4AFAA

Crystal structure of subtype-switched epithelial adhesin 1 to 2 a domain (epa1to2a) from candida glabrata in complex with glycerol
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
227
structure length
227
Chain Sequence
SKDPTTFPLGCSPDITTPKKGLSMELYSYDFRKKGSYPCWDAAYLDPNYPRTGYKSHRLLAKVDGVTGNINFYYHATKGCTPQLGHLPASYNYPKPLTMTNFTMLLYGYFRPKVTGFHTFTISADDLLFVNFGAGNAFDCCRRDSSADHFGNYQAYAIWGSKTAKDELTVHLDAGVYYPIRLFYNNRDNNGALSFTFKTESNENTVSDFSEYFFSLDDTEEGCPGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Promiscuity and Specificity During Candida Glabrata Invasion of Host Epithelia.
pubmed doi rcsb
source organism Candida glabrata
molecule tags Cell adhesion
molecule keywords EPA1P
total genus 60
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10528 GLEYA GLEYA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4afaA00
4AF9A 2XJQA 4ASLA 4COYA 2XJSA 4LHKA 2XJTA 4CP0A 4COZA 4COWA 4GQ7A 4AHXA 4AI0A 2XJVA 4AFBA 5A3MA 4CP1A 4AI2A 5A3LA 4LHLA 4CP2A 4A3XA 4COUA 4AHYA 4AFAA 4D3WA 4LHNA 4AHWA 4COVA 4AFCA 4AI1A 4AI3A 2XJUA 2XJPA 2XJRA 4AHZA
chains in the Genus database with same CATH superfamily
5FYYA 4QDSA 3AP5A 3H42B 5FYMA 5C8CC 5KBFA 4HN1A 4XE9A 5FYBA 5A33A 4HFSA 1PMIA 4BPZA 2AEYA 3C7HA 4CDQC 1COV2 1U5XA 3JQXA 5L19A 2BOJA 4AQTA 1G9CA 3H1YA 3WF1A 3OPTA 5BNPC 3IMNA 2W2IA 4LEJA 2FMYA 1OH3A 1G6NA 1TQ5A 4Q5OA 2WZPP 5F5QA 3VBFC 3P3PA 2XHKA 3SISA 5FOJB 1FX5A 2WO1A 1OKOA 3IDAA 1KDKA 3VKLA 4ZZ5A 4Y20B 3OB8A 1EAH3 2BVBA 4RYDA 4DZGA 1XE8A 2YGMA 1AYM1 1MZ6A 2Z2SB 4AF9A 4GXLA 3V64A 3OGJA 3GXUA 4L9BA 2GC0A 5C5TA 3FHIB 4E2QA 2A6XA 1BKZA 1GKBA 3RZJA 4GZ9A 2HKXA 2NP0A 2DVDA 1NX9A 3POWA 4LHLA 4Q8LA 2DVFA 4RL7A 4UT5A 5C4WC 4BYYA 5L73A 1AL23 2B9UA 1EV13 2A6YA 5FO9B 4TXWA 2WBKA 1JOJA 4IERA 3OUHA 4QQPA 4ZHNA 2FQPA 2DCYA 2Y6LA 1O3QA 1ZX5A 5L7OA 2F4PA 2R30A 4N7UA 1AXZA 4NIGA 4IV1C 5LEKA 1Z7S3 1RUD3 2XJPA 3ZPOA 1AVBA 1D2SA 4A41A 2W68A 1H6XA 5IFPA 3ZLIA 4ASLA 4YRDA 3WCRA 5FZ8A 5DPNA 1W6PB 1NCRB 4BISA 4W8JA 2ZABA 1J3QA 2UWCA 4K3UA 1R091 5KHGA 4ISRA 3DKQA 4ISQA 1ALYA 5JSRA 5FPZA 2XWJB 1H9WA 3MV01 3PUQA 4UW3A 4Z2WA 2DFBA 2WYSA 2XPJA 5CYYA 3GALA 5IAVA 4X6QB 2XDVA 4EN8B 2Y6GA 3ABZA 4C0HA 3HNMA 1EV11 3AKQA 3POEA 3WF0A 1CJPA 1JH5A 1FOD1 1MS0A 3MIHA 4MSVA 4LKDA 2XQXA 3PDQA 1F8VA 2NLRA 2BV4A 1W2UA 4OVEA 3ZR6A 4KI5M 4Z92B 5DABA 2P3IA 1UXXX 2D43A 1IQAA 1VIWB 3LSEA 4JTOA 2FBEA 2JICA 4LBLA 1AYN3 1ZM1A 2IFWA 5IFTA 2WO7A 3ZN4A 1RUOA 4RQPC 4AI0A 1IPKA 3UGGA 5A3WA 1F5FA 1WLCA 1DBNA 2OQ7A 2R6QA 1OFSA 2WQZC 2EIGA 3POBA 4QKNA 2VCMA 2ZACA 3OPWA 3OYWA 3AM2A 2BFUS 5JUVA 2JKBA 1XE0A 5FR3A 4FTSA 2B5HA 1QJY2 4A42A 5BV6A 5F5IA 3AVRA 1FV3A 2CWSA 3AZXA 3NNMA 3OUJA 4S2GA 4ZXEA 3DUIA 2IVJA 2ZX3A 3AKTA 1LGBA 4YYOA 1W04A 4GJZA 1QKQA 2Q4SA 5C3RA 4LHSA 1VALA 1DQ5A 1UYYA 3H7JA 4AQ2A 4QHZA 1GBGA 1FXZA 3MGUA 3NWKA 4DOUA 2J1EA 2VMFA 4N9HA 1OOPA 2OQ6A 4A7ZA 1FI2A 2W91A 3ES4A 5CBLA 5IVEA 5L36A 3RZGA 3NJVA 1H30A 2YB7A 3B69A 3WNKA 2ETEA 2V4VA 4HVOA 1REDA 1CWPA 3J8F3 3ZFGA 4Y1ZA 3THDA 1SMVA 2PHFA 4YFWA 2DVBA 3ST7A 4HKOA 1VMJA 5G04L 1GOGA 3K2OA 2TEPA 1LOBA 4CXWA 1KQRA 4XPVA 3VBOC 1YFWA 2ADDA 1PGL1 3AMPA 5FBZA 3L2YA 3RSJA 1D2QA 3GJAA 4BU2A 3V0AA 1VB2A 4QXKA 3EBRA 3LGRA 4IE4A 3N9MA 1WCKA 4MGZE 1BBT2 2IXHA 3UGFA 4B29A 3CU7A 1DYPA 3LEGA 4ES9A 2CY6A 3H7YA 5I91A 4KWLA 3ZIWA 2ZHKA 3VHRA 4CP0A 4QX3A 3AL6A 3T1MA 4HKLA 2BGPA 3UK9A 3J7LA 4JHZA 2X29A 4BB3A 1UY3A 2G9GA 2RS13 2E7TA 1T6GC 4OI4A 1WW4A 2WFF1 4CDWC 2HH9A 3OGVA 2CDPA 2YU2A 2Y0OA 3DKWA 3HQUA 4Q4Y3 4WM8A 2XKOA 3BTAA 1TG7A 1H8TB 3WW3A 4O61A 3H8UA 4F8AA 1UPSA 3NW4A 2JDHA 3IIIA 4PIXA 1WW6A 4TSVA 4XUNA 4AWDA 3IMMA 1ND2A 3ZYPA 4LO8A 1W6PA 1NCRA 4H55A 5FPAA 2QQVA 4CCEA 3WHUA 3ES1A 5FUNA 4AAXA 4QM8A 5FP3A 2P1BA 4JVAA 1LTEA 2WSUA 3FLRA 1OT5A 2Y6FA 4BQ5A 4MGQA 1E5SA 3RQ0A 2XL9A 1U5ZA 4XF1A 3N9QA 4ZU4A 3AMHA 4INDA 1ZBE3 1RVF2 1S0EA 3BN6A 1QJZA 1ZBE1 1H1MA 3KM5A 2WFF3 4BIFA 2JE8A 5KWRA 4XHBA 1QQP2 2PELA 1IS6A 3O0XA 3VKFC 4PI0A 1HRV3 1ENSA 2PXJA 2VOWA 4L0PA 3RPQA 3NNGA 4B4RA 3ZXJA 5LY2A 3VBRB 2WZR2 2ARXA 1WLDA 1BK0A 4JV4A 3GYDA 4P9YA 1RUNA 4AG4A 1PO22 3D6EA 4OI1A 4KBZA 3T30A 3M3OA 4BQ3A 1RUI3 1WBLA 4CA9A 2R072 4RHV2 1TNRA 1NXMA 4E4DX 4Q4W2 5FZBA 3SC7X 4M4PA 4NE9A 4LKFA 4K8RB 1AL21 3FFZA 3BU0A 3VDDB 2D6PA 2XBO1 4FPHA 4J1XA 1IPSA 1JUIA 2ZS6B 3DPRC 2XKPA 3FC0A 5FZ3A 5FWJA 1DQ6A 5CADA 5DAVA 1RUG3 3FLPA 1L7QA 4BDVB 1VBD1 4JQRA 1YEWA 1COV1 4BK5A 1D0HA 1YQCA 3ZXGA 5AC91 4QAWA 1PO13 2AZ5A 3FWEA 1ZNPA 5CNAA 2E32A 5FY1A 4XQDA 2EA7A 3NVCA 1C4RA 1AXYA 1FMD3 3NJZA 4NAOA 4QGLA 1TMF3 4QX7A 4UXAA 3W59A 1MACA 4YM1A 2OVUA 3AC0A 1OMIA 5F1RA 5FZOA 1KEXA 1ODNA 1VBE3 1ZBA1 3VUOA 3T2TA 4LBQB 3TN93 1K12A 2BU9A 4KWUA 3MLJA 2JJ6A 1RUC3 3ZYRA 1HJFA 1SBEA 2PHLA 4QDQA 5CFDA 3LCPA 1W6QA 2YV8A 1XRUA 4HPKB 5B4NA 4NPRA 3VBSC 1ZZ9A 1NCQC 3KT1A 5EZWA 4E4SA 4CDUC 2DURA 4YGDA 3AFKA 1W6OB 4R9CA 2RS12 2CGPA 2GC3A 2PMWB 4OI2A 5JCTA 2QJVA 2FZ1A 2BERA 4EROA 1DQ2A 2E7AA 4EQVA 1O4ZA 4MX3A 3MBWA 4XQ4A 4OLLA 2VR4A 3JQWA 5I0TA 2ET7A 1HB2A 1NOVA 1XYPA 1OVPA 4YVWB 4DXSA 1YQ2A 2QTWB 1QJY1 4CE8A 3CO2A 3DPRB 3ACFA 4W6WA 5IHRA 1D7PM 3NAPB 2Q30A 1LOCA 2VJXA 3T1LA 3LIHA 2D7FA 5ANNA 3SLIA 1WA4A 5FZIA 2VW2A 2BNOA 3C7GA 1B35A 1GICA 5A32B 1W6NA 4IV3A 3U78A 3FN9A 3M3EA 5JSOA 1ENXA 2AR6A 4XJ9A 5CG8A 4NN0A 1UZYA 1RVF3 4LNVA 5I8YA 2VTXJ 1HV1A 4YVSA 1YFYA 3URFA 4NIHA 2PQSA 4G3YC 4M3CE 3KQ4B 5AVAA 2PHTA 1FOD2 3AFGA 4EE2A 3DYOA 4PIYA 2W92A 2XLFA 3K51A 4JX0A 3BKZA 1T6BX 3ITQA 5FQ0A 1L3JA 4Q0PA 3O1SA 3NKTA 1XBFA 4BQXA 2CYFA 4QX2A 5DUUA 1H4HA 1GWKA 1LHUA 3DGTA 4V2VA 4XMAA 4YW5A 3T2QA 4B8EA 4FBFA 5I0DA 5FZFA 1HN1A 3KVAA 5LASA 3QH6A 4NJ4A 1NQDA 1PMJX 3KV4A 3IPVB 2WT2A 4KG0A 3WDVA 5IAXA 3HNYM 2Z69A 2OYZA 5FMCA 1PM7A 2CHHA 2VOVA 5A3MA 5GJ6A 2XB6C 4GH4B 2VUDA 5EJZB 4FPEA 2QQKA 5F3GA 2WQ4A 4LLOA 5FZ4A 1F35A 5BYNA 4OHWA 2RE9A 1AR92 3LA2A 4YGBA 3WT3A 5BY5A 3B94A 4A44A 3IDCB 3AXEA 1BMV1 3VZKA 1PVXA 4UBHA 2ZGSA 3PUAA 3ZXDA 1C3HA 2VH9A 3E6CC 3WNPA 1JZ3A 5CISA 1C28A 4AI9A 2Y38A 4Z2AA 1MZ5A 4JDNA 1JHJA 1GQHA 5EYYA 1PGL2 1H9PA 2RR13 4M3CF 3IN9A 4GMP1 1UW8A 2XOMA 1J1LA 1U5IA 1TME1 3H8RA 1NQJA 4XVHA 1Y7BA 1N1SA 3V56A 4TZDA 2ARBA 1L7LA 2WO3A 5FY0A 3G7DA 5FREA 3W5MA 1X8EA 2C1FA 1BBT1 1H2NA 4GIQA 3SH3A 3WQ1A 3ZYHA 4B4QA 1W9SA 3WD5A 1AR82 1JHNA 4O9GA 3TBDA 4J1WA 1S2EA 1WCDJ 1UZ0A 2TNFA 4RGKA 2D5FA 3U1XA 3AL5A 3CF6E 3W20A 1GZWB 1H8VA 3MIDA 1RL3A 3AZYA 5A6ZA 4LUKA 1UOFA 4FT8A 4FFIA 4CEYC 5AVPA 5A80A 4YW2A 4KMQA 2GZWA 5LA1A 5F39A 4Y20A 3O12A 4W65A 1ZRDA 2I74A 2R062 5LRSA 2DCJA 1C8M1 1XNBA 1J1TA 4BMEA 2QQMA 5FXXA 4CUCA 4JGYC 3FUOA 4LOSA 4P9GA 1DU3D 2F4LA 2RS52 3DPRA 1W39A 5H9PA 1R1A3 1CAUA 1G9BA 4JDMA 4K9SA 1M4WA 2QE3A 1V6NA 3TAYA 1Q8SA 4NHMA 1ENRA 1H6YA 1VBA1 3VD9A 5LWBA 1A78A 5GLUA 4M00A 1W6NB 3FLTA 3JBG1 1H2MA 4JRAA 1NXD1 5FZHA 5D1IA 3LEMA 3PNAA 2ES3A 2QQWA 3ZFEB 1GWLA 1O5LA 4HL0A 1HW5A 4IEQA 4AVSA 5FCCA 1JZ6A 3C7FA 3WCSA 2WWJA 2ZMKA 4NIDA 2D3RA 2W1SA 5C33A 2P3YA 1NLSA 3V65A 3HBZA 1RXGA 5FY5A 1PX4A 3GCXA 4YZ3A 4Z1VA 3DEMA 2GAUA 2C9AA 2CNAA 2NZ9A 1G7YA 4ZXKA 1HXS2 2O8QA 1ULFA 4AXOA 2J1TA 3ILFA 4S2DA 2VU9A 2VZQA 3W5NA 4LE4A 1NCQA 1H0BA 3LDRA 4Y26A 3B02A 2ZMLA 4WZCA 1S2KA 2W94A 2XMLA 2QQLA 4OYUA 3ZDVA 4YZ5A 1W6MB 3OBRA 4MXVA 1OLQA 3TNQA 1SLLA 3WOGA 1W9WA 4GB33 2ZZJA 4PCRA 1D4M1 1KITA 1QH6A 4GH4A 5J3UA 5JMCA 5M0TA 4RQPB 4CCMA 2KXLA 3RVHA 4COWA 2WS92 1IS4A 4U36A 4AQSA 4BLIA 3ME2A 2C9KA 1R1ZA 5JSPA 4ZU7A 2KM2A 2VVDA 3I59B 4KU8A 2GMPA 1RTVA 4GD4A 3WF4A 2ZX2A 1U5YA 3PJQA 4FP3A 3K4AA 2NQYA 3MICA 1MZEA 5JXJA 1DP0A 2VUJA 2ZMNA 4IEOA 5FO7B 2P3KA 2RR12 5JIUA 2EF6A 2DFCA 3C7OA 4AEDA 1RYYA 3BTZA 2JD9A 2RS33 2ZEYA 5EFUA 1O6UA 1MS5A 2JX9A 1LEDA 2RS31 4DRRA 3I4IA 4TN7A 3S6PA 1W05A 4Y1VA 4R4ZA 2FD8A 2OXBA 3M2MA 5ABJC 3THCA 1UMHA 3FZ3A 5IYYA 4UW5A 1KRIA 1NLRA 4YARA 4OHXA 4K40A 5FXVA 3KSCA 2Z42A 2ARCA 3TB0A 5C70A 2VZUA 1EAH2 3FJSA 4CEWA 4IW3A 4P9LA 4K8FA 5GLVA 4BMBA 5DAWA 5GZEA 1JYVA 4WM7A 2C6SA 2EXKA 1S0BA 1UO9A 1NCQB 2JDKA 4FI9A 1DCSA 4CDUB 2DVGA 2V72A 5ACA2 3H8OA 1UX7A 4JGZC 1K5MB 2OUHA 3LWCA 3PLQA 4LQRA 4Y1YA 4AI8A 3UJQA 2OUJA 1W6MA 2B39A 4IUGA 3USSA 2JECA 2E51A 1XJAA 3H1WA 4Y1XA 4WBBA 2YBKA 1WKYA 1VBD3 2P37A 2UYBA 5FYVA 1MVEA 3TOJA 3TWIA 1WCQA 1OPMA 3GJBA 1MR5A 2VULA 1UOJA 1UNBA 2GNTA 3LSDA 4JKLA 3WZ1A 4WVMB 1GUIA 5J09A 2MPFA 1DZTA 4NIAA 1AYN1 3U37A 3UKNA 3T08A 5JWPA 2DF7A 3NAPC 1FMD1 1IHMA 5FZLA 5CFCA 1PK6B 3K4ZA 1YI7A 3H3LA 1JU4A 4GWNA 1HRI2 2VVEA 3M7AA 4MGIE 2K9ZA 1O5UA 2G4IA 3N36A 1GZTA 4QGNA 4XJZA 3RWKX 4YSFA 2FDIA 4FP2A 5FP9A 5ANQA 3UT0A 1HXS3 4J25A 4AHXA 1ULEA 2DDUA 2E7QA 1W90A 3ZFFA 5A1LA 4NVPA 5KHHA 1A8DA 1VMFA 4JTNA 4OI0A 2VMIA 3BTYA 4AW7A 1PIV2 4H14A 1V9U1 4DO0A 4BQWA 1AL0G 2FMDA 1CN1A 4OZXA 5T5OA 1EPWA 3ROUA 2O0OA 1POQA 3KD4A 4E8DA 4PHZA 2KD7A 1CX1A 5FPVA 3I3QA 1N3OA 3R4UA 4RQPA 2R7EB 2DU0A 2VCBA 1POV0 3I2IA 3T0BA 1C57A 4K20A 5FLIA 4NPLA 3UETA 3VZOA 2A3YA 3VBUC 3M3QA 1ZZ8A 2GDFA 2JDAA 3FBMA 4PQ9A 1PZ9A 4IEUA 4LO5B 3D8CA 3WINE 3WNOA 1QJY3 2HYXA 1ZZ6A 3BU7A 3J7MA 1EUUA 5FWEA 4NHLA 3N9NA 1GP4A 1UXZA 4AVTA 3LOBA 5A70A 3MV11 5LB6A 3VDDA 3OSDA 4I02A 3D0JA 4HVRA 1U12A 1UMIA 4BM8A 5JZGC 2EXHA 4W6XA 1OVSA 2YC2A 2ZHMA 3HIFA 4LOTA 3AP6A 3VDAA 1Y9MA 5I0RA 5DAXA 3SCGA 1HQWA 1BVVA 5JI7A 1QH7A 2ZXQA 3PTRB 2A6VA 2IVIB 4GA9A 4QXCA 1JOBA 3VBOA 5IVYA 3TEZA 3BODA 3IKWA 3MI8A 5C8CA 2PAKA 4XAAA 4D7SA 4ES8A 1BMV2 4Y4RA 1HLCA 3OGRA 4KH9A 2VVFA 3MZHA 2HWE2 4L97A 2BGOA 3NV3A 2MNGA 3M3IA 4L8QA 4UFJA 3VGIA 2AH2A 4WM7B 5HXMA 3ZMNA 4AHWA 5DUVA 2WZR1 3WDUA 4G4FA 3DXUA 4AI1A 1A34A 4IESA 1E5RA 3PIGA 1OFNA 5FYTA 2C0ZA 1LOAA 1ND3B 3HEIA 3WXPA 3WNMA 3GBFA 1SFNA 2V09A 3GM8A 2JDPA 1W2TA 1LENA 4Z82A 5JOYA 1OUXA 4AGRA 4YFZA 4CCCA 1GOFA 2WLPA 5A6QA 1JBCA 1YQ5A 4HONA 4EZ4A 1FOD3 2V5YA 1FPN2 4XF9A 3ZPYA 4D94A 4EN9B 3TEXA 1ACCA 1YJKA 1IS5A 1UQXA 3ZM8A 2PAEA 1MPXA 1W8HA 4XFHA 5AC92 3AKPA 4MUVA 4Q27A 4FPYA 3KS7A 4XF3A 4XJUA 1BK1A 4NWWA 4XXAA 4NOTA 3U75A 2HWE3 5FXWA 5GM0A 4MGTA 5K7PA 5FZ9A 1W9YA 1CIYA 1RUI1 3RZHA 3O1VA 4CCKA 1XYOA 1N3PA 4A7KA 5FDBA 1IGOA 1QHDA 1J3PA 5F3IA 2UYAA 4COZA 1UY0A 5LW9A 2IXJA 2MEV3 4B3NA 5DG2A 1PGSA 2W08A 2Z4FA 2BUKA 1OOPB 2WFF2 3KV9A 4DUXA 1QIQA 4MOAA 4I01A 3GZAA 2EIEA 5DG1A 3VBOB 1FNZA 2A5ZA 2VQAA 3KT4A 4M3CB 3GBWA 3GCWA 3NJYA 4NO4A 3SEPA 5K0UB 2MHFA 1J84A 2DUOA 3VN4A 1MS9A 1NKGA 1S0GA 3E97A 3MFCA 3JXSA 3MPPG 4FXKB 3WG3A 1W0OA 2XJRA 3E5UA 3S7IA 2XR4A 5IVVA 4QX5A 2CTVA 1Z0HA 1ZA7A 2GNMA 3B3QE 3PVEA 4PF1A 2ZGTA 2QFEA 4P9JA 4Q0VA 1P8JA 5KHIA 1X8MA 3TEYA 4D6SA 2IFRA 1Q8QA 4OFGA 3VZNA 4CDWB 1PZ8A 3GGLA 4WM8C 5TSWA 4CXYA 1QMJA 3MW2A 4PI2A 3T09A 1C5HA 5IVFA 1H8TC 4QMAA 4IE5A 5L9BA 2YROA 3N7LA 2Q8CA 1YCIA 5A6YA 4N43B 2TUNA 1WWYA 4XCBA 1RIRA 1VRH1 2BZDA 2RS11 5CKMA 4ZS2A 4AAPA 2Q8OA 1DGWA 1W8OA 4YNIA 1DDLA 4XUQA 4HSLA 3CNAA 5KXBA 3MW3A 5D8AC 5FY9A 2P2KA 2Z79A 1RUG2 2B45X 1OF4A 1QJEA 2BYVE 2R063 2R061 1GMMA 3MIFA 1NE6A 4DEVA 4XETA 2JD4A 1VBE2 2RS53 5F3CA 4GULA 4LBOA 4META 5FUIA 2RG4A 1W8TA 1JOPA 1SDDB 1RUC1 5FQ0B 4OUEA 1OOPC 1Q3EA 4IDZA 1JYTA 1TMF2 5EV7A 2HLEA 3U10A 2WNOA 1H2LA 3UJOA 3N4MA 3POYA 4FPKA 5EJ3A 2BNNA 2DTYA 1JTZX 5K0UC 1STMA 1DGLA 5DMYA 1Z78A 3FX3A 1US2A 2TBVA 2VZPA 3D82A 2RDQA 3RYRA 4YM0A 1D4M3 5GZCA 4BXFA 4LBMA 1BVP1 4CPBD 5IW0A 3S5AA 4LHKA 1YHFA 5DZEA 1QNWA 3R6SA 1LU2A 5F6KA 1S0DA 4IETA 3P1IA 4XFCA 1QQP1 2FCTA 2JIGA 3D4KA 4CSWA 2QBXA 2AENA 5FZGA 3OF1A 4JC1A 3ZSJA 1XNTA 4R9DA 3ORJA 4XF4A 3POIA 5IVBA 1W8FA 4PDWC 2LUWA 3P3NA 4Y22B 1X9TA 2HEYF 1PO21 2P17A 2CAUA 3B9CA 2EIDA 3A0NA 1VBB3 3I2KA 2OW4A 4QPIA 3K3NA 4IEWA 3RJ2X 1DQ1A 1KS5A 1QY4A 2Y8KA 3H50A 2QQPA 2K46A 1D4VB 1F15A 4N43A 1XSQA 1RHI1 4Q26A 5IATA 2XVLA 3NSTA 2XUMA 3QCWA 4L11A 3RZMA 2ZGRA 4LBJA 2EAAA 4DS0A 2XBO2 4F83A 2BGCA 1US3A 1CAVA 2WSVA 3POFA 1K45A 5A7WA 1K42A 4X6RB 3FL7A 4XTPA 4ATFA 4BH9A 3VZLA 3NJXA 1W8UA 1Y3TA 1MS4A 3HN1A 5JXIA 1FAYA 3H9AA 4XFIA 4HG6B 4R52A 3OPZA 3IB3A 3O14A 3WEZA 1WW7A 1IKPA 3HN3A 1PNFA 3ZMOA 2RDSA 1QXPA 3ZYBA 5GZGA 2BFUL 4XDQA 5FP8A 5BNQA 4HK9A 1TZOA 1LB2A 5FZOB 3I2DA 4EZHA 2D6OX 3KF5A 4C90A 2YHJA 3CDZB 3WNNA 1HV0A 2ORXA 2VMGA 3VBRA 5FZMA 4AFDA 4ZU5A 3O0VA 5JDBA 5A3UA 3SHRA 2UWAA 1GV9A 1Y9QA 2GSYA 2XLGA 4MGYE 4XDPA 4HT1T 3SH4A 4AL9A 1LOFC 3IDEA 3KCXA 3NNLA 2HWD3 2PLV3 2W3JA 1JUHA 2H0VA 4QQ2A 5C3QA 4HKWA 3ZSMA 2VXRA 1O3RA 1UKGA 3ETQA 5FLJA 4DY5A 3EQEA 2E31A 5JR7B 1W2AX 4GJYA 2YYOA 4MXWB 1UOGA 3ZN6A 2K0GA 3MUY1 2P6HA 3CIHA 5F9TA 4PDWB 1GSLA 5JOXA 4BHPA 5J98B 4OMDA 1CAXB 1ZRRA 5IUQA 1WGPA 4YVWA 3VKMA 3TNPB 1SFYA 1C8M3 1KFXL 4EV0A 1YUDA 5FP7A 2QUOA 2RR11 4LIVA 5F2WA 4H7LA 3T4HB 1JYCA 3AZZA 5JXHA 1GP5A 3BOWA 1AHSA 1JZ5A 1JYWA 3ALQA 1BEV3 1RUE2 5FK7A 3KT7A 1C1FA 4ARXA 4EYUA 5A32A 2DBIA 4K1ZA 4N53A 4QB2A 2ZGLA 3AP7A 3IDBB 5A7WB 1AR83 3RG0A 3E5QA 1MQTA 1GR3A 4P00B 5CIRA 3WW4A 4YZ2A 1CD3G 1K3IA 3NV2A 4OUMA 1OA2A 5H9SA 2ZA9A 3HJRA 2X10A 4AZZA 3S30A 3UNPA 1GOHA 3I97A 4HPKA 4E27A 1D4M2 1QU0A 3A21A 3ELNA 4QB1A 4MLOA 3J8F1 1WD3A 4IEXA 1XE7A 4AFCA 5GZFA 3BPSA 4MHRA 1EYBA 3SKVA 3VBSB 4Y1UA 4BQ4A 4CU8A 1RJ7A 1C8M2 1OD3A 3T0AA 2E9QA 4LK6A 3VDCA 2B42B 3Q8FA 3KMHA 2BBAA 4OHVA 5E1RA 5L7OC 2XWBB 2UY8A 3NO8A 2WC2A 4NAMA 3I2FA 1AR81 2QKDA 5F5CA 3PVOA 1CAWA 4RD7A 3WW1A 4QKBA 3OBTA 5IK4A 3VHOA 1BHGA 3MIBA 3JB4C 1VLNA 2BWCA 1J83A 2Y6JA 2C5DA 1DIWA 4JAAA 1LRHA 2JIJA 5CU1A 3OY8B 1F2NA 1CAXA 1O8SA 4PJYA 1LEMA 4XJ8A 5DZFA 4YZ1A 2R16A 3UESA 2JE9A 2Y6HA 4J6GA 4O7XA 4QQOA 1NA1C 2GNDA 4DNYA 5F7UA 4XZUG 5BNNA 1PK6A 2YFZA 3LB9A 4L99A 2QNKA 2ZX0A 3J4UH 3WNLA 2XGXA 4C1WA 3SITA 1SG3A 5D2AA 4AOCA 5B4XA 2W46A 1ODMA 1RITA 2C4XA 1R092 3MIGA 1H4GA 4MG2A 2GH8A 3JZVA 1YC61 4NHKA 4DIQA 5BNPA 1O7FA 5JMOA 3ZFFB 2GNBA 4EJRA 1VJ2A 4QX1A 2PHRA 3BTXA 1TME2 4HXCA 1DLCA 4LMFA 4Y24A 2JWPA 3U14A 2HWD2 3LFMA 3CZUA 4KL1A 4XFBA 3UYJA 4ARYA 2YBPA 1V6MA 3POJA 1V70A 3WDXA 4LITA 3QLQA 5E16A 2PHUA 1GZWA 2DCZA 4IEZA 2BEOA 2ZX1A 2VTFA 1WMEA 2VNVA 3HT1A 4R8HA 4E4HA 1K5MC 3N9LA 1Q43A 2LALA 4MV2A 4PLMA 3PUHA 4MXWA 3ZN6B 2WNVA 5CVRA 3ZXFA 3HPNA 1OD5A 3HBKA 4Q29A 2SLIA 5JAXA 4BIOA 3VV1A 3A23A 1A8MA 3OGGA 5SV5A 2YDEA 3AZWA 1SEFA 1SLBA 2YGLA 5FYHA 2JDZA 4BA6A 1TE1B 1AXKA 3I7DA 3WY6A 5AFBA 1N1TA 2JDMA 3MLLA 4X8NA 1O59A 4V2WA 1B35C 1Y9GA 1AR71 3APBA 4QM9A 5JOWA 3DN7A 3BIEA 3HMYA 4XBQA 1TME3 4I3GA 5HCFA 2F6BA 3AP9A 4N53B 4CDXB 1UY4A 3JB8A 3WQ7A 2XXZA 1XOYA 2WNUB 4Q0QA 1H2KA 2VCCA 2XL7A 5J7MA 1OSGA 3NQHA 2VNGA 5AC93 3VBFA 1VRH2 5FJHA 1WMXA 1FATA 3I3MA 2ZKNA 2ZPXA 4TLGA 1Q8OA 4WM7C 4P9XA 1ONAA 3K48A 5L9VA 5H9QA 4JKMA 4LKEA 2D40A 1ZREA 2ZZQA 4O9EA 1QXRA 2VMHA 5KR7A 4ORFA 4CXXA 5J1XA 5DXDA 4OHZA 1ND3C 2W95A 4URTA 3VBHA 1RUJ2 3VB9A 4Q1RA 4FTEA 3WDYA 2HWC2 3D0SA 1W3VA 1ZBA2 1S0IA 2WYFA 4R9BA 1CESA 1R082 3F2ZA 1BJQA 3SCFA 1V9U2 5T50A 4AEKA 2ZBJA 1EUTA 1WBFA 3E6DA 3EB7A 4K21A 2WA3A 3I2OA 1O8PA 1QF3A 3W58A 4JGYB 4EN0A 4IV1A 3ZO0B 4A6OA 4FPFA 2D3PA 4O65A 1EP0A 4FPOB 4HBNA 4XBNA 4AHYA 4LULA 1RXFA 2WABA 3ACHA 5BNOC 5CFCC 1YO8A 1UZZA 5L9RA 2PHDA 2RM23 4FSJA 4JDOA 1VBD2 3QACA 5A7QA 4CCOA 4LUMA 3I8TA 3ZSKA 4U2AA 3WP4A 3KGLA 5BNNB 2VW1A 2WNEA 3AYEA 1AYN2 1SZBA 3RNSA 1CX4A 2ZKLA 5J36A 1JW6A 1U0AA 1GQGA 2A75A 5C8CB 2J7MA 3RYKA 3AK0A 5FZ0A 5C3OA 1WD4A 5LZ6A 3WV6A 4AGGA 4D8MA 4CDXA 2DV9A 3NKGA 4FPLA 4QX8A 4BJ0A 2WNUA 1HRI3 3LF7A 3BYWA 5FYCA 1RHI3 2ZX4A 3IAPA 1YIFA 4LBQD 5T55A 4IL7A 5CKNA 1LHOA 5FPXA 2V5DA 5FAXA 1JYNA 4OQ8A 2JG9C 2QZ3A 2FCUA 1HB3A 2VNOA 2WJSA 1PIV1 2WZEA 2Y64A 4QHOA 4ASKA 1ZRCA 1OF3A 3DXTA 3VD5A 3HQXA 1WA6X 2W9XA 4CEWB 4UOJA 1CPNA 2WIIB 4C8DA 4LT5A 2JEMA 1V6OA 2B8MA 3E6BA 1RUD2 4XIOA 3RI9A 2ARAA 5FZKA 1OI6A 2IWGB 3ZXAC 1EAH1 1YYNA 4N9IA 1OUSA 2A70A 4QT6A 1DHKB 1S1AA 4W6YA 5E88A 4ITCA 3MW4A 2A3WA 4WM8B 1PVC2 1UL9A 5A3TA 2BPA2 4AI2A 1R081 5FK8A 1YIPA 5C7GA 5ACA1 1PO23 1UCXA 5JZGA 3INAA 2DYCA 2HWC1 4COUA 2W39A 4GWIA 4D3WA 4EWEA 2A73B 4Q4W1 1V6JA 3LFIA 4Q4W3 4AEDB 1S2BA 2XVGA 3AMMA 1LHNA 1UU6A 4YW6A 4AVVA 2GN7A 3LEIA 4YG0A 3UGHA 4BWOA 4P5HA 5JR2A 4LA2A 4MYEA 2WT1A 1QXJA 4P9IA 1ND2C 2A6ZA 1W0NA 3VL8A 1PGW1 5E89A 2HWF3 5DUWA 4YW7A 4B7KA 2YUEA 2OPKA 2HWE1 2LM3A 3ZSEA 3PUIA 1MS3A 5ABJB 3A22A 1F4HA 2HJIA 2WFPA 4PBPA 5FPBA 1I5PA 2VO5A 3WUDA 2G19A 2IXIA 4IQPA 3AMQA 3OEAA 3VBHB 3E1F1 4MZUA 4FFGA 5C5UA 1ZBA3 4AEMA 2BDRA 5LEJA 2VMCA 5CEHA 1SLIA 2NPIA 5T5PA 5C9AC 1RUF2 2HWD1 5DDJ1 4JCKA 1FPN3 5EJ1B 1KDMA 4FOWA 5LBEA 1FPN1 2KR2A 4CEWC 1OKQA 2PLV1 2I45A 1AJOA 3I3DA 5FP4A 2W1UA 3GDBA 3ZKYA 2ZGUA 3LDBA 5EIYB 2YG0A 4JGZB 2RS32 2VNRA 3IWZA 4LIUA 2Q1ZB 1XNDA 3ZYFA 1JZ7A 2Q8EA 1KGYA 2JXAA 3S57A 2FDGA 2BBVA 5J96B 4XOGA 1F4AA 2Y60A 2RV9A 5JPMB 4QPGC 2ZAHA 4M01A 2CDOA 5L7OB 2ZOEB 1LCLA 4HMZA 1ENQA 2WWUA 5DQ0A 5HBAA 2DUQA 5HCBA 2EALA 5HXVA 4UW4A 5JIAA 3S7EA 5C6CA 3WG1A 1O3SA 3MF6A 4AEDC 1Q8VA 1GYKA 3M1HA 1BEV1 3C8XA 3ZFEC 1HQNA 5A7PA 4SBVA 5CAZA 3PTYA 1HXS1 1K5JA 4Z8BA 1RUH2 4WVVA 4F3JA 4QGMA 3ACIA 3CJIC 4AVAA 1VBA2 5FFOC 3ACLA 1DF0A 2OIIA 4XHXA 4LORA 3LPFA 5FMBA 3JBG3 3EYPA 1W2OA 1UN1A 3WF2A 1UYPA 4QPWA 4BQYA 4LKSA 3LD8A 4I30A 1MEC2 2ZAAA 2DCTA 1ZZBA 4KGGA 4RFRB 4XW3A 1UIJA 2GMEA 2IXKA 5LCWL 3RWNA 2RJ2A 2V73A 5A3OA 3VLBB 2OA2A 4A2UA 1AR61 3S5QA 3FHAA 2O8OA 3WX5A 4Q2FA 3VDBA 5IK8A 1DQ4A 3AB0A 1WLWA 2ERFA 2J1RA 4QKDA 5GLTA 1FMD2 5CFDC 4DEQA 4D69A 5C9AB 2WQ8A 4PT6A 1WZXA 3RMYA 2VC9A 4CCNA 3V0AB 2XJQA 3M3CA 3PMSA 3L2HA 4TWTA 5BXXA 2Q8DA 3N3HA 1PM4A 1N3QA 5GALA 2BQPA 4LO4B 1GLHA 5F5AA 1RUH3 3OYWB 2I2SA 1YI9A 2G9FA 2B46X 2VOXA 2YC0A 5F3EA 1VBB1 2PYTA 2AYHA 2OKXA 1YLLA 4E4ZA 1G9AA 4MO3M 3JBG2 1XNCA 2P4EA 3CHXA 1UMZA 2QCSB 3VBUA 5IVCA 1W99A 2DUPA 4QQHA 4AR2A 4XJAA 3H3UA 5DDJ2 5F6LB 3ECQA 3JUUA 3LDKA 3WF3A 3ZYGA 3SXWA 2UY9A 5FYSA 2VZVA 3KQRA 5DUXA 1V6KA 4AGVA 2Y34A 1HB4A 1YNAA 2HWF2 2PQQA 1B09A 3BALA 4FPCA 3ZXLA 3PVBB 2PAMA 4Y3OA 1HRV2 2XG3A 2R1DA 1AX2A 5SV8A 3NMBA 3ZXEA 1AR91 1OLRA 3O1MA 1LU1A 1O4YA 4Y5TA 5FYUA 2WWSA 4DB5A 4UYBA 1QNYA 3WSOA 3U0ZA 3O1RA 4FXGB 4CCJA 1FT9A 2WINB 5FMOL 1QDOA 1S55A 3WHTA 4FQ4A 3IBMA 3WNXA 1QJFA 3DYPA 1MS1A 4BXSV 1BBT3 1Q8PA 1DGWX 4Q4V3 3SMHA 1W03A 3CJXA 2BTVC 3BB6A 2YPDA 1Q56A 3WQBA 3PU8A 3SEEA 5CA6A 3ENRA 3U07A 2IZWA 2QDNA 5FY8A 3FE5A 4URAA 4GWMA 1DLLA 3N7JA 2B9VA 3W9AA 1LNSA 4N8MA 4Q4Y2 4DRVA 5FPUA 3KGZA 1HN0A 4HN0A 2CU5A 2Q1MA 5FY4A 5IWFA 5LBBA 1RUD1 1J58A 1G8WA 4DFSA 1N1YA 4QWNA 1WLTA 2QQIA 3O1OA 3PVNA 4LXLA 1SBFA 1T2XA 4LHNA 1GZ9A 4FCAA 3N9PA 2K2SA 4XUOA 2BRTA 2XBO3 4KBBA 1G9FA 3VHPA 3VKOA 3O1PA 1W8NA 3HAGA 1R64A 4GALA 1VB4A 3MHZA 2X5IC 1DZRA 3OGSA 2W0XA 2J1UA 1NA1B 4FPGA 4Y5Z0 5IVJA 4HLTA 1UKRA 1MQTB 5HPOA 3D5OA 1ZRFA 1KS4A 2D5HA 3WVJA 1NCRC 4XZPA 4AFMA 1F31A 4CCLA 2WS91 3MFAA 2OS2A 3PJYA 3RI8A 4XURA 1ZVFA 2CL2A 4HETA 4CP9A 4IV3C 1AZDA 5FZEA 4XTMA 3CLPA 1IZ3A 2H6CA 2HWB2 5GLWA 3H3ZA 1DZQA 3ZIXA 4M0NA 2C26A 3PURA 4XYXA 5FZDA 5HI0A 1ST8A 1VPHA 2IUWA 3UV9A 2E33A 5LY1A 3KV5A 1AYM2 2VG9A 4LA3A 3RZZA 1NG0A 1OQ1A 5FZAA 4CEYB 5CKQA 2J1SA 4QHBA 3USUB 1I9RA 1OC1A 3GNEA 2CGOA 4LBKA 3GBGA 4B1MA 2DU1A 3OCPA 3WDWA 1VBC2 2AEZA 2UU8A 2X53S 4JHTA 4CP1A 3J7NA 2W87A 2VD7A 2PTMA 2HEWF 3GF6A 3LEKA 2HBTA 4MHUA 4QB6A 4RS5A 4A6SA 2VZ3A 4UF0A 1HJGA 1SLAA 2RM21 5C3PA 2ENRA 4UBGA 5C4WA 1OA3A 1YRZA 2R49A 5JVVA 4IEPA 3B93A 2J1VA 4WVZA 5FZCA 3ZFEA 2HWB3 3I59A 2R041 4LBNA 4R9AA 1ZRIA 5A7NA 3CQOA 1RMU1 5IK5A 2PFWA 5JOZA 4N53C 1R083 2FDJA 5A7SA 4XILA 1TMF1 2CGNA 3OBAA 5D8AB 1HKDA 4XFGA 1XU2A 1LJ7A 1LR5A 4YVSC 5JLVA 1BLZA 4QXHA 1W28A 4S2HA 2VM9A 1AL22 3DL3A 4AFBA 3B00A 5BNPB 3KF3A 3MYXA 5A33B 1CGPA 1UYZA 1HDKA 2OX0A 4MGSA 3TN91 4CTEA 3O7OA 3DV8A 3GZTB 1LECA 1SHWB 2ZGQA 2E26A 2GC2A 5FTTC 5KXEA 3C2UA 1I3HA 4CUAA 2NN8A 1Z7S2 1OXCA 4COVA 1CVNA 2VZ1A 4AI3A 2YPJA 1FYUA 4QD2A 3IM0A 5LRRA 2EICA 1L7RA 1O4TA 4Q4X2 5KC6A 1X82A 1BYHA 2FCVA 1V6LA 3PUSA 2D6MA 2WNVB 1W8ZA 2D98A 5JI9A 5DZGA 1RB8G 3MEPA 2Q1FA 5FUPA 2Q5TA 2AACA 4R4XA 2QQNA 5FLHA 3DF0A 3USUA 4Y22A 4CDUA 3A4UA 4PQQA 2JDNA 2LROA 2Y0IA 3HR9A 1Q5OA 1TVGA 1SFPA 1AR72 4CRQA 2ATFA 3ZYJB 4BK4A 2A1XA 3W21A 1H1AA 3F95A 1UU5A 4WZFA 1DGRN 4KU7A 2WT0A 1DG6A 5FJKA 1VP6A 2J42A 1AX1A 1QJU3 3RFRA 3SNMA 1NA1A 4XC9A 5BNNC 1POV1 3KCCA 4HOOA 4FOQA 2YXSA 1RVF1 4Q4X3 1KD7A 3H8XA 3WP5A 5KXCA 5KXDA 3Q8AA 1UPIA 4CP9B 1NZIA 1PVC1 2QQJA 4H2AA 2GC1A 2W1QA 5A6XA 2FZ2A 2J22A 1IOAA 3MDPA 1UYXA 4YWAA 2RDRA 1JODA 4E9KA 2JG9B 1I1EA 4DXTA 2UURA 2YC4A 3THTA 4KWKA 3BGAA 4AVCA 4LJHA 4QX0A 4F7ZA 2H0BA 3DCQA 1ULDA 2W52A 3AYAA 3JU9A 3RGBA 1EPZA 4XFAA 2Y33A 4AHZA 4I0WB 1VRBA 4KWJA 1IG3A 4IGOA 1AJKA 4XFFA 4RS5B 1NT0A 5FKCA 3X29B 4CZSA 3U4SA 3VBRC 4AK3A 4JGYA 2WKKA 5EWSA 3C7EA 1QJX3 4XF0A 5HV0A 3OBZA 2ZGOA 3OTFA 4L2NA 3U4XA 2NYYA 1ZZ7A 1SQ4A 2DCKA 4YGCA 3Q8EA 4X8PA 4JZRA 4KG8A 1QWRA 3SKJE 5GKAC 2ET1A 4P02B 1QGLA 5BNOB 1X9PA 2VY0A 2YZ4A 1CAUB 1O3TA 2ORZA 4BCUA 4H7MA 3VD3A 4TLFA 2VMDA 4C0BA 2VXJA 2ZEWA 1NY71 2A71A 2WO2A 1CAWB 3MLKA 1VMHA 2GH2A 1RC6A 3ZFGC 4YW3A 4QPYA 3AX4A 1KJLA 1XXNA 1F5JA 1GZCA 1GWMA 4I0BA 4DINB 1VE0A 2JE7A 3O1UA 1DYKA 1N47A 4RR3C 3AJZA 4ZONA 4P14A 1W3XA 1BZWA 3KHBA 1PHMA 2ADEA 4C91A 4RGGA 1Y4WA 2ZJCA 1IQDC 3FMGA 5I8TA 4EN7B 1JXNA 4LE3A 2OZJA 3UKTA 3KV6A 3CBNA 1OURA 2EXJA 5ABJA 3LPGA 2G9ZA 3KHCA 3P6BA 1CJDA 4CUGA 1ASJ1 2ID4A 3WP6A 2R042 4Q0UA 1XQNA 5EYXA 4I0AA 4ZPIA 3T2OA 3WLUA 1LOFA 3FFQA 2DBNA 1HRI1 2ZGKA 3FBYA 1GQPA 4MH0E 1APNA 2R0FA 4KQ7A 5C8WA 4WV8A 4AYUA 2JB8A 1UD1A 1CQ9A 2A7AA 3BPZA 2Y6KA 1MEC3 1E5HA 2JKXA 2P3JA 2VBPA 4FPJA 1VBC1 4GB31 2QVSB 2VW0A 2WR9A 1PIV3 1G86A 2RDNA 3H1MA 4QPGB 3S0MA 5CG9A 1C8NA 4OULA 3ZR5A 4OUSA 2D93A 3WR0A 2RMU1 3A7QA 3GZEA 3ETPA 4IE7A 1SACA 2J1AA 5IJRA 3RYPA 3NRUA 4XQWA 5CZKA 4B4PA 3LZZA 3EXUA 4Q4Y1 4AVBA 2A3XA 2VMEA 3K75B 4UFIA 2ZHLA 5ERLA 2YBSA 5A1FA 4D6QA 2WNUC 2X5IB 5FZ7A 3QOPA 4PLNA 1ND2B 4IXLA 3J26N 5H9RA 1AUYA 1RUI2 3EMRA 1LOEA 1XNKA 2B7YA 2W47A 1RUJ1 1JS9A 3HWJA 4CYDA 4LO7A 4DPNA 4K6BA 1PNGA 4XXPA 3VZMA 5K8SA 2AC1A 2E53A 2VOKA 3RJRA 3KZ4C 2JG9A 4XJWA 5EXOA 4FVVA 1H1IA 3N9OA 4LTAA 4S2FA 2UWBA 3AKRA 3VBFB 1KJRA 2WL1A 3VHNA 1GP6A 1ND3A 2BW8A 3IT8A 1JMUB 3OOXA 2WRAA 4MADA 4JKKA 1CZVA 4OZOA 2HBUA 4YGEA 4PF5A 5I0SA 1SLCA 4IE0A 1A6CA 1RGSA 1SBDA 3NV4A 4JGZA 4MGKE 1CIWA 1UIKA 2R1BA 3R0RA 1PVC3 4JQTA 2BWAA 2OT7A 4HANA 4COYA 3LE0A 5DAPA 5KHKA 2CSGA 2VECA 5FZ1A 2B4KA 3N7KA 3ZXKA 1OH4A 1O91A 2R0HA 3ZN5A 1RINA 4P9WA 3U11A 4I2OA 4YG3A 3P5BA 5FXZA 3VDDC 2RJKA 3LA3A 4HSJA 4CUBA 5BNOA 5HCHA 4GH4C 2EAKA 1F9KA 4FAGA 2DTWA 1IPJA 2LW8A 3O0WA 1SPPA 4G9SB 2JG8C 4CDWA 2PHXA 4GAZA 3BIWE 5GLZA 3WW2A 1R093 1UF2C 3N7MA 4IV1B 2RMU2 4N7IA 3T3YA 2PA7A 3TEWA 1SCRA 4GMP3 4A3ZA 4D0QA 1XB9A 2D3SA 2HWF1 1VR3A 4Q4X1 1V00A 4OQ9A 3KVBA 3AYCA 5T52A 1S0JA 3OJBA 3NV1A 1MVQA 3J8F2 1KXGA 5IT6A 4TTGA 4CDXC 4EN6B 5F37A 1Z7S1 2WLQA 1CPMA 1YQ6A 1PO11 2F17A 1GNZA 2NMNA 1QEXA 1IS3A 3QBQA 4ASMB 4YG6A 3B5LB 1C1LA 1GFF2 5FOBB 2QDRA 2O14A 3BOPA 2EVXA 4M3CA 1X7NA 1ZZCA 4QXBA 1WMDA 5BUVA 5K0UA 1HB1A 1OHFA 1RMU3 3THPA 3WUCA 3T4VA 3CZJA 3JD71 1ASJ3 2RJLA 5KC5A 3VD7A 2IXCA 1WW5A 1S4CA 4H3WA 5I93A 1YFUA 2DVAA 4FFHA 5T54A 3M4FA 3GHMA 5EP9A 5E6HA 2XJUA 4YZ4A 3QD6A 3T0DA 2VBDA 1XPWA 4I3PA 4C1XA 1UAIA 4Q1PA 4HVQA 1J59A 3J7HA 5JPNB 1JYXA 2VAUA 4QPGA 5A3NA 2D97A 2V4AA 2WNVC 3WG2A 4CU7A 1RUF3 3VBUB 4OHYA 3FHQA 2FDFA 1LGCA 3WG4A 1RUG1 1X36A 4IGQA 1AR63 3I54A 4QPIC 3VZJA 4A7YA 2W1WA 4RFT0 5FV3A 1REFA 1COV3 1NLQA 1I6XA 2WA4A 5T5LA 2HWB1 5FIXA 2WAOA 4N43C 1VAVA 1VRH3 2W5FA 2X09A 2YY1A 5EQUA 3MO4A 4K1YA 2H6BA 5A1AA 2P34A 4FTBA 2OZ6A 1RMU2 4E8CA 5CFCB 2JG8B 2ZTNA 3J9SA 3KWVA 4DUWA 1JZ8A 2GU9A 1RUH1 1YFXA 2D6NA 3I49A 3BI3A 4UFLA 5BPXA 3B7MA 1VBB2 2Y26A 3ON7A 4TYSA 3HD8B 1CZSA 1VBC3 2VPVA 1RUJ3 2IXLA 2WAAA 4WVWA 4A4AA 4FFFA 4PBOA 1RUE1 2YU1A 5K9YA 1UU4A 4YM3A 1S0FA 4UFMA 4L92A 1GANA 3LA7A 1CR7A 1J3RA 2ZEXA 4RSUA 4IE6A 4IV3B 2ZGNA 4QKFA 2YMZA 1W9FA 3N35A 1V9U3 3O5SA 5K4LA 2CWMA 4MVTA 3AVSA 2ILMA 1POV3 4D6RA 1WMFA 3MF9A 4Q4V1 1AR62 2GP3A 1W6QB 1LULA 2QQUA 1FNYA 4Y5SA 2L9LA 2LTNA 1EV12 2HEVF 2XVKA 3T2PA 2I07B 5LK7B 1JYIA 4FQZA 1LHVA 1SDWA 3NL1A 4P5YA 1V0AA 2GN3A 1QOSA 3I2GA 1QQP3 5A3PA 5FY7A 4CEYA 3DECA 1NUKA 1W9TA 5GZDA 5AFEA 1ZA4A 3JD72 4SLIA 2FHRA 4HZFA 2XJVA 5DDJ3 1JZ2A 3SCHA 2AREA 3AKSA 2VZTA 2KA3A 3KB5A 2QQOA 4LLFA 1AF9A 3LIGA 1UZVA 2MEV2 4Q8KA 2RMU3 4Z07A 2PLV2 4AE2A 1QJU1 5C71A 4M4RA 1JU3A 3PHMA 1PO12 1M06G 1N1VA 3LKJA 1RHI2 2PHWA 2R073 2ZGMA 4RHV3 2CV6A 5FYIA 3E5XA 4FAHA 1B35B 1REEA 1YQ8A 5FRAA 5F8PA 1CAVB 3PMEA 1URXA 1H8TA 3CJIA 1XC6A 1QDCA 4GKXA 1W8WA 1W2NA 3AJYA 1C5IA 1AX0A 1ULPA 3M70A 1D0GA 3I3BA 4YVSB 2XJSA 2ZEZA 4UAPA 4ZY9A 5I8SA 5HCAA 5FMDA 4CDQB 2WUHA 4W4ZA 2XJTA 3EHKA 2JENA 3ZFGB 1AR73 4I09A 1OA4A 1R1A2 2C24A 2R32A 5D8AA 3GHNA 2PN5A 1LODA 2XLAA 3ZSLA 1RUC2 3G6JB 4XIKA 2AUYA 3JD73 2GMMA 4DY3A 4RA0A 1QJU2 1X50A 3C3VA 4AFAA 4AQ6A 3Q8BA 4RGAA 2WZ8A 4HK8A 1S0CA 4FOYA 4BLJA 4XACA 5B2GB 2VCAA 5DN2A 3TN92 2EIBA 2P6CA 1DYOA 1GU3A 1ULOA 3K4DA 2VZRA 1JI6A 4FOVA 3R4SA 1YWKA 1QJX1 2ZCWA 1PX3A 3GZUC 2D6KA 3WQ0A 4NMIA 2IC1A 5APAA 1G9DA 2VZSA 2ZHNA 1OQDA 3KCYA 3VBSA 1ULGA 4UFHA 5EPAA 2ZGPA 1TEIA 4BQ1A 5C4WB 2E63A 4V1PA 3AYDA 3VKNA 2JG8A 4XDOA 4P08A 4BZ4A 1LESA 3OD0A 4NRMA 4ZKTB 4CP2A 2JB4A 1WUVA 2VQUA 1CONA 5A7OA 4BQ2A 1NY72 5FPLA 4DUVA 2OPWA 3OUIA 4PLOA 3EJKA 5EHDA 5LA9A 2RVAA 4NHXA 4ATEA 5JXGA 1E5IA 3PU3A 4XAEA 3JCIA 2D6LX 2WS93 3MUZ1 3IIAA 4JRLA 3LAGA 3PIJA 4CPBA 3BCWA 3CJIB 1BCXA 3OY8A 2VQ0A 4XUPA 1HQLA 1MZFA 4XCAA 5FYZA 2BVVA 1KFUL 4LR4A 4K7JA 1ZYBA 2WDBA 3OG2A 4Y4YA 4CDQA 4E2GA 4XMIA 5C3SA 5ISLA 2LS6A 3R05A 1V6IA 1WCSA 4IEVA 1YJLA 3ZYIB 3ZVXA 4UFKA 4RN5A 4UI9L 5LA2A 1HIXA 4QQLA 2NMOA 5C9AA 1UX6A 3SH5A 1VBE1 3MIEA 3I3EA 3AMNA 3R4DB 3L9JT 1BEV2 1RUE3 3HVDA 2VL4A 5G05L 4FO9A 4DQAA 1VAKA 3VBHC 4RS5C 5CFDB 1OLMA 3CL1A 3ATGA 1AYM3 1MEC1 3FUQA 1RUF1 3O1TA 1LOGA 3VL9A 2JDUA 4IEYA 5I0UA 2WN3A 4NROA 1UY1A 1OQEA 2X05A 1JZ4A 5LBCA 1VBA3 5LATA 3POGA 4ET7A 1DQ0A 4ZZ8A 2XONA 4NUBA 5FBJA 4NIIA 1GNYA 4QU2A 2AGSA 2O1QA 2R043 4B7EA 3V0BA 4XEZA 3CEWA 2VUAA 1OPOA 3WP3A 4PIZA 3ILRA 1ZBE2 3BUCA 2VE1A 1VAMA 1GNHA 1LKNA 2QZ2A 5ACA3 1AR93 2Z5WA 1BXHA 1TNFA 1X33A 3OEBA 2VBBA 4OCTA 3RZKA 1NYWA 1RJ8A 5J48A 4RR3B 4YPJA 5LBFA 4LO6B 4QU1A 3UL2A 2WZR3 4LBQA 3TRSB 2VGDA 2R071 2VUCA 4RHV1 2G1MA 2XUEA 3AXDA 3K3OA 3SQOA 5LK5A 3ZFFC 1XSRA 4M0HA 3K46A 3RS6A 1PGW2 1CZTA 5FKBA 3QH7A 1SLTA 4B1LA 1PZ7A 1W6OA 3NNJA 3RZLA 3TYJA 2DWRA 5D21A 2JDYA 5F2SA 1UOBA 1YXWA 1DGRA 3CMGA 4BOWA 3RMXA 1UWWA 5DAQA 4EWDA 3I2JA 1IG0A 4NHYA 3HQRA 1HRV1 2GALA 4UW6A 4UWDA 4XUTA 1QOOA 2N7GA 4AEJA 5LA0A 4LPLA 3ZOIA 1UY2A 1K5MA 1XU1A 2X8KA 2LRPA 5HV4A 4NRQA 2HYKA 4QPIB 3HOBA 3EO6A 4YW1A 1OBNA 1DFQA 2VTXA 3I2HA 3NAPA 1LAJA 3CKHA 2FDHA 3MPBA 4A3XA 3IAQA 4E2SA 4YVWC 2YFUA 1LGNA 2D44A 2EXIA 2SBAA 5E8AA 4LK7A 4ONUA 1PK6C 2MEV1 3A0KA 3PL0A 4PDWA 4D7TA 1SCSA 1PMHX 3ACGA 3B01A 4WVMA 2RM22 3ZDSA 4XBLA 4KNCA 4Q4V2 1WCUA 1JN2P 4NPMA 2VZOA 2BOIA 3HT2A 1I5ZA 1NE4A 1MQTC 2X5IA 3DYMA 3NNFA 2Q0AA 2VQTA 1E57A 2BJSA 3HNBM 4OMCA 1FV2A 4XABA 2BP6A 3LQCA 3UKVA 3Q8CA 3OD4A 3POSA 4DXRA 1OLME 1LHWA 3ILNA 4ZS3A 2A6WA 3AP4A 3RRDA 1ULCA 3M8LA 3WDTA 1XYNA 2CAVA 5J37A 1IKQA 4GB32 5FZ6A 3D3AA 5T3NA 3IPVA 4GWJA 4W50A 5F32A 3ZKUA 3VD4A 4NWVA 3AZVA 1Y43B 1QJX2 4N90A 3H0OA 1XNAA 4IGPA 1MS8A 4Q0SA 2GP5A 5T5JA 1W06A 1W0PA 4GKYA 5FO8B 1A3KA 4DMIA 4DXZA 4CU9A 3IZOA 3Q9OA 2XHNA 4UF0B 4YW4A 2RHPA 3BVCA 4GQ7A 3V0BB 2XH6A 4KGQA 4CU6A 1ASJ2 4NR1A 4A45A 4YM2A 4YLZA 5A3LA 2WN2A 2P5BA 3ASIA 4BE3A 5FMOS 4D7YA 5CB7A 5IK7A 1HX6A 2BNMA 3B9IA 2FDKA 1BQPA 1EY2A 4QDRA 3RDIA 4EWAA 3LOIA 3KLSA 1NAEA 4NRPA 2NM1A 2E6VA 3K77A 2HWC3 1R1A1 3ZX7A 5JZGB 1UZWA 1SPPB 4GMP0 1QOTA 2RS51 2XQRA 4RR3A 4CVUA 2VOTA 4CCDA 4Y33A 5KHJA 1NZCA
chains in the Genus database with same CATH topology
3AP5A 5C8CC 5KBFA 4HN1A 4XE9A 5A33A 4HFSA 1PMIA 4BPZA 4CDQC 1COV2 1U5XA 3JQXA 5L19A 4AQTA 1G9CA 3H1YA 5BNPC 3IMNA 4LEJA 2FMYA 1TQ5A 1G6NA 2WZPP 5F5QA 3VBFC 3P3PA 2XHKA 3SISA 5FOJB 1FX5A 1KDKA 3VKLA 4Y20B 1EAH3 2BVBA 4DZGA 1XE8A 2YGMA 1AYM1 1MZ6A 2Z2SB 4AF9A 4GXLA 3V64A 3OGJA 4L9BA 2GC0A 3FHIB 4E2QA 2A6XA 1BKZA 1GKBA 2HKXA 2NP0A 2DVDA 3POWA 4LHLA 4RL7A 4Q8LA 2DVFA 5C4WC 4BYYA 5L73A 1AL23 2B9UA 1EV13 2A6YA 5FO9B 1JOJA 4IERA 4QQPA 2FQPA 2DCYA 1O3QA 1ZX5A 5L7OA 2F4PA 2R30A 4N7UA 1AXZA 4IV1C 5LEKA 1Z7S3 1RUD3 2XJPA 1AVBA 1D2SA 2W68A 4ASLA 4YRDA 3WCRA 1W6PB 1NCRB 2ZABA 1J3QA 2UWCA 4K3UA 1R091 5KHGA 4ISRA 4ISQA 1ALYA 5JSRA 5FPZA 2XWJB 1H9WA 4Z2WA 4UW3A 2XPJA 2DFBA 3GALA 4X6QB 4EN8B 4C0HA 1EV11 3AKQA 1CJPA 1JH5A 1FOD1 1MS0A 3MIHA 4MSVA 1F8VA 2NLRA 1W2UA 4OVEA 4Z92B 2P3IA 2D43A 1IQAA 1VIWB 3LSEA 4JTOA 2FBEA 2JICA 4LBLA 1AYN3 1ZM1A 2IFWA 3ZN4A 1RUOA 4RQPC 4AI0A 1IPKA 1F5FA 1WLCA 1DBNA 2R6QA 1OFSA 2WQZC 2EIGA 3OYWA 2ZACA 3AM2A 2BFUS 2JKBA 4FTSA 2B5HA 1QJY2 5BV6A 1FV3A 2CWSA 3AZXA 4S2GA 3DUIA 2ZX3A 3AKTA 1LGBA 4YYOA 1QKQA 2Q4SA 1VALA 1DQ5A 3H7JA 4AQ2A 1GBGA 1FXZA 3MGUA 3NWKA 4DOUA 5CBLA 4N9HA 1OOPA 4A7ZA 5L36A 1FI2A 3ES4A 1H30A 3B69A 2ETEA 4HVOA 1REDA 3J8F3 3ZFGA 4Y1ZA 1SMVA 2PHFA 4YFWA 2DVBA 3ST7A 4HKOA 2TEPA 1LOBA 1KQRA 4XPVA 3VBOC 1YFWA 1PGL1 3AMPA 5FBZA 3L2YA 3RSJA 1D2QA 3V0AA 1VB2A 4QXKA 3EBRA 3LGRA 1WCKA 4MGZE 1BBT2 2IXHA 4B29A 5I91A 3CU7A 1DYPA 4ES9A 2CY6A 3H7YA 4KWLA 3ZIWA 2ZHKA 3VHRA 4CP0A 3T1MA 4HKLA 3UK9A 2X29A 2G9GA 2RS13 2E7TA 1T6GC 4OI4A 1WW4A 2WFF1 4CDWC 4Q4Y3 2Y0OA 3DKWA 4WM8A 2XKOA 3BTAA 1H8TB 3WW3A 3H8UA 4F8AA 1UPSA 3NW4A 4PIXA 4TSVA 1WW6A 4AWDA 1ND2A 3ZYPA 4LO8A 1W6PA 1NCRA 3WHUA 3ES1A 4QM8A 4JVAA 1LTEA 2WSUA 3FLRA 3RQ0A 2XL9A 1U5ZA 4XF1A 4ZU4A 3AMHA 4INDA 1ZBE3 1RVF2 1S0EA 1QJZA 1ZBE1 1H1MA 3KM5A 2WFF3 4BIFA 5KWRA 4XHBA 1QQP2 2PELA 1IS6A 3O0XA 3VKFC 1HRV3 1ENSA 2VOWA 3RPQA 4B4RA 3ZXJA 3VBRB 2WZR2 2ARXA 1WLDA 4JV4A 4P9YA 3GYDA 1RUNA 4AG4A 1PO22 3D6EA 4OI1A 3M3OA 1RUI3 1WBLA 2R072 4RHV2 1TNRA 1NXMA 4E4DX 4Q4W2 1AL21 3FFZA 3VDDB 2D6PA 2XBO1 4FPHA 4J1XA 1JUIA 2ZS6B 3DPRC 2XKPA 3FC0A 1DQ6A 5CADA 1RUG3 3FLPA 1VBD1 4JQRA 1COV1 1D0HA 5AC91 3ZXGA 1PO13 2AZ5A 3FWEA 1ZNPA 5CNAA 4XQDA 2EA7A 3NVCA 1C4RA 1AXYA 1FMD3 3NJZA 4QGLA 1TMF3 4UXAA 3W59A 1MACA 4YM1A 2OVUA 1OMIA 5F1RA 1VBE3 1ZBA1 3VUOA 3T2TA 4LBQB 3TN93 3MLJA 2JJ6A 1RUC3 3ZYRA 1SBEA 2PHLA 5CFDA 3LCPA 1W6QA 2YV8A 1XRUA 4HPKB 4NPRA 3VBSC 1ZZ9A 1NCQC 3KT1A 5EZWA 4E4SA 4CDUC 2DURA 4YGDA 3AFKA 1W6OB 4R9CA 2RS12 2CGPA 2GC3A 4OI2A 5JCTA 2QJVA 2FZ1A 4EROA 1DQ2A 2E7AA 1O4ZA 4MX3A 4XQ4A 4OLLA 3JQWA 5I0TA 2ET7A 1NOVA 1XYPA 4YVWB 1QJY1 3CO2A 3DPRB 4W6WA 3NAPB 2Q30A 1LOCA 3T1LA 2D7FA 3SLIA 1WA4A 2VW2A 2BNOA 5A32B 1B35A 1GICA 1W6NA 4IV3A 3M3EA 5JSOA 1ENXA 2AR6A 4XJ9A 5CG8A 4NN0A 1UZYA 1RVF3 4LNVA 5I8YA 1HV1A 4YVSA 1YFYA 3URFA 4G3YC 4M3CE 5AVAA 2PHTA 1FOD2 3AFGA 2XLFA 3K51A 5FQ0A 1L3JA 4Q0PA 3NKTA 2CYFA 5DUUA 1H4HA 1LHUA 3DGTA 4B8EA 4XMAA 4YW5A 4FBFA 3QH6A 1NQDA 3IPVB 2WT2A 4KG0A 3WDVA 2Z69A 2OYZA 1PM7A 2VOVA 5A3MA 5GJ6A 2XB6C 4GH4B 4FPEA 2WQ4A 4LLOA 5BYNA 4OHWA 2RE9A 1AR92 3LA2A 4YGBA 3WT3A 5BY5A 3B94A 3IDCB 3AXEA 1BMV1 3VZKA 1PVXA 4UBHA 2ZGSA 3ZXDA 1C3HA 2VH9A 3E6CC 1C28A 2Y38A 1MZ5A 4JDNA 1GQHA 5EYYA 1PGL2 1H9PA 2RR13 4M3CF 3IN9A 4GMP1 1UW8A 1J1LA 1U5IA 1TME1 1NQJA 1Y7BA 1N1SA 3V56A 4TZDA 2ARBA 3G7DA 5FREA 1X8EA 2C1FA 1BBT1 1H2NA 4GIQA 3SH3A 3WQ1A 4B4QA 3WD5A 1AR82 1JHNA 4O9GA 3TBDA 4J1WA 1WCDJ 2TNFA 5FOBB 2D5FA 3CF6E 1GZWB 1H8VA 3MIDA 1RL3A 3AZYA 4LUKA 4FT8A 4CEYC 5AVPA 4YW2A 2GZWA 4Y20A 3O12A 4W65A 1ZRDA 2I74A 2R062 5LRSA 2DCJA 1C8M1 1XNBA 1J1TA 4BMEA 4JGYC 3FUOA 4P9GA 1DU3D 5H9PA 2RS52 3DPRA 1W39A 1G9BA 1R1A3 1CAUA 4JDMA 4K9SA 1M4WA 2QE3A 1V6NA 3TAYA 1Q8SA 4NHMA 1ENRA 1VBA1 1A78A 5GLUA 4M00A 1W6NB 3FLTA 3JBG1 1H2MA 4JRAA 1NXD1 5D1IA 3ZFEB 3PNAA 2ES3A 1O5LA 4HL0A 1HW5A 4IEQA 4AVSA 5FCCA 3WCSA 2ZMKA 2D3RA 5C33A 1NLSA 3V65A 3HBZA 4Z1VA 4YZ3A 2GAUA 2C9AA 2CNAA 2NZ9A 1G7YA 4ZXKA 1HXS2 2O8QA 1ULFA 4AXOA 3ILFA 4S2DA 2VU9A 4LE4A 1NCQA 1H0BA 4Y26A 3B02A 2ZMLA 4WZCA 1S2KA 4YZ5A 1W6MB 3OBRA 4MXVA 1OLQA 3TNQA 1SLLA 3WOGA 4GB33 4PCRA 2ZZJA 1D4M1 1KITA 1QH6A 4GH4A 5J3UA 5JMCA 4RQPB 2KXLA 4COWA 2WS92 1IS4A 4U36A 4AQSA 4BLIA 3ME2A 5JSPA 1R1ZA 4ZU7A 2KM2A 2VVDA 3I59B 4KU8A 2GMPA 1RTVA 2ZX2A 1U5YA 3PJQA 4FP3A 2NQYA 3MICA 1MZEA 2VUJA 2ZMNA 4IEOA 5FO7B 2P3KA 2RR12 5JIUA 2EF6A 2DFCA 4AEDA 2RS33 5EFUA 2JX9A 1MS5A 1LEDA 2RS31 4DRRA 3I4IA 3S6PA 4Y1VA 4R4ZA 3M2MA 5ABJC 3FZ3A 4UW5A 1KRIA 1NLRA 4YARA 4OHXA 4K40A 3KSCA 2Z42A 3TB0A 1EAH2 3FJSA 4CEWA 4P9LA 4K8FA 5GLVA 4BMBA 5GZEA 4WM7A 2EXKA 1S0BA 1NCQB 4CDUB 2DVGA 5ACA2 4JGZC 4Y1YA 1K5MB 2OUHA 3LWCA 3PLQA 4AI8A 3UJQA 2OUJA 1W6MA 2B39A 3USSA 2JECA 2E51A 3H1WA 4Y1XA 4WBBA 1VBD3 2UYBA 2P37A 3TOJA 1MVEA 3TWIA 1OPMA 1MR5A 2VULA 2GNTA 3LSDA 3WZ1A 4WVMB 5J09A 2MPFA 1DZTA 1AYN1 3UKNA 5JWPA 2DF7A 3NAPC 1FMD1 1IHMA 5CFCA 1PK6B 1YI7A 4GWNA 1HRI2 2VVEA 3M7AA 4MGIE 2K9ZA 1O5UA 2G4IA 3N36A 4QGNA 4XJZA 4YSFA 4FP2A 1HXS3 4AHXA 1ULEA 2E7QA 3ZFFA 4NVPA 5KHHA 1A8DA 4OI0A 4JTNA 2VMIA 4AW7A 1PIV2 4H14A 1V9U1 1AL0G 2FMDA 1CN1A 4OZXA 5T5OA 1EPWA 3ROUA 2O0OA 3KD4A 1N3OA 3R4UA 4RQPA 2DU0A 1POV0 3VZOA 1C57A 4K20A 5FLIA 2A3YA 3VBUC 3M3QA 1ZZ8A 2GDFA 3FBMA 4PQ9A 1PZ9A 4IEUA 4LO5B 3D8CA 3WINE 1QJY3 1ZZ6A 3BU7A 4NHLA 4AVTA 3LOBA 3VDDA 4I02A 3D0JA 4HVRA 1U12A 4BM8A 5JZGC 2EXHA 4W6XA 2ZHMA 3HIFA 3AP6A 5I0RA 3SCGA 1HQWA 1BVVA 5JI7A 1QH7A 4GA9A 2A6VA 3VBOA 3BODA 3IKWA 3MI8A 5C8CA 2PAKA 1BMV2 4D7SA 4ES8A 1HLCA 4KH9A 2VVFA 3MZHA 2HWE2 4L97A 3NV3A 2MNGA 3M3IA 4L8QA 3VGIA 2AH2A 4WM7B 3ZMNA 4AHWA 5DUVA 2WZR1 3WDUA 4G4FA 4AI1A 4IESA 1OFNA 2C0ZA 1LOAA 1ND3B 3WXPA 3GBFA 1SFNA 2V09A 1LENA 4Z82A 5JOYA 4AGRA 4YFZA 2WLPA 1JBCA 1FOD3 2V5YA 1FPN2 4XF9A 3ZPYA 4D94A 4EN9B 1YJKA 1IS5A 2PAEA 4XFHA 5AC92 3AKPA 4MUVA 4Q27A 4FPYA 3KS7A 4XF3A 4XJUA 1BK1A 4NWWA 4XXAA 4NOTA 2HWE3 5GM0A 5K7PA 1RUI1 1XYOA 1N3PA 4A7KA 5FDBA 1IGOA 1QHDA 1J3PA 2UYAA 4COZA 2IXJA 2MEV3 4B3NA 5DG2A 1PGSA 2W08A 2BUKA 1OOPB 2WFF2 4I01A 3GZAA 3VBOB 5DG1A 1FNZA 2A5ZA 2VQAA 3KT4A 4M3CB 3GBWA 4NO4A 5K0UB 2MHFA 2DUOA 3VN4A 1MS9A 1S0GA 3E97A 3MFCA 3MPPG 4FXKB 3WG3A 1W0OA 2XJRA 3E5UA 3S7IA 4QX5A 2CTVA 1Z0HA 2GNMA 3B3QE 3PVEA 2ZGTA 2QFEA 4P9JA 4Q0VA 5KHIA 1X8MA 2IFRA 1Q8QA 4OFGA 3VZNA 4CDWB 1PZ8A 4WM8C 5TSWA 1QMJA 3MW2A 1C5HA 1H8TC 4QMAA 2YROA 3N7LA 1YCIA 4N43B 2TUNA 1RIRA 1VRH1 2RS11 2Q8OA 1DGWA 4YNIA 1DDLA 4HSLA 3CNAA 5KXBA 3MW3A 5D8AC 2P2KA 2Z79A 1RUG2 2B45X 2R063 2BYVE 2R061 3MIFA 1NE6A 4XETA 2JD4A 1VBE2 2RS53 4GULA 4LBOA 4META 1RUC1 5FQ0B 1OOPC 1Q3EA 1TMF2 5EV7A 3U10A 1H2LA 3UJOA 3N4MA 3POYA 4FPKA 5EJ3A 2BNNA 2DTYA 1JTZX 5K0UC 1DGLA 1Z78A 3FX3A 2TBVA 3D82A 3RYRA 4YM0A 1D4M3 5GZCA 4LBMA 1BVP1 4LHKA 1YHFA 5DZEA 1QNWA 3R6SA 1LU2A 5F6KA 1S0DA 4IETA 4XFCA 1QQP1 3D4KA 2AENA 3OF1A 4JC1A 3ZSJA 4R9DA 4XF4A 4PDWC 2LUWA 3P3NA 4Y22B 2HEYF 1PO21 2P17A 2CAUA 3B9CA 3A0NA 1VBB3 2OW4A 4QPIA 4IEWA 3RJ2X 1DQ1A 1KS5A 1QY4A 3H50A 2QQPA 1D4VB 4N43A 1RHI1 4Q26A 2XVLA 3NSTA 2XUMA 3QCWA 4L11A 2ZGRA 4LBJA 2EAAA 4DS0A 2XBO2 4F83A 2BGCA 2WSVA 1CAVA 4X6RB 4XTPA 4ATFA 4BH9A 3VZLA 1Y3TA 1MS4A 3HN1A 1FAYA 3H9AA 4XFIA 4R52A 3OPZA 3O14A 1WW7A 1IKPA 1PNFA 3ZMOA 1QXPA 5GZGA 2BFUL 4XDQA 5BNQA 1LB2A 4HK9A 3I2DA 2D6OX 4C90A 2YHJA 1HV0A 2VMGA 3VBRA 4AFDA 3O0VA 5JDBA 3SHRA 2UWAA 1GV9A 1Y9QA 2GSYA 2XLGA 4MGYE 3SH4A 4HT1T 1LOFC 3IDEA 3KCXA 2HWD3 2PLV3 1JUHA 2H0VA 4QQ2A 4HKWA 3ZSMA 2VXRA 1O3RA 1UKGA 3ETQA 5FLJA 4DY5A 3EQEA 5JR7B 2YYOA 4MXWB 3ZN6A 5F9TA 2K0GA 5JOXA 4PDWB 1GSLA 4BHPA 5J98B 1CAXB 1ZRRA 5IUQA 1WGPA 4YVWA 3VKMA 3TNPB 1SFYA 1C8M3 1KFXL 4EV0A 1YUDA 2QUOA 2RR11 4H7LA 1JYCA 3AZZA 3BOWA 1AHSA 3ALQA 1BEV3 1RUE2 3KT7A 1C1FA 5A32A 4N53A 4K1ZA 2ZGLA 3AP7A 3IDBB 1AR83 3RG0A 3E5QA 1MQTA 1GR3A 5CIRA 3WW4A 4YZ2A 1CD3G 4OUMA 3NV2A 1OA2A 5H9SA 2ZA9A 3S30A 4HPKA 4E27A 1D4M2 1QU0A 3ELNA 4AFCA 4MLOA 3J8F1 1WD3A 4IEXA 1XE7A 5GZFA 1EYBA 3VBSB 4Y1UA 1RJ7A 1C8M2 2E9QA 2B42B 3KMHA 4OHVA 5E1RA 5L7OC 2XWBB 2UY8A 3NO8A 2WC2A 1AR81 2QKDA 3PVOA 1CAWA 4RD7A 3WW1A 3OBTA 3VHOA 3MIBA 3JB4C 1VLNA 2BWCA 2C5DA 1DIWA 4JAAA 1LRHA 5CU1A 3OY8B 1F2NA 1CAXA 4PJYA 4XJ8A 1LEMA 5DZFA 4YZ1A 2R16A 2JE9A 4J6GA 4DNYA 4QQOA 1NA1C 2GNDA 5BNNA 1PK6A 3LB9A 4L99A 2QNKA 2ZX0A 3J4UH 2XGXA 4C1WA 3SITA 1RITA 1R092 3MIGA 1H4GA 2GH8A 3JZVA 5BNPA 4NHKA 1O7FA 3ZFFB 2GNBA 4EJRA 1VJ2A 2PHRA 1TME2 4Y24A 2HWD2 4KL1A 4XFBA 1V6MA 1V70A 3WDXA 3QLQA 5E16A 2PHUA 1GZWA 2DCZA 4IEZA 2BEOA 2ZX1A 1WMEA 3HT1A 4R8HA 1K5MC 1Q43A 2LALA 4MV2A 4PLMA 4MXWA 3ZN6B 2WNVA 5CVRA 3ZXFA 1OD5A 4Q29A 2SLIA 5JAXA 4BIOA 3VV1A 1A8MA 3OGGA 5SV5A 3AZWA 2YDEA 1SEFA 1SLBA 2YGLA 2JDZA 4BA6A 1TE1B 1AXKA 3I7DA 3WY6A 5AFBA 1N1TA 3MLLA 4X8NA 1B35C 3APBA 1AR71 4QM9A 5JOWA 3DN7A 3HMYA 4XBQA 1TME3 4I3GA 5HCFA 2F6BA 3AP9A 4N53B 4CDXB 3JB8A 3WQ7A 2WNUB 4Q0QA 1H2KA 2XL7A 5J7MA 1OSGA 2VNGA 5AC93 3VBFA 1VRH2 1FATA 2ZKNA 2ZPXA 1Q8OA 4WM7C 4P9XA 1ONAA 3K48A 5H9QA 2D40A 1ZREA 2ZZQA 4O9EA 1QXRA 2VMHA 4ORFA 5DXDA 4OHZA 1ND3C 4URTA 3VBHA 1RUJ2 4Q1RA 4FTEA 3WDYA 2HWC2 3D0SA 1ZBA2 1S0IA 4R9BA 1CESA 1R082 1BJQA 3SCFA 1V9U2 5T50A 4AEKA 2ZBJA 1WBFA 3E6DA 4K21A 2WA3A 1QF3A 3W58A 4JGYB 4EN0A 4IV1A 3ZO0B 4FPFA 2D3PA 1EP0A 4FPOB 4HBNA 4XBNA 4AHYA 4LULA 5BNOC 5CFCC 1YO8A 1UZZA 2PHDA 2RM23 4FSJA 4JDOA 1VBD2 3QACA 4LUMA 3I8TA 3ZSKA 4U2AA 3WP4A 3KGLA 5BNNB 2VW1A 2WNEA 3AYEA 1AYN2 3RNSA 5J36A 1CX4A 2ZKLA 1JW6A 1U0AA 1GQGA 2A75A 5C8CB 3RYKA 3AK0A 1WD4A 3WV6A 4AGGA 4CDXA 2DV9A 3NKGA 4FPLA 2WNUA 1HRI3 1RHI3 2ZX4A 1YIFA 4LBQD 5T55A 4IL7A 1LHOA 5FPXA 5FAXA 2JG9C 2QZ3A 2VNOA 2WJSA 1PIV1 1ZRCA 3HQXA 4CEWB 1CPNA 2WIIB 4LT5A 2JEMA 1V6OA 2B8MA 3E6BA 1RUD2 4XIOA 3RI9A 1OI6A 2IWGB 3ZXAC 1EAH1 1YYNA 4N9IA 2A70A 4QT6A 1DHKB 1S1AA 4W6YA 5E88A 4ITCA 3MW4A 2A3WA 4WM8B 1PVC2 1UL9A 2BPA2 4AI2A 1R081 1YIPA 5ACA1 1PO23 1UCXA 5JZGA 3INAA 2DYCA 2HWC1 4COUA 2W39A 4D3WA 4EWEA 2A73B 4Q4W1 1V6JA 4Q4W3 4AEDB 1S2BA 2XVGA 3AMMA 1LHNA 1UU6A 4AVVA 2GN7A 4YG0A 4BWOA 4P5HA 4LA2A 4MYEA 2WT1A 1QXJA 4P9IA 1ND2C 2A6ZA 3VL8A 1PGW1 5E89A 2HWF3 5DUWA 4B7KA 2YUEA 2OPKA 2HWE1 2LM3A 3ZSEA 1MS3A 5ABJB 2HJIA 2WFPA 4PBPA 3WUDA 2IXIA 4IQPA 3AMQA 3VBHB 4MZUA 1ZBA3 4AEMA 5LEJA 1SLIA 2NPIA 5T5PA 5C9AC 1RUF2 2HWD1 5DDJ1 4JCKA 1FPN3 1KDMA 4FOWA 1FPN1 4CEWC 1OKQA 2PLV1 2I45A 1AJOA 2ZGUA 4JGZB 2RS32 2VNRA 3IWZA 2Q1ZB 1XNDA 2JXAA 2BBVA 5J96B 4XOGA 5JPMB 4QPGC 2ZAHA 4M01A 5L7OB 2ZOEB 1LCLA 4HMZA 1ENQA 5HBAA 2DUQA 5HCBA 2EALA 5HXVA 4UW4A 5JIAA 3S7EA 5C6CA 3WG1A 1O3SA 3MF6A 4AEDC 1Q8VA 1GYKA 3M1HA 1BEV1 3ZFEC 1HQNA 4SBVA 5CAZA 3PTYA 1HXS1 4Z8BA 1RUH2 4WVVA 4F3JA 4QGMA 4AVAA 3CJIC 1VBA2 5FFOC 3ACLA 1DF0A 2OIIA 4XHXA 3JBG3 1UN1A 4I30A 1MEC2 2ZAAA 2DCTA 1ZZBA 4KGGA 4XW3A 1UIJA 2GMEA 2IXKA 3RWNA 2V73A 3VLBB 2OA2A 4A2UA 1AR61 3WX5A 2O8OA 5IK8A 4Q2FA 1DQ4A 3AB0A 1WLWA 2ERFA 5GLTA 1FMD2 5CFDC 4D69A 5C9AB 3RMYA 3V0AB 2XJQA 3M3CA 3PMSA 3L2HA 4TWTA 5BXXA 3N3HA 5GALA 1N3QA 2BQPA 4LO4B 1GLHA 1RUH3 3OYWB 2I2SA 1YI9A 2G9FA 2B46X 2VOXA 2YC0A 4E4ZA 1VBB1 2PYTA 2AYHA 1G9AA 1YLLA 3JBG2 1XNCA 3VBUA 1UMZA 2QCSB 2DUPA 4QQHA 4XJAA 3H3UA 5DDJ2 5F6LB 3ECQA 3JUUA 3ZYGA 3SXWA 2UY9A 3KQRA 5DUXA 1V6KA 4AGVA 1YNAA 2HWF2 2PQQA 1B09A 3BALA 4FPCA 3ZXLA 3PVBB 2PAMA 1HRV2 2XG3A 2R1DA 1AX2A 5SV8A 3ZXEA 1AR91 1OLRA 1LU1A 1O4YA 2WWSA 4DB5A 1QNYA 3U0ZA 4FXGB 1FT9A 2WINB 5FMOL 1QDOA 1S55A 3WHTA 4FQ4A 3IBMA 3WNXA 1MS1A 1BBT3 1Q8PA 1DGWX 4Q4V3 3SMHA 3CJXA 2BTVC 3BB6A 1Q56A 5CA6A 3ENRA 3U07A 2IZWA 2QDNA 3FE5A 4GWMA 1DLLA 3N7JA 3W9AA 4Q4Y2 4DRVA 3KGZA 4HN0A 2Q1MA 1RUD1 1J58A 1G8WA 4DFSA 1N1YA 1WLTA 3PVNA 1SBFA 4LHNA 1GZ9A 4FCAA 2K2SA 2XBO3 4KBBA 1G9FA 3VHPA 3VKOA 3HAGA 4GALA 1VB4A 2X5IC 1DZRA 2W0XA 1NA1B 4FPGA 4Y5Z0 4HLTA 1UKRA 1MQTB 1ZRFA 3D5OA 1KS4A 2D5HA 3WVJA 1NCRC 4XZPA 4AFMA 1F31A 2WS91 3MFAA 3PJYA 3RI8A 1ZVFA 2CL2A 4HETA 4IV3C 1AZDA 4XTMA 3CLPA 1IZ3A 2H6CA 2HWB2 5GLWA 3H3ZA 1DZQA 3ZIXA 4M0NA 4XYXA 5HI0A 3UV9A 3RZZA 1AYM2 2VG9A 4LA3A 1NG0A 1OQ1A 4CEYB 4QHBA 3USUB 1I9RA 3GNEA 2CGOA 4LBKA 3GBGA 2DU1A 3OCPA 3WDWA 1VBC2 2UU8A 2X53S 4CP1A 4RS5A 2PTMA 2HEWF 3GF6A 1SLAA 2RM21 2ENRA 4UBGA 5C4WA 1OA3A 1YRZA 2R49A 5JVVA 4IEPA 3B93A 3ZFEA 4WVZA 2HWB3 3I59A 2R041 4LBNA 4R9AA 1RMU1 5IK5A 2PFWA 5JOZA 4N53C 1R083 4XILA 1TMF1 2CGNA 5D8AB 1HKDA 4XFGA 1XU2A 1LJ7A 1LR5A 4YVSC 5JLVA 4S2HA 3DL3A 1AL22 4AFBA 1CGPA 3B00A 5BNPB 3MYXA 5A33B 3TN91 1HDKA 4CTEA 3O7OA 3DV8A 3GZTB 1LECA 2ZGQA 5FTTC 2GC2A 5KXEA 3C2UA 1I3HA 2NN8A 1Z7S2 4COVA 1CVNA 4AI3A 2YPJA 1FYUA 4QD2A 3IM0A 5LRRA 4Q4X2 1O4TA 5KC6A 1X82A 1BYHA 1V6LA 2D6MA 2WNVB 2D98A 5JI9A 5DZGA 1RB8G 3MEPA 2Q5TA 4R4XA 5FLHA 3DF0A 3USUA 4Y22A 4CDUA 3A4UA 3HR9A 2Y0IA 1Q5OA 1AR72 4CRQA 2ATFA 3ZYJB 1H1AA 1UU5A 4WZFA 1DGRN 4KU7A 2WT0A 1DG6A 1VP6A 1AX1A 1QJU3 3SNMA 1NA1A 5BNNC 1POV1 3KCCA 4FOQA 2YXSA 1RVF1 4Q4X3 1KD7A 3WP5A 5KXCA 5KXDA 1UPIA 1PVC1 2GC1A 2FZ2A 1IOAA 3MDPA 4E9KA 2JG9B 1I1EA 2UURA 3THTA 4KWKA 4AVCA 4F7ZA 2H0BA 3JU9A 1ULDA 2W52A 3AYAA 1EPZA 4XFAA 4AHZA 4I0WB 4KWJA 1AJKA 4XFFA 4RS5B 3X29B 3VBRC 4JGYA 2WKKA 5EWSA 4XF0A 1QJX3 2ZGOA 3OTFA 4L2NA 3U4XA 2NYYA 1ZZ7A 1SQ4A 2DCKA 4YGCA 4X8PA 4KG8A 1QWRA 5GKAC 2ET1A 1QGLA 5BNOB 2YZ4A 2VY0A 1O3TA 1CAUB 4BCUA 4H7MA 4TLFA 4C0BA 1NY71 2A71A 1CAWB 3MLKA 2GH2A 1RC6A 3ZFGC 4YW3A 4QPYA 3AX4A 1KJLA 1XXNA 1F5JA 1GZCA 4I0BA 4DINB 2JE7A 1DYKA 1N47A 4RR3C 3AJZA 4P14A 1BZWA 1PHMA 4C91A 4RGGA 2ZJCA 3FMGA 5I8TA 4EN7B 1JXNA 4LE3A 2OZJA 3UKTA 2EXJA 5ABJA 1CJDA 1ASJ1 3WP6A 2R042 4Q0UA 1XQNA 5EYXA 4I0AA 3WLUA 1LOFA 3FFQA 1HRI1 2ZGKA 3FBYA 4MH0E 1APNA 2R0FA 4KQ7A 5C8WA 4WV8A 4AYUA 1UD1A 1CQ9A 2A7AA 3BPZA 1MEC3 4H55A 2P3JA 4GB31 4FPJA 1VBC1 2QVSB 2VW0A 1PIV3 1G86A 3H1MA 4QPGB 3S0MA 5CG9A 1C8NA 4OULA 4OUSA 2D93A