 3KV9A 3POIA 4GH4B 3V0BB 4WM8A 2FDJA 3CLPA 2IWGB 4DEVA 1LAJA 1UYPA 1JYXA 1SPPA 3S5QA 2XHKA 4YGEA 2XJPA 4EN6B 3JD73 1LHOA 1QQP1 1YCIA 2YDEA 3M3OA 3SCFA 1UX6A 2WT1A 4UF0A 2XPJA 4AFBA 3INAA 3ZN6B 4GWJA 1VBE3 2D3SA 4A45A 1HXS3 3FFZA 2VAUA 2GMPA 4ORFA 2A6WA 3HT1A 2WZEA 1LHWA 4H14A 4XF4A 2YFZA 3MBWA 5D1IA 1JYNA 1V00A 4Z82A 5K0UC 2ZGSA 1QY4A 1W90A 2VZPA 3DF0A 3MF9A 3RS6A 3LEKA 1W8UA 4EV0A 3RZLA 4CSWA 5A3WA 3N7MA 1GOFA 3S7IA 2WNEA 1J58A 1LOGA 4EE2A 1IKQA 3H1MA 3H42B 2WQZC 3H3UA 2QVSB 5FLHA 3T2PA 1UOBA 2ES3A 2RS52 3I2DA 4GB31 5A6ZA 1WMDA 3K3NA 4BQ1A 2WNVA 2QE3A 4G4FA 3GJAA 3ZXFA 3N7KA 5L7OB 4N43B 1AVBA 4TLGA 2IXJA 4XUNA 5C8WA 4NVPA 1RVF3 5CVRA 4N53A 4I2OA 3QBQA 1DF0A 4CU9A 4EROA 1OMIA 1DGLA 1NCRB 3WZ1A 1CAUA 3MEPA 3HBZA 3MIHA 4DO0A 1W0PA 4E2GA 2XGXA 3HT2A 3P3NA 3HNMA 1RVF1 1AR72 1IKPA 1GANA 2ET7A 2J42A 1Y9GA 1RUJ3 3GHNA 1OXCA 1CAVB 1NG0A 3D3AA 3OGJA 4NPMA 3GYDA 4QQPA 1OUXA 1RB8G 2R49A 3HPNA 1JZ5A 3S0MA 1XRUA 4ITCA 1WW7A 4CDXC 4QPIB 2QQKA 4QB1A 1GZWB 1SCRA 3WG1A 4BK4A 5FDBA 1CQ9A 4EN0A 1AJOA 2ZX3A 2W2IA 2GC0A 2YFUA 2AUYA 1ZX5A 1NCQB 4COVA 4BB3A 4OHZA 3SISA 3T2TA 2BPA2 3PURA 1RTVA 1RUC2 2EVXA 1UAIA 4X6RB 3LFMA 5FXVA 3SCGA 2JEMA 1HW5A 1DQ1A 1ULGA 2P3KA 4AR2A 3A0KA 3GZEA 4WM8C 2VZQA 1C8NA 4CEWB 1EV11 4XURA 3K51A 5DZGA 4Y22B 1ZZ6A 2VE1A 3NQHA 2GC1A 3H50A 2XMLA 1ND2C 3VBHB 3OBTA 2R063 1RUD1 4PQ9A 3EMRA 1BQPA 5FY0A 1N47A 1AUYA 1EV13 2WSUA 1E5SA 2XL9A 1LECA 4CU7A 3LSEA 4JDMA 3QCWA 1CR7A 2DVDA 1OKQA 3HIFA 4D6QA 4YZ5A 5FY8A 2JXAA 3QOPA 5FZDA 1WCUA 3ZLIA 5CFCC 3R0RA 3AMHA 4N9HA 3GXUA 4U2AA 1XNAA 4GAZA 1GFF2 1UU6A 1P8JA 4GKYA 3GBGA 4AL9A 1GSLA 3ITQA 4MO3M 3UL2A 4XQ4A 5BYNA 4FPEA 1L7RA 1SLCA 2D93A 2W5FA 5FZ0A 3ZXEA 5JMOA 4FSJA 4XUQA 3IPVB 3OGSA 2WS93 1PGL2 4H7LA 3MZHA 4CXWA 1LHVA 1WA6X 3NV1A 2X29A 3WP4A 1GLHA 1RUJ1 2Z69A 3GZUC 3I2IA 1QDOA 1RUF2 1JBCA 3K4DA 4IE5A 5HXVA 1G8WA 3C2UA 1D2SA 2ARAA 5GZCA 2Y0OA 1KD7A 1ULOA 3GHMA 4JGYA 2XJTA 3MLJA 3LOBA 2ZMNA 4IDZA 1AYN1 1J84A 3AFGA 4FPHA 4CA9A 5CA6A 5FR3A 4ZHNA 2DVGA 3ZFFB 5JOZA 1AYM3 3FC0A 2WNUC 3WR0A 1NLRA 1RUG2 1VIWB 1W6NB 1SG3A 1EPWA 4AG4A 4YM2A 1NY72 2B7YA 4RGAA 1BVVA 3S30A 4QX7A 2OZ6A 5KBFA 1W39A 3NJVA 1S4CA 4CCNA 2PQQA 2E6VA 3DL3A 3CQOA 1PM7A 4FFGA 2WZR3 1CZSA 2WO7A 4DY5A 4NIAA 4Y33A 1AX2A 4DB5A 1R1A3 4AK3A 2EIGA 1S2BA 2JD9A 4OUMA 4XF0A 1PO22 2C6SA 4JQTA 2DU1A 4UFIA 2VMCA 4WV8A 5HPOA 2WINB 5C3SA 5JIAA 5JPNB 4V2WA 1BYHA 4D8MA 4CDQA 2QQPA 5JZGC 4AEDA 3PIJA 1PO23 2B9VA 4C1WA 4CDWC 5A7SA 3FMGA 1UZZA 2VBBA 4RGGA 2PAEA 2EIEA 1CIYA 3OUHA 1EP0A 4K21A 5FXXA 4YSFA 4Y3OA 4RFT0 1NY71 3OBAA 5ERLA 1N3OA 3DN7A 1U12A 4GXLA 1U5XA 1H30A 1UXXX 4XFBA 2XLFA 2ARCA 1ZZCA 3AZVA 1YWKA 1DLCA 3HD8B 1UF2C 3ZXGA 2YGMA 4ZXKA 1W06A 2F4PA 4D7SA 2EXKA 4BQWA 1C28A 5FMCA 2BFUL 1FV2A 5FOJB 2QQVA 2Q8DA 4JC1A 5FFOC 3AMPA 2ZAHA 3LQCA 4OUEA 3CMGA 4M0NA 4QX2A 4E4SA 1JYIA 1ND3C 1CJPA 3I7DA 3CJIB 2VTXJ 2VPVA 3ILFA 4Z07A 1RUF1 1A8DA 1ND3A 2D5HA 3TYJA 4ARYA 4W8JA 1MQTA 2WNOA 2GH8A 1DQ5A 1GNYA 3LPFA 5T3NA 2VW1A 1W99A 2SBAA 2VZ1A 3OPTA 4BWOA 3AKRA 2CWMA 4HZFA 2ZHMA 1WA4A 1G9AA 1LGNA 2RR12 1GQHA 1M4WA 3GM8A 2GAUA 4OMDA 1RXGA 4R4ZA 4YVWC 1DQ2A 1WUVA 5CFDB 1STMA 4KWJA 4B3NA 4FPOB 3KHCA 1B35B 1HDKA 3ILNA 1KS4A 2OS2A 3IAPA 1HQLA 5LRRA 3JQWA 3R05A 1XU2A 3J9SA 3RZJA 2BU9A 4NE9A 4XFCA 4M3CA 5FYHA 3VB9A 4QU2A 2R1BA 3RRDA 2XR4A 1R081 2WWJA 2YXSA 4BCUA 5J09A 4CCOA 1WLWA 2W87A 1O3TA 1JZ3A 2W52A 2A7AA 3HJRA 3WF2A 4JHZA 3WNNA 2PQSA 3OY8B 5LATA 3I49A 3MW2A 2YY1A 4IV3B 4TLFA 2WL1A 5FP4A 5FOBB 5JI9A 5GM0A 1ODNA 4W6YA 2PLV2 5BNPC 4HL0A 1AF9A 1CAXA 4GMP0 4QQ2A 2E51A 3PU8A 4HPKA 1HB1A 3K4AA 2VOTA 2I2SA 4OFGA 3WQ7A 3MYXA 3M1HA 4O61A 4CXXA 5AFEA 5DZEA 2E9QA 2Q8EA 3ZYRA 3IPVA 2RS53 4CDUC 2ZEYA 3WY6A 2F4LA 2BBVA 5JXIA 3ZSJA 4ET7A 3ACLA 2VZUA 4QB6A 4EQVA 3AP9A 3QLQA 1VE0A 4CCLA 1PVC1 2UYBA 1H2MA 4R4XA 1WLCA 4HBNA 5C9AC 2E32A 1OH4A 3ACIA 1FV3A 4JGZC 2RS51 3AP4A 1SLIA 3DXUA 1M06G 1W8WA 1AR73 1PZ7A 5FKCA 4NAOA 5LA1A 2PELA 4A44A 2CAVA 4XFHA 5GZFA 3ZIWA 5GLWA 4Z92B 3H3LA 1F4AA 1YRZA 4YZ2A 4AI8A 4JZRA 1MEC2 3ZFEC 3ZYHA 3USSA 3DCQA 3LOIA 1UIKA 1ULCA 3NL1A 4P9WA 4IV1C 2WQ4A 4K8RB 3LDBA 5CYYA 3WDWA 2BP6A 4W50A 4RL7A 4URTA 3UJOA 2WO3A 4QM8A 5I93A 3HQRA 4JTOA 5F2SA 1X50A 4PJYA 2ZKNA 1HB4A 3U37A 2DU0A 1AR93 2Y34A 2JB8A 4LO7A 4B8EA 4W6XA 1ZA7A 3I2KA 3T0AA 1O3RA 2RS11 2R042 3KB5A 1Y7BA 1REDA 3VHRA 4RFRB 1S55A 5FIXA 2BOJA 4IGPA 4RD7A 2VMHA 5I0RA 1VAKA 3VL9A 1YUDA 3H8XA 1QJU3 3RJRA 5C8CB 1K5MC 5J7MA 2R061 2NMNA 1IHMA 4V1PA 4CEYC 1QQP2 4J6GA 2X5IC 2Q1MA 4MHUA 4L8QA 1YQ2A 5AC92 1H4GA 4OI1A 1SFNA 2EXIA 5EZWA 1OQDA 4AXOA 4QDSA 1YYNA 4COYA 3A23A 1RYYA 3C7EA 1RGSA 2XBO1 2VOKA 3I2OA 1LU2A 2I45A 1UOFA 3O1TA 3E5XA 3Q8FA 4TYSA 2DCJA 1CAWB 3KM5A 1Y3TA 2H0BA 4IW3A 4UFHA 5FMOL 3SH5A 2WAOA 4Y20A 4ATFA 1PVXA 4RQPB 3UGFA 3ZFGB 5FPAA 4E4DX 5C3OA 4IXLA 4YGDA 4AHXA 5I91A 1WD4A 2C4XA 3KV5A 1MS1A 1E5RA 2DFCA 3O0VA 4I02A 5FK8A 5C9AA 2UYAA 1VBA3 1TNFA 1RHI2 3IBMA 1TMF3 1LJ7A 1S2EA 3RYPA 1WKYA 4DS0A 4AEDC 3MV01 4CDWA 1W04A 4FFFA 4LO8A 4BXFA 2CGNA 5J37A 2J1EA 2Y6JA 4DXRA 3I97A 4YLZA 4HG6B 1ALYA 2FMDA 2PHRA 3LFIA 2QBXA 4L9BA 4R9AA 1WLTA 3WD5A 3KVAA 1JMUB 1T2XA 5A7QA 1ZZ8A 5ABJA 4QD2A 2C24A 5GZDA 1ZRRA 1ENXA 1NCQA 3O5SA 1JYCA 2RJKA 1W8OA 2JE8A 3FLTA 4NPRA 3LSDA 4CEWA 3S57A 3AYEA 5KHGA 1LB2A 2IVIB 4XTPA 4XVHA 2ZMKA 1ND2A 1H9PA 3AX4A 4U36A 1FMD3 4LORA 5KHHA 2XVGA 3WF4A 3MFCA 2WRAA 2WUHA 1AL0G 1YEWA 5ACA1 1H2LA 4PT6A 1J59A 3AJYA 1QJY2 3L2YA 2VZRA 2O14A 1DLLA 4XJZA 5FTTC 4DXSA 1CJDA 4CDQB 3ZSKA 3PVNA 4WZCA 1I3HA 2FDIA 4Q8LA 4AI0A 4LOTA 4X6QB 2P1BA 4Q4V1 2RDSA 4DXTA 4L11A 4S2HA 1GWMA 3BTZA 1H4HA 2F6BA 4WM7B 1JZ2A 4MSVA 3Q9OA 3NV3A 1DQ6A 4LO5B 2HWF2 5CFCA 5J48A 1MZ5A 1W6MA 3KV4A 3VDDC 2WFPA 2VNOA 2VQAA 1I5ZA 4I0BA 4LIUA 2PMWB 2P3YA 3BUCA 2HJIA 3ZMOA 4GIQA 4MGYE 5IVFA 2AYHA 4FO9A 3VBUB 5GLTA 2A73B 1RXFA 4PBPA 1MS4A 3MDPA 4Q4X3 3RQ0A 3POEA 4CP1A 3MPBA 1W6OB 2E53A 5DUWA 5FBZA 5G04L 4BM8A 4GWNA 3WHUA 2MHFA 1JU4A 2PFWA 2VOWA 3EHKA 3E6CC 5JWPA 2HWB2 3CL1A 2JG9B 2UWAA 4LE4A 4Q4Y3 4QPGA 4QKDA 1W9FA 1X9PA 4FPKA 5FZ4A 1HRI3 4JV4A 4B29A 3GDBA 5BXXA 3A21A 2D40A 3WNLA 1NKGA 3VN4A 3WINE 2G4IA 1CWPA 5FYUA 1CN1A 5FZOB 2R7EB 2RS33 4Z2WA 4QQHA 5C71A 1GYKA 1XB9A 4LBNA 1F31A 3VZOA 1VRH2 4MH0E 2ZZJA 2DCTA 3ROUA 2ADDA 1LODA 1VJ2A 4A42A 5JIUA 5JR7B 1CD3G 2I07B 2R0FA 1BBT2 3JB4C 1R1A1 5FPLA 4D7TA 2EAKA 3RPQA 4P08A 3KF5A 1DZRA 4YZ1A 2HLEA 1FX5A 2ENRA 2TUNA 2XKPA 2ZGMA 3OEAA 4LNVA 4RSUA 5DABA 4I30A 4AAXA 4OQ8A 2IXHA 1VMJA 2JG8C 3JQXA 5FPUA 2FDGA 1JH5A 2WWSA 2VCCA 5E88A 1RUNA 1IS4A 4CU8A 3GZTB 4D0QA 2VVFA 3BIEA 4L92A 1PZ9A 2WFF3 4Z2AA 1OA3A 5I0DA 1AJKA 4L99A 5K4LA 2ZGTA 3RFRA 1KEXA 3LIHA 1AYM1 2MEV2 1S0FA 2Y26A 4Y5Z0 3OUJA 3WDVA 3LF7A 1H8TC 1Q5OA 1W05A 3VBRB 5FJKA 4DINB 5HI0A 1YQ5A 1GV9A 1W6OA 5FRAA 1H2KA 3V65A 4DXZA 4WZFA 2AH2A 3AYCA 2WNUA 3UV9A 1XBFA 4XFFA 2XOMA 3D0SA 2VUJA 3AL6A 4PI2A 4PLOA 1EPZA 3UJQA 2LALA 5I0SA 1FPN1 3KZ4C 4UYBA 1ASJ2 2WZPP 1O59A 5A7OA 3MLLA 1N3QA 2QZ2A 1Z78A 2P17A 5JVVA 4ZZ5A 4D6RA 3OEBA 1D0HA 2VOVA 2XB6C 5C70A 3T2QA 2ZHKA 1AXKA 1QF3A 4GQ7A 4JQRA 4OCTA 1S0GA 3GF6A 4W65A 4WM7C 3ZM8A 4R9DA 4CRQA 1Q8OA 2HEWF 1F5JA 2JE7A 1OA2A 4I09A 4P00B 5F39A 4LMFA 2BNOA 3I59A 2BFUS 4LK6A 3AYAA 2JDUA 3AZZA 3TRSB 4FAHA 1YO8A 1Z7S1 4Q0QA 2J1AA 4Q27A 3TEZA 1XC6A 4XJWA 5BNNC 5CU1A 1VPHA 2ZGLA 1BJQA 1PMJX 4HKLA 3H8UA 1PIV1 4Q4X2 1UZYA 1HJFA 2D3RA 2KA3A 3B94A 1FMD2 3IDCB 4UFJA 3WHTA 1HXS1 4K20A 1AR92 3ZXKA 1Q8VA 3O0WA 4PIXA 2DYCA 5DG2A 2VNRA 2R1DA 5EJ1B 4NIDA 5KC6A 4DIQA 1PO13 1WGPA 2DUPA 2ARBA 2PHXA 3WW4A 1AR91 4AYUA 4QGLA 5FZ8A 1NA1A 2JDAA 4HVQA 3ZXAC 3LA7A 3IWZA 5FZLA 1PIV2 4FPYA 3S7EA 1RC6A 2ZKLA 4J1WA 3RMYA 4E4HA 3M4FA 1JUHA 1TZOA 3N9PA 5FV3A 1GMMA 3VBHA 2Y6LA 3FHQA 4IEPA 2Y64A 2QQOA 4P9YA 4OULA 3VDDA 4AQSA 4ISQA 1GR3A 4QX8A 4AVBA 3S6PA 3W5NA 2ZTNA 4NUBA 4RQPC 4AQ6A 1C57A 4BQYA 4HPKB 1YXWA 2NLRA 2YROA 4TN7A 4ISRA 1H9WA 1SDDB 3FFQA 4MGZE 5FXZA 3WP6A 1MS0A 1SBFA 5A7WB 2ZA9A 5JSRA 2E7TA 3AM2A 4LBKA 2A70A 2YU2A 4LR4A 5LEKA 5ABJB 3FBMA 5HBAA 1COV3 1VBA2 1W9TA 1ZVFA 1LOEA 1W2AX 2BWCA 4SLIA 1SHWB 5FBJA 3T4VA 3M2MA 1F15A 5A3UA 1JXNA 2HWB3 2E7QA 4F7ZA 4XACA 3BODA 2FCVA 2JX9A 1CAUB 2MEV1 5EP9A 1D4M2 3MIEA 2JG9A 1Y4WA 2CWSA 2Q8OA 1EUUA 5HV4A 1XXNA 4HFSA 1V6LA 1W3VA 3RJ2X 4QQLA 4YARA 3VD9A 1YFUA 3R6SA 5FY5A 1C3HA 3ZVXA 2RM22 4I3GA 3C3VA 3VD5A 4COZA 2ZS6B 4LUKA 3WDTA 1MQTB 4M4PA 5FMOS 1VB4A 4CDUA 2GC3A 4HLTA 5A33B 5A3LA 5T5JA 2NM1A 1MS5A 4LBQD 4RS5B 3WG2A 5BNOB 2DCKA 5ISLA 1GZWA 1LTEA 4GKXA 2KR2A 1QJZA 1WCDJ 5EJZB 4CPBA 1T6BX 3AFKA 2R043 1VBB1 1IS5A 3OGGA 2VW0A 3OCPA 3CDZB 3TOJA 2R0HA 4ARXA 1WMEA 4PBOA 2YB7A 3THPA 2FCUA 5L36A 1JZ7A 1Q43A 3N9LA 4J25A 4JGZB 1A34A 3IMNA 4E9KA 1N1TA 2W1UA 4LTAA 4WVVA 5FYZA 5DAVA 2B9UA 1F5FA 3JXSA 1TME2 1X7NA 4Q4W1 5FCCA 4E27A 1DGWA 4XCAA 2XUMA 3VKFC 1CZVA 1COV1 2GSYA 1AX1A 3ZYJB 2XONA 3I4IA 1OBNA 1QJX1 4XILA 1XNBA 3IKWA 4UT5A 2NQYA 4HK9A 1GNZA 1O6UA 2VG9A 4CE8A 1CIWA 3WW1A 2ORXA 1YQ6A 4QPGC 1VBC3 1JW6A 1URXA 1RUH2 4LT5A 1BMV1 3LAGA 4HMZA 3LEIA 3TNQA 5HV0A 3AJZA 1R64A 4IV3C 5CISA 1SDWA 1TMF2 2HWF1 3CHXA 5C5TA 4LA2A 5CADA 4OHYA 4META 2PHWA 3O1PA 2Y0IA 4FOWA 5FP7A 2IUWA 3PUIA 3TAYA 4YFZA 2W3JA 2J1UA 4AHYA 4X8NA 2WYFA 1C8M3 4QXKA 5FJHA 4YW5A 2BGPA 5IUQA 3RZGA 2BYVE 4PI0A 2B42B 1W6PB 4LLOA 2QNKA 4ZKTB 2WWUA 5EJ3A 4OHXA 2O0OA 1MS9A 3T3YA 4FQ4A 3VBUC 5CFDA 4DMIA 5I8YA 3NVCA 1RUC3 2J7MA 2QZ3A 5F6KA 3C7OA 1V9U2 2VU9A 4TTGA 1XNKA 3AKPA 3ZXJA 5CFDC 4I3PA 5T5PA 2V73A 4O7XA 3M3CA 3ZFFA 3PLQA 2FD8A 4EZHA 4QX0A 4IEUA 3CO2A 3LDRA 3N9MA 4KBBA 1BK0A 2XJUA 4NN0A 4SBVA 3POGA 2WABA 3VKLA 1APNA 3WXPA 5A70A 1PGL1 2ILMA 4IV3A 3TB0A 3UKVA 4CDQC 1QJY3 2Y6FA 1NQJA 4XEZA 3T4HB 1FT9A 3B7MA 4OVEA 1XNCA 2HEYF 1SFYA 1LGBA 1ZYBA 2XJVA 5FZHA 1NXD1 2ZGQA 5K7PA 3IDEA 5FP3A 2WR9A 3VKMA 1O3QA 3U07A 1PNFA 1W2TA 2QQNA 4FOYA 2D5FA 3M8LA 2Y60A 3TN92 5JCTA 1W6QB 4M01A 3KHBA 2WKKA 4URAA 4OHWA 1JHJA 3B00A 2JDMA 4AEDB 4LKFA 5I8TA 1LU1A 4YG6A 3GBWA 1H6YA 5C3RA 2D6MA 5F5CA 1XE7A 2HYXA 5BPXA 2DUQA 1YQCA 1MS3A 5AVPA 3IZOA 1XNTA 4PLMA 3SXWA 2ZX0A 4XDPA 3RNSA 5AC91 2WS91 3VD7A 1K42A 3WQBA 3VHOA 1W0NA 4BOWA 3MIDA 2RV9A 3ETPA 3MPPG 5DUVA 2XH6A 5FMDA 3ZFGC 4E8DA 2AEYA 3KS7A 4AI3A 2VBPA 4EZ4A 2W94A 2Z79A 1MVEA 1GQGA 4ZU7A 5A7PA 3EJKA 3BYWA 2WIIB 5FYTA 5D8AC 5A80A 5GZGA 1AR63 3W9AA 2CY6A 1MPXA 3RI9A 4AGRA 5CZKA 2FZ1A 2VR4A 2GP3A 3V0BA 4XW3A 1DG6A 2PLV3 5HCFA 1A8MA 3ZFFC 2YGLA 3IIAA 2JKXA 1JZ6A 1CGPA 3GNEA 4AEKA 5FPBA 5C8CC 5IVEA 1BCXA 1OPOA 4GJZA 2DCZA 4L0PA 5A33A 4GULA 1UMZA 2DVBA 1W8NA 3FL7A 5IK4A 1MEC1 1MZEA 3T0DA 3THCA 3V64A 4JKMA 5BNOA 3N7JA 3GBFA 3P1IA 2DURA 2BV4A 2JD4A 4MUVA 4AI2A 2G1MA 2VMGA 4AQTA 5FUNA 4M3CE 5JXHA 4FP2A 5EV7A 4XAEA 1OHFA 4QX3A 2QJVA 2WS92 4O65A 4QHZA 4XF1A 5JUVA 4FPCA 4TXWA 4YVWA 1VP6A 1W8TA 2HBUA 1H6XA 2R30A 3PMEA 4LO6B 4OMCA 5L9BA 1XE8A 2A6ZA 2V5YA 3POFA 1LOBA 4WM7A 4EWAA 5FWJA 1N1VA 3OJBA 3ZYGA 4Q5OA 1W6MB 1QJEA 5DAXA 3M70A 1C1FA 1UQXA 3VKNA 1R092 2VBDA 4AVAA 4XJ9A 3M3EA 1OQEA 3WNOA 5GALA 4DEQA 1LEDA 2VO5A 1CPNA 3ZN6A 5GJ6A 4RN5A 1KJLA 4EJRA 4Y4RA 4AF9A 1DGRA 3HNBM 4LHSA 4NOTA 5FP8A 1NT0A 3VV1A 1ND2B 1R083 2ERFA 4JAAA 3OGRA 4IGQA 1NOVA 3W5MA 2BZDA 2VXRA 4KWUA 3I2JA 2DVFA 4CEWC 4LEJA 1JYVA 4WM8B 2W46A 1AX0A 3M3IA 2IXIA 1CESA 3APBA 3MHZA 3PUAA 1J3QA 3ZYFA 4BQ4A 5FZEA 1AL23 3NSTA 4A6OA 1W2OA 5KHKA 5FY9A 3L2HA 1HKDA 1UO9A 4FCAA 1WZXA 2CNAA 4FQZA 3D6EA 5F32A 1RUOA 1ZRIA 4QM9A 3ES1A 3I3DA 1ZM1A 2QQMA 5FZ9A 5BNPB 4MVTA 3U0ZA 4BA6A 4FT8A 5FPXA 4LBOA 1O91A 4E2SA 3LEGA 4MHRA 5FMBA 2RR11 1W03A 3LKJA 1QJU2 4YW1A 4XJ8A 4KG8A 2ZAAA 2X5IA 1QQP3 1V6OA 4QWNA 4XHBA 4A7ZA 4D3WA 4DOUA 3KT1A 4LBQB 5D8AB 2F17A 5H9QA 5A3PA 5DMYA 1JU3A 4CP9B 3AZWA 3R4DB 1GU3A 4YM3A 4LBMA 1VMFA 2ZHNA 3NNGA 4QPGB 5FZMA 5C3PA 1VBE2 1HN0A 2GNTA 2NZ9A 4S2DA 5F5IA 3ZSMA 5HCAA 2A71A 2Y8KA 1EUTA 4Y20B 3JBG1 5DDJ1 1FAYA 1NYWA 1OH3A 4YGBA 1A6CA 1QH6A 4N43A 3VGIA 3A4UA 2OKXA 1DYPA 2DFBA 2O8QA 3LA2A 3VBSA 1CAWA 2RMU1 4HSJA 2BGCA 5LRSA 3IAQA 3ASIA 2O8OA 3M7AA 2H6BA 1JYWA 2QDNA 4MZUA 3O7OA 2KM2A 5J3UA 3KGZA 1EY2A 4GA9A 4R9BA 3J7HA 2E63A 3QACA 5HCBA 3RZKA 5FY4A 4C91A 1OFNA 3CF6E 3RZZA 3BALA 5FQ0A 1NXMA 2YC4A 2VC9A 2BW8A 3ALQA 3OF1A 4UW3A 4KWKA 4XCBA 5K0UB 2PHUA 4XUOA 1RUI1 4E4ZA 1FXZA 2DTYA 3DXTA 4ZU4A 5H9SA 1COV2 1AXYA 1K5MA 1REFA 3Q8AA 5JMCA 5IK7A 3AXEA 1POV0 1VLNA 1C4RA 4BMBA 5KXDA 4EWEA 4OZOA 1AL22 1UY2A 2EALA 3FZ3A 4UWDA 3K46A 1PO21 3NWKA 3DYMA 4Q4V3 5FUIA 4LXLA 3NW4A 3SEEA 5HCHA 3WG3A 1H2NA 2D7FA 4OLLA 2YHJA 2CSGA 3ACFA 4GH4A 3D82A 1FOD2 4S2FA 2P3IA 5FAXA 2LUWA 3I3EA 3ZXDA 4Y5TA 4B1MA 4DUXA 2EIBA 3H1WA 3MGUA 4BH9A 1OLME 1PNGA 1ZNPA 2PHDA 5LA9A 3KCXA 3SCHA 4QXBA 4Q26A 2YC0A 2R072 5E6HA 4IESA 3WDUA 3WQ0A 2A3XA 1RUG1 4NRQA 4PIYA 1BEV3 1GUIA 4CP9A 1V6JA 1PZ8A 2WBKA 3OUIA 2LM3A 3U10A 4BJ0A 5F2WA 4Q1RA 2JDPA 4UW5A 4CCMA 3I2GA 3VHNA 5ABJC 5IHRA 4CCEA 3VBUA 2VVEA 5FYIA 1AXZA 5T55A 4EN7B 1W6QA 4IQPA 4RR3A 1FPN3 3I2FA 5F6LB 2FDFA 3KMHA 3NV2A 1DP0A 2ZGUA 4NHMA 4BDVB 1WW5A 4QXCA 3J8F2 1XYNA 1RUE1 2GP5A 2HWE3 4DY3A 1Q8SA 4ASKA 2WNUB 3HBKA 3OD4A 4Q4Y1 2QQWA 4GZ9A 2ZOEB 1LOCA 1GKBA 1JS9A 1N1YA 4BZ4A 2MNGA 3HR9A 4DRRA 2QQIA 4QGNA 2OPKA 3I54A 1OKOA 2FZ2A 3ZPOA 2HYKA 4QKBA 2RDRA 4C1XA 1F9KA 2Z4FA 5C4WA 2GMEA 4N90A 2WT2A 3JUUA 2NMOA 4BQ3A 1PX4A 1CAVA 1Q56A 1R093 2PTMA 3OB8A 3AVRA 2BQPA 3ETQA 5DUUA 5BNNA 3FN9A 2BGOA 2GN3A 4A7YA 5FYBA 5IAXA 4PLNA 5DPNA 1JHNA 3WW3A 3K4ZA 3JD72
chains in the Genus database with same CATH topology
2HEVF 5T52A 1BBT3 2AGSA 1POV3 5J36A 3KT4A 4JCKA 4FAGA 1NZCA 1IPKA 1GNHA 1S0CA 2HWD3 3M3QA 5CFCB 4FOQA 1GZ9A 4ES9A 1LHNA 5FO8B 2ETEA 4XOGA 2WZR1 1VAMA 3ZN5A 1VAVA 4HANA 2A6XA 4F3JA 3AP6A 4Y22A 1QKQA 3E6DA 1UPIA 5EXOA 4UXAA 3R4UA 2D97A 5H9RA 3R4SA 1RVF2 1ENRA 4HVRA 1S2KA 1QU0A 4N7IA 1TME3 4KQ7A 4XJUA 2GNDA 4KL1A 1NCQC 2OW4A 1SLAA 2EF6A 3H7YA 4PDWB 1DZQA 3DPRA 3URFA 2B8MA 2VNGA 4JGZA 1Q8QA 4HK8A 3MW3A 4CDXB 3VBRC 4HKOA 3FHIB 1AR82 1SCSA 1HRI2 4M00A 2PA7A 4YNIA 5CBLA 2GNMA 3ES4A 2UY8A 3SLIA 3ST7A 2JG8B 4FPFA 3D4KA 1YLLA 1OPMA 1U5YA 4XHXA 3BOWA 2WFF1 2Q5TA 1W2UA 2A3WA 3V0AA 2VMIA 1O4YA 4QX5A 4C0HA 4EN8B 2ZJCA 1AYM2 1DHKB 1OFSA 3NKGA 3VZNA 1B35A 1JOJA 2PHFA 5I0TA 4P9LA 3MF6A 1RMU2 4HKWA 4I0AA 1FNZA 3HN1A 1VBD1 1ZBA3 2JICA 3DUIA 5SV5A 3JCIA 3EO6A 1VBB3 4FBFA 1O3SA 1PGW1 2R6QA 5B2GB 2G9GA 2YMZA 4TWTA 3J4UH 5JDBA 4A3XA 3AZXA 5BNOC 4RS5C 1X36A 2V09A 3AK0A 1R1A2 2JG9C 2D6LX 3ZX7A 4LBJA 1MQTC 4AFAA 4HVOA 4XQDA 5J98B 4AVSA 1MACA 3VLBB 3IN9A 2D6PA 3AZYA 2D6OX 4GH4C 3WX5A 3VBOA 2A6YA 4XXPA 2XBO3 3B9CA 4IEWA 4JRAA 1V70A 2ZPXA 3VBOC 4GB33 3VDDB 1C8M2 4RR3B 1SEFA 1F2NA 2HWE1 2AR6A 2P3JA 4XDQA 1XQNA 2HWB1 4KGGA 1HRV1 1H1AA 5JOXA 1MEC3 4RHV2 1LRHA 5LK7B 1O4TA 4NHLA 4AE2A 1PGSA 4P5HA 2P37A 1L3JA 4LHKA 5E16A 1KFXL 5BV6A 4JDOA 3LA3A 3KCCA 3IDBB 1LESA 1V6MA 2XVLA 2N7GA 5KXBA 3KCYA 4KH9A 3ZN4A 3H1YA 4FP3A 1LOFC 3WW2A 4F8AA 3LWCA 5C6CA 4PIZA 2SLIA 1WCKA 2DTWA 4FPLA 5GLZA 1D4M3 3ME2A 1SLBA 3KGLA 3MI8A 4QPYA 1HX6A 1HV0A 4AHWA 5ACA2 5BY5A 2JDZA 1TEIA 2BUKA 1MZFA 3TWIA 2ZACA 4RHV1 1ENQA 1DIWA 4Y1VA 2XLAA 3ZYPA 3QH6A 4UW6A 2XKOA 2HWE2 1C8M1 1KS5A 2E7AA 3JZVA 3FUOA 1WCSA 3OBRA 5BNNB 5F1RA 3BOPA 3OYWA 3LB9A 2IXCA 4PCRA 1FNYA 1DDLA 5IK5A 1RHI1 3SITA 1CAXB 4H3WA 5AFBA 4INDA 1EYBA 2PHTA 2IFRA 3BB6A 1HRV2 3E6BA 4KGQA 4XBQA 1YNAA 4PF5A 1K5MB 1Y9QA 1D2QA 3PJYA 5K0UA 4XXAA 5FQ0B 4L97A 4Z8BA 1OOPC 2NYYA 1PGW2 2UY9A 4PDWA 2XBO2 3MIGA 5LK5A 3ZFEA 3X29B 2X53S 4FPGA 3AXDA 2RJLA 1VBD2 2IC1A 1PO12 2QDRA 5E1RA 1QMJA 2GZWA 2JECA 5GLUA 2RR13 1H8TB 3KSCA 1N1SA 5AVAA 2WFF2 3UKTA 3AP7A 4FTSA 4MXVA 2RS12 2RE9A 5A32B 2XJSA 1QWRA 1QOTA 2IXLA 4IEVA 1O4ZA 5DUXA 4Q0PA 3B02A 2R073 1CONA 1RMU1 3QH7A 1OA4A 3KQRA 2W39A 1HRI1 3TNPB 4CDXA 1MVQA 1AR81 4LUMA 2ZCWA 1BXHA 4TZDA 4GALA 1IZ3A 1QXRA 3ZXLA 2D43A 1W0OA 3OYWB 2ZGPA 2BTVC 1KXGA 1LOFA 2Z2SB 1J1TA 2GC2A 1D4VB 1Q3EA 3VBFC 4QHBA 1ZRCA 4QQOA 1OLQA 2VY0A 4KU7A 3VBRA 1JUIA 1LGCA 1YHFA 4AFDA 3WVJA 1PVC2 1BKZA 4LA3A 5KC5A 1IPJA 1QGLA 2VULA 1J3RA 4JGYC 5CAZA 1U0AA 2FMYA 2WZR2 1G86A 3MIFA 4Q29A 4YZ4A 1S1AA 1YI7A 2GN7A 4LHLA 4M3CB 2DV9A 1B35C 1GICA 3WDYA 2PLV1 4XJAA 1A78A 1RJ7A 5JSOA 1G9CA 3AMNA 2WC2A 3ENRA 4LE3A 4AI1A 5KHJA 1R082 4HSLA 1UCXA 4AEJA 3JD71 3WQ1A 2C5DA 1OLRA 4K6BA 1AZDA 2MEV3 4ATEA 4RS5A 4Y4YA 1PHMA 4LBQA 3CJIC 5FPZA 3KLSA 4MYEA 1KDMA 2CYFA 2Q30A 2RHPA 2XVKA 4A7KA 4P9IA 1X8EA 2OA2A 3VZJA 4JTNA 1RUF3 2EA7A 3PVEA 1LULA 3D0JA 2BNMA 4W6WA 5BUVA 1IS3A 4YW3A 3VBSC 4XFIA 4YM0A 4BYYA 5J96B 1QNYA 1NLSA 1XNDA 1SMVA 3H9AA 3J8F1 2FBEA 3FUQA 3H0OA 5FO9B 3U4XA 5JZGB 4YVSA 1C1LA 5KWRA 2ZGNA 5H9PA 1HRV3 5I0UA 1RUD3 1YFYA 1DGWX 2XWJB 4B4RA 5K9YA 1LCLA 4Q4Y2 1U5IA 2BVVA 1BVP1 5EYYA 1RUE2 3N3HA 1XYOA 2R071 5KXEA 3EQEA 4MX3A 4IERA 5FO7B 4BLIA 1V9U3 1DBNA 1CVNA 2G9FA 1QDCA 2JKBA 2QKDA 4KU8A 4WVMB 2Q0AA 3EXUA 3A0NA 1LEMA 3DKWA 4ONUA 4Q0SA 4XF9A 3VBFA 4NHKA 2X5IB 4LBLA 4R9CA 4CEYB 1AL21 5D8AA 1UL9A 1DZTA 4B7EA 3USUB 2TNFA 4NR1A 1IS6A 5EYXA 3MIBA 4YG3A 5BNPA 4ASLA 2RS13 3MW4A 2DUOA 1FOD1 2X8KA 1ULDA 4MXWA 3NAPB 3WT3A 2PYTA 4RQPA 1VALA 1AYN3 1Y43B 2ZABA 4WBBA 5DXDA 3RMXA 1QNWA 2XG3A 2NPIA 1ULEA 1KRIA 2UWCA 2RMU2 4Y26A 1AYN2 4IV1B 1BZWA 3W59A 3FJSA 4DNYA 3KT7A 1RUI2 2WA3A 3H3ZA 5JAXA 3ZFEB 1SBDA 3JBG2 5DDJ2 2TBVA 1NE4A 3I59B 4IEOA 1XU1A 2PHLA 2IZWA 1J3PA 4P14A 4AGVA 4Z1VA 5C4WC 4XPVA 1RUJ2 2A6VA 2Q4SA 3JBG3 4M0HA 5DDJ3 3BU7A 5C9AB 4N7UA 4IEZA 2DF7A 4Q4W3 3VBHC 5F9TA 1PGL1 1ENSA 1SBEA 1EAH3 5TSWA 1QJU1 1ZBE2 3CNAA 3PVOA 4XFAA 5IT6A 1SLTA 1S0DA 4CDUB 1Q8PA 2EXJA 1Z0HA 1W6NA 3RI8A 4CP0A 2IXKA 2VQ0A 1DYKA 2AREA 1VBE1 3WOGA 4KWLA 5I8SA 2CL2A 4YRDA 1RUG3 3TBDA 1KJRA 2WLPA 4HETA 4YM1A 3NAPA 1RUD2 4N53C 4QPIC 2BBVA 2B39A 2K9ZA 5FLIA 1G7YA 1UD1A 2WJSA 4HN0A 5AC93 3N4MA 2WA4A 5C8CA 1EV12 4XTMA 2MPFA 3VUOA 5T50A 1CPMA 2Q1ZB 1PIV3 1RUC1 5GKAC 1NCRC 3HWJA 1UKRA 1ASJ3 3SH4A 4XQWA 5CNAA 4YVWB 4KG0A 1N3PA 4IV1A 2RS31 4B7KA 1EAH1 4N43C 3FLRA 4COWA 3E5UA 5L7OC 4BIOA 4O9GA 4DQAA 5L7OA 1JTZX 3ELNA 1AR71 4Q8KA 4ES8A 5EFUA 1QXJA 1RUE3 2D6KA 2JJ6A 1R091 1H1MA 2ZBJA 4NWVA 4G3YC 1HQNA 1ND3B 2NN8A 1SLLA 5GZEA 3VZKA 2ZX2A 1KQRA 4OI0A 4Y1UA 3L9JT 4FXKB 3POWA 4YVSB 4D69A 1QOOA 3CEWA 1AHSA 2ATFA 2YYOA 3BTAA 2HWD2 2RMU3 4XBLA 1I6XA 1BEV1 1T6GC 2C0ZA 4GB32 4MLOA 4YG0A 5JLVA 1MS8A 1X82A 4JVAA 4K7JA 4XBNA 4K9SA 1PK6C 1NQDA 4B4QA 2GMMA 1DQ0A 1IGOA 4CDWB 1HQWA 3N7LA 3ECQA 1POV1 1YJLA 3O14A 4GWMA 3WNXA 5E89A 3OY8A 4YSFA 3PNAA 1BEV2 3LZZA 1FI2A 1UPSA 2HWD1 3WLUA 2EXHA 4AGGA 4GMP1 2IFWA 4OI2A 5FREA 1X8MA 4BLJA 1ZBA2 4WVWA 2QFEA 3ILRA 1IOAA 4D7YA 5DG1A 2VVDA 5L73A 3D5OA 2WNVC 2ZX1A 3VBSB 1WLDA 2XL7A 3G6JB 4XMIA 4QT6A 3TN91 1PMIA 2VGDA 4LHNA 2A5ZA 2B45X 1EAH2 4YVSC 4OUSA 2RS32 2OIIA 3OTFA 5E8AA 1WBLA 3WDXA 3E97A 4IEXA 4FXGB 4YW4A 3ZDSA 2CGOA 1RUH3 1G6NA 2VW2A 1C5IA 2VOXA 4Y1XA 2XJRA 4L2NA 3WG4A 3P3PA 4NWWA 3KD4A 1FOD3 4MGKE 3POSA 4CTEA 3ZSEA 4XYXA 1YFXA 1I1EA 4IETA 1V9U1 1U5ZA 2GU9A 4FTBA 2EAAA 2UWBA 1G9DA 1D0GA 3DV8A 3SNMA 2DVAA 1LR5A 3B3QE 1ZBE1 3ATGA 3MICA 1S0EA 2Z42A 2C1FA 4X8PA 4N53B 3WCSA 3BPZA 4HT1T 1TMF1 1FYUA 1S0BA 1NCRA 3POYA 1RIRA 5IK8A 1RUI3 4JRLA 3B5LB 2A75A 1AR61 1RUH1 4K1ZA 1UIJA 1DU3D 4QGMA 4K3UA 5C33A 2W0XA 1RITA 3AMQA 4A2UA 2GNBA 4XMAA 4QPIA 1TE1B 1ZREA 3ZIXA 4Q4W2 1TME1 3ZPYA 3LGRA 4J1XA 2YUEA 2D3PA 4Q0VA 1BMV2 5C4WB 1GZCA 2PAMA 2P34A 2ZGRA 1VBC2 1VBB2 3N35A 1WD3A 1QJX2 3CJIA 3NJZA 1OD5A 1A3KA 3AKSA 3E5QA 4BE3A 1JN2P 2XJQA 1H8TA 3HMYA 3RYRA 1OSGA 3RDIA 2OVUA 3VZMA 4OI4A 4XFGA 2AENA 1UN1A 4Y24A 3IM0A 1QOSA 2W08A 1VRH3 2RM21 3FLPA 3AKTA 1DGRN 3NAPC 3BCWA 2FQPA 3VL8A 3OPZA 1OOPB 5ACA3 3GALA 4AEMA 4I0WB 4YFWA 1E57A 1D4M1 4CEYA 2B46X 2ZMLA 2HWC1 2OUHA 3WP3A 5A32A 5JOYA 1QH7A 3JU9A 3MFAA 2CV6A 1VBA1 1WW4A 2BNNA 3FWEA 4LO4B 1MR5A 3J8F3 4ASMB 1J1LA 4P9GA 3FE5A 4H55A 3SMHA 4AVVA 5SV8A 1V6NA 1YIFA 4DRVA 4WVZA 4HN1A 3SH3A 2CGPA 3RG0A 1QJX3 4Q2FA 3H7JA 1IQAA 4CYDA 3O12A 5KHIA 3JB8A 3B9IA 4COUA 1OQ1A 4YYOA 3HQXA 3RYKA 2C9AA 4R52A 1LOAA 1RJ8A 3VZLA 1NA1B 5CG8A 3EBRA 2W68A 2RM23 2DCYA 3AB0A 4P9JA 1FATA 1TQ5A 4AQ2A 4AVTA 1WBFA 2XLGA 2D98A 1SACA 2PN5A 4IL7A 2GALA 1MZ6A 5A3MA 4IEYA 1UU4A 3IT8A 4AVCA 1ONAA 3W58A 4FPJA 4OHVA 3B69A 3RWNA 3NV4A 1HV1A 1X33A 2O1QA 4LULA 2YV8A 4DFSA 2YZ4A 3WCRA 1O5UA 2VECA 2R16A 1G9BA 1LENA 2JE9A 3RSJA 1OOPA 3AYDA 1HIXA 1QXPA 1R1ZA 3G7DA 1H8VA 4EWDA 1HXS2 1O5LA 4Y1YA 1FMD1 4Q4X1 2K2SA 3VBOB 1WMFA 2Y38A 4C0BA 4B4PA 1ZZBA 4ZU5A 1QHDA 2YPJA 1UU5A 1FPN2 2WLQA 1KITA 4MV2A 4BHPA 4I01A 1YI9A 1Z7S2 4MXWB 2P2KA 3ZSLA 3J26N 1PK6A 4BPZA 2BEOA 1S0JA 4BIFA 4JGYB 1XYPA 4XF3A 1AR83 3T1MA 4MGIE 3THTA 3AMMA 2K0GA 2ZX4A 2OYZA 1H1IA 3T1LA 2NP0A 4JDNA 2R32A 4YZ3A 4NO4A 3B01A 2TEPA 1ASJ1 4XE9A 1LHUA 1WW6A 4AFMA 1F8VA 3USUA 4D94A 2HWC3 3VBFB 3LCPA 4AFCA 1KDKA 5GLVA 1RMU3 1LKNA 1YIPA 2ZGOA 3MLKA 3DPRC 3AP5A 1V6KA 1G9FA 4O9EA 2JENA 2HWC2 2GDFA 3V0AB 3AKQA 4QMAA 3HAGA 3O0XA 2JG8A 3PTYA 2QCSB 3SCFA 1VRH1 2BVBA 4K1YA 4Q0UA 2VH9A 1H0BA 4TSVA 1PO11 3ZO0B 1GBGA 1B09A 3B93A 4P9XA 2ZZQA 3SHRA 3WV6A 4DZGA 3GZAA 3VKOA 4F83A 3PHMA 4K40A 1ULFA 5JSPA 3BIWE 4FVVA 1BBT1 5FLJA 3WUDA 5JI7A 1O7FA 3TN93 2OZJA 2H0VA 2H6CA 3DPRB 3NKTA 4PDWC 1Z7S3 5DZFA 3V56A 1SQ4A 2ARXA 2UURA 1VBC1 2AZ5A 3PJQA 1W6PA 4R8HA 2VUAA 2ZGKA 5EWSA 1RINA 3WUCA 3PVBB 4YGCA 4AWDA 1NE6A 3PMSA 3NO8A 1ZZ9A 1RHI3 2ZHLA 4C90A 1PVC3 2LTNA 4RHV3 5LEJA 4EN9B 4E2QA 3ZFGA 2DWRA 2D6NA 3OD0A 2XWBB 4Q1PA 4S2GA 4XIKA 1RUNA 4LLFA 2WT0A 4UBHA 3VHPA 4AW7A 1HLCA 1QJY1 1AR62 1VB2A 1UKGA 1ZA4A 4IEQA 4N9IA 4OZXA 4XIOA 3UKNA 2A3YA 4RA0A 5KXCA 5T5LA 1C5HA 4Q4V2 1OI6A 1ZBE3 2GH2A 3DGTA 2D44A 3FBYA 5CIRA 1ZRDA 4FOVA 4GMP3 4CZSA 4AHZA 2KXLA 2CAUA 5T54A 4G9SB 5CB7A 4UW4A 2FHRA 3I8TA 5K8SA 1ZRFA 1BK1A 5JOWA 2I74A 3FX3A 2B5HA 4WVMA 5F5QA 1ZZ7A 2CTVA 2UU8A 5JZGA 1YJKA 4YW2A 4M3CF 3CJXA 3K48A 4DPNA 4CP2A 1I9RA 1S0IA 2WNVB 1V6IA 2PAKA 5CG9A 3N36A 2ET1A 4XETA 1NA1C 3D8CA 4FTEA 1YFWA 5T5OA 1DQ4A 3WP5A 2HWF3 4XZPA 2BWAA 1KFUL 1VR3A 2OUJA 2WSVA 4H7MA 4UBGA 4KNCA 1DFQA 4BMEA 3QD6A 1RL3A 2HKXA 1REEA 1TNRA 3CU7A 4Y1ZA 5L19A 2R062 3ZMNA 4K8FA 2Z5WA 4RR3C 3ZYIB 3U11A 1UW8A 3UK9A 2R041 1PK6B 1CX4A 2QUOA 1VBD3 1ZBA1 3V0BB 4GH4B 4WM8A 3CLPA 2IWGB 2XHKA 4YGEA 2XJPA 4EN6B 3JD73 1LHOA 1QQP1 1YCIA 2YDEA 3M3OA 1UX6A 2WT1A 2XPJA 4AFBA 3INAA 3ZN6B 1VBE3 2D3SA 1HXS3 3FFZA 2GMPA 4ORFA 2A6WA 3HT1A 1LHWA 4H14A 4XF4A 5D1IA 1V00A 4Z82A 5K0UC 2ZGSA 1QY4A 3MF9A 3DF0A 3RS6A 4EV0A 3N7MA 3S7IA 2WNEA 1J58A 1LOGA 1IKQA 3H1MA 2WQZC 3H3UA 2QVSB 5FLHA 2ES3A 2RS52 3I2DA 4GB31 1WMDA 4BQ1A 2WNVA 2QE3A 4G4FA 3ZXFA 3N7KA 5L7OB 4N43B 1AVBA 2IXJA 5C8WA 4NVPA 1RVF3 5CVRA 4N53A 4I2OA 3QBQA 1DF0A 4EROA 1OMIA 1DGLA 1NCRB 3WZ1A 1CAUA 3MEPA 3HBZA 3MIHA 1W0PA 4E2GA 2XGXA 3HT2A 3P3NA 1RVF1 1AR72 1IKPA 1GANA 2ET7A 3GHNA 3OGJA 1RUJ3 5D8AC 1CAVB 1NG0A 3GYDA 4QQPA 1RB8G 2R49A 3S0MA 1XRUA 4ITCA 1WW7A 4CDXC 4QPIB 3WG1A 1GZWB 1SCRA 5FDBA 1CQ9A 4EN0A 1AJOA 2ZX3A 2GC0A 2AUYA 1ZX5A 1NCQB 4COVA 4OHZA 3SISA 3T2TA 2BPA2 1RTVA 1RUC2 2EVXA 1UAIA 4X6RB 3SCGA 2JEMA 1DQ1A 1HW5A 1ULGA 2P3KA 3A0KA 4WM8C 1C8NA 4CEWB 1EV11 3K51A 5DZGA 4Y22B 1ZZ6A 2GC1A 3H50A 1ND2C 3VBHB 3OBTA 2R063 1RUD1 4PQ9A 1BQPA 1N47A 1AUYA 1EV13 2WSUA 2XL9A 1LECA 3LSEA 4JDMA 3QCWA 1CR7A 2DVDA 1OKQA 3HIFA 4YZ5A 5CFCC 2JXAA 3QOPA 3R0RA 3AMHA 4N9HA 4U2AA 1GFF2 1UU6A 4GKYA 3GBGA 5BYNA 1GSLA 3UL2A 4XQ4A 4FPEA 1SLCA 4FSJA 2D93A 3ZXEA 3IPVB 1PGL2 2WS93 4H7LA 3MZHA 1LHVA 3NV1A 2X29A 3WP4A 1GLHA 1RUJ1 2Z69A 3GZUC 1QDOA 1RUF2 1JBCA 5HXVA 1G8WA 3C2UA 1D2SA 5GZCA 2Y0OA 1KD7A 3GHMA 4JGYA 2XJTA 3MLJA 3LOBA 2ZMNA 1AYN1 3AFGA 4FPHA 5CA6A 2DVGA 3ZFFB 5JOZA 1AYM3 3FC0A 2WNUC 3WR0A 1NLRA 1RUG2 1VIWB 1W6NB 1EPWA 4AG4A 4YM2A 1NY72 2B7YA 4RGAA 1BVVA 3S30A 2OZ6A 5KBFA 1W39A 2PQQA 2E6VA 3DL3A 1PM7A 2WZR3 4DY5A 4DB5A 1AX2A 1R1A3 4AK3A 2EIGA 1S2BA 4OUMA 4XF0A 1PO22 2DU1A 4WV8A 2WINB 5JIAA 5JPNB 1BYHA 4CDQA 2QQPA 5JZGC 4AEDA 4C1WA 1PO23 4CDWC 3FMGA 1UZZA 4RGGA 2PAEA 4K21A 1EP0A 4RFT0 1NY71 1N3OA 3DN7A 1U12A 4GXLA 1U5XA 1H30A 4XFBA 2XLFA 1ZZCA 3AZVA 1YWKA 3HD8B 3ZXGA 1UF2C 2YGMA 4ZXKA 2F4PA 4D7SA 2EXKA 1C28A 2BFUL 1FV2A 5FOJB 4JC1A 5FFOC 3AMPA 2ZAHA 4E4SA 4M0NA 1JYIA 1ND3C 1CJPA 3I7DA 3CJIB 2VPVA 3ILFA 4Z07A 1RUF1 1A8DA 1ND3A 2D5HA 3TYJA 1MQTA 2GH8A 1DQ5A 5T3NA 2VW1A 2SBAA 4BWOA 3AKRA 2CWMA 4HZFA 2ZHMA 1WA4A 1G9AA 1LGNA 2RR12 1GQHA 1M4WA 2GAUA 4R4ZA 4YVWC 1DQ2A 1WUVA 5CFDB 4KWJA 4B3NA 4FPOB 1B35B 1HDKA 3ILNA 1KS4A 5LRRA 1HQLA 3JQWA 3R05A 1XU2A 3J9SA 4XFCA 4M3CA 4QU2A 2R1BA 3RRDA 1R081 2YXSA 5J09A 4BCUA 1WLWA 1O3TA 2W52A 2A7AA 3OY8B 3MW2A 2YY1A 4IV3B 4TLFA 2WL1A 5FOBB 5JI9A 5GM0A 4W6YA 2PLV2 5BNPC 4HL0A 1AF9A 1CAXA 4GMP0 4QQ2A 2E51A 4HPKA 4OFGA 2I2SA 3WQ7A 3MYXA 3M1HA 5AFEA 5DZEA 2E9QA 3ZYRA 3IPVA 2RS53 4CDUC 3WY6A 3ZSJA 3ACLA 3AP9A 3QLQA 1PVC1 2UYBA 1H2MA 4R4XA 1WLCA 4HBNA 5C9AC 4JGZC 1FV3A 2RS51 3AP4A 1SLIA 1M06G 1AR73 1PZ7A 2PELA 2CAVA 4XFHA 5GZFA 3ZIWA 5GLWA 4Z92B 1YRZA 4YZ2A 4AI8A 1MEC2 3ZFEC 3USSA 3LOIA 1UIKA 1ULCA 3NL1A 4P9WA 4IV1C 2WQ4A 3WDWA 4RL7A 4URTA 3UJOA 4QM8A 4JTOA 1X50A 4PJYA 2ZKNA 2DU0A 1AR93 4LO7A 4B8EA 4W6XA 1O3RA 2RS11 2R042 3KB5A 1Y7BA 1REDA 3VHRA 1S55A 5I0RA 4RD7A 2VMHA 1VAKA 3VL9A 1YUDA 1QJU3 3RJRA 5C8CB 1K5MC 5J7MA 2R061 2NMNA 1IHMA 4V1PA 4CEYC 1QQP2 4J6GA 2X5IC 2Q1MA 4L8QA 5AC92 1H4GA 4OI1A 1SFNA 2EXIA 5EZWA 1OQDA 4AXOA 1YYNA 4COYA 1RGSA 2XBO1 2VOKA 1LU2A 2I45A 3E5XA 4TYSA 2DCJA 1CAWB 3KM5A 1Y3TA 2H0BA 5FMOL 3SH5A 4Y20A 4ATFA 1PVXA 4RQPB 3ZFGB 4E4DX 4IXLA 4YGDA 4AHXA 5I91A 1WD4A 1MS1A 2DFCA 4I02A 3O0VA 5C9AA 2UYAA 1VBA3 1TNFA 1RHI2 3IBMA 1TMF3 1LJ7A 3RYPA 4DS0A 4AEDC 4CDWA 5J37A 4LO8A 2CGNA 4YLZA 1ALYA 2FMDA 2PHRA 4L9BA 4R9AA 1WLTA 3WD5A 1ZZ8A 5ABJA 4QD2A 5GZDA 1ZRRA 1ENXA 1NCQA 3O5SA 1JYCA 2RJKA 3FLTA 4NPRA 3LSDA 4CEWA 3AYEA 5KHGA 1LB2A 4XTPA 4AVBA 2ZMKA 3AX4A 1ND2A 1H9PA 4U36A 1FMD3 5KHHA 2XVGA 3MFCA 5ACA1 1AL0G 1H2LA 1J59A 3AJYA 1QJY2 3L2YA 5FTTC 1DLLA 4XJZA 1CJDA 4CDQB 3ZSKA 3PVNA 4WZCA 1I3HA 4Q8LA 4AI0A 4X6QB 4Q4V1 4L11A 4S2HA 1H4HA 2F6BA 4WM7B 4MSVA 3Q9OA 3NV3A 1DQ6A 4LO5B 2HWF2 5CFCA 5J48A 1MZ5A 1W6MA 3VDDC 2WFPA 2VNOA 2VQAA 1I5ZA 4I0BA 2HJIA 3ZMOA 4GIQA 4MGYE 2AYHA 4FO9A 3VBUB 5GLTA 2A73B 4PBPA 1MS4A 3MDPA 4Q4X3 3RQ0A 4CP1A 3MPBA 1W6OB 2E53A 5DUWA 5FBZA 4BM8A 4GWNA 3WHUA 2MHFA 2PFWA 2VOWA 3EHKA 3E6CC 5JWPA 2HWB2 3CL1A 2JG9B 2UWAA 4LE4A 4Q4Y3 4QPGA 4FPKA 1HRI3 4JV4A 4B29A 5BXXA 2D40A 3VN4A 3WINE 2G4IA 1CN1A 2RS33 4Z2WA 4QQHA 1GYKA 4LBNA 1F31A 3VZOA 1VRH2 4MH0E 2ZZJA 2DCTA 3ROUA 1LODA 1VJ2A 5JIUA 5JR7B 1CD3G 2I07B 2R0FA 1BBT2 3JB4C 1R1A1 4D7TA 2EAKA 3RPQA 4YZ1A 1DZRA 1FX5A 2ENRA 2TUNA 2XKPA 2ZGMA 4LNVA 4RSUA 4I30A 2IXHA 2JG8C 3JQXA 1JH5A 2WWSA 5E88A 1IS4A 3GZTB 2VVFA 4L92A 1PZ9A 2WFF3 5JPMB 1OA3A 1AJKA 4L99A 2ZGTA 3WDVA 1AYM1 1S0FA 2Y26A 2MEV2 4Y5Z0 5I93A 1H8TC 1Q5OA 3VBRB 4DINB 5HI0A 1GV9A 1W6OA 5FRAA 1H2KA 3V65A 4DXZA 4WZFA 2AH2A 3AYCA 2WNUA 3UV9A 4XFFA 3D0SA 2VUJA 4PLOA 1EPZA 3UJQA 2LALA 5I0SA 1FPN1 3KZ4C 1ASJ2 2WZPP 3MLLA 1N3QA 2QZ2A 1Z78A 2P17A 5JVVA 1D0HA 2VOVA 2XB6C 2ZHKA 1AXKA 1QF3A 4GQ7A 4JQRA 1S0GA 3GF6A 4W65A 4WM7C 4R9DA 4CRQA 1Q8OA 2HEWF 1F5JA 2JE7A 1OA2A 4I09A 4FAHA 2BNOA 3I59A 2BFUS 3AYAA 3AZZA 3TRSB 1YO8A 1Z7S1 4Q0QA 4Q27A 4XJWA 5BNNC 5CU1A 2ZGLA 1BJQA 4HKLA 3H8UA 1PIV1 4Q4X2 1UZYA 2KA3A 2D3RA 3B94A 1FMD2 3IDCB