4AFAA

Crystal structure of subtype-switched epithelial adhesin 1 to 2 a domain (epa1to2a) from candida glabrata in complex with glycerol
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
227
structure length
227
Chain Sequence
b'SKDPTTFPLGCSPDITTPKKGLSMELYSYDFRKKGSYPCWDAAYLDPNYPRTGYKSHRLLAKVDGVTGNINFYYHATKGCTPQLGHLPASYNYPKPLTMTNFTMLLYGYFRPKVTGFHTFTISADDLLFVNFGAGNAFDCCRRDSSADHFGNYQAYAIWGSKTAKDELTVHLDAGVYYPIRLFYNNRDNNGALSFTFKTESNENTVSDFSEYFFSLDDTEEGCPGLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPA1P
publication title Structural Basis for Promiscuity and Specificity During Candida Glabrata Invasion of Host Epithelia.
pubmed doi rcsb
source organism Candida glabrata
molecule tags Cell adhesion
total genus 60
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10528 GLEYA GLEYA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4afaA00
4AFCA 5A3LA 2XJRA 2XJSA 4AFBA 2XJUA 4COWA 4A3XA 2XJTA 4AHXA 4LHKA 4AHYA 4COZA 4AI1A 4AI2A 4GQ7A 4AHZA 4CP1A 2XJVA 4COYA 4CP0A 4AFAA 2XJPA 4LHLA 4AI0A 4COVA 4D3WA 5A3MA 4COUA 4AF9A 4ASLA 4AHWA 4LHNA 4AI3A 2XJQA 4CP2A
chains in the Genus database with same CATH superfamily
1BVVA 5D8AA 1BZWA 2VNOA 3ZYPA 4RS5C 2VVDA 2JECA 2ZMKA 4Q4W2 2BPA2 1RUD3 2OKXA 4GMP1 3EJKA 1OLRA 2HJIA 4A3XA 1PVC2 3DEMA 5FUIA 4XUOA 1PX3A 2HEVF 3HQXA 3NNJA 4HVOA 4UFLA 4DB5A 1A3KA 2W68A 3PMEA 2XQRA 1RUG2 3HD8B 1IS6A 2VG9A 2ZXQA 4FSJA 2W46A 2AUYA 4I3PA 3PTYA 1AYM2 4M3CF 3VDDA 3DPRA 4IEUA 4LBKA 3LZZA 2ARAA 4FCAA 1ND3A 4YZ4A 1IPKA 4B7EA 4AXOA 2IVJA 3KVAA 5FYHA 2QQVA 1XNKA 2HYKA 2QQMA 4WVVA 5CIRA 2CU5A 1AR73 4UW3A 3S7EA 4XFGA 2JXAA 3LGRA 3OCPA 4K8FA 3SCGA 1LNSA 2PA7A 2WWJA 4CDUC 3I2DA 4UW5A 4Y5TA 4Q8LA 5FUPA 4UOJA 2GNTA 4RD7A 1B35C 2HWE2 3RGBA 3ZYIB 1ZREA 4MXWA 1MEC2 3BN6A 4QB1A 3T1LA 5B2GB 1DQ4A 4ISQA 2DBNA 1UY3A 1WA4A 4R8HA 1QEXA 2BNNA 5FK8A 4LEJA 2WSVA 1BK0A 3K4AA 1OUXA 3IDAA 4M01A 2D6OX 4EZHA 4FOVA 1IZ3A 3GDBA 4ZKTB 3HBZA 2A3YA 5F8PA 3IMNA 2VY0A 2BU9A 2YU1A 5FPBA 3ZSLA 2FDKA 1YI7A 3ELNA 1QXPA 4YGEA 2WNUC 4CP9A 5EQUA 5A33B 4QXCA 1UO9A 4D6SA 3W5NA 1TMF1 1GSLA 1DQ2A 3JB4C 2WT0A 5C3PA 1O8SA 2RMU1 3HEIA 5A6YA 3A4UA 3K4ZA 2WR9A 5A3OA 1QQP2 2D44A 2R071 4QX3A 5FZDA 3U14A 4B29A 3TNQA 2JX9A 2ZKLA 4AEDB 1IQDC 2UURA 4FPLA 1BKZA 1UZZA 3OGRA 1LENA 4KQ7A 2Q8DA 3DUIA 2W91A 1X9PA 4IEQA 3SKJE 3WCSA 2QCSB 4L11A 1MS5A 2YC4A 4FQZA 1TVGA 1VBB1 1YNAA 4IV1A 1W03A 1QJY2 2BDRA 4Q4Y3 5T3NA 1D7PM 2JKXA 4XUNA 1DYPA 2V5YA 5AVPA 5IT6A 3RNSA 4KL1A 1WW7A 4TWTA 1DGWX 5G05L 2BWCA 4YG3A 5FDBA 2IXKA 4CCDA 5C3OA 4DNYA 2ZX4A 4AFBA 5CFCB 5T5LA 4Z82A 1LRHA 4PDWA 1ZBA2 3CO2A 3FL7A 4FVVA 1LHVA 4B4RA 2RDQA 1VB2A 5KHGA 5A3UA 2TEPA 2EF6A 4MXVA 4YWAA 3OEBA 3FLPA 2RM21 1BXHA 5FY7A 1JH5A 1NLSA 3KHBA 3NAPA 2WSUA 5LA1A 1ASJ3 3VBFB 4L97A 1HXS3 3LF7A 4RHV3 1OQ1A 1RUI3 2UYAA 3H3LA 4LBJA 4ZY9A 4XE9A 3ILNA 4NRQA 3WP6A 1HN0A 2IVIB 3BIWE 1VPHA 3WNLA 4YM3A 1APNA 4CCKA 5ANQA 5K9YA 3KV4A 3PLQA 1CX1A 4BQ3A 2J1SA 5KBFA 4XFFA 3RVHA 5AC92 2CSGA 5GJ6A 4XETA 3ZSKA 1F8VA 1UKRA 5GZCA 4YZ5A 2TUNA 1V9U1 1DQ5A 3MEPA 4QPGB 1JU3A 4QXKA 5EYXA 4A42A 1JYVA 4QX2A 1AL23 1EY2A 1WKYA 2ZGOA 3E5QA 5IFTA 3KGZA 5DUVA 5LW9A 5JLVA 4AZZA 3O12A 3SKVA 3R4DB 3MLJA 4LJHA 3ST7A 2EIGA 3ZFFC 1FATA 1GKBA 2Q8CA 4CUBA 3WSOA 1IG3A 4LIVA 4LUMA 2RS31 4PQ9A 4BQYA 1UX6A 2VMDA 1D4M1 4I0WB 5KHKA 3H8XA 1FX5A 2X5IC 3POGA 5CISA 5FP7A 3ZR6A 1C3HA 4HETA 1AR63 4U36A 2FHRA 4IERA 1TMF2 3ETQA 4OHVA 5BNPB 2RMU2 1URXA 3C3VA 5LATA 3T2QA 4RS5A 5JIAA 1WMEA 4AFMA 4LT5A 1AYN1 1OXCA 1SBFA 5FPZA 1N3PA 2RR13 1O3QA 3Q8FA 2WWUA 2PHRA 3AMNA 4CUAA 5FTTC 4JHTA 3A21A 3E5XA 4R9DA 1CJDA 2RS12 4HKOA 2QUOA 1GP6A 5FBZA 4XW3A 5FZ6A 3HNYM 1RTVA 3C7GA 2J1EA 2YPJA 3SC7X 1Q8QA 2AYHA 2BWAA 3MW4A 3ZFGC 5I93A 1AR82 1J84A 1ULDA 1XSQA 2P4EA 3MIEA 3NQHA 4C1XA 4URTA 5LRSA 2YDEA 2A71A 3H0OA 4CDUA 1AHSA 4A44A 1RVF3 3I8TA 4KWJA 4AHXA 1WW6A 2P17A 2H6BA 2V73A 2JENA 3C7HA 2FDGA 1B35A 2Y33A 2AEYA 4JTOA 4KU7A 3WT3A 4CP1A 5DZGA 4CEYB 1COV2 1KS4A 2VOWA 5LEKA 3DKWA 4DXZA 1K5MB 3WNOA 1XYOA 1S0BA 1MZ5A 2YV8A 4P9YA 3H3ZA 5FZMA 5A7QA 1QKQA 1YQ6A 1U5ZA 4GB31 4L0PA 3LA3A 1U12A 4N43B 4TTGA 5C9AB 3CHXA 4FOYA 2BGOA 2QQPA 1W8FA 1NT0A 3P6BA 3LDBA 2YBKA 4JKKA 4QX1A 1YIFA 2D93A 2WNUA 5D8AB 2E7TA 3EO6A 1Y9MA 4IQPA 4LULA 5C5UA 5LEJA 3H8OA 2WT1A 4I09A 3I59A 2DCTA 2LROA 2VZ1A 4CU8A 1TME1 1N1TA 5H9PA 3OD0A 4MGQA 5LA2A 1ACCA 1UIJA 3WDYA 2WKKA 1ONAA 3I7DA 4COUA 2R0HA 4NO4A 4XVHA 4JDOA 2VC9A 2OUJA 1MQTB 1GZ9A 3QH7A 3AP7A 3HT1A 1D4M2 2OPWA 3N7KA 4UFJA 4WVMB 3DPRB 4K1YA 4QM8A 3BYWA 4I02A 2Z79A 1HRV3 4OQ8A 3B00A 4XFIA 3S0MA 4NIDA 4HKLA 4JGZC 2DUPA 1W6NA 3ZSEA 5HV0A 4Y5Z0 2YC0A 5A32B 2NN8A 4Y1VA 1UOJA 4CCOA 4Y33A 4UT5A 4O9EA 4XQ4A 1FMD1 1JYNA 2HH9A 3VKMA 5IVFA 3E6CC 3SH5A 1ZM1A 2EXKA 2HWD3 4FP2A 1JS9A 1GMMA 4UBHA 4CVUA 5HXMA 2DYCA 1NAEA 5FMDA 2W47A 1I1EA 2VECA 4R52A 2C1FA 5DAXA 3B9IA 5J36A 4MGTA 2A75A 3WG3A 1FAYA 1US3A 2J1TA 4PLOA 3ZDSA 3E6DA 2JB4A 2B42B 1UU6A 1DQ0A 3AXEA 5E8AA 3U10A 4S2GA 2GNBA 3QBQA 4XACA 3RI8A 1PZ8A 1VBD3 1XC6A 2CY6A 4ZS3A 1IKQA 2EICA 3C7EA 5FZFA 3WF4A 1A8DA 3ZLIA 2WQ8A 4YW2A 2ATFA 2WNOA 2LUWA 5C3SA 3JQWA 2WLPA 1SLBA 2VOKA 1E5HA 2VZPA 1A6CA 1ZBE3 4Y4RA 1CWPA 2C24A 5DG1A 1OUSA 4IE5A 1PNFA 1CESA 3WLUA 3ZPYA 1REFA 1OHFA 3OPTA 3DYOA 4B7KA 5JAXA 4WZFA 1LECA 3ZXEA 1QH6A 4B4PA 1IS4A 2DU1A 4UBGA 2PYTA 4IV1B 4QQHA 1R091 2DBIA 1MVEA 4N9IA 4OYUA 1Y9QA 2X5IA 3FX3A 4DXSA 1PM7A 1JYCA 4CCLA 1LGCA 4UFKA 3LSDA 4AR2A 2C9KA 4GQ7A 1W05A 4LE4A 5CU1A 3UYJA 3RWNA 2AEZA 3F95A 2AH2A 3TEXA 1HB3A 1G9BA 2DUOA 4BXFA 4BLIA 3KV6A 4AEDC 4XABA 3PVBB 2RS52 1QMJA 3H1MA 1Z78A 3G7DA 5JVVA 3WG2A 2ARXA 1GUIA 3BVCA 4KG0A 1RHI2 1FYUA 1CPMA 1HX6A 2P37A 3N9NA 2ZGRA 3ZXDA 4H7MA 4QGLA 1CAUA 3CQOA 1HW5A 1VBE3 3OBRA 3KGLA 4RGAA 2D40A 2N7GA 1HRI3 1W8WA 3OJBA 3O1RA 2PLV3 4OULA 4YNIA 3ZFGA 4Q4X3 1W6PA 5H9RA 1H6YA 4LA2A 1OH4A 4BB3A 5CFCC 1S2KA 4ZXKA 5FK7A 3SH4A 4LKDA 1AXZA 4BDVB 2R042 4IL7A 2R063 2ZMNA 4LTAA 2UWCA 4IDZA 3WQ0A 2IXHA 2YBSA 3POIA 4X8NA 4RFT0 1GZTA 1GWLA 4DUWA 5KC6A 5L7OB 5BPXA 1GICA 3MI8A 3VBFC 5IFPA 2YGMA 3HMYA 2ORZA 3I97A 3O1VA 1U0AA 3ZN5A 4AVBA 4GWIA 2V4AA 1YCIA 4Y26A 1YQ5A 1UL9A 1W8TA 1N3OA 1RUC3 5FMOS 1O59A 1BEV1 3IPVA 2VCBA 2QJVA 4Q27A 4XZUG 3WF2A 1WW5A 3WY6A 1W04A 1ENXA 2VZRA 3GHNA 4DRRA 4JGYB 5ABJC 1QJU1 4DIQA 1CZTA 5KXEA 3O1MA 1RUF1 5LBBA 3VZOA 1LOFC 3GHMA 5K4LA 3LEIA 5L73A 3QH6A 4ORFA 4ISRA 2XWBB 2BBVA 2WRAA 2Y6FA 1AX0A 3CJIB 2XGXA 4A6OA 3NSTA 2CTVA 1SG3A 5FWEA 5GM0A 4ZZ8A 4ZHNA 1RUJ3 4AI8A 4KNCA 2PHDA 5DAWA 3NW4A 4HT1T 3IDBB 1VBC1 2W94A 4UF0A 3RI9A 1NE4A 1U5XA 5AFEA 1XPWA 4IUGA 5BV6A 1JBCA 2P3IA 4LBQD 5A80A 4AG4A 4UW6A 3KD4A 4JGZA 5BNPC 1PGL1 4K1ZA 1RMU1 2Q5TA 1W0PA 3AP4A 1J83A 4B3NA 4E4ZA 2E7QA 3P3NA 4CDUB 3K75B 1C8M3 1OQEA 5FZCA 1V6NA 2BGCA 3RDIA 1DZQA 1HQLA 3T0BA 1N1SA 2VTXJ 4QX8A 3NVCA 2WS91 1MZFA 1I5ZA 3MV11 3OSDA 4HN0A 4YM1A 1YLLA 2QQJA 3MGUA 5F6KA 2O14A 2ZZJA 4OHWA 3ZYHA 4V2WA 4FP3A 3KZ4C 1PO12 2MHFA 5A3WA 1YQCA 5KC5A 2W9XA 5FLJA 4R9CA 5A3NA 1QDOA 1LOEA 4YGBA 4AI9A 5FZ1A 5GZEA 4XBNA 1QY4A 4Y1XA 4YW6A 3JQXA 4NJ4A 3E6BA 3QACA 2HWB1 3I59B 2E33A 2RJLA 3R6SA 1QJFA 1XB9A 1EAH3 1J3PA 1RXFA 4G4FA 4XXAA 3KV5A 3QOPA 3T2PA 4BXSV 5FYSA 1X8MA 5C8CB 3V0AA 4M4PA 1DGRN 1VBA1 4FPGA 1UX7A 5J96B 3MV01 1HLCA 2Q8OA 1ODNA 5A3LA 1EV13 5BNQA 1K5MC 3OUIA 1MS1A 4YGDA 5JCTA 1QGLA 3OBAA 3AKPA 5FZGA 4UFHA 3AK0A 2YG0A 1VLNA 3HAGA 3WNXA 5JPMB 1W2UA 2EAAA 1W8ZA 2E9QA 2XLAA 4QAWA 5EJZB 1GZWA 1SDWA 5C9AC 5LK5A 3MYXA 4N8MA 4QX0A 1PZ9A 1LAJA 2JDNA 1YI9A 1BVP1 3WDXA 5EV7A 2EXIA 1RUE1 1UY4A 3T4VA 2RJ2A 4RR3C 2HYXA 5A33A 2VCCA 4CCEA 1WD4A 2RDNA 3AYCA 1RUF2 2C5DA 4META 4Q0UA 5E89A 1UW8A 1FOD3 1WZXA 5EP9A 2AZ5A 2DUQA 5FYIA 4AVCA 4IEWA 3RYRA 4D7TA 3CF6E 3KQRA 1H2MA 5FREA 3OGGA 1LJ7A 3IIAA 1SLAA 1JI6A 5I0UA 4AEDA 2HWF1 1A8MA 5HXVA 2Y34A 1LHNA 3N7JA 4YW3A 2D3RA 3QD6A 4DO0A 1GR3A 3CNAA 5FOJB 1MQTC 1C5IA 1JW6A 1RIRA 3NJXA 3NNGA 4Q29A 2WZPP 2ETEA 3HWJA 1VBC2 3CBNA 1TNFA 1BLZA 3BODA 2QE3A 4FO9A 3M7AA 2JE8A 4QDSA 3RS6A 4CDXB 2DTWA 4NAMA 4KWLA 5IUQA 1FPN1 3AZXA 5DDJ2 1AXKA 1PGL2 2DVBA 4EWEA 4D3WA 5LK7B 1REEA 4NIIA 1SDDB 1OPOA 1R1A1 1GWMA 1YFWA 5CFCA 2ZABA 2RV9A 1MS9A 5DMYA 1LR5A 2PHXA 2F4LA 1TQ5A 5FZOA 2D5HA 3FLRA 2GN3A 3J7LA 2P6HA 2WS92 3Q8BA 3H50A 3R05A 1PIV3 3T0DA 1WLDA 3L2YA 4YVSC 4MG2A 2PQSA 4W6YA 1AX1A 4W8JA 1R1ZA 3ZXJA 3VBFA 4LK6A 1BBT3 3M2MA 4QX5A 1S2BA 5DUWA 5F5CA 1UZYA 4IEXA 2WZR1 3MICA 4I0BA 4FOQA 1NLRA 3NRUA 2ZAAA 1ZRCA 2VVEA 4QKNA 3AMQA 4QKBA 3K4DA 3THDA 3LAGA 5IVEA 5FQ0A 3ZSMA 2A1XA 2E6VA 1NZIA 4XBLA 5ABJA 1RJ8A 4JKLA 1VBA2 2C9AA 2XJRA 2ZX2A 1SFYA 1DGLA 3DGTA 3BGAA 3PJYA 1LOFA 3F2ZA 4ZONA 1FNZA 1W8HA 1SLCA 4Q4W1 2FD8A 3D82A 3PURA 4QB2A 3THTA 5J09A 1PVC1 1WCKA 1I3HA 1S2EA 2D3PA 2F6BA 2VMGA 1PMHX 1LGBA 2BNMA 1XYNA 5FXZA 2WNVB 3AZVA 2WBKA 5A70A 2BQPA 1UNBA 3K77A 1VAMA 2I45A 3IT8A 3MBWA 4XHXA 1WLCA 5G04L 1AYM1 2A6WA 2VOVA 4QU1A 2J1AA 1RUE2 2XBO3 3D0SA 4Y3OA 5FZBA 3O0VA 4RA0A 1W6PB 4JC1A 4EN7B 1E5SA 1WW4A 3J8F3 5BNPA 4KU8A 3O1TA 2WZEA 1JZ4A 2GALA 2BNOA 1BCXA 5FZ4A 5A7OA 2WLQA 4W6WA 4O65A 1F35A 1CAVB 3JD73 3LE0A 3POEA 1V6JA 5FO7B 1LOGA 4DEQA 3WCRA 1YJKA 2H6CA 2HWE1 4ES9A 3GM8A 2ET7A 2W0XA 1MEC1 1O5LA 1VRBA 4LBQA 4FXGB 1SCRA 3M70A 3RFRA 1VRH1 4LHKA 2NP0A 4V2VA 1CN1A 1QJX2 2B45X 4W6XA 4QMAA 3EYPA 5DZEA 1UZWA 4LHLA 5LBEA 1ALYA 1J58A 3A0KA 5JI9A 2C6SA 1O7FA 4UI9L 3RJ2X 3ZKYA 3ZXKA 3M3IA 4JV4A 3VBOB 3UNPA 4LHSA 4K6BA 4DINB 3E97A 5FZLA 4P5HA 2Y6HA 5A7WA 1UU5A 3FBMA 1QOSA 1OVSA 1JZ3A 2AREA 1KD7A 1W9FA 2JDYA 2NM1A 2X10A 2YYOA 1QQP1 3AZYA 1ZZ8A 1FT9A 1ZA4A 2OA2A 3TRSB 1DBNA 3WR0A 3WNMA 4FPOB 5D1IA 1F31A 1EYBA 3A23A 5A3PA 2B8MA 5JIUA 5L7OC 3RZLA 1PO23 1UKGA 2B4KA 3AXDA 3POFA 1K5MA 5HPOA 5FZ3A 4AHZA 2BGPA 3CJXA 1YUDA 4GMP3 2IFWA 4YW1A 1EPZA 1S55A 4Z8BA 4UF0B 2LM3A 1AR92 5LBCA 1QJY1 5C9AA 4DUVA 5LASA 1J3RA 2Y26A 3KSCA 1GNHA 1BJQA 4JGYC 1REDA 3HIFA 2O8OA 4QB6A 4RR3A 4IV3A 5DZFA 5TSWA 3ZXAC 3NNMA 4XF1A 1RUH2 4KG8A 3CL1A 3GNEA 1ZBA1 1PM4A 2YFZA 4URAA 3OPZA 1JYWA 2JEMA 2W3JA 3B5LB 1HIXA 3ZMNA 3PMSA 1FV3A 2Y60A 1W2TA 3CJIC 1ULEA 4NHKA 4AFAA 3VD9A 1CR7A 2ZGKA 5IJRA 1I6XA 1MQTA 1E57A 2ZJCA 4XAAA 2W95A 1YEWA 3E5UA 3RZHA 4WVMA 2P2KA 4NHXA 5A6ZA 4BMEA 2EIEA 2RHPA 3PVOA 3M3EA 1V6OA 2QBXA 4TLFA 3SXWA 2E32A 2VZVA 5A32A 5I0DA 1SBDA 3UK9A 2CAVA 2D6KA 2AR6A 2XWJB 3DXTA 2YFUA 5GALA 4AVSA 4B1MA 1SMVA 5AC91 2ZX0A 3V0AB 2WT2A 4MH0E 2GU9A 3URFA 1DGWA 4KBZA 4MHRA 3VB9A 1VE0A 1VRH2 1AF9A 1O3TA 3IDEA 4A4AA 3HN3A 2R073 4YVSA 4PLMA 5FZEA 1R082 2PXJA 1CAWA 3LEGA 4OUEA 3WP3A 4YZ1A 1UWWA 4CDQC 3A22A 1GZWB 2HWC3 5T50A 2NZ9A 2K2SA 2C4XA 3C7OA 1UYXA 3JBG2 4INDA 4HPKB 5CKNA 1VBB3 1GANA 3TYJA 2ZMLA 3LEKA 4QWNA 3VDBA 5FY9A 2GMPA 4LBNA 3K2OA 5JWPA 1X33A 2W5FA 2YGLA 5LY2A 1UMHA 2ARBA 2ZTNA 5IVJA 1M06G 3M3QA 5CG8A 4KWKA 1XJAA 5KWRA 5C8CC 1QJZA 1SCSA 3VBSB 1NUKA 1YC61 3AC0A 1OVPA 4AI2A 3ETPA 2B7YA 2XJVA 4LUKA 5L9VA 2FZ2A 1BQPA 1IQAA 1HKDA 4JCKA 4OLLA 4XZPA 2P3KA 1CZVA 3WUDA 2RS11 2D6LX 2XXZA 1JZ8A 4NIHA 1H8VA 2WO2A 5LA9A 2XVKA 2RM23 3ZM8A 4EZ4A 3B93A 3T4HB 3FZ3A 1YWKA 4XBQA 5C5TA 1UCXA 4ZXEA 2WFF2 1AR81 4RQPC 3V56A 4NE9A 4E9KA 1W8UA 1RB8G 4XF3A 4XJAA 4YLZA 5LB6A 2R7EB 1XE7A 3M3OA 5FZOB 2QQWA 4LKFA 5F5QA 2V5DA 4NHMA 2J1VA 4Y24A 4UWDA 5FWJA 5J7MA 4MSVA 4YRDA 2VCAA 1COV1 4BMBA 5KXBA 3WNPA 4E2GA 3EXUA 2JDPA 1NQDA 3CIHA 4IGQA 2WIIB 3IDCB 5E16A 3MIHA 3UT0A 4L2NA 1QOTA 1V9U3 4LR4A 2DCZA 4Q1PA 4OI4A 1LEMA 1YIPA 4LBMA 4XCBA 3FFQA 4FFIA 4XIKA 5T54A 3T2OA 1H8TA 2VUJA 3KT4A 2B5HA 2GH8A 4R4ZA 1ND2B 2IXIA 3BOPA 4XJUA 3TN93 3GF6A 3POYA 3PJQA 4J1WA 1VAKA 2RS33 1NCRB 4YGCA 1U5YA 1V6KA 5FQ0B 3WDTA 5ABJB 2XB6C 4J1XA 3SCFA 2CGNA 1Z7S2 4TSVA 4Q4Y1 1OKQA 4HLTA 4IE7A 4K21A 3RZMA 2ZX3A 3VHRA 4OI1A 3UV9A 1S4CA 2WO3A 5E6HA 5FYCA 4D8MA 5ACA2 2FDHA 2PAMA 4TLGA 4CU7A 4FPJA 4FPKA 2ERFA 4QQLA 5L7OA 3BALA 4MVTA 4ZZ5A 1AYN3 3OBTA 1H0BA 1DGRA 1RUD2 4BU2A 3VZNA 2G4IA 4BQWA 3W5MA 5IVCA 4KH9A 3SH3A 4KWUA 2VO5A 4Q5OA 5EIYB 5EPAA 2FDJA 4EN9B 1PGW2 4E2QA 4HN1A 4P08A 4XF9A 2V72A 4JGYA 4WV8A 1HXS1 1PK6C 4RFRB 4RHV1 4FPYA 4DZGA 1NG0A 4O7XA 3WX5A 5FPVA 3GCXA 4BK4A 5FYYA 4Z2AA 1POV1 3I3BA 2PFWA 3LQCA 1AR72 1NCQC 2BV4A 3N9MA 1HJGA 1SPPA 2CAUA 3FC0A 3PU3A 4LBQB 4LNVA 4Y22A 4EROA 5I91A 5FOBB 2DDUA 1KFXL 2TBVA 3CJIA 2WNVC 1WCDJ 2VJXA 3W20A 4XDOA 4ITCA 4FTSA 4YSFA 4BISA 1GP4A 2VAUA 5FP4A 5A7SA 3D8CA 4NUBA 4M00A 3MLKA 5FR3A 4WBBA 5I8TA 4C1WA 4XTPA 4K9SA 4CPBD 4IETA 2VCMA 4GB33 1WCSA 5DQ0A 3JUUA 4WM7C 4Q26A 3ZR5A 5LCWL 5A7WB 3AM2A 2BZDA 2ZEWA 3EQEA 3MW2A 2ZGMA 4R9BA 5L9BA 4QPWA 3C7FA 2PTMA 5JMOA 2Y6GA 3AMMA 4P9JA 2ZCWA 4HVQA 5FXWA 2R1BA 1TME3 3AJZA 3VGIA 1UY0A 3WQ7A 2KM2A 4EN0A 3ZOIA 4A7KA 2J42A 4CDQA 2WUHA 2ZGPA 5EJ1B 1AJOA 3T3YA 3B9CA 1Q5OA 5DUXA 3VD5A 1WMXA 5F9TA 2RR11 1G9FA 5FO8B 3ZFEB 5BXXA 1XNAA 3VBOC 3O1OA 2QTWB 2WDBA 2KA3A 1ENQA 4RR3B 4IV3B 3AP9A 3I4IA 2YROA 4Q4Y2 2WFPA 1WCQA 2Y0OA 2D7FA 1ZVFA 4LO4B 4ZU7A 2JE7A 1Q8VA 2PHLA 5C8CA 3FJSA 1UAIA 2RS51 1W6MA 1ODMA 2JIGA 2QQOA 2WZ8A 5FYUA 4Y5SA 1MPXA 1CIWA 1FMD3 4GMP0 1E5IA 1RHI1 3KQ4B 1RVF1 2DFCA 2RDRA 4IEZA 4Y1ZA 2HBTA 4KGGA 1MS8A 2Y64A 2MEV3 1S0EA 2OZ6A 4XJ9A 5BYNA 4QD2A 4CUCA 2G1MA 5GLWA 1MZ6A 3AJYA 3I2JA 4GKYA 4HL0A 1FI2A 2C0ZA 1ASJ2 1T2XA 5L19A 3ALQA 1HXS2 1SFNA 4RHV2 5C8WA 1CQ9A 1RUI2 3EHKA 4RQPA 4NPMA 5FKBA 3RZZA 4JHZA 4QQOA 3QLQA 4OQ9A 3ES1A 2R041 3VZMA 5DPNA 5DG2A 2VTXA 3DL3A 4K3UA 4C91A 4MHUA 4LKEA 4QU2A 4Z1VA 1OD5A 3I3QA 2WABA 4YVSB 4S2DA 5IYYA 3MIFA 1CAWB 4NPLA 1Y43B 1F15A 3FUOA 1NQJA 3RWKX 5IHRA 1SBEA 3KT1A 3VD7A 5IAVA 4CDXA 1AL22 2LW8A 1OOPC 5A6QA 3CU7A 3LOIA 1K45A 3OYWB 4E8DA 4LKSA 3ACHA 4AI1A 1R093 1IOAA 5F6LB 3VLBB 3WG4A 4AEKA 4HZFA 3NV2A 3T1MA 3O1UA 2DCKA 2EAKA 2WQZC 4AE2A 2PMWB 2DF7A 3JB8A 3OBZA 1HB4A 5D2AA 1AR62 4CZSA 5D21A 2XL7A 5FCCA 2VBBA 4FXKB 3ME2A 4WVWA 3P5BA 3VZLA 3VUOA 2ZGSA 4YG6A 1STMA 4A6SA 2GNMA 1W2OA 4Q4V3 3HQUA 4EE2A 5L36A 2AENA 5IVYA 1S1AA 2YB7A 5F3GA 4CCJA 4LBLA 1X8EA 2D43A 2JDUA 5A1FA 3HNBM 2RR12 5A6XA 5DAVA 4BQ5A 2V09A 1W9YA 4H14A 1XU2A 4KBBA 4OFGA 4XFBA 5DABA 3LIHA 4YARA 5J48A 4OZOA 1LOAA 2DTYA 2H0VA 4EJRA 2W1QA 5A7NA 4DQAA 2GNDA 2VMHA 3GBFA 1AXYA 3PVNA 1PK6A 3H7YA 3M8LA 4YVWC 3VBSC 1QXRA 3D3AA 4XPVA 5F3EA 5GZFA 3FMGA 4N7IA 4EN8B 2WJSA 3BIEA 1NCQA 3KF5A 4QHBA 3RZGA 4FFFA 3LPFA 1UF2C 1XNDA 4MGIE 4I2OA 1RVF2 2Z5WA 4KI5M 1W90A 1Q56A 1ZRIA 4E4HA 2WNVA 2VNVA 3MLLA 1OBNA 5EHDA 2VNRA 2DURA 5K0UC 1H8TB 3FWEA 1PO11 5EFUA 3FHAA 4GALA 3BKZA 4LOTA 2O8QA 3MPBA 1FNYA 1V70A 1LULA 2OQ6A 2VZSA 4BWOA 3IKWA 2FCVA 5I0RA 1W6OA 5DXDA 4OCTA 4WM7A 1BEV3 2BERA 3ATGA 4JAAA 4XAEA 4ATFA 1CAVA 1OLME 5FY1A 3WZ1A 2EVXA 3I2FA 2G9ZA 1Y7BA 1QXJA 4ASKA 5FJHA 1IS3A 1QJU3 4HKWA 2FQPA 4QGMA 3U75A 1DYKA 5KXDA 3JCIA 4CPBA 1KRIA 3UGFA 4E27A 5F2SA 1RGSA 1JZ5A 5F5IA 5CA6A 2Y6KA 4XEZA 2NQYA 3S7IA 4YFWA 2GN7A 2Y38A 2IWGB 1ND2C 2VUDA 2XHNA 5H9QA 4AHYA 5BNOA 3PL0A 1UIKA 1XNCA 4N53B 5C4WA 1F2NA 3VKOA 4D7SA 1SACA 1WLWA 1NCRC 3VBOA 1YHFA 3PUAA 3O5SA 5ACA3 1JTZX 1HRV2 2EA7A 2JE9A 3TAYA 1KGYA 4GXLA 3X29B 3ZX7A 2BUKA 1OA4A 1RMU3 1HRI1 1PMIA 3HQRA 3LA2A 4JDMA 2DVAA 2MNGA 4FPCA 4XF0A 1SPPB 1GQPA 4KGQA 2J22A 4BIOA 4Y22B 5C71A 2BP6A 3NKGA 4Q4X1 1W28A 3T30A 2OS2A 1PZ7A 2VXJA 3BTYA 4FI9A 3WP4A 4CUGA 2LS6A 3ZXFA 1XE8A 1OT5A 3HPNA 2FBEA 1UN1A 4PQQA 3PIJA 3VHNA 2HWD2 2GP5A 2XVGA 4PBOA 3H8UA 1DFQA 4AFDA 4DY5A 4P14A 2WWSA 1N3QA 1ZZ9A 5I8SA 4CXXA 4PBPA 4ET7A 4CP0A 3POBA 1H6XA 2QQNA 3NJYA 5DDJ1 3WF3A 1PMJX 2PN5A 1NOVA 3MF9A 1C4RA 4HVRA 1JMUB 3J9SA 1UYZA 4HFSA 4CDWB 3AP6A 4XFAA 1N1YA 3CZJA 1VBD2 4FAHA 2NLRA 1XXNA 3RRDA 2A5ZA 5FPLA 1NY72 2V4VA 2NMNA 2D6PA 5J98B 2Y6LA 1UU4A 2HWB3 1O8PA 5AVAA 4NIAA 2Y8KA 1O91A 3VD3A 2HEWF 3MFAA 1ZBE2 1IGOA 2VW1A 4OMDA 2DCYA 2K0GA 1AUYA 2DWRA 5CVRA 2WN3A 4CDQB 4CDXC 1YFYA 4O61A 4PCRA 4QGNA 4DPNA 2UY9A 4MGZE 1OOPA 2FCUA 4CYDA 1UOFA 5CKMA 3POSA 3RSJA 5I0SA 2CGPA 1AVBA 1W9WA 1J59A 1GWKA 1RUJ1 5F5AA 5ISLA 3H42B 5I8YA 2JICA 3RPQA 2WINB 4PT6A 2ZAHA 3I2OA 4UW4A 2VZ3A 2E31A 3RG0A 2Q1FA 3JU9A 3U11A 3CKHA 1W6MB 2JDAA 3ZYFA 1VALA 1I9RA 4AEJA 4DY3A 4XJWA 4XDPA 2YY1A 5T52A 2JG9C 4UAPA 4A41A 2VZQA 5FO9B 2HWF3 5LY1A 1ZRDA 5JSPA 3TBDA 2XVLA 4EQVA 3ZFEC 3OY8A 4HPKA 3PIGA 1MZEA 3BOWA 4IESA 1X7NA 3N7LA 1LOCA 4IV3C 1AX2A 3IIIA 2VQ0A 3IB3A 3K51A 5JZGB 1TE1B 5SV8A 4RQPB 3ILFA 1HB1A 1VBE2 4NVPA 3WW2A 5KR7A 1FPN3 1H9PA 4MLOA 3MDPA 4P00B 1HRI2 2GMMA 1O3SA 2BJSA 4N9HA 4YVWA 3VBSA 2PLV2 2XJSA 1R1A3 4Q4X2 3A0NA 5KHJA 4UFMA 2W87A 4GD4A 5A3TA 3NL1A 4QM9A 1XNBA 3IM0A 3ZIWA 1WUVA 3NO8A 4XFHA 4AVTA 3SLIA 2YMZA 3RZJA 1KXGA 1RYYA 2R062 1LHWA 2QFEA 1EAH1 2Z69A 3I54A 1QJX1 2X09A 3KMHA 4UFIA 4WZCA 5CAZA 3UJOA 1OF3A 2YBPA 2A3WA 1DDLA 2FMDA 2D3SA 2VXRA 4R4XA 5K0UA 3ZN4A 4R9AA 2BFUS 5FMOL 1F5FA 3WW4A 3PUSA 1TNRA 1WBFA 3IMMA 4G9SB 1KDMA 2WZR3 3ES4A 3WW3A 5FP8A 2CGOA 4QXHA 1MVQA 1RUC2 3NMBA 1GV9A 4ES8A 4PIYA 1XQNA 4MGYE 4Y1UA 3AZZA 1Z0HA 1V6MA 1J1LA 2A70A 2EIDA 2ZEYA 3PTRB 3R4SA 1DP0A 2MPFA 2XJTA 4MGKE 2DCJA 3G6JB 4YW7A 4XFCA 1ZRRA 2YPDA 4Q0SA 4XILA 4D0QA 4MOAA 4YZ2A 5F3IA 2WAOA 5CB7A 3DN7A 4Q4W3 3ZYRA 4TZDA 1G86A 3V0BB 1PVC3 4RSUA 4Z07A 2EALA 4M0NA 1JZ7A 2PHUA 3AL5A 3T0AA 4XUTA 1DF0A 1AR91 1ND2A 3O0WA 2KXLA 1RUG3 2YHJA 1RUJ2 1UOBA 2SLIA 1NCRA 1AYM3 3GZUC 1O3RA 1GOFA 4AWDA 2BOIA 1PK6B 1KJRA 1T6GC 4MV2A 3Q8EA 3H1WA 5F39A 2VOTA 1RUH1 3AKRA 2WYFA 4YM0A 3ZFFA 2IXLA 2Z42A 1NCQB 3PDQA 1C8M2 1JHJA 3C2UA 2CV6A 4NAOA 4COZA 1ZZCA 2GP3A 2O1QA 3WXPA 2HWE3 4YPJA 5IATA 4W50A 4DS0A 1WLTA 3LCPA 1MEC3 3ECQA 4GJYA 4NR1A 1OQDA 4QKDA 5I0TA 3T2TA 1GQHA 4OHXA 4BQXA 4GWNA 4C0BA 5E1RA 3B02A 4E2SA 3DKQA 1KJLA 1LTEA 4JQTA 5IK4A 2P5BA 2Q8EA 1OFSA 4PF1A 1W6OB 5FZ8A 3DXUA 1YFXA 3KCCA 4WM7B 3PVEA 4Y20A 1D4VB 1VMHA 3ACIA 4D7YA 4H2AA 2ZACA 4YM2A 2VZUA 4P9IA 1RC6A 4BQ2A 1H1MA 2AC1A 1NYWA 4XURA 5LRRA 3KCYA 3O1PA 3SISA 1EAH2 1H1IA 2WL1A 5JDBA 1QQP3 2BOJA 3OUHA 1R081 1DQ1A 1OF4A 2ZEZA 1H8TC 2JDZA 2Y0IA 4BCUA 1EV12 2QDRA 2ZKNA 3USUA 4GKXA 5E88A 5BNOB 5C4WB 1RJ7A 3AL6A 5BUVA 3JBG1 3J4UH 4CTEA 3FHIB 3GGLA 3BPZA 3K3OA 3H8RA 1H9WA 5DN2A 1J1TA 3FHQA 4Y4YA 2X53S 3N7MA 1QJY3 2XHKA 2ZZQA 3PUIA 2VMIA 4DMIA 4PJYA 5IK7A 3N4MA 5KHHA 2W92A 1QIQA 2VZTA 3K48A 4HSLA 1C5HA 4O9GA 1UZ0A 3ON7A 1FOD2 1QJEA 3FFZA 5FMBA 1X9TA 2OVUA 1ZBA3 4PHZA 2L9LA 1ULFA 4P02B 4YZ3A 4ZU4A 2HEYF 2JG9A 2VW0A 3V64A 5BY5A 4OUMA 4XCAA 1RUNA 4AF9A 3B94A 4HMZA 4HK8A 4L99A 4QT6A 2D98A 3MZHA 4AI3A 4N53C 3SQOA 2W08A 3ZFEA 3WP5A 2EIBA 3PHMA 4J6GA 5FRAA 5IW0A 1AJKA 1ZRFA 2WO1A 1QWRA 2WFF1 2EXHA 4LITA 4QPYA 2D6MA 3HR9A 4S2HA 3ZKUA 3ZMOA 2TNFA 3KM5A 1L7LA 1MR5A 2CL2A 4OMCA 4RN5A 2RJKA 3KLSA 2I74A 2VMEA 3ZSJA 1O4TA 2FCTA 3OTFA 1OKOA 4KMQA 5FBJA 3UL2A 4COYA 1LESA 2XJPA 5AC93 4A3ZA 3WDWA 3ZPOA 2IXCA 4RYDA 1C28A 4BOWA 1PIV2 4IE4A 1IPJA 4MGSA 2WYSA 5FPXA 3I2KA 3LFIA 2XG3A 2PHWA 5C70A 1OOPB 1CONA 1W0OA 1PO21 1JU4A 1ZZ6A 4RL7A 3AFGA 1BBT2 1SLTA 5DUUA 4BE3A 4CDWC 2WA4A 3LKJA 4GWJA 4IEPA 2XUEA 4ONUA 3W59A 4FTBA 1W2AX 1DG6A 1NA1B 1DLCA 4G3YC 5FAXA 4EV0A 2UY8A 1Z7S1 2A6VA 2YXSA 4IW3A 4QQ2A 4TYSA 1WMDA 5KHIA 1TMF3 1YRZA 2NMOA 3GALA 3U4SA 4B8EA 3R4UA 2JDMA 2RMU3 2J1RA 5ACA1 4YG0A 1SLIA 1D0GA 2VZOA 4AQ6A 1K12A 5F3CA 1LGNA 1OA3A 4FBFA 3H7JA 1Q43A 2BW8A 4XF4A 1W3XA 5EZWA 4P9GA 4C90A 2QZ3A 3ITQA 4PLNA 1RUD1 1ULPA 5CKQA 1H2NA 5FV3A 3OPWA 3AYDA 2KD7A 2JJ6A 3B69A 1W06A 1ZYBA 3OY8B 3VV1A 3DECA 2E7AA 3AMPA 5DAQA 2RS13 3OYWA 4GH4B 3W21A 4A7YA 1PGW1 3TWIA 4BQ4A 3NJVA 3VD4A 2J1UA 1O5UA 2ENRA 1W6QB 2ZGNA 2IC1A 4YVWB 2XBO2 3DYMA 2RG4A 1SHWB 1AR83 2VGDA 2UYBA 4L8QA 4M0HA 1V0AA 3J8F2 4XMAA 3VBUC 4E8CA 5LA0A 5B4NA 1AR71 1RUOA 2JKBA 5A3MA 2CNAA 5ANNA 5H9SA 3JD72 1ZZBA 1KITA 3GCWA 2B46X 4GA9A 4CSWA 1D2QA 1C1FA 2X29A 1COV3 4F3JA 1OLMA 5DAPA 4BQ1A 5K0UB 4CEWB 2R49A 2P1BA 4X6RB 4FFGA 3HJRA 4PIZA 3VL9A 5JZGC 1YYNA 4QPIC 1W3VA 4LBOA 3U0ZA 2B9VA 1HN1A 1DCSA 2JG8C 3NJZA 4AOCA 4PI0A 1TEIA 1FXZA 3UKVA 1BYHA 2HWC1 1L7QA 4XMIA 2E51A 3M3CA 4EYUA 4Q2FA 2KR2A 5A1AA 4AW7A 4FT8A 3WHTA 4BHPA 2BEOA 4H7LA 3UESA 4XC9A 4CRQA 3INAA 3GZEA 3OD4A 1S0GA 1DIWA 4WM8C 3AX4A 3EB7A 3SMHA 5JOYA 5CNAA 1WWYA 3FLTA 4EN6B 1CGPA 3LA7A 1IHMA 2BRTA 3NKTA 1PO22 1UMZA 3OG2A 3OGVA 5GLVA 3MF6A 2FZ1A 3IN9A 5T5JA 2PAEA 3UJQA 4JQRA 1D4M3 4SBVA 3UETA 5J1XA 2AACA 1QU0A 5FZHA 5CFDB 5CADA 1XNTA 3B01A 3W58A 4QHZA 3RMXA 4AGRA 5F7UA 2VU9A 1HQWA 1QH7A 4GJZA 5GLZA 3OUJA 2VW2A 3ZFFB 4XJZA 3ILRA 3HNMA 1JODA 1PGSA 1OD3A 4XUQA 4H55A 3V65A 1QOOA 4UYBA 2VH9A 2WNEA 1POV3 3BTXA 3PUQA 5FZIA 3MPPG 3H3UA 2GZWA 1MS4A 1JOBA 1OH3A 3B3QE 5FPAA 2PHFA 4HOOA 2Q1MA 4N53A 2QQIA 5FYZA 5GLUA 4PIXA 1I5PA 2GH2A 2ZOEB 3LSEA 4A45A 4CU6A 2Q1ZB 2QKDA 1CVNA 2D6NA 2DFBA 3WNKA 1ASJ1 1H4HA 2Q0AA 1VB4A 4Y20B 2WAAA 1UY2A 1RUI1 5JXIA 4FPEA 1UXXX 4K40A 3RYKA 3KF3A 3DCQA 1JUHA 4M4RA 1EUUA 4B1LA 4Q0QA 1PNGA 3L9JT 2NYYA 2BTVC 4FPFA 3VDCA 3TN91 3N35A 4X6QB 3VBRB 1TZOA 1RINA 1VJ2A 3AVSA 4Q0VA 1S0CA 1H4GA 3CLPA 1VMJA 3LWCA 4D6RA 5C7GA 5JSRA 3I3MA 3USUB 4MADA 2DVFA 2E63A 3TEWA 5T5OA 3FBYA 1JXNA 5JI7A 1AL21 2R072 1PHMA 1JHNA 5FUNA 5HBAA 4AVAA 5A1LA 4NWWA 2JB8A 5J37A 1IG0A 1ENSA 4CDWA 2HWC2 1GZCA 2ZA9A 3D4KA 4IEVA 3WNNA 1WD3A 1GBGA 2F17A 1P8JA 3IAPA 3MHZA 4MX3A 3N3HA 4OI2A 2CWMA 3LB9A 1VBB2 1ZZ7A 2XKPA 5F2WA 4CE8A 3E1F1 1AR61 4LK7A 4AHWA 4XIOA 3VHPA 4CA9A 5JOZA 2VR4A 1NXD1 2G9GA 2ARCA 2PELA 2QQKA 2B9UA 1BHGA 4JVAA 1JN2P 1RL3A 1TG7A 4NN0A 5FP9A 3T08A 3B7MA 4M3CB 2JG9B 5FLIA 4N90A 2RS53 1W39A 2VOXA 3VBHB 3AP5A 3ACGA 1W99A 2CHHA 1W2NA 5BNOC 2OZJA 1E5RA 1GNYA 4Y1YA 5C4WC 1RHI3 3N9QA 1K42A 1AZDA 4MO3M 3ZO0B 1XU1A 3AKSA 4NOTA 5EJ3A 3ZDVA 5BNNC 3ZN6B 5ERLA 5IVVA 5LWBA 2RM22 3JXSA 4GULA 1KEXA 4LORA 1LHOA 2DU0A 1T6BX 4AI0A 4ARXA 1G9AA 4LLFA 4XJ8A 2DVGA 3H1YA 3Q8CA 4LXLA 5HCFA 5JMCA 4E4SA 3LPGA 1HDKA 3WD5A 3USSA 1GYKA 1ZX5A 3VBUA 2O0OA 2K9ZA 4LO7A 5CYYA 3N9LA 2A3XA 3UKTA 5HCBA 3VN4A 2YZ4A 5C3QA 4XTMA 2R043 4JDNA 1O4YA 2UWBA 3GXUA 1DZRA 1UPSA 5M0TA 3WOGA 1JOPA 5JR2A 5FLHA 4BLJA 5JPNB 4U2AA 2GC0A 1V6LA 4JRLA 2XQXA 1Y9GA 4AQ2A 1ULGA 4IGOA 1JZ2A 3ZYBA 5IK5A 2R1DA 3M4FA 3VL8A 3GYDA 4AGVA 4FTEA 1DQ6A 5JZGA 2OUHA 2Q4SA 4D69A 5J3UA 1V9U2 4QPIA 2F4PA 3NWKA 4M3CE 4ZS2A 2JG8A 3SITA 3I2HA 4HANA 1YXWA 2PAKA 1Q8SA 1OPMA 4QHOA 1LU1A 3AYAA 2QVSB 5LBFA 3TB0A 4AYUA 3TN92 1XYPA 1XSRA 4UXAA 4ZPIA 3UGGA 2QNKA 4LHNA 5SV5A 1JYXA 5IK8A 2RS32 4TXWA 3HT2A 3VDDB 4BA6A 2Y6JA 1QHDA 2GDFA 5T5PA 1ND3B 5JOWA 3KB5A 2SBAA 3GBWA 3CZUA 4WM8A 4IEOA 3LDRA 1UPIA 5FYVA 4GIQA 5EXOA 4AVVA 2IFRA 2QDNA 1JUIA 1NKGA 3GJBA 2ZGTA 1IKPA 1AYN2 1OURA 3MIDA 2XLFA 1RITA 3J7NA 2HKXA 3ABZA 4XXPA 4MXWB 1H2LA 3ACFA 2CDPA 4RGGA 5IVBA 1NA1C 3MUY1 2VVFA 2MEV1 2W39A 2OYZA 3DF0A 1HRV1 5JXGA 3AKTA 3LEMA 4V1PA 3GJAA 5HV4A 1UZVA 3WDVA 2XLGA 3O14A 4LOSA 1Q8OA 2XOMA 4AAPA 1IPSA 2XR4A 5FJKA 2FDIA 5FY4A 3AVRA 1GP5A 3V0BA 4AEMA 4CP9B 2XPJA 1H1AA 1KFUL 1WMFA 1CZSA 1UQXA 2HWD1 2ZEXA 5C3RA 1VIWB 1B09A 2WO7A 3J7HA 1DHKB 3D6EA 4FFHA 4HONA 1JOJA 4NPRA 4OVEA 4W4ZA 3THPA 4GH4C 5FPUA 3VKLA 1NE6A 1LB2A 2QQUA 2ADEA 3MIBA 2G9FA 1UD1A 3WUCA 2J7MA 1CAXA 1PO13 1UXZA 4YW4A 3SCHA 3U07A 2D5FA 2JD4A 4WVZA 3UKNA 2ZGLA 3LOBA 1YQ8A 1VBD1 1PVXA 2EXJA 4COVA 1XRUA 4Z2WA 4GB32 1NY71 1GU3A 2CYFA 4LLOA 5K8SA 4LPLA 1VP6A 2WQ4A 5C33A 2XDVA 1DLLA 2Z2SB 3HN1A 5FMCA 1CJPA 3MUZ1 1W8NA 2ET1A 1ZBE1 2YC2A 5JXHA 1OFNA 1W9SA 3W9AA 2QZ2A 2A6YA 4CEWC 1SFPA 4BJ0A 4BIFA 3FE5A 4A7ZA 3K3NA 1TME2 3U1XA 4PDWB 3BCWA 1GLHA 5FXVA 1LOBA 1GOHA 2FMYA 4A2UA 2X8KA 3TEZA 1WCUA 4Q4V1 1N47A 4MZUA 3ENRA 4Q0PA 2P6CA 3BPSA 4JTNA 4K7JA 1D0HA 4C8DA 1KDKA 3ORJA 2JD9A 1Q8PA 1YO8A 1MACA 3NAPB 4LMFA 5F37A 3QCWA 5FZ0A 1MS0A 1ST8A 4NHLA 4HG6B 3HVDA 1RUF3 4OHZA 4LQRA 4ZU5A 2A73B 5F1RA 1JZ6A 2LALA 2IUWA 1H2KA 1XE0A 4Z92B 2GAUA 3BB6A 2VMCA 1F4AA 2ZHLA 2ZPXA 4AK3A 4AQTA 3OGSA 4DRVA 3P3PA 4DOUA 2C26A 4OI0A 3C8XA 1JYTA 1G9DA 1FMD2 5C6CA 3S57A 2VMFA 5HCHA 1UOGA 1IS5A 1VBC3 5FYBA 2ZHMA 3L2HA 5BNNA 5CFDC 3AMHA 2MEV2 3S30A 2OIIA 3WG1A 1VBE1 5DDJ3 4CP2A 3ZXGA 3N9PA 3NV4A 3U78A 4AFCA 3RZKA 3D0JA 2PLV1 1LODA 2VULA 5FKCA 1OLQA 3WEZA 3WF1A 1H30A 1DZTA 3VZKA 2X05A 3P1IA 1POV0 1US2A 4K20A 4LO8A 2BBAA 4IGPA 2WS93 4OUSA 5T55A 2R061 4SLIA 3Q8AA 1Y4WA 3DV8A 2FDFA 2OT7A 1LKNA 2XONA 4XYXA 4RS5B 2HBUA 1UY1A 3CDZB 1VAVA 3RQ0A 3O1SA 3ZVXA 2R0FA 4QPGC 2GC3A 2Z4FA 4P9WA 4F83A 4EWAA 1LCLA 4H3WA 3LFMA 3N36A 1RUC1 2XUMA 3WQBA 1V6IA 1G8WA 1KS5A 1R092 1WGPA 3VBRC 4DUXA 4NIGA 2OX0A 1BMV1 2VE1A 4I30A 1C57A 1MS3A 3NNLA 3VDAA 3ACLA 3ROUA 1J3QA 1VBA3 4CXWA 3KVBA 3EBRA 2VPVA 4E4DX 2GC2A 4FPHA 4BZ4A 3BI3A 3KS7A 4QQPA 3WHUA 3RMYA 4PF5A 4NRPA 4L92A 5FP3A 4YYOA 1ZA7A 5FY0A 2W1WA 4Q4V2 1B35B 2ZHNA 4AQSA 4J25A 3MIGA 5FZKA 1K5JA 1GQGA 3GZTB 1HQNA 2JDKA 3OOXA 4OHYA 1NA1A 3IAQA 5FY5A 1RUE3 1G7YA 1W9TA 2OXBA 5FFOC 4MYEA 2YUEA 2ILMA 3CMGA 3T09A 2GC1A 4S2FA 3VZJA 1ULOA 3WW1A 2D97A 4IE0A 3VBUB 5LZ6A 3I2GA 3RJRA 4CCCA 4XUPA 3LD8A 2VM9A 4JKMA 4QXBA 3WQ1A 4DFSA 5HI0A 3KWVA 1C8M1 4P5YA 3NNFA 4NWVA 2K46A 3VBHC 1CX4A 1F9KA 1LEDA 2UU8A 2ZX1A 3PUHA 1NXMA 1O4ZA 2WNUB 2ZGUA 2VQAA 4QKFA 1YJLA 3POJA 2VUCA 3THCA 2P34A 3VHOA 3TEYA 1CPNA 4I01A 1DYOA 1Q3EA 1VR3A 2UWAA 4NRMA 4ATEA 4GH4A 5F32A 2RDSA 1QJX3 3PNAA 3AFKA 3U4XA 4LIUA 4QPIB 4CEYC 2A7AA 2JG8B 2XL9A 3ZYJB 4NROA 1W6QA 1C8NA 1QF3A 3AYEA 2E26A 2LRPA 3ASIA 4XOGA 3RYPA 3IWZA 2IXJA 2XJUA 4N7UA 2R6QA 2I2SA 1ULCA 1L7RA 4LO6B 3TNPB 3AZWA 4N43C 1BEV2 1V00A 4QX7A 3TOJA 3WV6A 2BVBA 5GZGA 1LU2A 4ARYA 4F7ZA 5HCAA 4L9BA 3ZYGA 2PHTA 4WM8B 1W6NB 4W65A 3WF0A 5EWSA 4BK5A 5L9RA 5D8AC 1FV2A 1QJU2 4CEWA 4OZXA 4CXYA 2ADDA 1EV11 2W52A 1Y3TA 4HXCA 4GZ9A 1YFUA 3J26N 4I3GA 3N9OA 4BYYA 2ORXA 1U5IA 1F4HA 2HLEA 2W1UA 1O6UA 4IEYA 4JRAA 3IBMA 4YW5A 1A34A 4TN7A 5FYMA 1AR93 4JX0A 2GSYA 4CCNA 2XKOA 4GAZA 5FXXA 2CWSA 1GNZA 2VBDA 3H9AA 4AGGA 3I49A 3U37A 5GZDA 4DXTA 2VD7A 1BMV2 3BU0A 3KHCA 5CG9A 3VDDC 3GZAA 4C0HA 4P9LA 1HV1A 1S0FA 3DPRC 1RXGA 3OGJA 1JYIA 1KQRA 3UGHA 1ND3C 1RUH3 1FOD1 2RVAA 2WC2A 3GBGA 3HOBA 3WVJA 4MUVA 2H0BA 1RMU2 2OPKA 2GMEA 3OB8A 3ZXLA 3J7MA 1LHUA 1OSGA 2R30A 3JZVA 5B4XA 4Q1RA 5JOXA 2VQTA 5A7PA 4BM8A 2A6ZA 2JDHA 3ZIXA 5JXJA 3MO4A 1CAXB 1HB2A 2ZHKA 3S5AA 5CFDA 4F8AA 4X8PA 2ZGQA 1SQ4A 1R64A 3KCXA 3LDKA 2BYVE 3EMRA 3M1HA 3NV3A 4XHBA 1X36A 1CD3G 1EPWA 1PX4A 3DYPA 3AB0A 3LIGA 2B39A 2OQ7A 3WDUA 5IAXA 3BTAA 1M4WA 4IXLA 5FZ9A 2VL4A 5FIXA 3A7QA 2ZS6B 3D5OA 4EWDA 2X5IB 5FZ7A 1NLQA 2YU2A 5CBLA 3S5QA 2BVVA 2E53A 1G6NA 1VRH3 1X82A 4YFZA 2HWB2 4HBNA 1PIV1 1XOYA 4QDRA 1R083 2DV9A 2JIJA 3SEPA 5JR7B 4QDQA 4AAXA 2XH6A 3NV1A 1BBT1 2IZWA 2PQQA 4FAGA 4P9XA 3APBA 3MFCA 4QPGA 3I2IA 3SHRA 2CDOA 1S0DA 4COWA 4D94A 4HSJA 3JBG3 5KXCA 2ZBJA 2VQUA 4B4QA 1QNYA 2G19A 4XDQA 5FYTA 3MW3A 4BPZA 4IV1C 3BUCA 1RUG1 1SZBA 3VBRA 1CAUB 1NZCA 1SLLA 1EUTA 4JZRA 4IE6A 1POQA 1OI6A 3AKQA 4FQ4A 4K8RB 4NMIA 4XQDA 1SEFA 2WN2A 3ZFGB 1WA6X 3KT7A 2VTFA 4FOWA 3VKNA 3POWA 1WBLA 2P3JA 4PDWC 3PU8A 1S0JA 5EYYA 5AFBA 3WINE 2VBPA 3BTZA 2XMLA 3HBKA 5APAA 1OA2A 4XQWA 2HWF2 5BNNB 1G9CA 2I07B 2VUAA 3SNMA 1D2SA 4DEVA 4CCMA 3NAPC 5FY8A 2XBO1 1OMIA 1GOGA 1X50A 1YQ2A 2WFF3 3KV9A 4ASMB 2ID4A 3SEEA 1VMFA 3J8F1 1A78A 1ENRA 1GFF2 1QNWA 5JUVA 3I3EA 3OEAA 5K7PA 1FPN2 3O7OA 3BU7A 4I0AA 2NPIA 1CIYA 4NHYA 3IPVB 2W2IA 4M3CA 3JD71 1F5JA 1R1A2 5GKAC 2Q30A 3VBHA 2RE9A 4RGKA 1UYYA 4LO5B 4CU9A 2OW4A 5FZAA 1S0IA 1K3IA 1ZNPA 2DVDA 2XJQA 4LA3A 4AL9A 1C1LA 1AL0G 1EP0A 2W1SA 2BFUL 3O0XA 5IWFA 3R0RA 4BH9A 5CZKA 1L3JA 1N1VA 1QDCA 1HV0A 1OC1A 3ZN6A 1XBFA 1W8OA 1UYPA 1NX9A 4CEYA 4D6QA 4DXRA 3I3DA 5GLTA 4Q8KA 2JWPA 1BK1A 2P3YA 4GWMA 2ES3A 2AGSA 1UMIA 2QQLA 3FUQA 3CEWA 2WZR2 2LTNA 3IZOA 4HK9A 3S6PA 3FN9A 2WA3A 4N43A 1Z7S3 3VKFC 1DU3D 2R32A 4PI2A 4ASLA 1HJFA 2A6XA 5CEHA 5JSOA 2R16A 2VNGA 4JGZB 4LE3A 3Q9OA 1W0NA 3OF1A 3K46A
chains in the Genus database with same CATH topology
1BVVA 5D8AA 1BZWA 2VNOA 3ZYPA 4RS5C 2VVDA 2JECA 2ZMKA 4Q4W2 2BPA2 1RUD3 4GMP1 3EJKA 1OLRA 2HJIA 4A3XA 1PVC2 2HEVF 3HQXA 4HVOA 4DB5A 1A3KA 2W68A 3PMEA 3HD8B 1RUG2 4FSJA 1IS6A 2VG9A 2AUYA 4I3PA 3PTYA 1AYM2 4M3CF 3VDDA 3DPRA 4IEUA 4LBKA 3LZZA 4FCAA 4YZ4A 1ND3A 1IPKA 4B7EA 4AXOA 4WVVA 1XNKA 2HYKA 5CIRA 1AR73 4UW3A 3S7EA 4XFGA 2JXAA 3LGRA 3OCPA 4K8FA 3SCGA 2PA7A 4CDUC 3I2DA 4UW5A 4Q8LA 2GNTA 4RD7A 1B35C 2HWE2 3ZYIB 1ZREA 4MXWA 1MEC2 3T1LA 5B2GB 1DQ4A 4ISQA 1WA4A 4R8HA 2BNNA 4LEJA 2WSVA 4M01A 2D6OX 4FOVA 1IZ3A 4ZKTB 3HBZA 2A3YA 3IMNA 2VY0A 3ZSLA 1YI7A 3ELNA 1QXPA 4YGEA 2WNUC 5A33B 1TMF1 1GSLA 1DQ2A 3JB4C 2WT0A 2RMU1 3A4UA 1QQP2 2D44A 2R071 4B29A 3TNQA 2JX9A 2ZKLA 4AEDB 2UURA 4FPLA 1BKZA 1UZZA 4KQ7A 1LENA 3WCSA 3DUIA 4IEQA 2QCSB 4L11A 1MS5A 4FQZA 1VBB1 1YNAA 4IV1A 1QJY2 4Q4Y3 5T3NA 1DYPA 2V5YA 5AVPA 5IT6A 3RNSA 4KL1A 1WW7A 4TWTA 1DGWX 2BWCA 4YG3A 5FDBA 2IXKA 4DNYA 2ZX4A 4AFBA 5CFCB 5T5LA 4Z82A 1LRHA 4PDWA 1ZBA2 3CO2A 4FVVA 1LHVA 4B4RA 1VB2A 5KHGA 2TEPA 2EF6A 4MXVA 3FLPA 2RM21 1BXHA 1JH5A 1NLSA 3NAPA 2WSUA 1ASJ3 3VBFB 4L97A 1HXS3 4RHV3 1OQ1A 1RUI3 2UYAA 4LBJA 4XE9A 3ILNA 3WP6A 3BIWE 4YM3A 1APNA 5K9YA 3PLQA 5KBFA 4XFFA 5AC92 5GJ6A 4XETA 3ZSKA 1F8VA 1UKRA 5GZCA 4YZ5A 2TUNA 1V9U1 1DQ5A 3MEPA 4QPGB 4QXKA 5EYXA 1AL23 1EY2A 2ZGOA 3E5QA 3KGZA 5DUVA 5JLVA 3O12A 3R4DB 3MLJA 3ST7A 2EIGA 3ZFFC 1FATA 1GKBA 4LUMA 2RS31 4PQ9A 1UX6A 1D4M1 4I0WB 5KHKA 1FX5A 2X5IC 1C3HA 4HETA 1AR63 4U36A 2FHRA 4IERA 1TMF2 3ETQA 4OHVA 5BNPB 2RMU2 1URXA 3C3VA 4RS5A 5JIAA 1WMEA 4AFMA 4LT5A 1AYN1 1SBFA 5FPZA 1N3PA 2RR13 1O3QA 2PHRA 3AMNA 5FTTC 3E5XA 4R9DA 1CJDA 2RS12 4HKOA 2QUOA 5FBZA 4XW3A 1RTVA 2YPJA 1Q8QA 2AYHA 2BWAA 3MW4A 3ZFGC 5I93A 1AR82 1ULDA 3MIEA 4C1XA 4URTA 5LRSA 2YDEA 2A71A 3H0OA 4CDUA 1AHSA 1RVF3 3I8TA 4KWJA 4AHXA 1WW6A 2P17A 2H6BA 2V73A 2JENA 1B35A 4KU7A 4JTOA 3WT3A 4CP1A 5DZGA 4CEYB 1COV2 1KS4A 2VOWA 5LEKA 3DKWA 4DXZA 1K5MB 1XYOA 1S0BA 1MZ5A 2YV8A 4P9YA 3H3ZA 1QKQA 1U5ZA 4GB31 3LA3A 1U12A 4N43B 5C9AB 4FOYA 2QQPA 1YIFA 2D93A 2WNUA 5D8AB 2E7TA 3EO6A 4IQPA 4LULA 5LEJA 2WT1A 4I09A 3I59A 2DCTA 1TME1 1N1TA 5H9PA 3OD0A 1UIJA 3WDYA 2WKKA 1ONAA 3I7DA 4COUA 2R0HA 4NO4A 4JDOA 2OUJA 1MQTB 1GZ9A 3QH7A 3AP7A 3HT1A 1D4M2 3N7KA 4WVMB 3DPRB 4K1YA 4QM8A 4I02A 2Z79A 1HRV3 3B00A 4XFIA 3S0MA 4HKLA 4JGZC 2DUPA 1W6NA 3ZSEA 4Y5Z0 2YC0A 5A32B 2NN8A 4Y1VA 4O9EA 4XQ4A 1FMD1 3VKMA 3E6CC 3SH5A 1ZM1A 2EXKA 2HWD3 4FP2A 4UBHA 2DYCA 1I1EA 2VECA 4R52A 2C1FA 5J36A 3B9IA 2A75A 3WG3A 1FAYA 4PLOA 3ZDSA 3E6DA 2B42B 1UU6A 1DQ0A 3AXEA 5E8AA 3U10A 4S2GA 2GNBA 3QBQA 3RI8A 1PZ8A 1VBD3 2CY6A 1IKQA 1A8DA 4YW2A 2ATFA 2LUWA 3JQWA 2WLPA 1SLBA 2VOKA 1A6CA 1ZBE3 5DG1A 1CESA 3WLUA 3ZPYA 1REFA 1OHFA 4B7KA 5JAXA 4WZFA 1LECA 3ZXEA 1QH6A 4B4PA 1IS4A 2DU1A 4UBGA 2PYTA 4IV1B 4QQHA 1R091 1MVEA 4N9IA 1Y9QA 2X5IA 3FX3A 1PM7A 1JYCA 1LGCA 3LSDA 4GQ7A 5CU1A 4LE4A 3RWNA 2AH2A 1G9BA 2DUOA 4BLIA 4AEDC 3PVBB 2RS52 1QMJA 3H1MA 1Z78A 3G7DA 5JVVA 3WG2A 2ARXA 4KG0A 1RHI2 1FYUA 1CPMA 1HX6A 2P37A 3ZXDA 2ZGRA 4H7MA 4QGLA 1CAUA 1HW5A 1VBE3 3OBRA 3KGLA 4RGAA 2D40A 2N7GA 1HRI3 3OJBA 2PLV3 4OULA 4YNIA 3ZFGA 4Q4X3 1W6PA 5H9RA 4LA2A 5CFCC 1S2KA 4ZXKA 3SH4A 1AXZA 2R042 4IL7A 2R063 2ZMNA 4LTAA 2UWCA 3WQ0A 2IXHA 4X8NA 4RFT0 5KC6A 5L7OB 5BPXA 1GICA 3MI8A 3VBFC 2YGMA 3HMYA 1U0AA 3ZN5A 4AVBA 1YCIA 4Y26A 1UL9A 1N3OA 1RUC3 5FMOS 1BEV1 3IPVA 3WY6A 2QJVA 4Q27A 1WW5A 1ENXA 3GHNA 4DRRA 4JGYB 5ABJC 1QJU1 5KXEA 1RUF1 3VZOA 1LOFC 3GHMA 5L73A 3QH6A 4ORFA 4ISRA 2XWBB 2BBVA 1AX0A 3CJIB 2XGXA 3NSTA 2CTVA 5GM0A 1RUJ3 4AI8A 4KNCA 2PHDA 3NW4A 4HT1T 3IDBB 1VBC1 3RI9A 1NE4A 1U5XA 5AFEA 5BV6A 1JBCA 2P3IA 4LBQD 4AG4A 4UW6A 3KD4A 4JGZA 5BNPC 1PGL1 4K1ZA 1RMU1 2Q5TA 1W0PA 3AP4A 4B3NA 4E4ZA 2E7QA 3P3NA 4CDUB 1C8M3 1OQEA 1V6NA 2BGCA 3RDIA 1DZQA 1HQLA 1N1SA 3NVCA 2WS91 1MZFA 1I5ZA 4HN0A 4YM1A 1YLLA 3MGUA 5F6KA 2ZZJA 4OHWA 4FP3A 3KZ4C 1PO12 2MHFA 5KC5A 5FLJA 4R9CA 1QDOA 1LOEA 4YGBA 5GZEA 4XBNA 1QY4A 4Y1XA 3JQXA 3E6BA 3QACA 2HWB1 3I59B 3R6SA 2RJLA 3U4XA 4G4FA 1EAH3 1J3PA 4XXAA 3QOPA 1X8MA 5C8CB 3V0AA 1DGRN 1VBA1 4FPGA 5J96B 1HLCA 2Q8OA 5A3LA 1EV13 5BNQA 1K5MC 4YGDA 1MS1A 5JCTA 1QGLA 3AKPA 5JPMB 3AK0A 1VLNA 3HAGA 3WNXA 1W2UA 2EAAA 2E9QA 2XLAA 1GZWA 1SDWA 5C9AC 5LK5A 3MYXA 1PZ9A 1YI9A 1BVP1 3WDXA 5EV7A 2EXIA 1RUE1 4RR3C 5A33A 1WD4A 3AYCA 5KHIA 1RUF2 2C5DA 4META 4Q0UA 5E89A 1UW8A 1FOD3 4D7TA 2AZ5A 2DUQA 4AVCA 4IEWA 3RYRA 3CF6E 3KQRA 1H2MA 5FREA 3OGGA 1LJ7A 3IIAA 1SLAA 5I0UA 4AEDA 2HWF1 1A8MA 5HXVA 1LHNA 3N7JA 4YW3A 2D3RA 3QD6A 1GR3A 3CNAA 5FOJB 1MQTC 1C5IA 1JW6A 1RIRA 2WZPP 4Q29A 2ETEA 3HWJA 1VBC2 1TNFA 3BODA 2QE3A 4FO9A 3M7AA 3RS6A 4CDXB 2DTWA 4KWLA 5IUQA 1FPN1 3AZXA 5DDJ2 1AXKA 1PGL2 2DVBA 4EWEA 4D3WA 5LK7B 1REEA 1OPOA 1R1A1 1YFWA 5CFCA 2ZABA 1MS9A 1LR5A 2PHXA 1TQ5A 2D5HA 3FLRA 2GN3A 2WS92 3H50A 3R05A 1PIV3 1WLDA 3L2YA 4YVSC 4W6YA 1AX1A 1R1ZA 3ZXJA 3VBFA 1BBT3 3M2MA 4QX5A 1S2BA 5DUWA 1UZYA 4IEXA 2WZR1 3MICA 4I0BA 4FOQA 1NLRA 2ZAAA 1ZRCA 2VVEA 3AMQA 3LAGA 5FQ0A 3ZSMA 2E6VA 4XBLA 5ABJA 1RJ8A 1VBA2 2C9AA 2XJRA 2ZX2A 1SFYA 1DGLA 3DGTA 3PJYA 1LOFA 1FNZA 1SLCA 4Q4W1 3D82A 5J09A 3THTA 1PVC1 1WCKA 1I3HA 2D3PA 2VMGA 2F6BA 1LGBA 2BNMA 1XYNA 2WNVB 3AZVA 2BQPA 4XHXA 1VAMA 2I45A 3IT8A 1WLCA 1AYM1 2A6WA 2VOVA 1RUE2 2XBO3 3D0SA 3O0VA 4RA0A 1W6PB 4JC1A 4EN7B 1WW4A 3J8F3 5BNPA 4KU8A 2GALA 2BNOA 1BCXA 2WLQA 4W6WA 1CAVB 3JD73 1V6JA 5FO7B 1LOGA 3WCRA 1YJKA 2H6CA 2HWE1 4ES9A 2ET7A 2W0XA 1MEC1 1O5LA 4LBQA 4FXGB 1SCRA 3M70A 1VRH1 4LHKA 2NP0A 1CN1A 1QJX2 2B45X 4W6XA 4QMAA 5DZEA 4LHLA 1ALYA 1J58A 3A0KA 5JI9A 1O7FA 3RJ2X 3ZXKA 4JV4A 3VBOB 4DINB 4K6BA 3E97A 4P5HA 1UU5A 3FBMA 1QOSA 2AREA 1KD7A 2YYOA 2NM1A 3PNAA 3AZYA 1QQP1 3WR0A 1ZZ8A 1FT9A 1ZA4A 2OA2A 3TRSB 1DBNA 4FPOB 5D1IA 1F31A 1EYBA 5JIUA 5L7OC 2B8MA 1PO23 1UKGA 3AXDA 1K5MA 4AHZA 3CJXA 1YUDA 4GMP3 2IFWA 4YW1A 1EPZA 1S55A 4Z8BA 2LM3A 1AR92 1QJY1 5C9AA 1J3RA 2Y26A 3KSCA 1GNHA 1BJQA 4JGYC 1REDA 3HIFA 2O8OA 4RR3A 5DZFA 4IV3A 5TSWA 3ZXAC 4XF1A 1RUH2 4KG8A 3CL1A 3GNEA 1ZBA1 3OPZA 2JEMA 3B5LB 1HIXA 3ZMNA 3PMSA 1FV3A 4NHKA 3CJIC 1ULEA 4AFAA 1CR7A 2ZGKA 1I6XA 1MQTA 1E57A 2ZJCA 3E5UA 4WVMA 2P2KA 4BMEA 2RHPA 3PVOA 3M3EA 1V6OA 4TLFA 3SXWA 5A32A 1SBDA 3UK9A 2CAVA 2D6KA 2AR6A 2XWJB 5GALA 4AVSA 1SMVA 5AC91 2ZX0A 3V0AB 2WT2A 4MH0E 2GU9A 3URFA 1DGWA 1VRH2 1AF9A 1O3TA 3IDEA 2R073 4YVSA 4PLMA 1R082 1CAWA 3WP3A 4YZ1A 4CDQC 1GZWB 2HWC3 5T50A 2NZ9A 2K2SA 3JBG2 4INDA 4HPKB 1VBB3 1GANA 3TYJA 2ZMLA 2GMPA 4LBNA 5JWPA 1X33A 2YGLA 2ARBA 2ZTNA 1M06G 3M3QA 5CG8A 4KWKA 5KWRA 5C8CC 1QJZA 1SCSA 3VBSB 4AI2A 2B7YA 2XJVA 4LUKA 2FZ2A 1BQPA 1IQAA 1HKDA 4JCKA 4OLLA 4XZPA 2P3KA 3WUDA 2RS11 2D6LX 1H8VA 2XVKA 2RM23 3B93A 3FZ3A 1YWKA 4XBQA 1UCXA 2WFF2 1AR81 4RQPC 3V56A 4E9KA 1RB8G 4XF3A 4XJAA 4YLZA 1XE7A 3M3OA 5F5QA 4NHMA 4Y24A 5J7MA 4MSVA 4YRDA 5KXBA 1COV1 4BMBA 4E2GA 3EXUA 1NQDA 2WIIB 3IDCB 5E16A 3MIHA 4L2NA 1QOTA 1V9U3 4LR4A 2DCZA 4Q1PA 4OI4A 1LEMA 1YIPA 4LBMA 4AVTA 3FFQA 4CDXC 5T54A 1H8TA 2VUJA 3KT4A 2B5HA 2GH8A 4R4ZA 1ND2B 2IXIA 3BOPA 4XJUA 3TN93 3GF6A 3POYA 3PJQA 4J1WA 1VAKA 2RS33 1NCRB 4YGCA 1U5YA 1V6KA 5FQ0B 3WDTA 5ABJB 2XB6C 4J1XA 3SCFA 2CGNA 1Z7S2 4TSVA 4Q4Y1 1OKQA 4HLTA 4K21A 2ZX3A 3VHRA 4OI1A 3UV9A 5ACA2 2PAMA 4FPJA 4FPKA 2ERFA 4QQLA 5L7OA 3BALA 4MVTA 1AYN3 3OBTA 1H0BA 1DGRA 1RUD2 3VZNA 2G4IA 4KH9A 3SH3A 4EN9B 1PGW2 4E2QA 4HN1A 4XF9A 4JGYA 4WV8A 1HXS1 1PK6C 4RHV1 4FPYA 4DZGA 1NG0A 3WX5A 1POV1 2PFWA 1AR72 1NCQC 4LNVA 2CAUA 3FC0A 4EROA 5I91A 4LBQB 4Y22A 5FOBB 2TBVA 1KFXL 3CJIA 2WNVC 1WCDJ 4FTSA 4ITCA 4YSFA 3D8CA 4M00A 3MLKA 5I8TA 4WBBA 4C1WA 4XTPA 4K9SA 4IETA 4GB33 1WCSA 3JUUA 4WM7C 4Q26A 3AM2A 3EQEA 3MW2A 2ZGMA 4R9BA 2PTMA 3AMMA 4P9JA 2ZCWA 4HVQA 2R1BA 1TME3 3AJZA 3VGIA 3WQ7A 4EN0A 2KM2A 4A7KA 4CDQA 2ZGPA 1AJOA 3B9CA 1Q5OA 5DUXA 5F9TA 2RR11 1G9FA 5FO8B 3ZFEB 5BXXA 3VBOC 2KA3A 1ENQA 4RR3B 4IV3B 3AP9A 3I4IA 2YROA 4Q4Y2 2WFPA 2Y0OA 2D7FA 1ZVFA 4LO4B 4ZU7A 2JE7A 1Q8VA 2PHLA 5C8CA 3FJSA 1UAIA 2RS51 1W6MA 1CIWA 1FMD3 4GMP0 1RHI1 1RVF1 2DFCA 4IEZA 4Y1ZA 4KGGA 1MS8A 2MEV3 1S0EA 2OZ6A 4XJ9A 5BYNA 4QD2A 5GLWA 1MZ6A 3AJYA 4GKYA 4HL0A 1FI2A 2C0ZA 1ASJ2 5L19A 3ALQA 1HXS2 1SFNA 4RHV2 5C8WA 1CQ9A 1RUI2 3EHKA 4RQPA 3RZZA 4QQOA 3QLQA 3ES1A 2R041 3VZMA 5DG2A 3DL3A 4K3UA 4C91A 4QU2A 4Z1VA 1OD5A 4YVSB 4S2DA 3MIFA 1CAWB 1Y43B 3FUOA 1NQJA 1SBEA 3KT1A 4CDXA 1AL22 1OOPC 3CU7A 3LOIA 3OYWB 4AI1A 1R093 1IOAA 5F6LB 3VLBB 3WG4A 4AEKA 4HZFA 3NV2A 3T1MA 2DCKA 2EAKA 2WQZC 4AE2A 2DF7A 3JB8A 1AR62 4CZSA 2XL7A 5FCCA 4FXKB 4WVWA 3ME2A 3VZLA 3VUOA 2ZGSA 4YG6A 2GNMA 4Q4V3 5L36A 2AENA 1S1AA 4LBLA 1X8EA 2D43A 2RR12 2V09A 4XFBA 4H14A 1XU2A 4KBBA 4OFGA 5J48A 4YARA 1LOAA 2DTYA 2H0VA 4EJRA 4DQAA 2GNDA 2VMHA 3GBFA 1AXYA 3PVNA 1PK6A 3H7YA 3M8LA 4YVWC 3VBSC 1QXRA 4XPVA 5GZFA 3FMGA 4N7IA 4EN8B 2WJSA 1NCQA 4QHBA 1UF2C 1XNDA 4MGIE 4I2OA 1RVF2 2Z5WA 1Q56A 2WNVA 3MLLA 2VNRA 2DURA 5K0UC 1H8TB 3FWEA 1PO11 5EFUA 4GALA 2O8QA 3MPBA 1FNYA 1V70A 1LULA 4BWOA 5I0RA 3IKWA 1W6OA 5DXDA 4WM7A 1BEV3 3ATGA 4JAAA 4ATFA 1CAVA 3WZ1A 2EVXA 1Y7BA 1QXJA 1IS3A 1QJU3 4HKWA 2FQPA 4QGMA 5KXDA 1DYKA 3JCIA 1KRIA 4E27A 1RGSA 5CA6A 4XEZA 2NQYA 3S7IA 4YFWA 2GN7A 2Y38A 2IWGB 1ND2C 4AHYA 5H9QA 5BNOA 1UIKA 1XNCA 4N53B 5C4WA 1F2NA 3VKOA 4D7SA 1SACA 1WLWA 1NCRC 3VBOA 1YHFA 3O5SA 5ACA3 1JTZX 1HRV2 2EA7A 2JE9A 3TAYA 4GXLA 3X29B 3ZX7A 2BUKA 1OA4A 1RMU3 1HRI1 1PMIA 3LA2A 4JDMA 4XIKA 2DVAA 2MNGA 4FPCA 4XF0A 4BIOA 4KGQA 4Y22B 4Q4X1 3NKGA 1PZ7A 3WP4A 3ZXFA 1XE8A 3VHNA 2FBEA 1UN1A 2HWD2 2XVGA 4PBOA 3H8UA 1DFQA 4AFDA 4DY5A 4P14A 2WWSA 1N3QA 1ZZ9A 5I8SA 4PBPA 4CP0A 5DDJ1 2PN5A 3MF9A 1NOVA 1C4RA 4HVRA 3J9SA 4HFSA 4CDWB 3AP6A 4XFAA 1N1YA 1VBD2 4FAHA 2NLRA 1XXNA 3RRDA 2A5ZA 1NY72 2NMNA 2D6PA 5J98B 1UU4A 2HWB3 5AVAA 1O91A 2HEWF 3MFAA 1ZBE2 1IGOA 2VW1A 2DCYA 2K0GA 1AUYA 2DWRA 5CVRA 4CDQB 1YFYA 4PCRA 4QGNA 4DPNA 2UY9A 4MGZE 1OOPA 4CYDA 3POSA 3RSJA 5I0SA 2CGPA 1AVBA 1J59A 1RUJ1 5I8YA 2JICA 3RPQA 2WINB 2ZAHA 4UW4A 3RG0A 3U11A 3JU9A 1W6MB 1VALA 1I9RA 4AEJA 4DY3A 4XJWA 2YY1A 5T52A 2JG9C 5FO9B 2HWF3 1ZRDA 3TBDA 2XVLA 3ZFEC 3OY8A 4HPKA 1MZEA 3BOWA 4IESA 1X7NA 3N7LA 1LOCA 4IV3C 1AX2A 3K51A 2VQ0A 5JZGB 1TE1B 5SV8A 4RQPB 3ILFA 1VBE2 3WW2A 4NVPA 1FPN3 1H9PA 4MLOA 3MDPA 1HRI2 2GMMA 1O3SA 4N9HA 4YVWA 3VBSA 2PLV2 2XJSA 1R1A3 4Q4X2 3A0NA 5KHJA 3NL1A 4QM9A 1XNBA 3IM0A 3ZIWA 1WUVA 3NO8A 4XFHA 3SLIA 2YMZA 1KXGA 3KMHA 2R062 1LHWA 2QFEA 1EAH1 2Z69A 3I54A 1QJX1 5JSPA 4WZCA 5CAZA 3UJOA 2A3WA 2FMDA 2D3SA 2VXRA 4R4XA 5K0UA 3ZN4A 4R9AA 2BFUS 5FMOL 1F5FA 3WW4A 1TNRA 1WBFA 4G9SB 1KDMA 2WZR3 3ES4A 3WW3A 2CGOA 1MVQA 1RUC2 1GV9A 4ES8A 4PIYA 1XQNA 4MGYE 4Y1UA 3AZZA 1Z0HA 1V6MA 1J1LA 2A70A 3R4SA 4MGKE 2MPFA 2XJTA 2DCJA 3G6JB 4XFCA 1ZRRA 4Q0SA 4XILA 4YZ2A 4TZDA 5CB7A 3DN7A 4Q4W3 3ZYRA 1G86A 3V0BB 1PVC3 4RSUA 4Z07A 2EALA 4M0NA 2PHUA 1DF0A 1AR91 1ND2A 3O0WA 2KXLA 1RUG3 2YHJA 1RUJ2 2SLIA 1NCRA 1AYM3 3GZUC 1O3RA 4AWDA 1PK6B 1KJRA 1T6GC 4MV2A 3H1WA 1RUH1 3AKRA 4YM0A 3ZFFA 2IXLA 2Z42A 1NCQB 1C8M2 3C2UA 2CV6A 4COZA 1ZZCA 2O1QA 3WXPA 2HWE3 4DS0A 1WLTA 3LCPA 1MEC3 3ECQA 4NR1A 5I0TA 1OQDA 3T2TA 4C0BA 1DDLA 1GQHA 4OHXA 4GWNA 5E1RA 3B02A 4E2SA 1KJLA 1LTEA 5IK4A 1OFSA 1W6OB 1YFXA 3KCCA 4WM7B 3PVEA 4Y20A 1D4VB 4D7YA 2ZACA 4YM2A 4P9IA 1RC6A 1H1MA 1NYWA 5LRRA 3KCYA 3SISA 1EAH2 1H1IA 2WL1A 5JDBA 1QQP3 1R081 1DQ1A 1H8TC 2JDZA 2Y0IA 4BCUA 1EV12 2QDRA 2ZKNA 3USUA 4GKXA 5E88A 5BNOB 5C4WB 1RJ7A 5BUVA 3JBG1 3J4UH 4CTEA 3FHIB 3BPZA 1H9WA 1J1TA 4Y4YA 2X53S 3N7MA 1QJY3 2XHKA 2ZZQA 2VMIA 4DMIA 4PJYA 5IK7A 3N4MA 5KHHA 3K48A 4HSLA 1C5HA 4O9GA 1FOD2 3FFZA 2OVUA 1ZBA3 1ULFA 4YZ3A 4ZU4A 2HEYF 2JG9A 2VW0A 3V64A 5BY5A 4OUMA 1RUNA 4AF9A 3B94A 4HMZA 4HK8A 4L99A 4QT6A 2D98A 3MZHA 4AI3A 4N53C 2W08A 3ZFEA 3WP5A 3PHMA 4J6GA 5FRAA 1AJKA 1ZRFA 1QWRA 2WFF1 2EXHA 4QPYA 2D6MA 3HR9A 4S2HA 3ZMOA 2TNFA 3KM5A 1MR5A 2CL2A 2RJKA 3KLSA 2I74A 3ZSJA 1O4TA 3OTFA 3UL2A 4COYA 1LESA 2XJPA 5AC93 3WDWA 2IXCA 1C28A 4BOWA 1PIV2 1IPJA 5FPXA 2XG3A 2PHWA 1OOPB 1CONA 1W0OA 1PO21 1ZZ6A 4RL7A 3AFGA 1BBT2 1SLTA 5DUUA 4BE3A 4CDWC 2WA4A 3LKJA 4IEPA 4ONUA 3W59A 4FTBA 4G3YC 1DG6A 1NA1B 5FAXA 4EV0A 2UY8A 1Z7S1 2A6VA 2YXSA 4QQ2A 4TYSA 1WMDA 1TMF3 1YRZA 2NMOA 3GALA 4B8EA 3R4UA 2RMU3 5ACA1 4YG0A 1SLIA 1D0GA 4AQ6A 1LGNA 1OA3A 4FBFA 3H7JA 1Q43A 2BW8A 4XF4A 5EZWA 4P9GA 4C90A 2QZ3A 4PLNA 1RUD1 1H2NA 3AYDA 2JJ6A 3B69A 3OY8B 1ZYBA 3VV1A 2E7AA 3AMPA 2RS13 3OYWA 4GH4B 4A7YA 1PGW1 3TWIA 1O5UA 2ENRA 1W6QB 2ZGNA 2IC1A 4YVWB 2XBO2 1AR83 2VGDA 2UYBA 4L8QA 4M0HA 4XMAA 3J8F2 3VBUC 1AR71 1RUOA 2JKBA 5A3MA 2CNAA 5H9SA 3JD72 1ZZBA 1KITA 2B46X 4GA9A 1D2QA 1C1FA 2X29A 1COV3 4F3JA 4BQ1A 5K0UB 4CEWB 2R49A 4X6RB 4PIZA 5JZGC 3VL9A 1YYNA 4QPIC 4LBOA 3U0ZA 2JG8C 3NJZA 1TEIA 1FXZA 3UKVA 1BYHA 2HWC1 4XMIA 2E51A 3M3CA 4Q2FA 4AW7A 4FT8A 3WHTA 4BHPA 2BEOA 4H7LA 4CRQA 3INAA 3OD4A 1S0GA 1DIWA 4WM8C 3AX4A 5JOYA 3SMHA 5CNAA 3FLTA 4EN6B 1CGPA 3LA7A 1IHMA 3NKTA 1PO22 1UMZA 5GLVA 3MF6A 2FZ1A 3IN9A 5T5JA 2PAEA 3UJQA 4JQRA 1D4M3 4SBVA 1QU0A 5CFDB 5CADA 3B01A 3W58A 3RMXA 4AGRA 2VU9A 1HQWA 1QH7A 5GLZA 2VW2A 3ZFFB 4XJZA 3ILRA 1PGSA 4H55A 3V65A 1QOOA 2VH9A 2WNEA 1POV3 3MPPG 3H3UA 2GZWA 1MS4A 3B3QE 2PHFA 2Q1MA 4N53A 5GLUA 4PIXA 3LSEA 2GH2A 2ZOEB 2Q1ZB 2QKDA 1CVNA 2D6NA 2DFBA 1ASJ1 1H4HA 2Q0AA 1VB4A 4Y20B 1RUI1 4FPEA 4K40A 3RYKA 1JUHA 4Q0QA 1PNGA 3L9JT 2NYYA 2BTVC 4FPFA 3TN91 3N35A 4X6QB 3VBRB 1RINA 1VJ2A 4Q0VA 1S0CA 1H4GA 3CLPA 3LWCA 5JSRA 3USUB 2DVFA 2E63A 5T5OA 3FBYA 1JXNA 5JI7A 1AL21 2R072 1PHMA 1JHNA 5HBAA 4AVAA 5J37A 4NWWA 1ENSA 4CDWA 2HWC2 1GZCA 2ZA9A 3D4KA 4IEVA 1WD3A 1GBGA 4MX3A 3N3HA 4OI2A 2CWMA 3LB9A 1VBB2 1ZZ7A 2XKPA 1AR61 4AHWA 4XIOA 3VHPA 5JOZA 1NXD1 2G9GA 2PELA 2B9UA 4JVAA 4NN0A 1JN2P 1RL3A 3B7MA 4M3CB 2JG9B 5FLIA 4N90A 2RS53 1W39A 2VOXA 3VBHB 3AP5A 5BNOC 2OZJA 4Y1YA