4AFBA

Crystal structure of subtype-switched epithelial adhesin 1 to 3 a domain (epa1to3a) from candida glabrata in complex with glycerol
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
227
structure length
227
Chain Sequence
SKDPTTFPLGCSPDITTPKKGLSMELYSYDFRKKGSYPCWDAAYLDPNYPRTGYKSHRLLAKVDGVTGNINFYYHATKGCTPQLGHLPASYNYPKPLTMTNFTMLLYGYFRPKVTGFHTFTISADDLLFVNFGAGNAFDCCRRDSSADHFGNYQAYAIWGSKTAKDELTVHLDAGVYYPIRLFYNNIGKDGALSFTFKTESNENTVSDFSEYFFSLDDTEEGCPGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Promiscuity and Specificity During Candida Glabrata Invasion of Host Epithelia.
pubmed doi rcsb
source organism Candida glabrata
molecule tags Cell adhesion
molecule keywords EPA1P
total genus 55
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10528 GLEYA GLEYA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4afbA00
4AI2A 4COWA 4D3WA 4COYA 4LHKA 4AFAA 4A3XA 4AFCA 4COVA 4AF9A 4CP2A 4LHLA 4AHXA 2XJQA 5A3MA 4LHNA 4GQ7A 2XJSA 2XJRA 2XJUA 4AI3A 4COUA 4AHYA 2XJTA 4CP0A 4AFBA 4COZA 2XJPA 4ASLA 2XJVA 4AI1A 4AHWA 4CP1A 4AHZA 4AI0A 5A3LA
chains in the Genus database with same CATH superfamily
4QPGA 4FAHA 2QDNA 1CJPA 1QXPA 1LESA 3FLRA 3GHMA 4ZY9A 4K3UA 5T3NA 1PK6C 1O3SA 1VALA 4OQ9A 1AZDA 4LKDA 4KL1A 4Q29A 4N43B 3VBFB 1QGLA 3NNJA 3NMBA 1A6CA 3LDBA 2VBDA 3KLSA 4UOJA 2VOXA 3N9LA 2OT7A 4L0PA 4NHKA 1W99A 5FMDA 5GLVA 3WVJA 2ZHMA 2GMMA 1RUF2 2OXBA 4CDUA 2EICA 3E6BA 4OZXA 1SLLA 1IS4A 4M4PA 2Y64A 2R30A 3HEIA 3PLQA 4O65A 1OMIA 1CAVA 1UXZA 3OY8A 3ZFFC 3MLJA 1OQDA 4LPLA 1QWRA 2PHXA 1K5MA 1HRI3 4D6SA 5LEKA 2E51A 3RG0A 1IGOA 5D1IA 1FPN2 1XU2A 2DFBA 4MSVA 3T2QA 5IUQA 4B4QA 5D8AA 4R8HA 2HBUA 2K0GA 1ENRA 2VQ0A 3I3QA 4PI2A 5J98B 5LRRA 5F2SA 5DUWA 2YBSA 2ZGTA 4NIHA 4ATFA 1ZRFA 1W6OB 2R071 4JGZA 4QT6A 4K1YA 1RUE1 3N7KA 2D6NA 2XJRA 1DYPA 1WCQA 3HIFA 2XR4A 4N7IA 4U2AA 4Y33A 3O1SA 2JB4A 5E1RA 4QD2A 1GQPA 4IEWA 4XIKA 4D6QA 3N4MA 3FLPA 3ENRA 5A7QA 4DXSA 4KNCA 5HCFA 5L7OA 4W4ZA 3ZXGA 4AFDA 5I8TA 1RUJ2 4IE6A 4N7UA 5AC91 5A3UA 4RFT0 4PIYA 4Q4W1 3B94A 1D4M2 2VULA 4HKOA 4E8CA 4V2VA 2D6LX 2GNTA 4QKBA 5HXVA 2XKPA 3ZYBA 4HXCA 1DGWX 1EV12 2DFCA 3PU8A 3LEKA 1PO22 2CWMA 4XFFA 3EBRA 4WM8A 4MHRA 5JOXA 5EXOA 1K45A 2EALA 2NM1A 3NV2A 3AKRA 3ATGA 5FJHA 3WNPA 5DZFA 4SBVA 4C0HA 1GP6A 2JD9A 1RUD3 1WBFA 3J4UH 2ZAHA 3IKWA 4KGQA 3WW3A 1AR91 5FXZA 1BQPA 1SHWB 1LHVA 4YPJA 3Q8AA 3POGA 4LO7A 3AVRA 1L7QA 1AR71 5FZ6A 5CAZA 4WBBA 1DFQA 1W3VA 1Y43B 2G9ZA 3L9JT 3RYPA 4XJUA 2YMZA 1VBD1 1B35C 1XYPA 1F35A 4ZZ8A 4Q8LA 1FNYA 3AKQA 1SBDA 1FT9A 1ZYBA 3PMSA 4ZZ5A 4ZU7A 5KWRA 3S0MA 1QF3A 4N9IA 4QDQA 2RJLA 4S2GA 4QX2A 3JCIA 3EO6A 2GH8A 1MQTC 2BGCA 5I0UA 3VZOA 4OCTA 3FWEA 2D6KA 2P17A 4FT8A 3KCYA 5CKNA 2AREA 2JDAA 3VD7A 5BY5A 4XUOA 5J96B 3DN7A 4F8AA 4PI0A 1WD4A 5KHIA 1LB2A 3QH7A 3NQHA 2LS6A 1MS9A 4TYSA 1KD7A 3VBRB 3HJRA 1CAXB 4A7ZA 5AVAA 1YHFA 1AYM1 4CU6A 4Z2AA 3O14A 4ZU5A 1WLWA 1GP4A 2ZEYA 4QX8A 1P8JA 1UY3A 2BZDA 1RVF2 2J1UA 2YU1A 3WNLA 1OUSA 2VZ3A 5LW9A 1FYUA 2ARAA 2ZZJA 2VZVA 2XUMA 4LHLA 3TEXA 3ZKYA 5JXGA 2ZHLA 3M3OA 2G1MA 5KXCA 1WCSA 2D5FA 1G9CA 1UOJA 3ZFEA 5CVRA 5C9AC 1IKPA 1Y4WA 4HVQA 3EJKA 4I30A 2R041 2CYFA 4KBZA 3M3CA 5A3TA 2A5ZA 3OB8A 3O5SA 4P9WA 3WNNA 2ZAAA 3IIIA 4ITCA 5DZGA 2JG8C 2GSYA 5A32A 3MYXA 5D8AB 1JXNA 1DLCA 2AGSA 2VZQA 3N7MA 4P5HA 4LBJA 5CKQA 4LBQD 2HWF2 1RUI1 3I59A 3M1HA 2VJXA 4UFJA 3WHUA 3WDWA 3WR0A 4XZPA 3RYKA 4BXSV 3T2PA 3QLQA 1YNAA 3LKJA 3SH4A 1G8WA 2RJKA 2R7EB 2R1DA 4JGZB 4CZSA 1DGWA 3I3EA 2KR2A 5JI7A 4AWDA 5GKAC 1C1FA 1UY4A 3ILFA 2CSGA 3N36A 1JYIA 2ARXA 5GLZA 3ZPOA 3ZXJA 1CIYA 1AUYA 4RQPC 5BXXA 3O1MA 3MIHA 4XOGA 1QJY1 5ANNA 3LDKA 2SBAA 3CHXA 5L7OC 5DUUA 1H30A 3IPVB 3ZXDA 5IYYA 1RHI2 2VO5A 1IS3A 1QJX1 1JZ7A 4A3XA 4HN0A 4M3CB 3VKFC 4Q4V3 3ES4A 3DPRA 5FP4A 1Y3TA 2ZXQA 3BKZA 1YXWA 1POQA 4BMEA 5HV4A 5IATA 2DBNA 5EQUA 3K51A 4AEDA 2QDRA 2P5BA 2ORZA 3RZKA 4CDUB 2W1UA 1PIV1 5E6HA 2RS53 1QJFA 3PNAA 1UZVA 3W21A 2WC2A 1CAWA 2QUOA 5L9RA 2WNUB 3SNMA 4DUWA 5F3CA 1LAJA 4NWWA 4D7YA 3T1LA 3BYWA 4AOCA 3T3YA 5JXIA 3ZMNA 1AXKA 1OA4A 4KWLA 3AM2A 4X6QB 3IMMA 4N53A 1PO13 3PURA 3MW3A 2WFF1 2WWSA 3DPRC 4P9GA 1D4M1 2WN2A 2ZMLA 3LEMA 3SLIA 1B35B 3OYWB 2TEPA 3D5OA 4GKXA 1CX4A 3I2HA 5FOBB 3PUIA 2ZGLA 3T4HB 3AB0A 4R4XA 5IAXA 2B7YA 2XH6A 5FREA 5I8YA 4J6GA 1OPOA 3WDVA 2WR9A 2YU2A 4UBGA 4ASLA 4BB3A 1AX1A 2XONA 5C5TA 3T4VA 3CNAA 5DQ0A 4LO8A 4CCEA 1W6PA 4ZXEA 2ZABA 4YW2A 4E4ZA 1AJKA 4E2SA 2J7MA 4QKNA 4URAA 1MS3A 3HT1A 1W3XA 2BV4A 1Q3EA 1FMD1 3TN91 2W9XA 4W6XA 3JQXA 3UKTA 5IFTA 2BGOA 2ILMA 3KQ4B 4YVSA 1ULGA 2GH2A 4GD4A 5AVPA 1PGW1 3B5LB 3M70A 2A6ZA 4N9HA 5GLUA 3TEZA 3MV01 4DRRA 5C5UA 5G04L 1T2XA 3BOWA 3KV6A 5BNOA 5A33A 2B4KA 4HT1T 1ZX5A 4O9GA 4Q1PA 3VL8A 1Y9GA 3WHTA 2CV6A 1RUG1 3KMHA 3KS7A 1DIWA 2RS13 1V00A 2HWD2 1H8TA 1S0DA 2WBKA 4JDOA 4NOTA 3POJA 5FZ1A 2XG3A 4LIVA 5IK4A 4AR2A 1QU0A 2C1FA 4WM8B 1L7RA 4YM0A 5C9AA 1W6QA 1SLIA 4FOYA 2ZHKA 4ZU4A 1W6QB 3RDIA 4LXLA 1ODNA 3TRSB 1RB8G 4Q5OA 1GANA 4H7MA 1RUE3 5CKMA 3GDBA 3BIWE 4RR3B 4UF0A 3RRDA 4MV2A 4RR3A 3I2GA 1E5SA 2HWB1 2YV8A 4IEQA 4MGQA 4XUQA 3TWIA 1JZ4A 5CISA 3B9IA 2XQRA 1JOJA 1GOFA 3ZSJA 4ATEA 1PZ9A 1REEA 3PVEA 2ZTNA 2QQKA 3SHRA 3ZR6A 5FDBA 2RM21 4TTGA 3N9MA 4Y5TA 2JG9C 4UFLA 4XQDA 1LJ7A 4CCMA 1WGPA 3S7EA 1GYKA 1MS1A 3GBGA 3NO8A 3Q8CA 3N9NA 3B00A 1LCLA 1A34A 5LBBA 3NL1A 1RVF1 4HBNA 1V9U2 3GJAA 1W8OA 2D7FA 3SCGA 1ST8A 2P1BA 2IVJA 1M4WA 2W95A 4FCAA 4JTNA 5IVYA 1PM4A 2LUWA 1RMU2 4CVUA 1FOD1 2HWF1 3VB9A 3O1OA 5IWFA 3LA7A 4EYUA 4L97A 1F31A 2QQLA 1O7FA 4GMP0 3MIGA 4OQ8A 4QXBA 1VMJA 2NPIA 1EV13 2GZWA 4FFFA 3GHNA 2VZSA 1K3IA 4AI8A 3R4UA 4SLIA 2R073 1BVVA 1IPKA 1RINA 2YGLA 3QOPA 5FQ0B 4MXWB 2JIJA 4XJWA 2W0XA 5FIXA 3VKMA 1COV1 4QB2A 3N9PA 3MLLA 4XUPA 1F8VA 2WNVB 3OGGA 5FXXA 2RS32 5C4WA 2QVSB 4B1LA 1ENXA 4IL7A 4RS5C 4CUAA 4RGAA 1POV3 1JU3A 1G9AA 4AVVA 3UKVA 2P4EA 2UY9A 2XMLA 4K9SA 1LEMA 4CP9A 4XTPA 1IHMA 5CFCA 2DURA 4BIFA 4MLOA 4XFHA 3KCCA 1Q5OA 2B5HA 4NRMA 2HEYF 1S4CA 3BTYA 5A1AA 5KXEA 4P00B 1O3RA 2WWUA 3OUJA 4RN5A 2J1SA 4YGBA 3AZZA 2AACA 2VOWA 4XXAA 1OC1A 3VD3A 1TQ5A 2LW8A 1RUI2 4INDA 5HCAA 1OOPC 1RUH3 4XQ4A 5T54A 4AG4A 1C5HA 1XU1A 3SMHA 1WW7A 1PGW2 1TZOA 2RV9A 3ZN5A 2ZMKA 4RS5A 1URXA 3W20A 1ZBE3 3IMNA 3O0VA 2WAOA 1VMFA 5A80A 4BK5A 4LOSA 4O61A 3VL9A 2DVDA 3T0BA 1NCQC 2X53S 5I0SA 1F2NA 4XJZA 4C1WA 1G9DA 4NIIA 4AVCA 1VRBA 1K42A 4NAOA 1X82A 4NJ4A 1RUG3 1EY2A 4WVZA 3UKNA 4FPKA 2IXIA 1QDOA 1UMZA 2CAVA 1ND2A 2D93A 1XPWA 2Y0OA 3IPVA 4XCBA 4Y4YA 2OIIA 5LK5A 5KHJA 1LOCA 1NZIA 2EAAA 4NVPA 4CP1A 1ZA4A 1R1A2 3EB7A 3CF6E 5BNPA 5FLHA 1U5IA 4ORFA 1HQNA 4DPNA 2GN7A 1NYWA 1C28A 1DGLA 4BU2A 1O6UA 1NCRC 1H8TB 1JZ3A 3CZJA 4HKWA 2VW0A 2JDZA 1SMVA 2EF6A 1NA1A 2A6XA 4PDWB 4NHYA 1PNGA 5EYXA 4MGSA 5C6CA 4LTAA 3K3NA 3PVOA 5FZAA 4BMBA 4DS0A 4DEQA 1KFXL 2YHJA 4H14A 3PIJA 1RUC3 2AUYA 3BGAA 2Y0IA 4LMFA 1LOEA 4FOVA 3P3NA 1OBNA 2YC4A 4YM2A 3I49A 4GXLA 3O7OA 4OI4A 4BM8A 4COYA 3WCRA 1WUVA 4DFSA 2WO1A 2ZEWA 1S0CA 2CDPA 4QQHA 3ZKUA 1FX5A 1IQAA 4I3GA 1OVSA 1TME3 5A3MA 2DU1A 5A33B 2HEWF 4GB31 3ZYGA 2EXIA 1C8M3 1F5FA 4DUXA 3TEYA 5CFCC 1LRHA 4Y22B 5IAVA 5CZKA 3WNKA 2QFEA 4TWTA 5F5CA 5FZOA 5FPZA 5IVJA 4GAZA 3VDAA 2DVAA 1ZZCA 5FZ4A 3AP4A 1TEIA 2BTVC 2DYCA 4FFIA 2ZGUA 1AR61 4YZ1A 1EYBA 2V5YA 3POWA 1WA4A 1JZ6A 4I01A 2J22A 5JDBA 5A70A 1QJU1 2VMEA 4ZS2A 4FP3A 4MGKE 4NHXA 5FYVA 1TG7A 4FFHA 5A7OA 3AZWA 3VBHC 4A42A 3ZVXA 3VBSC 3MICA 3WD5A 5F8PA 4Q4X3 1J1LA 1TNFA 2PHDA 5GM0A 2ZMNA 4JHZA 5F7UA 3T0AA 2R061 3SKJE 2BBVA 2EIGA 2IWGB 1WMDA 1QOTA 2XBO3 2OYZA 3V0BB 2DVFA 3M3QA 4XC9A 2HWB3 1W2NA 4LKFA 2D6MA 3V65A 2H0VA 2BNNA 2W1QA 1SDWA 1F9KA 3PUQA 1EPWA 4FPFA 4JGZC 3S5AA 2VTFA 1ZRDA 3VD4A 3K46A 2R063 2Z69A 4I0BA 1SLBA 4ISRA 1OURA 1PNFA 2WNUC 4RGKA 5FYCA 2DU0A 2JG9A 2ID4A 2VVEA 4NUBA 2D6OX 3MW2A 5J7MA 2LALA 1W9FA 4PLNA 5IVFA 5DDJ1 2VCMA 2XVGA 5L7OB 4WM7B 1CAUA 4V1PA 1NZCA 5FUNA 4LBKA 4AI3A 4XETA 5L9VA 2VBBA 2R6QA 3BOPA 3ZSEA 1YQCA 2XL9A 3ETQA 2JIGA 1QXRA 1HKDA 5DDJ3 4YW1A 3WDUA 4Q4Y2 4RSUA 1LODA 4WZCA 5IJRA 3SISA 4KMQA 4LT5A 4GWMA 3WG3A 1WWYA 4UW4A 2PAMA 4LK6A 3M4FA 4WM7C 3URFA 1ZRIA 3C7HA 4JGYB 2RS31 3C7EA 3RMXA 2V5DA 3ON7A 4K8RB 2HWC1 2RG4A 3OCPA 3QACA 4NHMA 1A8MA 4KG0A 1H4GA 1R1ZA 3VBOC 1HRV2 3LEGA 4C8DA 3OY8B 4MOAA 2VUCA 5LATA 2WFPA 3BTZA 1JH5A 4ISQA 1A78A 4RQPA 4E9KA 5FZIA 2PQQA 4CEYA 5FMOS 4MVTA 4A7YA 3U11A 1SCRA 3H8OA 2I45A 2XWJB 5FZ3A 3KB5A 4FPYA 3LDRA 4YVSC 2QKDA 4QDSA 2WO3A 4H3WA 4O7XA 1R091 5BYNA 4XFBA 3B9CA 2OW4A 3ZFGC 3VDDC 4IETA 3U14A 4BLIA 5JXJA 2JG8B 3C7OA 2V72A 2V09A 3DKWA 4Q0QA 5DAXA 3KQRA 5FWEA 5CFDC 1LHNA 3DUIA 3VBUC 4RL7A 4IE5A 3AX4A 1LKNA 5KR7A 4EQVA 1XBFA 1ZZBA 1VBE3 1AL22 3NV1A 4BQ3A 5EJZB 1VAVA 5CBLA 3NJVA 4J25A 2BUKA 2P3YA 1UOBA 3FUQA 2QBXA 3THTA 1LTEA 3VZMA 1PGL2 5GLTA 1W6PB 3GNEA 4RHV3 1VBB1 4M01A 1JUHA 4YGDA 5ABJB 5LZ6A 4FTBA 1YC61 3KVAA 1VIWB 1X9PA 3MPBA 4W6WA 2GC2A 5C7GA 1I6XA 3S7IA 1ODMA 1PMIA 1AXYA 3NJYA 3BU0A 1I5PA 1EAH1 1GNYA 3EYPA 2E7AA 1LGNA 1W0PA 5F5QA 1MQTB 1FNZA 5FY5A 3ACHA 1CWPA 2VZPA 5A7SA 5F5AA 3ORJA 3IN9A 4XDOA 3RYRA 1UYZA 3QD6A 3OUHA 3HD8B 4XDPA 2VU9A 3VBRC 3LPFA 4GMP1 3RZGA 1UOGA 3GGLA 1AR83 3L2HA 2OVUA 2WT2A 1ZBA3 4YM1A 2Y8KA 1RUC2 1GBGA 5FO8B 2FHRA 1HB1A 2VXJA 2FZ1A 1AVBA 1MVQA 4AEMA 1QH7A 3FX3A 2VCBA 3CIHA 4DEVA 3TYJA 1Z7S1 3OUIA 1BHGA 2K46A 4AAPA 1RUH1 3FBYA 1DGRN 1UY1A 5LRSA 2VG9A 4QM9A 5FYMA 3ACLA 4MGYE 4XURA 1Q8VA 5FUIA 4CDQB 4OI0A 2D3PA 2CGOA 2DCZA 4JKLA 2RM23 2ZACA 3ZFGA 1FV3A 4NIDA 1DQ4A 4Q1RA 1ULPA 1FAYA 1PMJX 5LY2A 2HWE3 3FFQA 3VBOB 4GWNA 4JRLA 5IVBA 3TBDA 4C91A 1YFXA 2XXZA 3AFGA 5EHDA 1ZRCA 4YW5A 5IK7A 2E7TA 1PVC1 1VBB3 2PFWA 4XHXA 5BNQA 3R4DB 2CL2A 1KS5A 5A7PA 1YQ5A 3UGGA 3M3EA 2ZEZA 5G05L 4Z2WA 5HV0A 4ZKTB 1HXS3 1S1AA 2XVLA 1YJLA 5DN2A 2WWJA 2ZGRA 3WX5A 1QOSA 2BFUL 1W39A 3HQUA 1H9PA 5LBCA 3RMYA 5A7WB 4Z82A 2BYVE 2CGNA 3DECA 4R9CA 4XYXA 4OHVA 1SLCA 1KS4A 2ES3A 4YW6A 3A7QA 2WS91 1SLAA 1XNCA 1LGBA 1V6OA 2W39A 3POBA 4W50A 4QGMA 5CA6A 4O9EA 2ZX3A 1HB2A 3ZXEA 3U07A 4BIOA 2XJUA 4AXOA 1JHJA 3VKNA 2BERA 4YZ5A 4V2WA 1LGCA 2GNMA 1JYWA 2VW1A 1EUTA 2C0ZA 2YPDA 3NRUA 3WT3A 5HCHA 4A7KA 1D4VB 1F15A 2JJ6A 3POIA 3SKVA 5C33A 5FY8A 4DXRA 3MIFA 3GBFA 2X09A 3ZFGB 1OF4A 2A73B 2CWSA 1GLHA 3HQXA 3Q8FA 5JOWA 1UYYA 4CCOA 4AFCA 2ET1A 1S0FA 3K48A 4N53C 4KWKA 4XE9A 3B02A 2F17A 1UW8A 1V70A 2ZGNA 2A7AA 4LLFA 3U1XA 1A3KA 2RS51 4LO6B 4LHNA 2ZBJA 1W04A 3D8CA 1PVXA 3HBZA 5D21A 3WY6A 3T30A 3ZXAC 3VBSA 1OD3A 3WW4A 3ECQA 3A0NA 3RQ0A 5EYYA 1PK6B 2NLRA 2BW8A 2VAUA 4LITA 4FXGB 4OLLA 4PIXA 4R52A 5FZKA 3VBFA 3FN9A 1K5JA 5DXDA 1C1LA 5JVVA 1VP6A 1GOGA 3ZYIB 1U5YA 1HJGA 3NNMA 1LHWA 3PTYA 3UT0A 5FY9A 2P3IA 1NT0A 1ZRRA 4GJZA 1GQHA 3OBTA 2P34A 3K3OA 2VMDA 4KQ7A 4XXPA 4AFAA 4DUVA 5LB6A 5BNNB 4NRQA 5FZCA 2H6BA 4OYUA 5TSWA 4CUBA 5FQ0A 1H8VA 3DYOA 1S55A 1UY0A 4J1XA 1XNKA 5EWSA 5E8AA 1S0EA 3MF9A 1V0AA 4UAPA 1WA6X 1C57A 2JKBA 3ZX7A 2F6BA 5J48A 4PLMA 1QJZA 1RUE2 1TVGA 4COZA 2ETEA 4PQ9A 1LR5A 1VBA2 4P9JA 3LAGA 4QXCA 4XJAA 3MIDA 4BLJA 4IE4A 2WNVC 1J1TA 4CUCA 2E6VA 1A8DA 4CUGA 2ORXA 2XLAA 5FZFA 2WSVA 5LBFA 3POEA 2FDFA 5JSRA 3OOXA 2PHUA 1RHI1 2XBO2 3LFIA 4OUSA 4PT6A 1YUDA 2FCUA 1JZ5A 4Q26A 2A1XA 1ZM1A 3DXTA 4HZFA 4CCLA 1O5LA 2HLEA 4QQ2A 5C4WC 1CQ9A 2CHHA 2V4AA 1HRI2 5FXWA 2A71A 1VB2A 3E5QA 2WZR2 2QTWB 4XF9A 4BQXA 4GKYA 1N1YA 4JKKA 4XJ8A 2W3JA 1BJQA 1K12A 1UZWA 1W8UA 2BWAA 1ONAA 1WW5A 4FOQA 4M3CA 4UW3A 3SC7X 3VBSB 1OA3A 4AK3A 3E6CC 2FDGA 4EWEA 2LTNA 1NQJA 1BBT3 3AMQA 1SFYA 1VBC2 1GSLA 3BALA 4IEVA 1LOBA 4F7ZA 1PIV3 4FAGA 4W8JA 5I91A 3ZSKA 4RD7A 4CPBA 5FZBA 4EN8B 4H55A 3HBKA 1JMUB 3NKTA 4AVAA 5KHKA 1MZEA 2Y6HA 1UN1A 3H0OA 4Z8BA 3PMEA 2UWBA 1PX4A 4JQTA 4AHXA 1UWWA 3VBUA 2UYBA 1HRV1 1TME2 2EAKA 4AEDC 4IGPA 1G9BA 1VAKA 4BQ5A 3MZHA 1VJ2A 1AR92 4HK9A 4HVOA 2B8MA 5E16A 5EP9A 4Y1YA 3HOBA 1XQNA 2E33A 2IXKA 5FBJA 5C3SA 3S57A 3W9AA 2X05A 4OHYA 2NMOA 1DQ0A 5JCTA 3VD9A 5I8SA 4XF1A 1NX9A 4QPGC 4CCCA 2WDBA 1LHOA 3THCA 1BXHA 3UETA 4CDWC 1OKQA 1D0HA 2P6CA 2GN3A 4HSLA 1J84A 3RNSA 2JX9A 3PUSA 2WS92 2PTMA 2ARCA 1RUJ1 3Q8EA 3T2OA 1R093 2VR4A 2C5DA 3TAYA 1GZ9A 4META 3POYA 4XAAA 1N3PA 1QJEA 2BQPA 1ACCA 2J42A 3KT1A 4MZUA 4Y5Z0 4HL0A 4PLOA 3KSCA 4UI9L 4QHOA 1JYCA 4EN9B 3B3QE 2VD7A 1SBEA 4NAMA 3W59A 4F83A 4OMDA 4BZ4A 1DDLA 3KWVA 1W8ZA 1L3JA 1JOPA 4CEWC 4YW7A 2E63A 1W8WA 2WL1A 4AW7A 2AC1A 4MGTA 5IVVA 5FZEA 4Q0UA 1C3HA 1XYOA 1QXJA 2R062 2X8KA 3BPZA 4XBNA 5CNAA 5LA9A 3ELNA 2BPA2 2BJSA 3BVCA 2WINB 2RMU2 2HWB2 4QGNA 2FQPA 1O3QA 1ASJ1 2V4VA 3D6EA 5F37A 5L19A 4JRAA 4QU2A 2Q1ZB 4P9LA 3MI8A 4XDQA 2W2IA 4QPIA 5KC5A 4X8NA 1RJ8A 4YVWC 4H7LA 2VNRA 1F5JA 5B4XA 1QKQA 5A6XA 3C7GA 5FZLA 1UZYA 2HH9A 1YFYA 4FXKB 3LA3A 5F2WA 1GFF2 4K7JA 2WNEA 4MYEA 1LULA 4BOWA 3OGVA 1S2BA 1S0JA 2YDEA 5IVCA 1UX7A 3AZVA 5CEHA 1S0BA 5F1RA 3FHQA 4RR3C 3IAPA 1WCUA 3VBHA 1WMXA 1ZA7A 1O3TA 2WA4A 4Y22A 2AZ5A 1K5MC 3LA2A 5L73A 3BIEA 1NLRA 1NCRA 1YIFA 1CIWA 2DBIA 5APAA 5EJ3A 2XHNA 3WCSA 2YC0A 5I0RA 1KGYA 2GC3A 2AR6A 3RSJA 2MEV1 5EPAA 5JMCA 3HPNA 5FY7A 3OEAA 2IZWA 3MW4A 2DCYA 3GZTB 3USSA 3PIGA 1RC6A 4LNVA 4XF4A 3OF1A 2WT1A 4WVVA 3NV3A 4LUMA 3PJQA 3WUDA 1R64A 1MZ6A 1XNAA 1UQXA 2W68A 3WDTA 3KZ4C 4Y26A 3ZYRA 1AYM2 1UNBA 3JBG3 1HW5A 2A3YA 2KA3A 4ZONA 2O14A 5FPAA 3ZYFA 1SBFA 5FK8A 1DQ5A 1O5UA 4G4FA 5FPLA 2OZJA 2DV9A 2XBO1 1OOPA 1DP0A 2WRAA 1SG3A 1XNTA 3T1MA 4FOWA 2RR13 4AHYA 4CCJA 4CP0A 2W46A 3DF0A 4UF0B 1RUC1 2HYKA 4HN1A 1XE8A 4NHLA 3VHPA 2EVXA 5CB7A 1W9TA 1AHSA 1W0NA 1YRZA 3NVCA 3I8TA 4GALA 2C4XA 4LKEA 4LQRA 4QX3A 5DAVA 4DIQA 4UBHA 4IV1C 3AP9A 1SACA 4LEJA 4XABA 4XAEA 5DPNA 4AI2A 5FR3A 5FP7A 2KM2A 3UGHA 3HR9A 4Q4V2 3VBOA 3O0XA 3G7DA 5FLIA 3AZYA 3ZSMA 3I2DA 4P02B 3V0BA 2D5HA 1AR82 2ADDA 5A6QA 2ZHNA 1D2SA 1NA1C 1X9TA 4K40A 3FJSA 4HSJA 4RA0A 2O8QA 4XEZA 3JZVA 1ULDA 3CMGA 2G9FA 3NSTA 4PCRA 2WZEA 4LO5B 2UY8A 4YVSB 2VCAA 4GB33 1FV2A 3AL5A 4J1WA 4DXZA 5BNOB 1PO21 4WV8A 1UOFA 4WM7A 1KDMA 1OHFA 3R05A 1NE4A 4BISA 1JHNA 4KU8A 2WUHA 3H3ZA 1LEDA 3S6PA 4YW4A 4FPJA 1YJKA 2FBEA 2SLIA 1EPZA 4XW3A 3THDA 3VZJA 4OUMA 4ES8A 2VPVA 1NY72 3KGZA 5FPBA 2WAAA 1NCQA 1F4HA 2YZ4A 4W65A 2GNBA 2JDMA 3CDZB 1BVP1 2EXKA 2HWE2 3KD4A 3WDXA 3H8UA 4IGOA 1OH3A 4AQTA 1N1SA 2P6HA 2WLQA 4NPRA 3WINE 4WVWA 1CD3G 3SEPA 4Y1ZA 1D2QA 4HETA 3WF4A 3AYEA 1IS5A 4GZ9A 1N1VA 3KCXA 3A23A 3LWCA 2E7QA 4AZZA 3ZOIA 1I9RA 4HFSA 2Z79A 2E31A 4UFKA 2VBPA 4CU9A 5IVEA 4LORA 4MXWA 4C90A 2I07B 2WSUA 4IV1A 4YVWA 2EIBA 3UYJA 2UURA 4D69A 2RHPA 5FWJA 2R32A 3AYAA 4FO9A 4L8QA 4JGYC 2ZGKA 3HNMA 1H2KA 1MZ5A 1APNA 2ZX0A 3BTXA 1NLSA 3J8F2 1G6NA 5GLWA 1COV3 3X29B 2B39A 1T6GC 4PIZA 5FKBA 1GZWB 2J1EA 1YQ8A 1ENQA 3VDBA 5FO9B 1QMJA 4LE4A 5FBZA 5FTTC 1GQGA 4AHZA 2RE9A 2RS11 1MS4A 3ME2A 5DAQA 4DQAA 1OLMA 2RDSA 2Y60A 4GB32 1TMF1 2BVVA 2Q8DA 5T5JA 2Q8CA 2YROA 3GJBA 5LK7B 2Y6GA 3LIHA 4BQWA 1CESA 1D0GA 2ZZQA 4R9AA 5K9YA 1J3RA 4QX1A 1OOPB 2AENA 2D3RA 5DMYA 3M3IA 1H0BA 2PAEA 1E5HA 2CU5A 5T5LA 4HG6B 2RDRA 3I3BA 4HONA 2JE8A 1UXXX 2LRPA 1WW4A 5H9PA 1OA2A 2VTXA 4LE3A 3M8LA 3EQEA 4FQ4A 1CR7A 4Z07A 2ZOEB 4QX0A 1VPHA 1K5MB 4XACA 2WA3A 4OZOA 2E9QA 4IV1B 3ZMOA 2VL4A 2XPJA 1PGSA 3USUA 2ZKNA 2QZ3A 3ZN6B 2FDJA 3R6SA 5BNPB 3VBHB 1ZZ8A 2BOIA 2B42B 3FLTA 1KFUL 2OQ6A 3NAPB 1OFNA 2GMEA 3WQ1A 2R042 1JS9A 1R092 2GMPA 4LBLA 4EZHA 3ALQA 5A3PA 4EN0A 1ZREA 2BU9A 3IIAA 4AE2A 1MVEA 3WQBA 3ZLIA 2HWF3 2R1BA 3HNBM 1HRV3 5SV5A 3ZO0B 1ENSA 1DQ2A 5M0TA 3WP5A 3I3DA 1MPXA 1NY71 4IQPA 4AEKA 3H7JA 3KM5A 4LULA 3CLPA 2UYAA 1ND2C 1NXD1 1MS0A 1X50A 4JHTA 4LHKA 5DAPA 3WP4A 3U4SA 1AL21 4AF9A 1IQDC 1X7NA 2NN8A 1W28A 3RFRA 4GA9A 1LHUA 2ZKLA 3KF5A 1H4HA 3OSDA 2UU8A 2WNVA 4QX7A 3VDDA 3I3MA 2CGPA 4I3PA 2WZ8A 4N43C 5C3OA 2EIDA 4IEUA 1QH6A 2W91A 3A21A 3C7FA 1C4RA 4R9BA 5DUVA 2RMU3 4BWOA 2ZA9A 1LU1A 3H50A 5AC92 4BA6A 1BBT2 2WZR3 1C5IA 5FKCA 1RUOA 2FCVA 4Y5SA 4MO3M 1RHI3 2B9VA 2EA7A 1C8NA 4WVMA 2C26A 2PAKA 5C4WB 4EV0A 5DABA 1UD1A 5JR7B 3WSOA 1H1AA 3LPGA 2QQOA 2OS2A 3AYCA 5T50A 2FZ2A 5KC6A 4AGVA 1H2LA 1FPN1 2ZX2A 3VBFC 4Z1VA 3A4UA 4TZDA 4Y1UA 2HYXA 5H9SA 1ULFA 5ACA1 4E27A 4LO4B 1G86A 1AR93 4IEXA 1XYNA 2Z2SB 3C2UA 4UWDA 1QJY2 1UKRA 4JX0A 1QQP3 1WBLA 3FMGA 4QX5A 4AVSA 2RS12 4HOOA 4TLFA 1JI6A 3CJIB 5FZHA 2ZX1A 5H9QA 1AR73 4UYBA 1ZBA1 2LM3A 3D0JA 3WW2A 1N47A 4QU1A 2VZ1A 3JU9A 1YWKA 5HI0A 2Q0AA 2CNAA 5J36A 3GF6A 3KGLA 1V6LA 2D97A 3OEBA 1LOFC 3AC0A 1KDKA 5BUVA 1GZWA 2XJQA 3MIEA 3JD73 1XE7A 3BCWA 2YFUA 3SEEA 3UL2A 4LBQB 2YFZA 3OPWA 2JECA 4QQLA 5LA2A 3GZUC 4MG2A 1RUG2 2J1AA 5CYYA 1CAVB 1W9SA 5LY1A 3LE0A 2H6CA 1FOD3 2WJSA 2DCJA 3B7MA 1JZ2A 1AR62 4MGZE 5A32B 1D4M3 3BPSA 5JIUA 3AVSA 4Q0PA 1C8M2 1RL3A 3MEPA 5HXMA 1VAMA 1QEXA 4BK4A 4AL9A 2XLGA 2A3XA 1UY2A 5F6LB 2W1SA 3MF6A 4H2AA 4CDXA 3ZYPA 2AEZA 5A1LA 4FPGA 5FZMA 4PBOA 1SCSA 3MV11 4A44A 1J83A 4NIGA 5F9TA 4XVHA 2YBKA 3VZKA 1YQ6A 4MX3A 1CPNA 2XGXA 3OJBA 4XPVA 1OXCA 4I0AA 1H8TC 1FI2A 2WLPA 4IEPA 4JDMA 2JG9B 1WLDA 5FMCA 2ZX4A 3MDPA 3FHIB 5JOYA 1CAUB 1ULCA 4QPGB 3N7LA 1EAH3 4IESA 3T0DA 1Q8OA 2Z4FA 3LGRA 1PVC3 5KXBA 3LZZA 4K20A 4M00A 2XVKA 4W6YA 2JICA 2VNGA 4EN6B 3K75B 4CA9A 2QQVA 4B3NA 4RHV2 1DQ1A 1Q8QA 2W94A 1G7YA 3J7HA 3GALA 4RS5B 3VUOA 1Z0HA 1RUD1 3O1PA 3DKQA 5LCWL 1HXS1 2VOKA 3HAGA 4WZFA 1I5ZA 2WZR1 1H6YA 4D7SA 1ASJ3 2WYSA 5A3OA 1GZTA 3E1F1 1HLCA 2PHTA 2YPJA 3PJYA 4RFRB 3VDDB 1RJ7A 2VW2A 5ERLA 4XFGA 1S0GA 4MH0E 3SH3A 3FFZA 2D3SA 2PHRA 1GOHA 1CAWB 3DV8A 4CDWA 2QZ2A 1V6MA 5AC93 1UX6A 1DZQA 3QCWA 2WNOA 4GIQA 1OQEA 1UYXA 2PLV1 2XL7A 1DYKA 3WNXA 3O1TA 2JDPA 3INAA 4YNIA 4N53B 1Y7BA 1OSGA 2B46X 2OPKA 1OLME 1RTVA 3AMHA 4LBOA 3EXUA 4XFIA 4AQ2A 3ZDVA 4GH4A 1LU2A 3JB4C 3VKLA 3WQ0A 2RM22 4COUA 1RYYA 1W9WA 2WQZC 4QM8A 3WLUA 2RS33 5FZDA 4B4PA 5K0UC 2YUEA 1MACA 1UIJA 1GKBA 1DG6A 3CBNA 3J8F3 4Q4W2 5BNPC 1IKQA 1VBA1 4IXLA 1SPPA 4DY3A 5A6ZA 3GXUA 4AI1A 4Y4RA 3NWKA 4GMP3 3ZFFA 4GH4C 4ONUA 4PF1A 4NIAA 3THPA 3FHAA 2QQWA 4FPHA 4G3YC 5BNOC 2Y38A 3APBA 3PDQA 2RS52 4JCKA 3LSDA 4CXXA 2OUJA 1OLRA 2ADEA 1CN1A 2LROA 3F2ZA 4KGGA 1PZ8A 3PU3A 2OX0A 4IUGA 3RWKX 1US3A 4M3CE 5FYSA 3AJZA 2VOTA 5DUXA 5E88A 2QQIA 1VBB2 5JLVA 1QJX2 3OPZA 4RGGA 3FL7A 4Q4W3 4QB6A 2XWBB 3GBWA 2RJ2A 2G19A 2VMGA 1ND2B 4CXYA 1C8M1 1GICA 1BK1A 4CXWA 1KQRA 3IDBB 4NRPA 2FDHA 1OPMA 3RGBA 4P14A 2DWRA 3Q8BA 1JN2P 1SEFA 5LASA 4LK7A 2FD8A 1YI7A 2BOJA 1ALYA 1DCSA 1HQWA 2WT0A 4MXVA 5JSOA 4ZHNA 5L9BA 4K21A 2XKOA 1XNDA 5FZGA 3VV1A 4CCNA 3GM8A 1NAEA 4FP2A 3IZOA 3AZXA 4XJ9A 5C8CA 5BV6A 3RZJA 1AL0G 1LECA 1MS5A 2AYHA 4FPLA 2YXSA 4DMIA 1XXNA 5C71A 4K6BA 2NP0A 2EXJA 2Q4SA 4CDQC 4HVRA 4S2HA 1H9WA 3BODA 3QH6A 4YG6A 1JW6A 2NYYA 2Q5TA 1KRIA 3NJXA 2B45X 4HPKB 2VNVA 1AR81 1CZVA 1WZXA 1JUIA 4MUVA 5HPOA 5J09A 4CDUC 1ZBA2 4A2UA 1BYHA 4XUTA 2WZPP 2H0BA 1GV9A 1RUD2 4IEYA 4ZPIA 1G9FA 3SCHA 4DRVA 1PO12 2EXHA 3WP3A 3NJZA 1FMD2 3AKSA 3DEMA 3GCWA 3TN92 3WNOA 3IT8A 3J7NA 1SQ4A 2OUHA 2WIIB 3J7LA 1CGPA 3PUHA 3OBZA 5KHGA 3AKTA 5JOZA 4UFHA 2VZRA 1OT5A 1SZBA 4YYOA 1E5RA 5GZCA 1W06A 2ENRA 1V9U1 2JDHA 3ZYJB 5A3NA 3V64A 2VVFA 4C1XA 1KJLA 1X8MA 2WNUA 3UJQA 3LFMA 2WKKA 1QNWA 2MNGA 4B1MA 4DO0A 1S0IA 3AXDA 1HN1A 5ABJC 2BNMA 3HWJA 1RXGA 2A70A 3ITQA 1W9YA 4GJYA 1H1MA 2ARBA 4KH9A 3USUB 3WDYA 1JBCA 4S2DA 4TN7A 2C9KA 4RHV1 2RR12 2W08A 5FOJB 1H6XA 2VY0A 3IAQA 2Y34A 4CU7A 2DDUA 4FPEA 2CY6A 2UWAA 5T5PA 3N35A 3GZEA 4DB5A 1VBE1 3R0RA 2PHFA 1GWKA 3DL3A 4IDZA 2PELA 4UFIA 1NA1B 4PDWA 5DG2A 4E4SA 1W8NA 2R0HA 4XMAA 5IK5A 3AFKA 1FOD2 4P9IA 4E4DX 2P3JA 1AX0A 4QDRA 2Q1FA 2CAUA 2XJPA 1VBE2 1UZ0A 2P2KA 1UMIA 2Y6FA 3PL0A 4OI2A 1PX3A 3NAPA 3QBQA 3O1UA 3H3LA 3MBWA 3W5MA 4NPLA 4KU7A 4L2NA 1UZZA 2W92A 4UT5A 3U78A 2BGPA 1CZSA 4KI5M 5A3WA 3ES1A 3WG1A 4B7EA 1W6NA 3OG2A 4E2QA 5FMBA 4PJYA 5KBFA 3C3VA 4G9SB 3WG2A 3WG4A 5JMOA 4N8MA 1ULEA 4Q4X2 5T5OA 1UKGA 1XSRA 5HBAA 4NPMA 1NG0A 1W05A 4JGYA 4OI1A 3ZIXA 5F6KA 1S2EA 3VZNA 1W2AX 3IDCB 1NKGA 4QHZA 4D0QA 1GMMA 2DCTA 1ZVFA 2GP5A 2ZGQA 1XE0A 2YC2A 4QB1A 5FY1A 4D8MA 2G4IA 5IT6A 3NW4A 4Y3OA 3UESA 3JB8A 4BJ0A 4YARA 5EIYB 1R083 3OBRA 1UL9A 4YW3A 3VBUB 5C9AB 5JWPA 1UPIA 3Q9OA 2MPFA 4GULA 4QKDA 3SCFA 3PUAA 4Q4V1 4AVBA 5LWBA 4LBMA 2XUEA 5KHHA 4BPZA 1ZZ9A 1US2A 3D4KA 3WF3A 2V73A 3I2FA 1UO9A 3TOJA 1O59A 2DTYA 1ZBE2 1J58A 1W90A 3ZXKA 2IXCA 3H1WA 4DZGA 5JUVA 5BPXA 1TMF2 4CDWB 5ISLA 2GC1A 3I4IA 3J9SA 1CPMA 1HIXA 3ROUA 2W5FA 1GWLA 4YLZA 1X36A 3GZAA 4LBNA 3ETPA 3V56A 3VDCA 3PVNA 1AYN1 4B7KA 3ACGA 3KT7A 3UGFA 5C3PA 3ST7A 1HRI1 3VBRA 2UWCA 3C8XA 2I74A 4YVWB 4XTMA 4ASKA 4B8EA 1E57A 1RGSA 4FTEA 3T2TA 2Y6JA 3LSEA 5I0TA 2W52A 1OH4A 2Z5WA 3WOGA 4AHWA 5A6YA 3FBMA 3LQCA 4CDQA 5F5IA 5C8WA 3P6BA 2VQTA 5FY0A 4B4RA 3TEWA 3WEZA 3I2JA 5FYZA 2P3KA 1RUF3 1GWMA 1JZ8A 3V0AB 4D7TA 4L9BA 3VLBB 1W6MB 1EAH2 4BQ2A 2QQNA 4YZ4A 1PGL1 3H3UA 5A1FA 4Y1VA 1CVNA 1KJRA 1R1A3 2FMYA 3HVDA 3U4XA 1HV0A 2PYTA 4UFMA 4L11A 2VOVA 3UJOA 1OI6A 1KXGA 2BDRA 2OZ6A 1PO11 4YSFA 5DZEA 5HCBA 3OGJA 1UIKA 5ANQA 1S2KA 1TME1 5CFDA 3ZSLA 5J37A 4IW3A 4Q27A 2A6WA 5CADA 2RDNA 3CL1A 2N7GA 4HKLA 1YEWA 4E8DA 2IFWA 4MGIE 1DU3D 1R081 1V6KA 1HX6A 1JYNA 2A75A 2C9AA 1WD3A 3I7DA 1W2UA 3K2OA 4BCUA 2ZGOA 1LENA 3E97A 4YZ2A 4XFCA 2D44A 2ZPXA 3KV5A 3J7MA 1VB4A 1Q8SA 1W8TA 4CDXB 4AFMA 1RIRA 2ET7A 5JAXA 1X33A 3BN6A 5FPVA 5FUPA 1VBC1 2ATFA 1IPSA 2DVBA 2VGDA 1BBT1 3AK0A 3RPQA 1UU5A 5JR2A 1PIV2 5JSPA 3J8F1 5C3QA 1PHMA 5H9RA 1BCXA 3JXSA 2E32A 3TNQA 2D6PA 3CJIC 3T09A 4CEYB 4XFAA 4QGLA 5BNNC 1HV1A 3FC0A 4A45A 3ZN6A 4IV3C 4XUNA 1VBC3 2X29A 4PDWC 2BFUS 3IB3A 3O0WA 4URTA 4DINB 4EWDA 5FXVA 5FZ8A 4JTOA 4Y1XA 3TNPB 1BEV1 4IEZA 5FAXA 5ACA2 4COWA 1VR3A 1NE6A 3CO2A 4Q0VA 3H9AA 5C70A 2L9LA 3KF3A 4COVA 2XOMA 2JDNA 2DCKA 4OULA 1OUXA 1W0OA 4M0NA 5A7NA 3ZFFB 4QMAA 4Q2FA 1STMA 1QNYA 3K4DA 1NCRB 1N3QA 5D2AA 1RXFA 4LA3A 4OUEA 3R4SA 2C24A 1GNHA 3WP6A 2DVGA 3SXWA 3G6JB 1MEC3 5FYIA 5A3LA 3ZXLA 2GAUA 2J1RA 5JPNB 3UNPA 1UAIA 1QJX3 2X5IA 3KV9A 3M7AA 5EZWA 4EZ4A 5FP8A 1IOAA 2XDVA 4QPIC 4QXKA 3D0SA 1ZZ6A 3O1RA 3ACIA 1PVC2 4QXHA 4CEYC 4OHXA 1O8PA 1WMFA 5JZGB 3AP7A 2HJIA 5GZEA 3AKPA 1CONA 1L7LA 1YQ2A 2WABA 4K1ZA 4AFBA 4BE3A 3OTFA 2E53A 4DXTA 4CCKA 4CU8A 2JDKA 1IS6A 4YZ3A 4P9YA 1MEC2 5LBEA 5L36A 1ASJ2 2Y26A 1XSQA 2MEV2 3PTRB 5FYYA 5GZFA 3MLKA 4PBPA 5JZGC 3ZYHA 1LOAA 2YG0A 4CP9B 1IPJA 5FYBA 5I0DA 4HMZA 1J3PA 2HWC2 2Q30A 3RJ2X 1VLNA 4KWUA 4EROA 2W1WA 2ZGSA 3N9QA 3P5BA 3V0AA 1V6NA 3O12A 4Q4X1 1CAXA 3TB0A 1Z78A 2VTXJ 4YRDA 5I93A 3ZXFA 1N3OA 2DF7A 2J1TA 4FSJA 3NNGA 2JE7A 5DG1A 4BQ4A 1YYNA 3POSA 2D98A 1QJU3 1W8HA 3W58A 1GP5A 1PMHX 4LJHA 4Q4Y1 1TNRA 2PA7A 4AAXA 3E6DA 1XRUA 5B2GB 1H2NA 4AEDB 2ZJCA 3H42B 3UV9A 4A3ZA 4OMCA 1U5ZA 2X5IB 2I2SA 3NV4A 4QPYA 3WQ7A 4JC1A 3KT4A 5AFEA 3WF0A 1CJDA 1U5XA 1HDKA 2Y6LA 4XQWA 2GP3A 5FMOL 4AVTA 4BXFA 4KG8A 4GWJA 3CU7A 5F3GA 1QQP1 1DF0A 1IG0A 2IFRA 3AJYA 1JYVA 2WN3A 1N1TA 2DUPA 2MHFA 2A6YA 2HEVF 4HANA 4BDVB 1AYN2 2O8OA 1RITA 3J26N 3NNLA 2FMDA 5DAWA 3ZIWA 1DBNA 2QNKA 1VMHA 1GZCA 1BEV2 2TNFA 2WS93 3I2OA 2YBPA 3ACFA 2WQ8A 4FBFA 1XC6A 3AYDA 4BYYA 4QHBA 4IE7A 5F32A 1U0AA 1X8EA 4XIOA 2VMCA 3WXPA 1TE1B 4JZRA 1SLTA 3MUY1 3ZPYA 1BLZA 4D94A 1YFUA 2EIEA 3MPPG 3GYDA 2KD7A 1ULOA 4D6RA 1REDA 5J1XA 3F95A 4AGRA 4CSWA 5C8CC 2VC9A 2VUDA 1I3HA 1UU4A 1JTZX 1CZTA 1T6BX 4XBQA 2O1QA 2JE9A 2NQYA 4NN0A 4LLOA 4FVVA 4A4AA 2A6VA 1I1EA 1Y9MA 1V9U3 1NOVA 2PLV3 2XHKA 4QWNA 1PZ7A 5LA1A 2VUJA 3H7YA 2WQ4A 3M2MA 3OD4A 5FP3A 5FY4A 1JOBA 5EFUA 2VZOA 1R082 4CRQA 3KHBA 4JQRA 4L92A 3E5UA 1DZTA 3D82A 4YGEA 5FV3A 3WF1A 1OQ1A 1DZRA 4FPCA 1YFWA 3IBMA 4ZXKA 2K9ZA 2PN5A 3PVBB 4C0BA 2A3WA 3CJXA 5ACA3 5JXHA 3ZN4A 3MIBA 4MADA 1QQP2 4Y24A 1W2OA 5T55A 3RZZA 1Y9QA 3K77A 2QQPA 4K8FA 2YB7A 1DYOA 1HQLA 2X10A 2HWE1 5CFDB 4JV4A 4XHBA 1ZBE1 4BQYA 5B4NA 5JPMB 2WO2A 4N43A 1EUUA 4FTSA 5K7PA 1FMD3 3TN93 5IK8A 2Q8OA 5FYTA 5CG8A 1J3QA 4AGGA 2VZTA 1KITA 5FZ9A 1VE0A 3LOIA 2VUAA 3EMRA 5FRAA 3ZFEB 1JU4A 1LNSA 1NLQA 5D8AC 5FZ0A 3VKOA 4ASMB 2JB8A 2CDOA 3H1MA 2R043 4TXWA 1QY4A 3VHNA 1IZ3A 3WV6A 4NROA 2BVBA 1DLLA 2YY1A 4YFWA 2HWC3 2VQAA 1Z7S2 1XNBA 3JQWA 4IGQA 4Q0SA 4D3WA 4EWAA 3H8XA 3RVHA 1AX2A 3AP5A 4OVEA 4BHPA 2RDQA 1EP0A 2OKXA 5CIRA 3I97A 2WO7A 4LIUA 4Y20A 3WF2A 4YG0A 1AL23 5FP9A 4HPKA 1VRH2 4EJRA 1WCKA 4A41A 2WFF3 3LD8A 2YYOA 2R0FA 4AYUA 5ABJA 2F4LA 2P37A 4E2GA 4P5YA 1WLTA 3ILNA 5IHRA 3JD71 5JI9A 4M3CF 1WCDJ 1WLCA 4Q4Y3 5K4LA 3DPRB 1UF2C 2PLV2 4DY5A 1MEC1 1Q8PA 3OGSA 2RMU1 1W6MA 1MQTA 1WKYA 2CTVA 3DXUA 1UCXA 4Z92B 2YGMA 3HQRA 2KXLA 5T52A 3VHRA 4R9DA 1O4ZA 1QIQA 2IXLA 4HK8A 4TSVA 2PHLA 3MFAA 5C8CB 3P1IA 1GNZA 3FZ3A 2VE1A 1COV2 3ABZA 1CX1A 3LF7A 3N3HA 2PXJA 3ZDSA 4BH9A 2WFF2 1QDCA 4RYDA 1HB4A 2R49A 2F4PA 1NQDA 2TUNA 4LHSA 1WW6A 1U12A 1BKZA 3WNMA 2QQJA 3ILRA 3AL6A 1FPN3 1RVF3 4ET7A 1XJAA 1O91A 2VVDA 1YI9A 4IERA 3BUCA 3CEWA 1BEV3 1NUKA 3ZM8A 3UK9A 3RZHA 2Y33A 1R1A1 2JD4A 2XB6C 4KBBA 3SITA 4JVAA 4I09A 3JUUA 2WYFA 2XJVA 5DDJ2 4NO4A 1XB9A 5F39A 4UW5A 3L2YA 4ARXA 1ND3B 4HLTA 4RQPB 4YFZA 3EHKA 2RVAA 5CG9A 4E4HA 3HT2A 2C6SA 2Y6KA 1MZFA 3K4AA 1GU3A 2JEMA 1OLQA 2BEOA 3B01A 3CJIA 4FQZA 5KXDA 2JDYA 1H2MA 2BNOA 2BBAA 5LA0A 4GQ7A 2XQXA 1TMF3 4BQ1A 1VRH3 1W8FA 2VQUA 1Z7S3 1JYTA 4X6RB 1WMEA 3O1VA 3MUZ1 4JKMA 2VMIA 4ZS3A 1W6NB 2PHWA 5FYHA 2Q8EA 3KHCA 3S5QA 1E5IA 4FI9A 4I02A 5FJKA 1GUIA 2O0OA 4OHZA 2DUQA 3I2KA 5CU1A 3A0KA 5IW0A 2IVIB 5FFOC 3MGUA 4AI0A 5AFBA 1PM7A 2QJVA 2IXJA 3CZUA 5E89A 5EJ1B 3LEIA 3MFCA 1OFSA 3AXEA 3LIGA 4R4ZA 1ZNPA 5A7WA 2W87A 1BMV1 2HWD3 4U36A 1NXMA 2GC0A 2NMNA 2GDFA 3E5XA 3AMNA 4JAAA 1H1IA 2VZUA 1YCIA 4ES9A 4WVMB 1W03A 3IDAA 4CEWB 3AMPA 3GCXA 5K8SA 1AF9A 5FLJA 1RUNA 1BMV2 3OBAA 3U37A 4P08A 3JBG2 5GALA 3S30A 2G9GA 5K0UA 2ZGMA 1V6IA 2QQMA 2VMHA 3H8RA 4QAWA 4F3JA 3D3AA 2FDKA 2GU9A 4GH4B 2R16A 4XF3A 4YG3A 5BNNA 1ND3C 4M4RA 4QQOA 4NMIA 4YWAA 4JDNA 5F3EA 4XCAA 1YO8A 4QKFA 3IM0A 4TLGA 1O4YA 5JIAA 3VHOA 4EN7B 1AXZA 3HN3A 1MS8A 4CP2A 4ARYA 2BWCA 5GJ6A 3K4ZA 3KVBA 1B09A 4A6OA 1F4AA 4X8PA 2Z42A 2FCTA 5C3RA 2HKXA 2HWD1 2VMFA 3WUCA 3T08A 3BU7A 1NCQB 3VN4A 5LEJA 3SQOA 3N7JA 1PK6A 4NWVA 1V6JA 3P3PA 1O8SA 4CE8A 4AQ6A 2PQSA 4LR4A 4PHZA 2VCCA 3WW1A 2QQUA 2ERFA 2XLFA 1OD5A 1EV11 1QHDA 2VH9A 1O4TA 4N90A 2GNDA 1AYM3 5FZOB 3LB9A 4QPWA 1DQ6A 4OFGA 2QCSB 3HMYA 4S2FA 5JZGA 1RUJ3 1BZWA 4CEWA 4YGCA 3AMMA 4CPBD 4QQPA 3CQOA 4MHUA 2HBTA 1KEXA 4LBQA 1QJY3 4IV3B 3WZ1A 3H1YA 2QE3A 2VNOA 1AJOA 4LKSA 4I2OA 1W6OA 3B93A 1UMHA 3RZLA 1AR72 2JG8A 5J3UA 3U10A 1Q43A 1VBA3 2IUWA 2VECA 2IC1A 1UPSA 1D7PM 3JD72 4FFGA 4XILA 5EV7A 1AYN3 1ND3A 2RR11 3NKGA 3VZLA 2VXRA 1VBD3 1UYPA 1YIPA 4PF5A 1M06G 2OA2A 3LOBA 4LA2A 3DYMA 3KV4A 3RI9A 1SPPB 3ZFEC 1OVPA 4B29A 1AR63 4M0HA 2JENA 3I59B 3POFA 4FPOB 4XMIA 5SV8A 1OKOA 1RUH2 1RUI3 4EE2A 1HXS2 3DCQA 3ASIA 1GR3A 3BTAA 1W2TA 3N9OA 5FO7B 2GALA 1REFA 4LUKA 4UXAA 3VGIA 2JWPA 2VM9A 3RS6A 1JYXA 1J59A 1UU6A 1HB3A 4PQQA 1SDDB 3SH5A 3RI8A 1Q56A 3IWZA 3U0ZA 1LOGA 3HN1A 3I54A 1MR5A 4YM3A 3FE5A 2MEV3 5FYUA 1VBD2 3DGTA 3OD0A 4GWIA 1VRH1 2DUOA 2AEYA 2ZGPA 3IDEA 4I0WB 5IFPA 3CKHA 2JKXA 2D40A 1DHKB 1PO23 2ZEXA 2IXHA 3B69A 4XZUG 1JODA 5FPXA 4CYDA 1FATA 2E26A 5FZ7A 4KWJA 4CCDA 2XJSA 3JBG1 4XF0A 2OPWA 2OQ7A 4OHWA 4DNYA 1YLLA 3BB6A 2BRTA 3MO4A 1LOFA 1POV0 1SFNA 2XJTA 4IV3A 1SFPA 4AI9A 3W5NA 3RWNA 5GZDA 4CTEA 3OGRA 1B35A 3OYWA 1RMU1 2J1VA 4IEOA 4NE9A 3I2IA 2NZ9A 1RUF1 3NNFA 5FCCA 5FPUA 5CFCB 4AEJA 2FDIA 4NR1A 2BP6A 3NAPC 2TBVA 3ZR5A 4L99A 3RZMA 4Y20B 3HNYM 4A6SA 3FUOA 3AP6A 1QJU2 4LOTA 4QPIB 1RMU3 3DYPA 1HN0A 5K0UB 1FXZA 1POV1 1IG3A 5F3IA 4Q8KA 1BK0A 5GZGA 2JXAA 4WM8C 2AH2A 3BI3A 1HJFA 4UW6A 2JDUA 3OPTA 3LCPA 4P9XA 2R072 4AQSA 4CDXC 2DTWA 2Q1MA 1DGRA 1OF3A 1QOOA 2PMWB 3A22A 3RJRA 3U75A 4DOUA 4IE0A 2B9UA 5FK7A 1XOYA 2W47A 3MHZA 2D43A 2ZCWA 3VD5A 2X5IC 2K2SA 4XBLA 3PHMA 1ZZ7A 2ZS6B
chains in the Genus database with same CATH topology
4QPGA 4FAHA 2QDNA 1CJPA 1QXPA 1LESA 3FLRA 3GHMA 4K3UA 5T3NA 1PK6C 1O3SA 1VALA 1AZDA 4KL1A 4Q29A 4N43B 3VBFB 1QGLA 1A6CA 3KLSA 2VOXA 4NHKA 3WVJA 5GLVA 2ZHMA 2GMMA 1RUF2 4CDUA 3E6BA 4OZXA 1SLLA 1IS4A 3PLQA 2R30A 1OMIA 1CAVA 3OY8A 3ZFFC 3MLJA 1OQDA 1QWRA 2PHXA 1K5MA 1HRI3 5LEKA 2E51A 3RG0A 1IGOA 5D1IA 1FPN2 1XU2A 2DFBA 4MSVA 4B4QA 5IUQA 5D8AA 4R8HA 2K0GA 1ENRA 2VQ0A 5J98B 5LRRA 5DUWA 2ZGTA 4ATFA 1ZRFA 1W6OB 2R071 4JGZA 4QT6A 4K1YA 1RUE1 3N7KA 2D6NA 2XJRA 1DYPA 3HIFA 4N7IA 4U2AA 5E1RA 4QD2A 4XIKA 4IEWA 3N4MA 3FLPA 3ENRA 4KNCA 5HCFA 5L7OA 3ZXGA 4AFDA 5I8TA 1RUJ2 4N7UA 5AC91 4RFT0 4PIYA 4Q4W1 3B94A 1D4M2 2VULA 4HKOA 2D6LX 2GNTA 5HXVA 2XKPA 1DGWX 1EV12 2DFCA 1PO22 2CWMA 4XFFA 3EBRA 4WM8A 5JOXA 5EXOA 2EALA 2NM1A 3NV2A 3AKRA 3ATGA 5DZFA 4SBVA 4C0HA 1RUD3 1WBFA 3J4UH 2ZAHA 3IKWA 4KGQA 3WW3A 1AR91 1BQPA 1LHVA 4LO7A 1AR71 5CAZA 4WBBA 1DFQA 1Y43B 3WV6A 4EN6B 3L9JT 3RYPA 4XJUA 2YMZA 1VBD1 1B35C 1XYPA 4Q8LA 1FNYA 3AKQA 1SBDA 1FT9A 1ZYBA 3PMSA 4ZU7A 5KWRA 3S0MA 1QF3A 4N9IA 2RJLA 4S2GA 3JCIA 3EO6A 2GH8A 1MQTC 2BGCA 5I0UA 3VZOA 3FWEA 2D6KA 2P17A 4FT8A 3KCYA 2AREA 5BY5A 5J96B 5KHIA 3DN7A 4F8AA 1WD4A 1LB2A 3QH7A 1MS9A 4TYSA 1KD7A 3VBRB 1CAXB 4A7ZA 5AVAA 1YHFA 1AYM1 3O14A 4ZU5A 1WLWA 1RVF2 1FYUA 2ZZJA 2XUMA 4LHLA 2ZHLA 3M3OA 5KXCA 1WCSA 2D5FA 1G9CA 5C9AC 3ZFEA 5CVRA 1IKPA 4HVQA 3EJKA 4I30A 2R041 2CYFA 3M3CA 2A5ZA 3O5SA 4P9WA 2ZAAA 4ITCA 5DZGA 2JG8C 2GSYA 5A32A 3MYXA 5D8AB 1JXNA 2AGSA 3N7MA 4P5HA 4LBJA 4LBQD 2HWF2 1RUI1 3I59A 3M1HA 3WHUA 3WDWA 3WR0A 4XZPA 3RYKA 3QLQA 1YNAA 3LKJA 3SH4A 1G8WA 2RJKA 2R1DA 4JGZB 4CZSA 1DGWA 5JI7A 4AWDA 5GKAC 1C1FA 3ILFA 3N36A 1JYIA 2ARXA 5GLZA 3ZXJA 1AUYA 4RQPC 5BXXA 3MIHA 4XOGA 1QJY1 2SBAA 5L7OC 5DUUA 1H30A 3IPVB 3ZXDA 1RHI2 1IS3A 1QJX1 4A3XA 4HN0A 4M3CB 3VKFC 4Q4V3 3ES4A 3DPRA 1Y3TA 1YXWA 4BMEA 3K51A 4AEDA 2QDRA 4CDUB 1PIV1 2RS53 3PNAA 2WC2A 1CAWA 2QUOA 3SNMA 2WNUB 4NWWA 4D7YA 3T1LA 3ZMNA 1AXKA 1OA4A 4KWLA 3AM2A 4X6QB 4N53A 1PO13 3MW3A 2WFF1 2WWSA 3DPRC 4P9GA 1D4M1 2ZMLA 3SLIA 1B35B 3OYWB 2TEPA 3D5OA 4GKXA 1CX4A 5FOBB 2ZGLA 3AB0A 4R4XA 2B7YA 2XH6A 5FREA 5I8YA 4J6GA 1OPOA 3WDVA 4UBGA 4ASLA 1AX1A 3CNAA 4LO8A 1W6PA 2ZABA 4YW2A 4E4ZA 1AJKA 4E2SA 1MS3A 3HT1A 1Q3EA 1FMD1 3TN91 3UKTA 4W6XA 3JQXA 2ILMA 4YVSA 1ULGA 2GH2A 5AVPA 5GLUA 1PGW1 3B5LB 3M70A 2A6ZA 4N9HA 1PGL1 4DRRA 3BOWA 5BNOA 5A33A 4HT1T 1ZX5A 4O9GA 4Q1PA 3VL8A 3WHTA 2CV6A 1RUG1 3KMHA 3KS7A 1DIWA 2RS13 1V00A 2HWD2 1H8TA 1S0DA 4JDOA 4NOTA 2XG3A 5IK4A 1QU0A 2C1FA 4WM8B 4YM0A 5C9AA 1W6QA 1SLIA 4FOYA 2ZHKA 4ZU4A 1W6QB 3RDIA 3TRSB 1RB8G 1GANA 4H7MA 1RUE3 3BIWE 4RR3B 3RRDA 4MV2A 4RR3A 2HWB1 2YV8A 4IEQA 3TWIA 3B9IA 1JOJA 3ZSJA 4ATEA 1PZ9A 1REEA 3PVEA 2ZTNA 3SHRA 5FDBA 2RM21 2JG9C 4XQDA 1LJ7A 1WGPA 3S7EA 1GYKA 1MS1A 3GBGA 3NO8A 3B00A 1LCLA 3NL1A 1RVF1 4HBNA 1V9U2 2D7FA 3SCGA 1M4WA 4FCAA 4JTNA 2LUWA 1RMU2 1FOD1 2HWF1 3LA7A 4L97A 1F31A 4GMP0 1O7FA 3MIGA 2NPIA 1EV13 2GZWA 3GHNA 4AI8A 3R4UA 4SLIA 2R073 1BVVA 1IPKA 1RINA 2YGLA 3QOPA 5FQ0B 4MXWB 4XJWA 2W0XA 3VKMA 1COV1 3MLLA 1F8VA 2WNVB 3OGGA 5C4WA 2RS32 2QVSB 1ENXA 4IL7A 4RS5C 4RGAA 1POV3 1G9AA 4AVVA 3UKVA 2UY9A 4K9SA 1LEMA 4XTPA 1IHMA 5CFCA 2DURA 4BIFA 4MLOA 4XFHA 3KCCA 1Q5OA 2B5HA 2HEYF 5KXEA 1O3RA 4YGBA 3AZZA 2VOWA 4XXAA 5HCAA 1TQ5A 1RUI2 4INDA 1OOPC 1RUH3 4XQ4A 5T54A 4AG4A 1C5HA 1XU1A 3SMHA 1WW7A 1PGW2 3ZN5A 2ZMKA 4RS5A 1URXA 1ZBE3 3IMNA 3O0VA 3VL9A 2DVDA 1NCQC 2X53S 5I0SA 1F2NA 4XJZA 4C1WA 1G9DA 4AVCA 1X82A 1RUG3 1EY2A 4WVZA 3UKNA 4FPKA 2IXIA 1QDOA 1UMZA 2CAVA 1ND2A 2D93A 2Y0OA 3IPVA 4Y4YA 2OIIA 5LK5A 5KHJA 1LOCA 4NVPA 2EAAA 4CP1A 1ZA4A 1R1A2 3CF6E 5BNPA 5FLHA 1U5IA 4ORFA 1HQNA 4DPNA 2GN7A 1NYWA 1C28A 1DGLA 1NCRC 1H8TB 4HKWA 2VW0A 1SMVA 2JDZA 2EF6A 1NA1A 2A6XA 4PDWB 1PNGA 5EYXA 5C6CA 4LTAA 3PVOA 4BMBA 4DS0A 1KFXL 2YHJA 4H14A 1RUC3 2AUYA 2Y0IA 1LOEA 4FOVA 3P3NA 4YM2A 4GXLA 3O7OA 4OI4A 4BM8A 4COYA 3WCRA 1WUVA 4DFSA 4QQHA 1S0CA 1FX5A 1IQAA 4I3GA 1TME3 5A3MA 2DU1A 5A33B 2HEWF 4GB31 3ZYGA 2EXIA 1C8M3 1F5FA 5CFCC 1LRHA 4Y22B 2QFEA 4TWTA 5FPZA 2DVAA 1ZZCA 3AP4A 1TEIA 2BTVC 2DYCA 2ZGUA 1AR61 4YZ1A 1EYBA 2V5YA 3POWA 1WA4A 4I01A 5JDBA 1QJU1 4FP3A 4MGKE 3AZWA 3VBHC 3ZVXA 3VBSC 3MICA 3WD5A 4Q4X3 1J1LA 1TNFA 2PHDA 5GM0A 2ZMNA 2R061 2BBVA 2EIGA 2IWGB 1WMDA 1QOTA 2XBO3 2OYZA 3V0BB 2DVFA 3M3QA 2HWB3 2D6MA 3V65A 2H0VA 2BNNA 1SDWA 1F9KA 4FPFA 1EPWA 4JGZC 1ZRDA 2R063 2Z69A 4I0BA 1SLBA 4ISRA 1PNFA 2WNUC 2DU0A 2JG9A 2VVEA 2D6OX 3MW2A 5J7MA 2LALA 4PLNA 5DDJ1 2XVGA 5L7OB 4WM7B 1CAUA 4V1PA 1NZCA 4LBKA 4AI3A 4XETA 2R6QA 3BOPA 3ZSEA 2XL9A 3ETQA 1QXRA 1HKDA 5DDJ3 4YW1A 3WDUA 4Q4Y2 4RSUA 1LODA 4WZCA 3SISA 4LT5A 4GWMA 3WG3A 4UW4A 2PAMA 4WM7C 3M4FA 3URFA 4JGYB 2RS31 3RMXA 2HWC1 3QACA 3OCPA 4NHMA 3VBOC 1A8MA 4KG0A 1H4GA 1R1ZA 1HRV2 3OY8B 2WFPA 1JH5A 4ISQA 1A78A 4RQPA 4E9KA 2PQQA 4CEYA 5FMOS 4MVTA 4A7YA 3U11A 1SCRA 2I45A 2XWJB 3KB5A 4FPYA 4YVSC 2QKDA 4H3WA 1R091 5BYNA 4XFBA 3B9CA 2OW4A 3ZFGC 3VDDC 4IETA 4BLIA 2JG8B 2V09A 3DKWA 4Q0QA 3KQRA 5CFDC 1LHNA 3DUIA 3VBUC 4RL7A 3AX4A 1LKNA 1ZZBA 1VBE3 1AL22 3NV1A 1VAVA 5CBLA 2BUKA 3FUQA 3THTA 1LTEA 3VZMA 1PGL2 5GLTA 1W6PB 3GNEA 4RHV3 1VBB1 4M01A 1JUHA 4YGDA 5ABJB 4FTBA 1VIWB 3MPBA 4W6WA 2GC2A 1I6XA 3S7IA 1PMIA 1AXYA 1EAH1 2E7AA 1LGNA 1W0PA 1MQTB 1FNZA 3IN9A 3RYRA 3QD6A 3HD8B 3VBRC 2VU9A 4GMP1 1AR83 3L2HA 2OVUA 2WT2A 1ZBA3 4YM1A 1RUC2 1GBGA 5FO8B 2FHRA 2FZ1A 1AVBA 1MVQA 4AEMA 1QH7A 3FX3A 3TYJA 1Z7S1 1RUH1 3FBYA 1DGRN 5LRSA 2VG9A 4QM9A 3ACLA 4MGYE 1Q8VA 4CDQB 4OI0A 2D3PA 2CGOA 2DCZA 2RM23 2ZACA 3ZFGA 1FV3A 1DQ4A 4Q1RA 1FAYA 2HWE3 3FFQA 3VBOB 4GWNA 4JRLA 3TBDA 4C91A 1YFXA 3AFGA 1ZRCA 4YW5A 5IK7A 2E7TA 1PVC1 1VBB3 2PFWA 4XHXA 5BNQA 3R4DB 2CL2A 1KS5A 3M3EA 4Z2WA 4ZKTB 1HXS3 1S1AA 2XVLA 1YJLA 3WX5A 2ZGRA 1QOSA 2BFUL 1W39A 1H9PA 3RMYA 4Z82A 2BYVE 2CGNA 4R9CA 4XYXA 4OHVA 1SLCA 1KS4A 2ES3A 2WS91 2W39A 1SLAA 1LGBA 1V6OA 1XNCA 5CA6A 4QGMA 4O9EA 2ZX3A 3ZXEA 3U07A 4BIOA 2XJUA 4AXOA 3VKNA 4YZ5A 1LGCA 2GNMA 2VW1A 2C0ZA 3WT3A 4A7KA 1D4VB 2JJ6A 5C33A 3MIFA 3GBFA 3ZFGB 3HQXA 2A73B 2CWSA 1GLHA 5JOWA 4AFCA 2ET1A 1S0FA 3K48A 4N53C 4KWKA 4XE9A 3B02A 1UW8A 1V70A 2ZGNA 2A7AA 4LLFA 1A3KA 2RS51 4LO6B 4LHNA 2ZBJA 3D8CA 1PVXA 3HBZA 3WY6A 3ZXAC 3VBSA 3WW4A 3ECQA 3A0NA 3RQ0A 5EYYA 1PK6B 2NLRA 2BW8A 4OLLA 4R52A 4FXGB 5I0TA 4PIXA 3VBFA 5DXDA 5JVVA 1C1LA 1VP6A 3ZYIB 1U5YA 1LHWA 3PTYA 2P3IA 4KQ7A 1ZRRA 1GQHA 3OBTA 2P34A 4AFAA 4XXPA 5BNNB 2H6BA 5TSWA 5FQ0A 1H8VA 1S55A 4J1XA 1XNKA 5EWSA 5E8AA 1S0EA 3MF9A 1C57A 2JKBA 3ZX7A 2F6BA 5J48A 4PLMA 1QJZA 1RUE2 4COZA 2ETEA 4PQ9A 1LR5A 1VBA2 4P9JA 3LAGA 4XJAA 4BLJA 3MIDA 2WNVC 1J1TA 2E6VA 1A8DA 2XLAA 2WSVA 5JSRA 2PHUA 1RHI1 2XBO2 4OUSA 1YUDA 4Q26A 4HZFA 1ZM1A 1O5LA 4QQ2A 5C4WC 1CQ9A 1HRI2 2A71A 1VB2A 3E5QA 2WZR2 4XF9A 4GKYA 1N1YA 4Y1ZA 4XJ8A 1BJQA 1WW5A 3VBSB 4UW3A 2BWAA 1ONAA 4M3CA 4FOQA 4AK3A 3E6CC 1OA3A 4EWEA 2LTNA 1NQJA 1BBT3 3AMQA 1SFYA 1VBC2 1GSLA 3BALA 4IEVA 1LOBA 4F7ZA 1PIV3 4FAGA 5I91A 3ZSKA 4RD7A 4EN8B 4H55A 3NKTA 4AVAA 5KHKA 1MZEA 1UN1A 3H0OA 4Z8BA 3PMEA 2UWBA 4AHXA 3VBUA 2UYBA 1HRV1 1TME2 2EAKA 4AEDC 1G9BA 1VAKA 3MZHA 1VJ2A 1AR92 4HK9A 4HVOA 2B8MA 5E16A 4Y1YA 1XQNA 2IXKA 3W9AA 4OHYA 2NMOA 1DQ0A 5JCTA 5I8SA 4XF1A 4QPGC 1LHOA 1BXHA 4CDWC 1OKQA 1D0HA 2GN3A 4HSLA 3RNSA 2JX9A 2WS92 2PTMA 1RUJ1 1R093 2C5DA 3TAYA 1GZ9A 4META 3POYA 1N3PA 2BQPA 4MZUA 3KT1A 4Y5Z0 4HL0A 4PLOA 3KSCA 1JYCA 4EN9B 3B3QE 1SBEA 3W59A 4F83A 4BZ4A 1DDLA 1L3JA 4CEWC 2E63A 2WL1A 4AW7A 4ES9A 4Q0UA 1C3HA 1XYOA 1QXJA 2R062 2X8KA 3BPZA 4XBNA 5CNAA 3ELNA 2BPA2 2WINB 2RMU2 2HWB2 4QGNA 2FQPA 1O3QA 1ASJ1 3D6EA 5L19A 4JRAA 4QU2A 2Q1ZB 4P9LA 3MI8A 4XDQA 4QPIA 5KC5A 4X8NA 1RJ8A 4YVWC 4H7LA 2VNRA 1F5JA 1QKQA 1UZYA 1YFYA 4FXKB 3LA3A 1GFF2 4K7JA 2WNEA 4MYEA 1LULA 4BOWA 1S2BA 2YDEA 1S0JA 3AZVA 1S0BA 5F1RA 4RR3C 3VBHA 1O3TA 2WA4A 4Y22A 2AZ5A 1K5MC 3LA2A 5L73A 1NLRA 1NCRA 1YIFA 1CIWA 5EJ3A 3WCSA 5I0RA 2YC0A 2GC3A 2AR6A 3RSJA 2MEV1 5JMCA 2IZWA 3MW4A 2DCYA 3GZTB 3USSA 1RC6A 4LNVA 4XF4A 3OF1A 2WT1A 4WVVA 3NV3A 4LUMA 3PJQA 3WUDA 1MZ6A 2W68A 3WDTA 3KZ4C 4Y26A 3ZYRA 1AYM2 3JBG3 1HW5A 2A3YA 2KA3A 1SBFA 1DQ5A 1O5UA 4G4FA 2OZJA 2DV9A 2XBO1 1OOPA 3T1MA 4FOWA 2RR13 4AHYA 4CP0A 3DF0A 1RUC1 2HYKA 4HN1A 1XE8A 4NHLA 3VHPA 2EVXA 5CB7A 1AHSA 3NVCA 1YRZA 3I8TA 4GALA 4UBHA 4IV1C 3AP9A 1SACA 4LEJA 4AI2A 2KM2A 3HR9A 4Q4V2 3VBOA 3O0XA 3G7DA 5FLIA 3AZYA 3ZSMA 3I2DA 3V0BA 2D5HA 1AR82 2ZHNA 1D2SA 1NA1C 4K40A 3FJSA 4HSJA 4RA0A 2O8QA 4XEZA 3JZVA 1ULDA 2G9FA 3NSTA 4PCRA 4LO5B 2UY8A 4YVSB 4GB33 1FV2A 4J1WA 4DXZA 5BNOB 1PO21 4WV8A 4WM7A 1KDMA 1OHFA 3R05A 1NE4A 1JHNA 4KU8A 3H3ZA 1LEDA 3S6PA 4YW4A 4FPJA 1YJKA 2FBEA 2SLIA 1EPZA 4XW3A 3VZJA 4ES8A 4OUMA 2VPVA 1NY72 3KGZA 1NCQA 2YZ4A 4W65A 2GNBA 1BVP1 2EXKA 2HWE2 3KD4A 3WDXA 3H8UA 4AQTA 1N1SA 2WLQA 4NPRA 3WINE 4WVWA 1CD3G 1D2QA 4HETA 3AYEA 1IS5A 1N1VA 3KCXA 3LWCA 2E7QA 1I9RA 4HFSA 2Z79A 4MXWA 4C90A 2I07B 2WSUA 4IV1A 4YVWA 2UURA 4D69A 2RHPA 2R32A 3AYAA 4FO9A 4L8QA 4JGYC 2ZGKA 1H2KA 1MZ5A 1APNA 2ZX0A 1NLSA 3J8F2 1G6NA 5GLWA 1COV3 3X29B 2B39A 1T6GC 4PIZA 1GZWB 1ENQA 1QMJA 4LE4A 5FBZA 5FTTC 1GQGA 4AHZA 2RE9A 2RS11 1MS4A 3ME2A 4DQAA 4GB32 1TMF1 2BVVA 5T5JA 2YROA 5LK7B 1CESA 1D0GA 2ZZQA 4R9AA 5K9YA 1J3RA 1OOPB 2AENA 2D3RA 3M3IA 1H0BA 2PAEA 5T5LA 1WW4A 5H9PA 1OA2A 4LE3A 3M8LA 3EQEA 4FQ4A 1CR7A 4Z07A 2ZOEB 1K5MB 2WA3A 2E9QA 4IV1B 3ZMOA 2XPJA 1PGSA 3USUA 2ZKNA 2QZ3A 3ZN6B 3R6SA 5BNPB 3VBHB 1ZZ8A 2B42B 3FLTA 1KFUL 3NAPB 1OFNA 2GMEA 3WQ1A 2R042 2GMPA 1R092 4LBLA 3ALQA 4EN0A 1ZREA 3IIAA 4AE2A 1MVEA 2HWF3 2R1BA 1HRV3 5SV5A 3ZO0B 1ENSA 1DQ2A 3WP5A 1NY71 4IQPA 4AEKA 3H7JA 3KM5A 4LULA 3CLPA 2UYAA 1ND2C 1NXD1 1MS0A 1X50A 4LHKA 3WP4A 1AL21 4AF9A 1X7NA 2NN8A 4GA9A 1LHUA 2ZKLA 1H4HA 3VDDA 2UU8A 2WNVA 2CGPA 4I3PA 4N43C 4IEUA 1QH6A 1C4RA 4R9BA 5DUVA 2RMU3 4BWOA 2ZA9A 1LU1A 3H50A 5AC92 4BA6A 1BBT2 2WZR3 1C5IA 1RUOA 1RHI3 2EA7A 1C8NA 4WVMA 2PAKA 5C4WB 4EV0A 5JR7B 1UD1A 1H1AA 3AYCA 5T50A 2FZ2A 5KC6A 4AGVA 1H2LA 1FPN1 2ZX2A 3VBFC 4Z1VA 3A4UA 4TZDA 4Y1UA 5ACA1 5H9SA 1ULFA 4E27A 4LO4B 1G86A 1AR93 4IEXA 1XYNA 2Z2SB 3C2UA 1QJY2 1UKRA 4QX5A 1QQP3 1WBLA 3FMGA 4AVSA 2RS12 4TLFA 3CJIB 2ZX1A 5H9QA 1AR73 1ZBA1 2LM3A 3D0JA 3WW2A 1N47A 3JU9A 1YWKA 5HI0A 2Q0AA 2CNAA 5J36A 3GF6A 3KGLA 1V6LA 2D97A 1LOFC 1KDKA 5BUVA 1GZWA 2XJQA 3MIEA 3JD73 1XE7A 3BCWA 3UL2A 4LBQB 2JECA 4QQLA 3GZUC 1RUG2 1CAVB 2H6CA 1FOD3 2WJSA 2DCJA 3B7MA 1AR62 4MGZE 5A32B 1D4M3 5JIUA 4Q0PA 1C8M2 1RL3A 3MEPA 1VAMA 2XLGA 2A3XA 5F6LB 3MF6A 4CDXA 3ZYPA 5FO9B 4FPGA 4PBOA 1SCSA 5F9TA 3VZKA 4MX3A 1CPNA 2XGXA 3OJBA 4XPVA 4I0AA 1H8TC 1FI2A 2WLPA 4IEPA 4JDMA 2JG9B 1WLDA 2ZX4A 3MDPA 3FHIB 5JOYA 1CAUB 1ULCA 4QPGB 3N7LA 1EAH3 4IESA 1Q8OA 5KXBA 3LGRA 1PVC3 3LZZA 4K20A 4M00A 2XVKA 4W6YA 2JICA 2VNGA 4B3NA 4RHV2 1DQ1A 1Q8QA 1G7YA 4RS5B 3GALA 3VUOA 1Z0HA 1RUD1 1HXS1 2VOKA 3HAGA 4WZFA 1I5ZA 2WZR1 4D7SA 1ASJ3 1HLCA 2PHTA 2YPJA 3PJYA 3VDDB 1RJ7A 2VW2A 4XFGA 1S0GA 4MH0E 3SH3A 3FFZA 2D3SA 2PHRA 1CAWB 3DV8A 4CDWA 2QZ2A 1V6MA 5AC93 1UX6A 1DZQA 3QCWA 4GIQA 1OQEA 2PLV1 2XL7A 1DYKA 3WNXA 3INAA 4YNIA 4N53B 1Y7BA 1OSGA 2B46X 2OPKA 1RTVA 3AMHA 4LBOA 3EXUA 4XFIA 4AQ2A 4GH4A 1LU2A 3JB4C 3VKLA 3WQ0A 2RM22 4COUA 4QM8A 4B4PA 2WQZC 3WLUA 5K0UC 2RS33 2YUEA 1MACA 1UIJA 1GKBA 1DG6A 3J8F3 4Q4W2 5BNPC 1IKQA 1VBA1 4IXLA 4DY3A 4AI1A 3NWKA 4GMP3 3ZFFA 4GH4C 4ONUA 3THPA 4FPHA 4G3YC 5BNOC 2Y38A 3APBA 2RS52 4JCKA 3LSDA 2OUJA 1OLRA 1CN1A 4KGGA 1PZ8A 4M3CE 3AJZA 5DUXA 5E88A 5JLVA 1VBB2 1QJX2 3OPZA 4RGGA 4Q4W3 2XWBB 3GBWA 2VMGA 1ND2B 1C8M1 1GICA 1BK1A 1KQRA 3IDBB 1OPMA 4P14A 2DWRA 1JN2P 1SEFA 1YI7A 1ALYA 2WT0A 1HQWA 4MXVA 5JSOA 4K21A 2XKOA 1XNDA 3VV1A 4FP2A 3AZXA 4XJ9A 5C8CA 5BV6A 1AL0G 1LECA 1MS5A 2AYHA 4FPLA 2YXSA 4DMIA 1XXNA 4K6BA 2NP0A 2EXJA 2Q4SA 4CDQC 4HVRA 4S2HA 1H9WA 3BODA 3QH6A 4YG6A 1JW6A 2NYYA 2Q5TA 1KRIA 4HPKB 2B45X 1AR81 5J09A 4MUVA 1JUIA 4CDUC 1ZBA2 4A2UA 1BYHA 2WZPP 2H0BA 1GV9A 1RUD2 4IEYA 3SCHA 1G9FA 4DRVA 1PO12 2EXHA 3WP3A 3NJZA 1FMD2 3AKSA 3TN92 3IT8A 1SQ4A 2OUHA 2WIIB 1CGPA 5KHGA 3AKTA 5JOZA 4YYOA 5GZCA 2ENRA 1V9U1 3ZYJB 3V64A 2VVFA 4C1XA 1KJLA 1X8MA 2WNUA 3UJQA 2WKKA 1QNWA 2MNGA 1S0IA 3AXDA 5ABJC 2BNMA 3HWJA 2A70A 1H1MA 2ARBA 4KH9A 3USUB 3WDYA 1JBCA 4S2DA 4RHV1 2RR12 2W08A 5FOJB 2VY0A 4FPEA 2CY6A 2UWAA 5T5PA 3N35A 4DB5A 1VBE1 3R0RA 2PHFA 3DL3A 2PELA 1NA1B 4PDWA 5DG2A 4E4SA 2R0HA 4XMAA 5IK5A 3AFKA 1FOD2 4P9IA 4E4DX 2P3JA 1AX0A 2CAUA 2XJPA 1VBE2 2P2KA 4OI2A 3NAPA 3QBQA 4KU7A 4L2NA 1UZZA 3ES1A 3WG1A 4B7EA 1W6NA 4E2QA 4PJYA 5KBFA 3C3VA 4G9SB 3WG2A 3WG4A 1ULEA 4Q4X2 5T5OA 1UKGA 5HBAA 1NG0A 4JGYA 4OI1A 3ZIXA 5F6KA 3VZNA 3IDCB 2DCTA 1ZVFA 2ZGQA 2G4IA 5IT6A 3NW4A 3JB8A 4YARA 1R083 3OBRA 1UL9A 4YW3A 3VBUB 5C9AB 5JWPA 1UPIA 3Q9OA 2MPFA 4GULA 3SCFA 4Q4V1 4AVBA 4LBMA 5KHHA 4BPZA 1ZZ9A 3D4KA 2V73A 3TOJA 2DTYA 1ZBE2 1J58A 3ZXKA 2IXCA 3H1WA 4DZGA 5BPXA 1TMF2 4CDWB 2GC1A 3I4IA 3J9SA 1CPMA 1HIXA 3ROUA 4YLZA 1X36A 3GZAA 4LBNA 3V56A 4B7KA 3PVNA 1AYN1 3KT7A 3ST7A 1HRI1 3VBRA 2UWCA 2I74A 4YVWB 4XTMA 4B8EA 1E57A 1RGSA 4FTEA 3T2TA 3LSEA 4AHWA 2W52A 3WOGA 2Z5WA 3FBMA 4CDQA 5C8WA 4B4RA 2P3KA 1RUF3 3V0AB 4D7TA 4L9BA 3VLBB 1W6MB 1EAH2 4YZ4A 3H3UA 4Y1VA 1CVNA 1KJRA 1R1A3 2FMYA 3U4XA 1HV0A 2PYTA 4L11A 2VOVA 3UJOA 1OI6A 1KXGA 2OZ6A 1PO11 4YSFA 5DZEA 5HCBA 3OGJA 1UIKA 1S2KA 1TME1 5CFDA 3ZSLA 5J37A 4Q27A 2A6WA 5CADA 3CL1A 4HKLA 2N7GA 2IFWA 4MGIE 1DU3D 1R081 1V6KA 1HX6A 2A75A 2C9AA 1WD3A 3I7DA 1W2UA 4BCUA 2ZGOA 1LENA 3E97A 4YZ2A 4XFCA 2D44A 2ZPXA 1VB4A 1Q8SA 4CDXB 4AFMA 1RIRA 2ET7A 5JAXA 1X33A 1VBC1 2ATFA 2VGDA 2DVBA 1BBT1 3AK0A 3RPQA 1UU5A 1PIV2 5JSPA 3J8F1 1PHMA 5H9RA 1BCXA 3TNQA 2D6PA 3CJIC 4CEYB 4XFAA 4QGLA 5BNNC 1HV1A 3FC0A 3ZN6A 4IV3C 1VBC3 2X29A 4PDWC 2BFUS 3O0WA 4URTA 4DINB 4EWDA 4JTOA 4Y1XA 3TNPB 1BEV1 4IEZA 5FAXA 5ACA2