4AFBA

Crystal structure of subtype-switched epithelial adhesin 1 to 3 a domain (epa1to3a) from candida glabrata in complex with glycerol
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
227
structure length
227
Chain Sequence
SKDPTTFPLGCSPDITTPKKGLSMELYSYDFRKKGSYPCWDAAYLDPNYPRTGYKSHRLLAKVDGVTGNINFYYHATKGCTPQLGHLPASYNYPKPLTMTNFTMLLYGYFRPKVTGFHTFTISADDLLFVNFGAGNAFDCCRRDSSADHFGNYQAYAIWGSKTAKDELTVHLDAGVYYPIRLFYNNIGKDGALSFTFKTESNENTVSDFSEYFFSLDDTEEGCPGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPA1P
publication title Structural Basis for Promiscuity and Specificity During Candida Glabrata Invasion of Host Epithelia.
pubmed doi rcsb
source organism Candida glabrata
molecule tags Cell adhesion
total genus 55
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10528 GLEYA GLEYA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4afbA00
4LHKA 4AHZA 4AI1A 4COVA 5A3LA 4LHNA 4COUA 4AI0A 4COYA 4AFBA 4A3XA 4CP2A 4AI2A 2XJRA 2XJQA 5A3MA 4D3WA 2XJVA 4COWA 4AFCA 4AI3A 4AHYA 4AFAA 2XJUA 4CP1A 4CP0A 2XJTA 4AHXA 4GQ7A 4AF9A 4ASLA 4COZA 4AHWA 2XJSA 4LHLA 2XJPA
chains in the Genus database with same CATH superfamily
1IS6A 4AE2A 2NMNA 4ZPIA 1KFUL 5E8AA 1W6PA 5HV0A 2R16A 1W9SA 1M4WA 2VTXJ 2VUAA 3VV1A 4EQVA 4OVEA 3AL5A 4JRAA 1JYXA 1IKPA 4IQPA 1R1A3 3SKJE 3VKLA 2ATFA 4HXCA 5FYHA 4XF0A 1WW7A 5CISA 3SCHA 4LUKA 2ZEXA 4QHZA 4JZRA 3BCWA 3AFGA 2DTYA 1HXS2 1NCRB 4MHRA 4YG3A 2PELA 3WNXA 3ZKUA 5JOXA 2WUHA 4ASLA 3DYMA 5FZ9A 3JXSA 3HBZA 4FCAA 1JMUB 3WQ1A 1ULEA 4LO4B 4F7ZA 4YZ2A 2NZ9A 2LW8A 1WZXA 4AVBA 2D98A 4WM7B 5D21A 1D0GA 3MEPA 2VGDA 5FZLA 2RJLA 3RDIA 1KQRA 1W6OA 4R9CA 2P17A 1K42A 4DRRA 3LDBA 5CZKA 5I8TA 1KJRA 4JTOA 4XFIA 4LBQD 5AC92 1WW5A 3KT7A 2NN8A 3M3OA 2MEV1 4Q26A 5FMDA 1X33A 2LROA 4HSLA 2RMU2 4CCDA 4KBBA 4I0WB 1AR93 3KVAA 3V65A 4DFSA 4YM0A 3O1RA 2BPA2 2BGPA 4FTBA 4GD4A 4LOSA 3KQRA 4HL0A 2JDYA 3IDCB 1AL0G 3Q9OA 2J1RA 3U75A 3KV5A 2V4VA 5HCAA 4XFAA 3FBMA 4X8NA 2XUMA 2VZUA 3RFRA 5IVBA 1ZZ8A 4BA6A 1AR91 2R1DA 5A32A 1IZ3A 2PQQA 4AI1A 1XB9A 3UGGA 3URFA 4C8DA 2JECA 1RUD3 3DV8A 1SBFA 3C7OA 4IUGA 1XYOA 4MGTA 1HRV3 4YZ4A 1TEIA 1AYN2 2V09A 3WG3A 1D2SA 2VNRA 1W8HA 2WABA 3HQXA 1AYM2 1V6KA 4W50A 4C1XA 4XTMA 5DZEA 4AHYA 3KF5A 3MFCA 2WBKA 1KFXL 4I3GA 1RUD1 1WCQA 1CJDA 3N9MA 4AZZA 5FYTA 1HRV1 2HBTA 3GZTB 5IAXA 3DYPA 4OFGA 5BY5A 1LKNA 3D3AA 3A4UA 3NJZA 4K7JA 5JDBA 4FOYA 1C8NA 2B5HA 1NA1C 2H6BA 4CCNA 5JSRA 2I45A 4FFGA 3NV3A 5F8PA 3AYEA 1XE7A 3FMGA 2AACA 5H9QA 4Q4Y2 2GP3A 4UBHA 1G8WA 2HWE2 5LA1A 4ZU4A 4URAA 2J1UA 4A7ZA 1RL3A 3AMHA 3MI8A 1BHGA 5A33A 1FOD2 3TB0A 1UMZA 2H0VA 3WP5A 4CCJA 4IGQA 1FV3A 1MQTC 4ZXEA 5B4NA 1G9AA 4QQLA 4CEYA 3HVDA 4K21A 4PLOA 1F31A 3CZUA 2BBVA 3RGBA 3TRSB 1GQPA 1G7YA 2CAVA 2ZGRA 1SLBA 1HRI3 3S5QA 1HB3A 3N9NA 1H2NA 1OVPA 3I2DA 1B35A 5F32A 2FDKA 1E5IA 5FP9A 3WUDA 3RZJA 1HX6A 4QX7A 4COUA 1AR72 3GBWA 4JDOA 1K3IA 3SISA 1HRI1 4IEPA 1QJY2 3JB8A 2AR6A 1V6JA 3BUCA 5T5PA 2ZGTA 1KITA 2GN3A 1SLCA 2WIIB 4XIOA 2RV9A 4P9IA 5F2SA 1DZQA 1NCRA 1OBNA 1VRBA 2DURA 1V70A 3I49A 5GZFA 2Z42A 2JJ6A 3WDVA 2JDNA 1J1TA 3BB6A 2HWD1 3JBG2 2Y38A 3KQ4B 2JG9B 4AI9A 2DBNA 3WNLA 3ATGA 1U5XA 4Q4W2 4EZ4A 5GKAC 5A1AA 5F1RA 4Y5Z0 1JZ8A 1RJ7A 3HMYA 2C24A 2W52A 1JZ6A 2VOKA 2XR4A 4HN0A 5EV7A 4BIOA 1UYPA 2TNFA 3B94A 4N7IA 5IVVA 1ZZ7A 4D8MA 2QQMA 4QX8A 3SKVA 3RQ0A 1V6IA 1VAVA 1F15A 5FYUA 3D0JA 1NKGA 2P6CA 1JS9A 3F95A 1Q8OA 4NO4A 1IG3A 4Q4X3 2WWJA 5FXVA 3IDEA 2EIEA 3EO6A 5CNAA 3IIAA 1N47A 4JV4A 4MGZE 3FHAA 4AVVA 4GKXA 4QM9A 4QKDA 1RYYA 4Q8LA 2QDNA 4WZCA 2UWBA 5LK7B 1STMA 2XJTA 2WL1A 1HV0A 3ZFFC 4QDQA 1T2XA 3MGUA 1UYXA 4Q4X1 2HWC2 2GC0A 3VBSC 2W39A 4Q5OA 4Y26A 3PJYA 1E57A 4DQAA 1GZWB 4QPIB 2C4XA 1DYKA 1R093 3NSTA 2OXBA 4CDXB 4Y1VA 2V4AA 2EIGA 2VJXA 3EHKA 3BI3A 1PO11 4G9SB 2UYAA 4AFBA 5H9RA 5EJ1B 2D44A 4CDQC 4QHOA 3V0BB 5J96B 1O3SA 4IE0A 1R091 3UT0A 3K3NA 3VBOC 1AR82 4CZSA 2E51A 4LBLA 4AXOA 4JKMA 4CP0A 1GMMA 4TTGA 4LOTA 4KU7A 2ZOEB 2ZHKA 3PU8A 1C57A 1CAXB 1JZ5A 2VMEA 3I8TA 3EYPA 1BK0A 3I7DA 2XJPA 1NYWA 2MPFA 5FUIA 1WCKA 1Y9QA 3HNMA 3AMMA 2YGLA 2YBSA 1EV12 3D0SA 3WDWA 4MSVA 4DXRA 1SZBA 1H6YA 4NWVA 2WT0A 1COV2 1OLMA 4IV3B 4QKBA 5I0TA 1C8M2 4CEWC 4MGIE 3L9JT 1UY1A 2ID4A 3R6SA 5LZ6A 4OZXA 3ZPOA 5EZWA 1SCSA 3OBRA 3VKNA 1OA4A 2WC2A 3FHQA 1HV1A 1MS9A 1KD7A 3K51A 2WNUB 1CONA 1H2KA 2VQUA 1JYTA 4KI5M 1ZRRA 3M8LA 4QX0A 1BMV1 1DLCA 1FYUA 4I01A 1S2BA 1GNHA 4Z82A 3ZFGB 1ZNPA 4XAEA 3VKMA 2YC0A 5BNNC 2ETEA 1SFYA 3ZYHA 2KM2A 3VL9A 4UWDA 5I0UA 4A7KA 3N9PA 4NJ4A 4NHLA 1ZBA1 3I2IA 2E63A 4JGZC 5FYYA 2D6NA 3WF4A 3KZ4C 4JGYC 2MHFA 2E6VA 3VDAA 3NMBA 3SEEA 2WR9A 3B9CA 2DTWA 2VCAA 5ISLA 4DUWA 3UK9A 2X10A 5FUNA 3W9AA 1C5HA 2CDPA 2W87A 2FHRA 2DUOA 3OSDA 4YZ1A 1K45A 5L7OC 1WLDA 2EA7A 1IQDC 1CAVB 1DGWX 3WG2A 3B93A 4D6SA 2JG9A 2P3JA 2QQIA 2RJ2A 3RZHA 4HT1T 3FFQA 1W8WA 3OF1A 4LTAA 1OKQA 5KXDA 3A7QA 3SITA 2HEYF 3WF1A 4QB1A 1US2A 4EYUA 3VLBB 4LO6B 1YIFA 5DPNA 2BV4A 2WNVB 1UZZA 4Y24A 4QB2A 2MEV2 1CX4A 1SFPA 5CKNA 1YQ8A 4CVUA 5I0SA 1LOFA 2VW2A 3C7FA 3LEIA 1C5IA 4JDNA 2GH8A 4NRPA 1XPWA 2DVBA 3LF7A 5E6HA 3T2OA 1S0DA 2Q4SA 4OLLA 3WQ7A 5FOJB 3J26N 1UY4A 3EMRA 3ZIXA 3WQBA 1LOEA 2ZHMA 5HCHA 3FE5A 3KF3A 1NLSA 1AXKA 1J1LA 4P9JA 3SHRA 3BGAA 2ZABA 4AQ6A 4B4QA 2CV6A 1NCRC 1AR92 4D7TA 1C4RA 1GZWA 4QPIA 1PIV3 1UYYA 2Q0AA 1GV9A 3MW4A 3VZNA 3WG4A 4QXHA 4CDXA 2NM1A 2Y34A 1EUUA 1N3QA 4O7XA 3J7HA 3O1PA 3QOPA 5FLHA 4YM1A 4WM7C 2I2SA 4Q0UA 3V0BA 3ES1A 4AWDA 2J1AA 4RS5C 2VUDA 3QH6A 4LXLA 1PIV1 4XVHA 2RS33 1RUD2 1SLAA 2Q8CA 4XDQA 4XJAA 3T0AA 4BXFA 1HRV2 3S5AA 2D6KA 5LASA 5F3GA 4IESA 1GICA 1LHWA 2XBO1 4HBNA 1CAXA 3AKQA 4GQ7A 1ODNA 4XW3A 1NG0A 1UOJA 3AP7A 1LHOA 2RS31 2YDEA 2VQTA 4ZKTB 5FZEA 4GMP1 1NCQB 2DCYA 4MXWB 1UIKA 2ZS6B 3AXDA 4H7MA 2W47A 1XU2A 3CJIB 3RZGA 4IV3A 4OHZA 4AEDB 3ZOIA 5F2WA 4EROA 4E27A 3ZR6A 5C8WA 3KS7A 4HKWA 3BVCA 3MW2A 2WNUA 4KWKA 4XCAA 4NHXA 5J98B 4AGRA 3WP3A 2TUNA 3W5NA 4FO9A 4LO8A 4P02B 3NJVA 4LPLA 1VLNA 1UO9A 2GAUA 3ZFGA 3NNLA 2GC1A 1OURA 4OHXA 1VRH3 2GC2A 3AYCA 5FMOS 5JSOA 3OBAA 1SMVA 2X05A 3NRUA 3A0KA 4QX3A 5HCBA 5GZCA 4D0QA 3WY6A 4ZZ5A 4LBJA 1HRI2 3TEYA 4XETA 1CN1A 4L92A 3OGVA 3LFMA 1OFNA 1VRH1 3L2HA 4NUBA 3E5QA 1U5YA 3B7MA 4UXAA 1IKQA 4ZXKA 2R061 2IFRA 2A3XA 5A3WA 3K4DA 2XVLA 2RR13 4YGCA 2DWRA 3F2ZA 4CSWA 3A22A 3C3VA 1WMEA 1OI6A 4HVRA 1NZCA 2ZGMA 4LIVA 5CVRA 1LOBA 4ITCA 1CAVA 1XYPA 2HWD2 1RC6A 3K48A 5T5JA 2E7TA 5LCWL 4N43B 1NAEA 3VBRC 4S2GA 3NW4A 2WSUA 4RR3C 3AJZA 2VUJA 1JHNA 2PQSA 2RR11 2ZCWA 5FV3A 1S0EA 3HJRA 4Z8BA 1JZ7A 1VMHA 1YEWA 4M4RA 2FD8A 4A6SA 4AHZA 1LRHA 5EPAA 3TEXA 3GXUA 1W28A 3POEA 5DG2A 3OGRA 2ZHNA 2WNVA 2RS13 3DXTA 5KHGA 1X8MA 4ZHNA 5FZOB 2VBBA 1NX9A 3KWVA 3AYAA 4XTPA 3IMMA 4CU8A 5FY9A 4ARXA 3OGJA 1IS4A 3DF0A 3NNJA 1VE0A 3OB8A 4W8JA 3MPBA 1W39A 3POGA 5FYSA 3NV1A 2DCZA 4BYYA 3GHNA 1J83A 2ARAA 2RS11 4R9DA 1BZWA 4QXCA 1LJ7A 4LITA 1ZRCA 2QZ3A 4Q4X2 3VBFB 4A45A 4CDWC 4XABA 3IWZA 2VL4A 3MHZA 4ONUA 4QGMA 3UKVA 2XLFA 3PIJA 4RYDA 3IDBB 1POV0 1MZFA 2NMOA 3IAPA 1PO12 1UU6A 3Q8AA 4QHBA 1MS8A 4OHYA 1DFQA 2DFBA 2HJIA 1QY4A 1US3A 2WAAA 2CL2A 4DIQA 5I93A 4CP2A 3FX3A 5HPOA 4BIFA 1WCUA 3K75B 1R092 1ASJ3 4G3YC 5IFTA 5F6KA 1RXGA 2IZWA 3N7LA 4PF5A 2FCUA 3VDBA 1LOFC 1H2MA 4XEZA 5LEKA 4UFIA 4S2FA 1PGL1 3ZXGA 3J9SA 2D3SA 4E2SA 5ABJB 1WKYA 5KR7A 1NCQA 4FXKB 5FBZA 4MXWA 3AZWA 1UXZA 1HLCA 4CRQA 1W8FA 3V56A 3CJIA 2D43A 5C70A 3VDCA 3ZMOA 4FPFA 4XCBA 4AEDA 4QPIC 5FKBA 1XE8A 1LOCA 1XSQA 4IEQA 3VBHC 5J1XA 4XMIA 4V2WA 2XONA 1MQTB 3RI8A 1JI6A 3ZSLA 3ZX7A 1RB8G 1UOGA 4XF4A 5DG1A 5A3PA 3N4MA 1BMV2 2IWGB 4Z2AA 4URTA 1LEMA 5CADA 1I5PA 1RINA 1SDDB 2AZ5A 3WG1A 3ZXAC 4CXYA 3HR9A 3UETA 1XRUA 3PMEA 4I3PA 2IUWA 4IE6A 2BU9A 2HWE3 1J3RA 5JPMB 2ARBA 5I0DA 1ZBA2 4TYSA 2CSGA 4XF3A 5LK5A 1H4HA 3ZFEC 1N3PA 1W9YA 4AGVA 4BQYA 4P9GA 4ASMB 5FYBA 1O4TA 1UU4A 1GUIA 1H6XA 1HJGA 2WSVA 3E6DA 4GIQA 5A6QA 2PAEA 3AL6A 4MZUA 5EP9A 4AGGA 1SHWB 1E5SA 2WWSA 2VO5A 1AJOA 1C1FA 1KXGA 1MS3A 1QIQA 1UY2A 2K9ZA 2LM3A 2ZTNA 3A21A 4I02A 4BXSV 5AFEA 5A3OA 3O14A 4ET7A 5JSPA 1C28A 4DS0A 1TE1B 2XHNA 2BOJA 3AP5A 3ECQA 4DY5A 2HEWF 2LUWA 4N43A 1X9PA 5JUVA 3OOXA 2WKKA 2Y0IA 1RUH1 3POIA 3RZKA 4XUQA 2C6SA 2QQOA 3ZYIB 1YQCA 4R8HA 3MYXA 3B5LB 4HKOA 2ZMLA 4YW1A 4Z1VA 1DP0A 1GBGA 2BNOA 1VBA3 2ZGPA 3APBA 2D6MA 5FYIA 2ARCA 4SBVA 1JYNA 2W1UA 5FZOA 3PVNA 3WP4A 4QQ2A 2JB4A 4HPKB 3WNPA 1SQ4A 1W05A 2ADDA 1XNKA 2YZ4A 1VBA1 4LHSA 2YMZA 3PDQA 3SH5A 3VZOA 3WSOA 2AH2A 1UY3A 3JBG3 3LQCA 4MHUA 3VZKA 4WZFA 3WW3A 4Y5TA 1A34A 4LEJA 4QPGC 3ZFFB 5ANNA 3VBFA 4Q4V3 1XU1A 3VBSB 1CD3G 2ZPXA 3LIGA 3INAA 4UFMA 3DKWA 2VZVA 2GMMA 3LFIA 2A70A 2IXLA 3IN9A 3K2OA 5FYCA 5LRRA 5I91A 5BYNA 5FY1A 3BU0A 2JX9A 1YQ6A 2C9AA 4YRDA 1I9RA 3PUQA 3GGLA 5CG9A 4LHNA 1WUVA 4CDQB 2H0BA 1V00A 3LDRA 5KWRA 2WJSA 2JENA 1B09A 1X50A 4Q0PA 3RRDA 1PIV2 3OD0A 5IWFA 4F8AA 3OBTA 4IEOA 4QPWA 3VBOB 1WMXA 3T2PA 3VKFC 1GNZA 4NOTA 4XXAA 5F5IA 5FRAA 5FZAA 1DF0A 2MNGA 2XBO2 1LOAA 4CP1A 1OQDA 4EWAA 3WCRA 1Z7S3 2VM9A 1IPKA 4MGQA 4XBNA 5ABJA 2RS32 2Y8KA 5IVJA 5DABA 2J1SA 2YYOA 4OI4A 4WVMB 3LB9A 3HD8B 4F83A 3VHOA 4GWNA 3K46A 1UMHA 5F9TA 3WW1A 1VBB3 3LE0A 2JG8C 4CEWB 1Z7S1 3UKNA 3KB5A 5JI9A 1MS1A 2CWMA 2Y26A 3D82A 2B9UA 4PIYA 2A73B 4Z07A 1MQTA 4B8EA 4YSFA 1C1LA 3E5UA 4XFGA 3J7MA 4E4SA 5E1RA 2XJVA 4F3JA 1H1MA 2BGCA 3IB3A 2HH9A 4M4PA 1QGLA 5DUUA 3TNQA 1VBB1 4FPYA 4MH0E 4ZY9A 2OW4A 3ZKYA 4CCEA 2A1XA 2J7MA 1TMF3 5BNNB 2ZZJA 1UNBA 5GLZA 1QEXA 2I07B 4JGZB 5FZ8A 5LA2A 4BQWA 2VAUA 2E7AA 2WRAA 2RG4A 4JGYB 1W9TA 3I3DA 5FLJA 4XQ4A 3ON7A 3WNKA 4B1LA 1VRH2 1TMF1 4LORA 4P9WA 4IEVA 2VVEA 4KG0A 3CBNA 2R062 1MS0A 2G4IA 1F5FA 5C3OA 3O12A 1QKQA 1SG3A 3KT4A 2YROA 3BOPA 3NJYA 5FCCA 3RMXA 3AZZA 1Q8VA 3KV4A 4FPHA 1H8TC 1OUXA 3ORJA 4GB33 5L7OB 3ZXFA 2XB6C 3AXEA 3S57A 1WW4A 3L2YA 4NHMA 2E31A 3PTYA 1VMFA 1VP6A 4W6YA 2F4PA 2GH2A 4FOVA 3ZN6B 4DRVA 1UMIA 2RR12 2PHTA 4RFRB 2H6CA 1GOHA 4XILA 3LPFA 1ULOA 4GB31 1KS5A 4PT6A 5FIXA 3H8UA 5HI0A 4BM8A 4HPKA 3MLJA 2VMDA 1GZCA 2Y6FA 4D7SA 1CAWB 1VAKA 2JD4A 1N3OA 3H9AA 1FNYA 2CGPA 1QXPA 1UZWA 3NAPC 5FPVA 4XFHA 1PM4A 1AZDA 1EYBA 1DYPA 3RZLA 2OUHA 2P5BA 3DL3A 4LULA 5IVCA 3RZMA 1QHDA 1AJKA 2RS12 1GZ9A 3AJYA 5FXZA 4JX0A 3ZFFA 5FZFA 3S7IA 3VBSA 2P3YA 4YPJA 2VZQA 3ZLIA 1F35A 1LGCA 3PMSA 1H8VA 3AP6A 4YGEA 3U1XA 1W04A 1D0HA 5FK8A 4GWJA 1S1AA 2D3PA 3D5OA 1AXYA 3GF6A 2MEV3 2WQ4A 1SEFA 4N43C 1NZIA 4CDQA 3OYWB 5D2AA 3TEZA 4KGGA 5T54A 4CU9A 4RS5B 5HBAA 1O91A 1NQJA 2ZZQA 5IT6A 5JVVA 4DUVA 1EAH3 1QH6A 3VBOA 2NPIA 2G9ZA 4W65A 4E2QA 1UOBA 1I6XA 1LTEA 2Y60A 1JUHA 2YC4A 3POYA 1YNAA 4LKFA 4QXBA 2W1SA 5T5OA 1HJFA 5L19A 3AM2A 4AVAA 4NROA 3U4XA 2XWJB 1PGL2 2YV8A 1EAH1 1CZSA 5A7WB 3ZYPA 1LAJA 3E6BA 4AF9A 3MIFA 3WDUA 1ASJ2 1HB1A 2WT1A 3HEIA 4OYUA 3MW3A 2W94A 4PDWC 4RN5A 2Q8OA 4J1WA 1WLCA 3VBFC 3VKOA 2OS2A 2B46X 2R7EB 3ZSMA 2FBEA 1Z0HA 3I3QA 2WNEA 4CEWA 2EALA 2BJSA 4CCKA 2YBKA 1AR63 1VMJA 2DVDA 4HKLA 1IHMA 2RDSA 4GULA 4CUGA 5AVPA 3N9QA 1ZM1A 3OGSA 5I8SA 1UIJA 1QWRA 3KGLA 3RZZA 3T30A 4CYDA 3QACA 3T09A 2J42A 4BPZA 5FLIA 3ILFA 3AZYA 1ZA7A 1AR61 1VALA 4W4ZA 3UESA 2A6XA 5BNNA 3KHCA 1HQWA 3THTA 2BWAA 3R05A 1BBT3 2PHLA 3U14A 2FDIA 3FN9A 2R49A 1S2EA 4JGZA 3H8RA 3I2HA 5FR3A 5KBFA 1DQ0A 2LS6A 4JGYA 2WZEA 1DU3D 1JOPA 4IGPA 4M00A 5LATA 1FXZA 3ROUA 3WT3A 5ABJC 3M2MA 4IDZA 1POQA 3JZVA 3SH3A 5C3RA 4JHTA 2IVJA 3RMYA 3GBFA 4EE2A 2LRPA 5GZGA 1BBT1 4AVCA 5FWJA 4PBPA 5BXXA 3BTYA 4I0BA 2Y6GA 4UW3A 5L7OA 3CF6E 1RUJ1 3E6CC 2ZX2A 3LSEA 3FLTA 5A70A 1ZZ6A 2WS93 3PIGA 4BQ2A 3VBRB 1RUH2 3ZN6A 1LENA 1OPOA 4RR3B 5FP7A 2QZ2A 4NR1A 3ZN4A 4CCOA 4KG8A 1FMD1 4C90A 5FZIA 2R073 4W6WA 4LE4A 1W06A 2VQAA 4DOUA 4AAPA 4ZS2A 5FPXA 1BVVA 2A75A 4UW5A 3JCIA 1QDOA 2HKXA 2WS91 5FZ3A 1DZTA 3BKZA 3GZUC 1CAWA 4PLMA 1G9DA 4I2OA 2DVAA 4DB5A 4QMAA 2XGXA 2V5DA 3H3UA 4B4PA 2R071 3GBGA 4NPRA 5LY2A 3Q8FA 1VBA2 2X8KA 5FREA 1ND3B 1QJX1 4K9SA 2RM21 1L7LA 2HWD3 3SCFA 2Y6LA 2VUCA 2A6ZA 2F4LA 3I59B 1JU3A 2LTNA 1S55A 5ACA3 4AQ2A 4AOCA 4CDWB 1K5MC 4M3CF 4QDRA 2QQVA 4WV8A 5FMCA 3TBDA 3LEGA 3VBUC 2VNOA 5FPUA 3P3NA 5T52A 1RXFA 4MADA 3PURA 4HZFA 1V9U3 3D6EA 3PL0A 1H1AA 4LKEA 2RHPA 2YU1A 2PHRA 3J7NA 3OYWA 4WM7A 2QQWA 3UNPA 2WZR3 3BU7A 3B00A 4Q4V2 5A1LA 5ACA1 4RS5A 1IOAA 4H2AA 2DVGA 2ZX1A 5EXOA 3VB9A 1I3HA 2EXHA 4QB6A 2C5DA 2PHWA 3HNYM 1V9U1 1W8NA 1OVSA 3FZ3A 5IK4A 2WZR1 5JI7A 2W91A 1W9FA 2YHJA 2VZ3A 3WNNA 1D7PM 5A7WA 2X5IB 5FKCA 1YO8A 3A23A 1PO13 4BQ5A 3VD9A 4KWJA 5E88A 4M0HA 4RSUA 1CX1A 5K7PA 4GA9A 4D94A 4LMFA 4CE8A 1Z7S2 1AHSA 1LHNA 2JIGA 3IPVB 4PIZA 3VBHB 4YW6A 3ABZA 3AK0A 4Y33A 1BQPA 1NQDA 2BNNA 3LCPA 1KDMA 5JCTA 3N36A 1VBB2 1UQXA 2JICA 5FP4A 1SCRA 2JDAA 1APNA 3K4ZA 3IAQA 4Q29A 1PX3A 4FTEA 2VTFA 4KL1A 3P5BA 5HXMA 1RUE3 4AHXA 3O1OA 1SDWA 2CHHA 1LCLA 4OMDA 4RFT0 3ZFEB 3ACLA 1YXWA 3GZAA 2XLGA 3FBYA 1YC61 1HQNA 5IK5A 1O4ZA 5F7UA 1LECA 1TMF2 1A8DA 1AUYA 3T0BA 3CKHA 4XUNA 1T6GC 3W58A 4LBQB 3I3MA 1CESA 1HW5A 1RUE1 2V73A 4RGAA 3WZ1A 1IQAA 1UZ0A 1ULGA 3T4VA 2PHDA 5JAXA 1OMIA 2W1QA 1IS3A 1H9WA 4K1ZA 4Y1ZA 5C5TA 1ZZCA 3SH4A 4LLFA 2ZGQA 2B8MA 1MS4A 2QQNA 2IC1A 3VBRA 1ZBA3 4RR3A 3OJBA 2TEPA 2YUEA 3G7DA 2OX0A 2GDFA 5I8YA 1NE4A 5IAVA 4COZA 1JZ3A 4NIDA 3AP9A 3HWJA 2IFWA 3HT1A 4GB32 3S7EA 1J58A 4J6GA 4NIIA 4GWIA 3RWNA 5GLWA 5FXXA 2B42B 3M1HA 3OG2A 4PHZA 2W92A 2UYBA 2DUPA 4I30A 3JQWA 4FPJA 5FK7A 5JOWA 3S0MA 5KC6A 2ORXA 4QKFA 1ND3A 2DYCA 4FOQA 2XJRA 5FZ0A 4JVAA 1NE6A 2VU9A 5E16A 1UW8A 1KEXA 3CJXA 1SFNA 1YFYA 3I97A 3I59A 1WBLA 4QPGB 5F5QA 5A7QA 2G9FA 3ZXKA 5EFUA 2VY0A 4CDWA 1CZVA 3ACFA 3CDZB 4A7YA 4D7YA 4XDOA 4AVSA 4IV1B 2VTXA 3ST7A 2ZX4A 5SV8A 2YXSA 4JTNA 4MOAA 5FZ6A 5JXGA 1UL9A 2ET1A 5FZKA 2C0ZA 1SLLA 3BIWE 2J1VA 4DMIA 1H4GA 4Q1PA 4L99A 2IXHA 1TQ5A 4BLJA 1W6NB 4X6QB 3I2FA 3KCCA 3CLPA 3ZN5A 5LBBA 5K0UC 2NP0A 4YW5A 4ES8A 2VW1A 4M3CB 1PK6C 1YWKA 3KMHA 1EAH2 3H0OA 4YVSC 1CPMA 4FPOB 4NRMA 1OC1A 1RIRA 2R30A 2WT2A 3X29B 5L9RA 3Q8BA 3J8F3 1QH7A 2ZGSA 2VE1A 4FQ4A 4UAPA 4OI1A 3WVJA 4V2VA 1YYNA 2XPJA 2A7AA 2JG8B 5FZDA 1UXXX 3IPVA 4C0BA 3K3OA 4NIAA 3VBHA 1NUKA 5A3NA 1H30A 3KCYA 5GZDA 2OT7A 1WA6X 4RA0A 3WV6A 1GP5A 5EIYB 2ZACA 1N1YA 3J8F1 4B7KA 2CGOA 2XBO3 1PZ9A 5GZEA 2CDOA 1OH3A 5A3TA 3AKSA 4NN0A 4ARYA 1AR62 4MUVA 4AFAA 4GMP3 4OQ8A 1O3QA 1YHFA 5D1IA 2VZSA 2ZGNA 4DO0A 1BJQA 4EN7B 1UZYA 1PVC3 2XKOA 4MLOA 1W6QB 1KDKA 2EVXA 1QMJA 2WAOA 4KGQA 3ZFEA 3BALA 2GNTA 3NNFA 4CUAA 1F8VA 3AYDA 2BVVA 4HVOA 2Q30A 1GFF2 5GM0A 2RVAA 4LBQA 3ACGA 1BBT2 1OQEA 4MXVA 4CU6A 4LBKA 1PVC1 4LR4A 4QU1A 3M3QA 2AYHA 1V6MA 2WN2A 3S30A 5C7GA 1ULCA 2A5ZA 2ZX3A 1H8TB 3RI9A 1LNSA 2PN5A 3VUOA 4NIHA 3JU9A 1VPHA 2GNDA 5FY7A 4BQ1A 5FDBA 4FQZA 4YNIA 4CPBD 5J3UA 1OLME 2BBAA 3PUHA 1FMD2 5EYXA 4RGGA 1MZ6A 3PHMA 3CHXA 4P00B 5EYYA 1VAMA 1KRIA 2X29A 3PVOA 2WS92 5DAPA 1DQ4A 2R063 2ZJCA 3DCQA 1OA2A 2ORZA 4ATEA 5LY1A 4ES9A 3NAPB 2R072 1Y3TA 3LWCA 4I0AA 1QJX2 3RPQA 4OUEA 2RM22 4FSJA 1UCXA 2YC2A 1K5JA 2W08A 3OUJA 3POWA 4QPGA 2YG0A 5FO7B 4R9BA 1KJLA 3ZIWA 5G04L 1BKZA 2IXJA 3POBA 2D40A 2GALA 1VJ2A 1BCXA 4IW3A 3GZEA 2YB7A 4IV1A 4XXPA 4YVWB 3ZMNA 5FOBB 1YJLA 1WD3A 1WA4A 1OPMA 4YM3A 1FT9A 1YJKA 4PIXA 4QKNA 4NIGA 4BK5A 5F37A 1PGW1 5ACA2 3RJRA 1QU0A 1CR7A 3WW4A 1OLQA 1LOGA 1W8ZA 3AFKA 3PJQA 4AVTA 5JXHA 3T3YA 4A44A 3SNMA 2P34A 2D5FA 4EN9B 1W6NA 1V9U2 1T6BX 3RJ2X 1GWKA 1GR3A 5FZGA 2FZ1A 2WZR2 3DPRC 5FTTC 4Z2WA 4M3CA 3CL1A 3AVSA 1O8PA 3EJKA 4H7LA 1ND3C 3CEWA 1OH4A 1UAIA 1ZBE1 2ZKNA 3V64A 4K8RB 3N3HA 4LNVA 4KNCA 4FXGB 1ACCA 4META 4PDWB 2OZ6A 3WX5A 1H1IA 1OUSA 3J4UH 1QJU3 3WEZA 3O1MA 2AEZA 2JG8A 3GCWA 3NV4A 2R043 1NLQA 2JWPA 3VZLA 1V6NA 4E8CA 3KT1A 4ZZ8A 5DZGA 2W0XA 2FCTA 5CBLA 3KLSA 3T08A 4XF9A 1MZ5A 2D7FA 1JU4A 1QJU1 1ZZ9A 3E5XA 4L2NA 5EWSA 2JDMA 2R041 3DGTA 4FBFA 3MIHA 2FZ2A 2O8OA 3ZYBA 4BQXA 2CY6A 3RSJA 1OD3A 5FQ0B 2PXJA 1Q8QA 1WW6A 1W6QA 5HCFA 4NPMA 3VN4A 3AZXA 4B4RA 5KHIA 3KM5A 4FPGA 3RNSA 3O1SA 3IDAA 3VZMA 2DU0A 1VBC3 1W0NA 2X5IC 3PVBB 5A6ZA 5A6YA 5M0TA 3TYJA 5JMCA 4LHKA 1RUE2 4KWLA 3MLKA 1OOPC 1VB2A 1JW6A 5JXJA 1L7QA 1RVF3 4GAZA 1TZOA 4BU2A 2BOIA 1OA3A 1XNCA 3ES4A 3BPZA 5B2GB 4Q27A 1H8TA 1N1TA 1RUC3 1W2AX 2UU8A 2VBDA 1VBC1 2CNAA 3PTRB 3SQOA 2XJQA 2VR4A 1DQ2A 1GSLA 3M3EA 4R4XA 3TEWA 4JDMA 5AVAA 5JIAA 5A7NA 1A6CA 1UPIA 1JTZX 2RDNA 5A1FA 2RMU1 2ET7A 5C71A 1RVF1 2A3YA 5J37A 4XYXA 4CXXA 3DYOA 5F3CA 1S4CA 1QOOA 1RUC1 2ERFA 5BPXA 5KHHA 1YUDA 3U11A 4EN6B 5J7MA 4AAXA 4YG6A 5DAQA 2DDUA 2WYFA 1OHFA 5C3SA 3WW2A 4N9IA 3PLQA 4AL9A 1KS4A 2B39A 5CU1A 5CFDC 3NAPA 2N7GA 2DCKA 3NQHA 4MO3M 1OF4A 2E33A 1HKDA 3ZYFA 2JB8A 1AYN1 2JE8A 3GJAA 4QPYA 2IVIB 4E2GA 1XQNA 2P6HA 1RUH3 3ILRA 4D3WA 5JZGC 2WZPP 4DZGA 1ZX5A 4IERA 1K5MB 3E97A 5CFCB 3MO4A 5A6XA 1W8UA 3QBQA 2UWCA 4YVWA 4XZUG 1C3HA 3VBUB 2EAAA 4RHV3 2QQUA 4Q0VA 1QJEA 5IFPA 3H7YA 3EXUA 1ND2C 1U12A 2AGSA 5JWPA 1D2QA 1W3VA 5LBCA 4KQ7A 4PQQA 1IPJA 1O4YA 2VNVA 2CTVA 2DCTA 3MF6A 5DAXA 1SBEA 3H7JA 1WBFA 1MEC3 3D8CA 4UW6A 4X8PA 3QCWA 4RHV1 2IXCA 3LOIA 3VD5A 1CIYA 2HBUA 1NY71 1NOVA 2GMPA 1NLRA 4AI2A 2UURA 1WLTA 2QQJA 3T1LA 2WLQA 4XPVA 2YU2A 3P3PA 4LT5A 2FMDA 1MEC1 2GNMA 5C3PA 2OPWA 4NAMA 3KGZA 1LHUA 4PDWA 3CMGA 4LK6A 4TLGA 5L73A 1L3JA 2XDVA 1QJFA 1JOBA 2ENRA 2PHFA 1DQ1A 3R4DB 4IV1C 4LA3A 3AMPA 4BK4A 4XHBA 4P5HA 2C26A 2DUQA 5JR2A 4QDSA 1W9WA 3RYKA 1ONAA 3J8F2 3WHTA 1DDLA 3KCXA 5T5LA 4Q2FA 2ARXA 3N7JA 3WHUA 4XFBA 5F5AA 1QOSA 2GNBA 4BOWA 1DGLA 3MPPG 4Y5SA 1VBE1 1ENXA 5FP8A 4CUBA 2VMIA 2Y6HA 3MLLA 3W59A 3J7LA 2YFUA 1F2NA 5FQ0A 1MR5A 3AVRA 1H9PA 3AKTA 2UY8A 1ZRIA 4L97A 5C6CA 5J48A 1RUOA 4N8MA 4INDA 4Y4YA 4UBGA 4EZHA 3THPA 1FPN3 2BFUL 1W0PA 4A41A 1PMIA 4XJ9A 2CAUA 2XXZA 2DBIA 5BNPB 1RUF3 4BB3A 5K9YA 2JIJA 1PMJX 5E89A 2W5FA 2PAMA 2GU9A 1PVC2 2WFF3 3FJSA 3ELNA 2VCBA 3FFZA 2OYZA 3GALA 2B45X 1FPN1 2OUJA 3ZSJA 3OY8B 1XE0A 1JXNA 5C9AB 4FI9A 1RUF1 1E5RA 4E4DX 4A4AA 1AX0A 3DUIA 1O5UA 1W0OA 2XQXA 4OULA 4BLIA 1DG6A 2WFF1 2ZEZA 3VHNA 3QLQA 1DIWA 4K8FA 3LA7A 1LGBA 3N9LA 2VVFA 3OBZA 3USUB 4NE9A 2W3JA 2GZWA 1ZRDA 4XJUA 3B02A 2Q5TA 2Z4FA 4JKLA 4XBQA 3AKRA 3UKTA 4WVWA 4CCLA 4MGKE 1WLWA 1Y9MA 5FPAA 4AEMA 5FPLA 3OTFA 4UYBA 2IXKA 2Q8DA 1OD5A 5A3LA 5C4WC 4IE5A 2BDRA 3ILNA 1W2UA 4LBNA 1PVXA 4YW3A 2HYXA 3C7GA 3EB7A 4QU2A 2JDHA 1BK1A 3M70A 2DCJA 4ZS3A 5ERLA 2ZEYA 1ZVFA 4D6RA 1K5MA 5CFCA 4JCKA 3PUSA 4LA2A 5KHJA 5F5CA 4PI2A 3VBUA 2P2KA 2E32A 1HN1A 4NHKA 3JD73 4XE9A 1HQLA 3I2GA 1FI2A 3OUIA 1K12A 5HXVA 3AC0A 4MGYE 1LODA 1LGNA 1J84A 1P8JA 5D8AC 4J1XA 1MACA 5LRSA 3NJXA 2VZRA 1W03A 5DN2A 5BNOC 1GKBA 5JOZA 1RUI3 2ES3A 1YFUA 3H1YA 4DXSA 3JD71 2QVSB 2EF6A 4FVVA 5J36A 4FP3A 1CIWA 3O1UA 1Y43B 5K0UB 3HIFA 4LK7A 1ALYA 4HK9A 3LA3A 2NLRA 4YYOA 2Q1MA 1UYZA 1ZZBA 1PK6B 2RE9A 4YVSB 4XURA 1YI7A 3T2QA 4K20A 1RUI1 1F9KA 2R6QA 4E9KA 3QH7A 4ISQA 4E4ZA 4EJRA 3MUY1 4AW7A 1GNYA 3PU3A 2O1QA 4KWUA 4YVWC 3N7KA 5G05L 2BW8A 4O65A 2QNKA 3G6JB 4OZOA 2HEVF 4A2UA 1YQ5A 2JDPA 2ZX0A 3WLUA 1U0AA 3M3CA 1QJU2 1CAUB 1DQ6A 3WD5A 5EJ3A 5L36A 1O8SA 2R042 1I1EA 1JZ4A 2EAKA 3HPNA 4H3WA 2XL9A 5LA0A 4IEXA 3RWKX 4BWOA 1OF3A 2B7YA 1AXZA 3WDXA 1LEDA 3WDYA 3K77A 3SCGA 1LESA 5FAXA 3ZYGA 3DKQA 4DUXA 2HWF3 2W9XA 1R1A1 2A6YA 5FY8A 4YGBA 2QQPA 4Q1RA 2WN3A 2VCCA 5BNPA 2VOVA 4HFSA 4HG6B 1URXA 4FPEA 2G1MA 2PHXA 4WVMA 2QDRA 2NQYA 4XFFA 4TLFA 1IGOA 2DFCA 1R1ZA 3OPZA 4GH4C 3HBKA 4O9EA 1XNDA 2WQZC 2B9VA 3CZJA 4NRQA 5FZ1A 2HWF1 1SLIA 2Q8EA 1VBC2 2PA7A 3NNMA 3TNPB 1V6OA 3OY8A 1H0BA 1AF9A 3RYPA 2W46A 3SLIA 4AK3A 5FY5A 5C9AA 4IETA 1G9BA 2DF7A 3POFA 3DEMA 3WINE 1PZ8A 4BJ0A 1QQP3 3BYWA 2WNOA 2WO7A 3ETQA 4AFCA 1PHMA 1NXMA 1RVF2 3AX4A 3ETPA 2ZHLA 5FYVA 1PGSA 4JQRA 1AL23 5EHDA 3USUA 1RUC2 2G9GA 2JE7A 4L9BA 4R52A 1G9FA 3AB0A 4IEZA 2VMCA 4B7EA 4LKSA 4Q0SA 4IEUA 3WP6A 4AI8A 4EWEA 5AFBA 2YGMA 4AHWA 3B9IA 1A78A 1QQP1 5LB6A 5FY0A 4YZ5A 2VC9A 1VB4A 1MPXA 2YPJA 3W20A 2BTVC 3U78A 1AL21 1RUJ3 2BEOA 2WINB 4UFKA 4GKYA 2ZMKA 3AP4A 3I3EA 4QGLA 2C1FA 2J1TA 4GXLA 1OLRA 5IK8A 5GLTA 4TSVA 1GOGA 1SLTA 2KA3A 2QJVA 3V0AB 2BERA 1FMD3 2FMYA 3ASIA 4JHZA 5C8CB 3R4UA 1JYWA 2VNGA 4HETA 3VDDC 4Y1UA 5CKMA 1GU3A 3UYJA 4OI2A 2FDFA 5FZHA 3KVBA 4DINB 3TN93 4H14A 1JYCA 2Y6KA 2XMLA 4OHWA 3BODA 2WA4A 3TWIA 3BTZA 4AEJA 2SLIA 3MZHA 3HAGA 1QNWA 1UOFA 3OUHA 1YFXA 1QJX3 2XHKA 2RM23 1J3PA 1VBD3 4FFIA 4K6BA 4RHV2 2B4KA 2XVGA 4ZONA 1NY72 1DGWA 4I09A 3TN91 1LULA 5K0UA 3DXUA 4L11A 1TG7A 2WFPA 3DPRB 1PK6A 3VD4A 4YVSA 3VL8A 1MEC2 1VBD1 4FFHA 1PNFA 2BRTA 2ZGOA 3MIGA 4CU7A 2D3RA 1Q5OA 1YCIA 2XH6A 4Y1XA 5CB7A 5K8SA 2RS53 1WMFA 4QT6A 4CDUC 4Y3OA 5CFCC 1JYIA 1H2LA 1O7FA 3H50A 5DAVA 4TN7A 1OFSA 1XXNA 4LHLA 1Q3EA 5I0RA 3VD7A 1ENQA 2VZTA 1V0AA 4HLTA 1WWYA 2A3WA 4WM8C 4FTSA 1CAUA 1WCDJ 2RS51 1YLLA 4QQPA 3WNMA 4RQPC 1VBE2 1Y7BA 2QQLA 4TWTA 2E26A 3KV9A 3U07A 4DEVA 2WYSA 2ZGUA 2OIIA 4MX3A 1PX4A 4FFFA 4YW2A 1FX5A 5GLUA 4N53C 4RD7A 3VHRA 4N9HA 2YY1A 3ACHA 5A3UA 1UKGA 4LLOA 3WXPA 1F4AA 4FP2A 2OVUA 1QOTA 2FQPA 3S6PA 2AREA 2NYYA 5KXEA 3RG0A 1REFA 4EN8B 4QX2A 3O0XA 4HONA 3RS6A 2OA2A 1O5LA 3LSDA 4JC1A 2ZGLA 1N1SA 2HWB3 1L7RA 1OOPB 2R0HA 3LZZA 5LBFA 3UJOA 5JXIA 5FPBA 3R4SA 5A80A 4Z92B 5KXBA 1FPN2 1W8OA 3VGIA 2W2IA 4QX5A 1RUF2 4AFDA 2VZ1A 2V72A 2W95A 3I4IA 4V1PA 2HWB1 2IXIA 4PQ9A 3FC0A 5LA9A 5KHKA 4TZDA 2WFF2 3U4SA 1LB2A 3OEAA 1W2OA 4LQRA 2VXJA 3ZPYA 2ILMA 2KR2A 2XJUA 3AKPA 1IS5A 5FZBA 1UD1A 2AENA 4L8QA 3MIDA 2WQ8A 4OQ9A 4FPKA 5DXDA 4XC9A 4LBOA 2GN7A 2J1EA 5H9PA 1GZTA 2YPDA 1E5HA 4UW4A 5CFDB 3I2OA 3VHPA 3NO8A 4G4FA 5DDJ3 1QJZA 2VULA 3LPGA 3WF2A 3H1MA 1QNYA 4A3ZA 5BNPC 4JRLA 3NKGA 1BEV3 2E9QA 1LU2A 2Y0OA 1CJPA 4M0NA 4YLZA 5JZGB 4W6XA 1AVBA 3V0AA 1FAYA 1SACA 5BUVA 4YFWA 5APAA 5F3EA 5A3MA 4U2AA 4XMAA 5C8CA 1CWPA 1ZRFA 2ZGKA 5DDJ1 3JUUA 3ZO0B 2XUEA 2YFZA 5L9BA 5C9AC 1ND2B 1BEV1 4PCRA 2WWUA 3U37A 4ZU7A 3T2TA 1GANA 1A3KA 3DECA 1XBFA 1GQHA 1WCSA 2Q1FA 1X7NA 4NPLA 5JIUA 2C9KA 1BLZA 4XUTA 1U5ZA 1QXJA 2VH9A 3P6BA 1S0FA 4S2HA 2W1WA 5FZ4A 5FXWA 4Q0QA 5H9SA 2VMGA 3C7HA 3H1WA 2AEYA 4IL7A 4EN0A 3JD72 1W3XA 1CGPA 4CA9A 1J59A 2ZAAA 2WZ8A 3N35A 3DPRA 5JOYA 4Y20B 4R9AA 2VECA 3AMQA 2WDBA 3NV2A 3W21A 2JDUA 2GC3A 3CNAA 1GLHA 2ZAHA 3T4HB 2VCMA 3UV9A 1RUI2 3NKTA 2P37A 2K2SA 1D4VB 4BH9A 4GJYA 2UY9A 3BTXA 1ZYBA 4D6QA 1ENRA 1W6MB 3IIIA 3I54A 2ZBJA 3RYRA 2D6PA 2R1BA 3C7EA 4XAAA 4DXTA 2QQKA 5LEJA 3B69A 3UGHA 4HANA 3PUIA 3NVCA 1RHI3 4JAAA 2WO3A 3OD4A 3KV6A 4FPLA 3FL7A 4R4ZA 4XACA 5DQ0A 3MF9A 5EJZB 1W90A 3ZXDA 1ENSA 1PNGA 2VOWA 3W5MA 2BYVE 2VPVA 4XJZA 4UFLA 4XUPA 5FYMA 2Z69A 4DPNA 4N90A 1XNAA 2BGOA 3RVHA 1SBDA 3ENRA 5IK7A 4P9XA 1CVNA 1YRZA 2RJKA 2PLV3 2VD7A 5GJ6A 1RHI1 4OMCA 1GWLA 4UF0B 5ANQA 2ZMNA 3QD6A 3R0RA 4GJZA 4LJHA 4NWWA 5L9VA 2LALA 4RGKA 3H3ZA 3UL2A 3I3BA 1TME3 4AQSA 3MDPA 2PTMA 1R1A2 1XSRA 1GYKA 2Y6JA 2X5IA 1DGRN 4ATFA 1RUG3 2ZKLA 3FWEA 3LD8A 5FO9B 5C3QA 3GJBA 1Q56A 2AUYA 2PLV1 2F6BA 4CEYC 4BE3A 1OOPA 2BVBA 2VXRA 3GM8A 3LGRA 5CKQA 5BNQA 3IMNA 3OPTA 1RMU3 3CIHA 4LO7A 3I2KA 3H8XA 1TME1 1UZVA 1YQ2A 2HWF2 2XOMA 1B35C 1GP6A 4LO5B 5K4LA 1RUG1 2X09A 4PJYA 2VMHA 1O3TA 4BDVB 3THCA 4UFHA 2BZDA 5CIRA 3BPSA 5DZFA 4QXKA 2ADEA 2GSYA 2OPKA 2P1BA 3NNGA 1I5ZA 1RMU1 1TNRA 2GP5A 4MYEA 4FPCA 4NVPA 5A7SA 4GZ9A 3WQ0A 4A42A 4ASKA 1UKRA 1VIWB 4XQWA 3ZXEA 4XJ8A 3IKWA 1MVQA 5FZMA 4EWDA 1J3QA 1QQP2 2A6VA 2TBVA 3ZM8A 1QF3A 5CFDA 1Q43A 5B4XA 1AL22 5FUPA 5FZ7A 4K1YA 2A6WA 4AFMA 2CYFA 5C4WB 5KXCA 4TXWA 4CUCA 2XL7A 4NHYA 4XF1A 2ZEWA 3OCPA 3WDTA 4CCMA 5IVYA 3P1IA 5JZGA 3VZJA 1MS5A 1UX7A 1XNTA 4A6OA 3H8OA 1O3RA 3ZVXA 1OQ1A 1DYOA 2BWCA 1CZTA 1RUJ2 4Y22B 1D4M3 4Y1YA 5IJRA 2OQ6A 1ND2A 2CGNA 5IYYA 1DZRA 2KXLA 2QUOA 3FHIB 4FT8A 4OUMA 1PO23 3FLRA 3WOGA 1UN1A 5D8AB 4XBLA 3ALQA 2UWAA 4BQ3A 4WVZA 1XYNA 3UGFA 2XJSA 1D4M1 5BNOB 4BCUA 2YBPA 2JD9A 2D6LX 2AC1A 3DN7A 4UI9L 3JB4C 4XOGA 1POV3 1WMDA 4C91A 5KC5A 3TN92 2VOXA 1X9TA 5T55A 1DGRA 1G6NA 1PO21 2DVFA 4C0HA 4Y20A 1V6LA 1NXD1 4XJWA 3TOJA 4JKKA 3SEPA 4DEQA 3MFAA 4P5YA 1VBD2 5SV5A 2W68A 2BP6A 3FLPA 2XQRA 1POV1 3OEBA 1IPSA 1RGSA 3PVEA 2XLAA 3ZYRA 1QXRA 2VMFA 1W6MA 5JR7B 3ZXJA 3WCSA 5C8CC 1RJ8A 1ST8A 1R083 4BHPA 4CP9B 1JZ2A 2O8QA 4QWNA 5DAWA 3BOWA 4MG2A 1UU5A 1UX6A 2L9LA 1OSGA 2RS52 1IG0A 2O14A 5FJKA 1CQ9A 1S0BA 4KU8A 2EIBA 1ULFA 2J22A 4S2DA 1R081 1JHJA 1UF2C 1ZBE3 3MUZ1 1DLLA 2D5HA 3LIHA 4H55A 3HN1A 3LEMA 1VR3A 3NL1A 4LBMA 4N7UA 5BV6A 4UF0A 1FV2A 2R0FA 3USSA 5CYYA 1OKOA 1AX1A 2X53S 3FUQA 2VBPA 2VVDA 1WGPA 2ZXQA 1W99A 4GMP0 1O6UA 2JKXA 4LUMA 1EP0A 4SLIA 1RITA 3HOBA 2QFEA 4GH4B 1REEA 2CWSA 4AR2A 3T0DA 2K46A 1G9CA 3GYDA 3BTAA 4YW7A 3HQRA 5IHRA 3E1F1 3AZVA 3WNOA 1GWMA 2HWB2 3OGGA 2VW0A 1HDKA 1Q8PA 2P3KA 1HXS3 3HNBM 1EPWA 1XC6A 4LIUA 3N9OA 4FAGA 4AQTA 4ORFA 5T50A 1REDA 4BMBA 3ZR5A 2PAKA 4HSJA 3OPWA 4QQHA 3A0NA 1JN2P 1HXS1 5FPZA 3PNAA 2WLPA 5C4WA 4KH9A 1W2TA 3O1TA 4WBBA 5AC93 2JG9C 2XKPA 3K4AA 1RUNA 3ITQA 4OHVA 3HT2A 2RMU3 3T1MA 1XNBA 1A8MA 3ZSEA 4PI0A 3U0ZA 1HB2A 3LDKA 3ZXLA 4Y22A 5C33A 5DDJ2 4XZPA 2HYKA 3VDDB 5AC91 1UY0A 1BEV2 3H3LA 3HQUA 4O61A 5FMOL 1O59A 1N1VA 5JLVA 1EPZA 5D8AA 3LA2A 1DHKB 1NA1B 5F3IA 2KD7A 1JODA 2PHUA 5HV4A 2K0GA 4QX1A 5BNOA 4AYUA 2R32A 1AYN3 1W8TA 1ASJ1 3O5SA 4UFJA 4DXZA 4OI0A 1UPSA 3TAYA 4DY3A 1W2NA 1AYM3 2BFUS 4B1MA 2XVKA 4PLNA 4YARA 3O0WA 4HK8A 5GLVA 2D93A 5CEHA 4UT5A 1YIPA 1JBCA 1GP4A 2EICA 2D97A 4CDXC 4GWMA 1FATA 2FDHA 3D4KA 3MIBA 1TNFA 3ZDSA 1MVEA 2JDKA 3O0VA 2JXAA 1R64A 1PM7A 1ZREA 2FCVA 2FDGA 1AYM1 4CDUB 3CQOA 4X6RB 2Q1ZB 5FYZA 1KGYA 4CP9A 4UOJA 2OKXA 3MIEA 3PUAA 4Q4Y3 2QE3A 4KMQA 3IBMA 2F17A 2OQ7A 1ULPA 1LHVA 2P4EA 4P9YA 4WM8B 2QCSB 3N7MA 3POJA 4J25A 3LOBA 1OT5A 4RQPB 4M01A 4NMIA 4LE3A 1FOD3 5FO8B 4AI0A 5CG8A 4Q4Y1 4B29A 2HLEA 2Y64A 4WVVA 4COYA 1HB4A 2HWE1 2VZPA 1RHI2 4N53B 2ZA9A 2V5YA 4HN1A 4ZU5A 4A3XA 4HVQA 1OXCA 1WD4A 4FOWA 5FWEA 3U10A 1S0GA 4XQDA 4IV3C 4ISRA 4DNYA 4COWA 4GALA 2QKDA 2VQ0A 1F5JA 3AMNA 1FOD1 4YM2A 3WF3A 2PLV2 2EXIA 3FUOA 2PFWA 2WNUC 1CPNA 1PMHX 2BQPA 4HMZA 1AR73 1G86A 3SC7X 4GH4A 1SPPB 2RDRA 4M3CE 1X36A 1QJY3 2BNMA 4P14A 1TME2 3M4FA 1VBE3 3ZFGC 2OZJA 2Z2SB 2QTWB 2WA3A 1RUG2 3SMHA 5LWBA 3BIEA 1Y9GA 4EV0A 3B3QE 1LU1A 4P08A 4IGOA 1W6PB 1NT0A 4YFZA 5DUVA 4YWAA 1AR71 3LAGA 4O9GA 5A7PA 1RMU2 5T3NA 4D69A 5JPNB 4AG4A 1QJY1 1PZ7A 1X8EA 4PF1A 3VD3A 2CU5A 2PMWB 4MVTA 5EQUA 5DUWA 3IT8A 2WO2A 1X82A 2EIDA 4Q4W3 2VG9A 4XFCA 3IZOA 1F4HA 4BQ4A 3MV01 4XIKA 3ACIA 4BZ4A 1HN0A 1YI9A 2D6OX 2PYTA 2JDZA 2DU1A 4XDPA 2RDQA 4E4HA 3JQXA 3JBG1 5CAZA 2GMEA 4Q4W1 3Q8CA 2I74A 3NWKA 4QGNA 1HIXA 4Q4V1 4XUOA 3KD4A 2XWBB 4QAWA 2WO1A 1W6OB 3CO2A 3O7OA 2G19A 1DCSA 4E8DA 1JUIA 2SBAA 2JE9A 2XG3A 3VDDA 1Y4WA 1YFWA 2VOTA 3UJQA 5IVEA 3O1VA 2WNVC 5LW9A 3LKJA 5TSWA 5FJHA 4RL7A 4CTEA 1UWWA 1BXHA 2HWC3 4Y4RA 5GALA 1NA1A 3KHBA 4JQTA 1ULDA 5CA6A 3M7AA 3MICA 1S0JA 3BN6A 4BISA 4AEKA 1D4M2 1Q8SA 3GDBA 4NAOA 3ME2A 4YGDA 3ZDVA 4C1WA 5F6LB 3WUCA 5FFOC 3MV11 1QDCA 3KSCA 5C5UA 2EXJA 2HWC1 1PO22 1DQ5A 1Z78A 3HN3A 4HOOA 1LR5A 3H42B 2BUKA 3GHMA 2EXKA 4QQOA 5IUQA 4BMEA 3LEKA 5A32B 3Q8EA 4YW4A 3EBRA 1AR83 1JYVA 5J09A 1BYHA 2Z79A 5DUXA 4MGSA 4PBOA 4IE7A 4LKDA 3CU7A 5DMYA 4QM8A 4CDUA 2JKBA 3GNEA 4AI3A 2DV9A 4B3NA 1ZA4A 3ZYJB 1DBNA 2O0OA 1S2KA 5IVFA 1JH5A 3WF0A 4K40A 4MV2A 1AR81 1EV13 3B01A 1EY2A 5F39A 5FBJA 4WM8A 1PGW2 5LBEA 1COV3 5IATA 1C8M3 1RTVA 4RQPA 5A7OA 3IM0A 2JEMA 5FZCA 2QBXA 2Y33A 2E7QA 1R082 3THDA 5JMOA 4COVA 1S0CA 1GOFA 1XJAA 1XOYA 1NCQC 4L0PA 4OUSA 3ZSKA 4N53A 1BVP1 1EV11 3C2UA 4FAHA 1ODMA 4KBZA 4OCTA 1JOJA 3CJIC 3EQEA 5FP3A 4IEWA 1COV1 4CPBA 3GCXA 1C8M1 1GQGA 3I2JA 2FDJA 2P3IA 3C8XA 5FMBA 4YG0A 1U5IA 4AEDC 4Q8KA 1EUTA 1AX2A 1S0IA 1TVGA 2E53A 5A33B 1ZBE2 4IEYA 1MZEA 1FNZA 4YZ3A 2VZOA 2A71A 4CEYB 4XHXA 3WR0A 4CXWA 3M3IA 2Z5WA 3POSA 4K3UA 1SPPA 3MBWA 4IE4A 4U36A 4CCCA 1M06G 4IXLA 3SXWA 5FY4A 5IW0A 4P9LA 1B35B 4QD2A
chains in the Genus database with same CATH topology
1IS6A 4AE2A 2NMNA 1KFUL 5E8AA 1W6PA 2R16A 1M4WA 2VUAA 3VV1A 4OVEA 4JRAA 1IKPA 4IQPA 1R1A3 3VKLA 2ATFA 4XF0A 1WW7A 3SCHA 4LUKA 3BCWA 3AFGA 2DTYA 1HXS2 1NCRB 4YG3A 3WNXA 2PELA 5JOXA 4ASLA 3HBZA 4FCAA 3WQ1A 4YZ2A 1ULEA 4LO4B 4F7ZA 2NZ9A 4AVBA 2D98A 4WM7B 1D0GA 3MEPA 2VGDA 2RJLA 3RDIA 1KQRA 1W6OA 4R9CA 2P17A 4DRRA 5I8TA 1KJRA 4JTOA 4XFIA 4LBQD 5AC92 1WW5A 3KT7A 2NN8A 3M3OA 2MEV1 4Q26A 1X33A 4HSLA 2RMU2 4KBBA 4I0WB 1AR93 3V65A 4DFSA 2BPA2 4YM0A 4FTBA 3KQRA 4HL0A 3IDCB 1AL0G 3Q9OA 5HCAA 4XFAA 3FBMA 4X8NA 2XUMA 1ZZ8A 4BA6A 1AR91 2R1DA 5A32A 1IZ3A 2PQQA 4AI1A 3URFA 2JECA 1RUD3 3DV8A 1SBFA 1XYOA 1HRV3 4YZ4A 1TEIA 1AYN2 2V09A 3WG3A 1D2SA 2VNRA 3HQXA 1AYM2 1V6KA 4C1XA 4XTMA 5DZEA 4AHYA 3MFCA 1KFXL 4I3GA 1RUD1 1CJDA 1HRV1 3GZTB 4OFGA 5BY5A 1LKNA 3A4UA 3NJZA 4K7JA 5JDBA 4FOYA 1C8NA 2B5HA 1NA1C 2H6BA 5JSRA 2I45A 3NV3A 3AYEA 1XE7A 3FMGA 5H9QA 4Q4Y2 4UBHA 1G8WA 2HWE2 4ZU4A 4A7ZA 1RL3A 3AMHA 3MI8A 5A33A 1FOD2 3TB0A 1UMZA 2H0VA 3WP5A 1G9AA 1FV3A 1MQTC 2BBVA 4QQLA 4CEYA 4K21A 4PLOA 1F31A 3TRSB 1G7YA 2CAVA 2ZGRA 1SLBA 1HRI3 1H2NA 3I2DA 1B35A 3WUDA 1HX6A 4COUA 1AR72 3GBWA 4JDOA 3SISA 1HRI1 4IEPA 1QJY2 3JB8A 2AR6A 1V6JA 5T5PA 2ZGTA 1KITA 2GN3A 1SLCA 2WIIB 4XIOA 4P9IA 1DZQA 1NCRA 2DURA 1V70A 5GZFA 2Z42A 2JJ6A 3WDVA 1J1TA 3BB6A 2HWD1 3JBG2 2Y38A 2JG9B 3ATGA 1U5XA 4Q4W2 5GKAC 5F1RA 4Y5Z0 1RJ7A 3HMYA 2W52A 2VOKA 4HN0A 5EV7A 4BIOA 4N7IA 2TNFA 3B94A 1ZZ7A 3RQ0A 1V6IA 1VAVA 3D0JA 4NO4A 1Q8OA 4Q4X3 3IDEA 3EO6A 5CNAA 3IIAA 1N47A 4JV4A 4MGZE 4AVVA 4GKXA 4QM9A 4Q8LA 2QDNA 4WZCA 2UWBA 5LK7B 2XJTA 2WL1A 1HV0A 3ZFFC 3MGUA 4Q4X1 2HWC2 2GC0A 3VBSC 2W39A 4Y26A 3PJYA 1E57A 4DQAA 1GZWB 4QPIB 1DYKA 1R093 3NSTA 4CDXB 4Y1VA 2EIGA 3EHKA 1PO11 4G9SB 2UYAA 4AFBA 5H9RA 4CDQC 2D44A 3V0BB 5J96B 1O3SA 1R091 3VBOC 1AR82 4CZSA 2E51A 4LBLA 4AXOA 4CP0A 4KU7A 2ZOEB 2ZHKA 1C57A 1CAXB 3I8TA 3I7DA 2XJPA 1NYWA 2MPFA 1WCKA 1Y9QA 3AMMA 2YGLA 1EV12 3D0SA 3WDWA 4MSVA 4NWVA 2WT0A 1COV2 4IV3B 5I0TA 1C8M2 4CEWC 4MGIE 3L9JT 3R6SA 4OZXA 5EZWA 1SCSA 3OBRA 3VKNA 1OA4A 2WC2A 1HV1A 1MS9A 1KD7A 3K51A 2WNUB 1CONA 1H2KA 1ZRRA 3M8LA 1BMV1 1FYUA 4I01A 1S2BA 1GNHA 4Z82A 3ZFGB 1ZNPA 3VKMA 2YC0A 5BNNC 2ETEA 1SFYA 2KM2A 3VL9A 5I0UA 4A7KA 4NHLA 1ZBA1 2E63A 4JGZC 2D6NA 3KZ4C 4JGYC 2MHFA 2E6VA 3B9CA 2DTWA 3UK9A 3W9AA 1C5HA 2FHRA 2DUOA 4YZ1A 5L7OC 1WLDA 2EA7A 1CAVB 1DGWX 3WG2A 3B93A 2JG9A 2P3JA 4HT1T 3FFQA 3OF1A 4LTAA 1OKQA 5KXDA 3SITA 2HEYF 3VLBB 4LO6B 1YIFA 2WNVB 1UZZA 4Y24A 2MEV2 1CX4A 5I0SA 1LOFA 2VW2A 1C5IA 4JDNA 2GH8A 2DVBA 1S0DA 2Q4SA 4OLLA 3WQ7A 5FOJB 3J26N 3ZIXA 1LOEA 2ZHMA 3FE5A 1NLSA 1AXKA 1J1LA 4P9JA 3SHRA 4AQ6A 2ZABA 4B4QA 2CV6A 1NCRC 1AR92 4D7TA 1C4RA 1GZWA 4QPIA 1PIV3 2Q0AA 3WG4A 1GV9A 3MW4A 3VZNA 4CDXA 2NM1A 1N3QA 3QOPA 5FLHA 4YM1A 4WM7C 2I2SA 4Q0UA 3V0BA 3ES1A 4AWDA 4RS5C 3QH6A 1PIV1 2RS33 1RUD2 1SLAA 4XDQA 4XJAA 1HRV2 2D6KA 4IESA 1GICA 1LHWA 2XBO1 4HBNA 1CAXA 3AKQA 4GQ7A 4XW3A 1NG0A 3AP7A 1LHOA 2RS31 2YDEA 4ZKTB 4GMP1 1NCQB 2DCYA 4MXWB 1UIKA 2ZS6B 3AXDA 4H7MA 1XU2A 3CJIB 4IV3A 4OHZA 4AEDB 4EROA 4E27A 5C8WA 3KS7A 4HKWA 3MW2A 2WNUA 4KWKA 5J98B 4AGRA 3WP3A 2TUNA 4FO9A 4LO8A 1VLNA 2GAUA 3ZFGA 2GC1A 4OHXA 1VRH3 2GC2A 3AYCA 5FMOS 5JSOA 1SMVA 3A0KA 5HCBA 5GZCA 3WY6A 4LBJA 1HRI2 4XETA 1CN1A 4L92A 1OFNA 1VRH1 3L2HA 3E5QA 1U5YA 3B7MA 4UXAA 1IKQA 4ZXKA 2R061 2IFRA 2A3XA 2XVLA 2RR13 4YGCA 2DWRA 3C3VA 1WMEA 1OI6A 4HVRA 1NZCA 2ZGMA 5CVRA 1LOBA 4ITCA 1CAVA 1XYPA 2HWD2 1RC6A 3K48A 5T5JA 2E7TA 4N43B 3VBRC 4S2GA 3NW4A 2WSUA 4RR3C 3AJZA 2VUJA 1JHNA 2RR11 2ZCWA 4Z8BA 1S0EA 4AHZA 1LRHA 5DG2A 2ZHNA 2WNVA 2RS13 5KHGA 1X8MA 3AYAA 4XTPA 3OGJA 1IS4A 3DF0A 3MPBA 1W39A 3NV1A 2DCZA 4BYYA 3GHNA 2RS11 4R9DA 1BZWA 1LJ7A 1ZRCA 2QZ3A 4Q4X2 3VBFB 4CDWC 3IWZA 4ONUA 4QGMA 3UKVA 2XLFA 3IDBB 1POV0 1MZFA 2NMOA 4QHBA 1PO12 1UU6A 1MS8A 4OHYA 1DFQA 2DFBA 2HJIA 1QY4A 2CL2A 5I93A 4CP2A 3FX3A 4BIFA 1R092 1ASJ3 4G3YC 5F6KA 2IZWA 3N7LA 4PF5A 1LOFC 1H2MA 4XEZA 5LEKA 4S2FA 1PGL1 3ZXGA 3J9SA 2D3SA 4E2SA 5ABJB 1NCQA 4FXKB 5FBZA 4MXWA 3AZWA 1HLCA 4CRQA 3V56A 3CJIA 2D43A 3ZMOA 4FPFA 4AEDA 4QPIC 1XE8A 1LOCA 4IEQA 3VBHC 4XMIA 1MQTB 3RI8A 3ZSLA 3ZX7A 1RB8G 4XF4A 5DG1A 3N4MA 1BMV2 2IWGB 4URTA 1LEMA 5CADA 1RINA 3WG1A 2AZ5A 3ZXAC 3HR9A 1XRUA 3PMEA 4I3PA 2HWE3 1J3RA 5JPMB 2ARBA 1ZBA2 4TYSA 4XF3A 5LK5A 1H4HA 3ZFEC 1N3PA 4AGVA 4P9GA 4ASMB 1O4TA 1UU4A 3E6DA 2WSVA 4GIQA 2PAEA 4MZUA 4AGGA 2WWSA 1AJOA 1C1FA 1KXGA 1MS3A 2LM3A 2ZTNA 2K9ZA 4I02A 5AFEA 5JSPA 3O14A 1C28A 4DS0A 1TE1B 3AP5A 3ECQA 4DY5A 2HEWF 2LUWA 4N43A 2WKKA 2Y0IA 1RUH1 3ZYIB 4R8HA 3MYXA 3B5LB 4HKOA 2ZMLA 4YW1A 4Z1VA 1GBGA 2BNOA 3APBA 1VBA3 2ZGPA 2D6MA 4SBVA 3WP4A 3PVNA 4QQ2A 4HPKB 1SQ4A 1XNKA 2YZ4A 1VBA1 2YMZA 3VZOA 3SH5A 2AH2A 3JBG3 3VZKA 4WZFA 3WW3A 4LEJA 4QPGC 3ZFFB 3VBFA 4Q4V3 1XU1A 3VBSB 1CD3G 2ZPXA 3INAA 3DKWA 2GMMA 2A70A 2IXLA 3IN9A 5LRRA 5I91A 5BYNA 2JX9A 4YRDA 2C9AA 1I9RA 5CG9A 4LHNA 1WUVA 4CDQB 2H0BA 1V00A 5KWRA 2WJSA 2JENA 1B09A 1X50A 4Q0PA 3RRDA 1PIV2 3OD0A 4F8AA 3OBTA 4IEOA 3VBOB 3VKFC 1GNZA 4NOTA 4XXAA 5FRAA 1DF0A 2MNGA 2XBO2 1LOAA 4CP1A 1OQDA 4EWAA 3WCRA 1Z7S3 1IPKA 4XBNA 5ABJA 2RS32 2YYOA 4OI4A 4WVMB 3LB9A 3HD8B 4F83A 3VHOA 4GWNA 5F9TA 3WW1A 1VBB3 2JG8C 4CEWB 1Z7S1 3UKNA 3KB5A 5JI9A 1MS1A 2CWMA 2Y26A 3D82A 2B9UA 4PIYA 2A73B 4Z07A 1MQTA 4B8EA 4YSFA 1C1LA 3E5UA 4XFGA 4E4SA 5E1RA 2XJVA 4F3JA 1H1MA 2BGCA 3TNQA 1QGLA 5DUUA 1VBB1 4FPYA 4MH0E 2OW4A 1TMF3 5BNNB 2ZZJA 5GLZA 2I07B 4JGZB 2E7AA 4JGYB 5FLJA 4XQ4A 1VRH2 1TMF1 4P9WA 4IEVA 2VVEA 4KG0A 2R062 1MS0A 2G4IA 1F5FA 3O12A 1QKQA 3KT4A 2YROA 3BOPA 5FCCA 3RMXA 3AZZA 1Q8VA 4FPHA 1H8TC 4GB33 5L7OB 3ZXFA 2XB6C 3AXEA 1WW4A 3L2YA 4NHMA 3PTYA 1VP6A 4W6YA 2F4PA 2GH2A 4FOVA 3ZN6B 4DRVA 2RR12 2PHTA 2H6CA 4XILA 4GB31 1KS5A 5HI0A 3H8UA 4BM8A 4HPKA 3MLJA 4D7SA 1GZCA 1CAWB 1VAKA 2JD4A 1N3OA 3H9AA 1FNYA 2CGPA 1QXPA 3NAPC 4XFHA 1AZDA 1EYBA 1DYPA 2OUHA 3DL3A 4LULA 1QHDA 1AJKA 2RS12 1GZ9A 3AJYA 3ZFFA 3S7IA 3VBSA 1LGCA 3PMSA 1H8VA 3AP6A 4YGEA 1D0HA 1S1AA 2D3PA 3D5OA 1AXYA 3GF6A 2MEV3 2WQ4A 1SEFA 4N43C 4CDQA 3OYWB 4KGGA 5T54A 5HBAA 4RS5B 1O91A 1NQJA 2ZZQA 5IT6A 5JVVA 1EAH3 1QH6A 3VBOA 2NPIA 4W65A 4E2QA 1I6XA 1LTEA 1JUHA 3POYA 1YNAA 5T5OA 5L19A 3AM2A 4AVAA 3U4XA 2XWJB 1PGL2 2YV8A 1EAH1 3ZYPA 3E6BA 4AF9A 3MIFA 3WDUA 1ASJ2 2WT1A 2Q8OA 3MW3A 4PDWC 4J1WA 1WLCA 3VBFC 3VKOA 2B46X 3ZSMA 2FBEA 1Z0HA 2WNEA 4CEWA 2EALA 1AR63 2DVDA 4HKLA 1IHMA 4GULA 5AVPA 1ZM1A 5I8SA 1UIJA 1QWRA 3KGLA 3RZZA 4CYDA 3QACA 4BPZA 5FLIA 3ILFA 3AZYA 1AR61 1VALA 5BNNA 2A6XA 1HQWA 3THTA 2BWAA 3R05A 1BBT3 2PHLA 2R49A 4JGZA 5KBFA 1DQ0A 4JGYA 1DU3D 4M00A 3WT3A 1FXZA 3ROUA 5ABJC 3M2MA 3SH3A 3JZVA 3RMYA 3GBFA 5GZGA 1BBT1 4AVCA 4PBPA 5BXXA 4I0BA 4UW3A 5L7OA 3CF6E 1RUJ1 3E6CC 2ZX2A 3LSEA 3FLTA 1ZZ6A 2WS93 3VBRB 1RUH2 3ZN6A 1LENA 1OPOA 4RR3B 2QZ2A 4NR1A 3ZN4A 4KG8A 1FMD1 4C90A 2R073 4W6WA 4LE4A 2VQAA 4DOUA 5FPXA 1BVVA 2A75A 4UW5A 3JCIA 1QDOA 2HKXA 2WS91 1DZTA 3GZUC 1CAWA 4PLMA 1G9DA 4I2OA 2DVAA 4DB5A 4QMAA 2XGXA 3H3UA 4B4PA 2R071 3GBGA 4NPRA 1VBA2 2X8KA 5FREA 1ND3B 1QJX1 4K9SA 2RM21 3WDYA 2HWD3 3SCFA 2A6ZA 3I59B 2LTNA 1S55A 5ACA3 4AQ2A 4CDWB 1K5MC 4M3CF 4WV8A 3TBDA 3VBUC 2VNOA 3P3NA 5T52A 4HZFA 1V9U3 3D6EA 1H1AA 2RHPA 4WM7A 2PHRA 3OYWA 2WZR3 3BU7A 3B00A 4Q4V2 5ACA1 4RS5A 1IOAA 2DVGA 2ZX1A 5EXOA 1I3HA 2EXHA 2C5DA 2PHWA 1V9U1 3FZ3A 5IK4A 2WZR1 5JI7A 2YHJA 2X5IB 1YO8A 1PO13 4KWJA 5E88A 4M0HA 4RSUA 5K7PA 4GA9A 4D94A 1Z7S2 1AHSA 1LHNA 3IPVB 4PIZA 3VBHB 3AK0A 1BQPA 1NQDA 2BNNA 3LCPA 1KDMA 5JCTA 3N36A 1VBB2 2JICA 1SCRA 1APNA 4Q29A 4FTEA 4KL1A 1RUE3 4AHXA 1SDWA 1LCLA 4RFT0 3ZFEB 3ACLA 1YXWA 3GZAA 2XLGA 3FBYA 1HQNA 5IK5A 1O4ZA 1LECA 1TMF2 1A8DA 1AUYA 1T6GC 3W58A 4LBQB 1CESA 1HW5A 1RUE1 2V73A 4RGAA 3WZ1A 1IQAA 1ULGA 5JAXA 2PHDA 1OMIA 1IS3A 1H9WA 4K1ZA 4Y1ZA 1ZZCA 3SH4A 4LLFA 2ZGQA 2B8MA 1MS4A 3VBRA 2IC1A 1ZBA3 4RR3A 3OJBA 2TEPA 2YUEA 3G7DA 2GDFA 5I8YA 1NE4A 4COZA 3AP9A 3HWJA 2IFWA 3HT1A 4GB32 3S7EA 1J58A 4J6GA 3RWNA 5GLWA 2B42B 3M1HA 2UYBA 2DUPA 4I30A 3JQWA 4FPJA 5JOWA 3S0MA 5KC6A 1ND3A 2DYCA 4FOQA 2XJRA 4JVAA 1NE6A 2VU9A 5E16A 1UW8A 3CJXA 1SFNA 1YFYA 3I59A 1WBLA 4QPGB 5F5QA 2G9FA 3ZXKA 5EFUA 2VY0A 4CDWA 4A7YA 4D7YA 4AVSA 4IV1B 3ST7A 2ZX4A 5SV8A 2YXSA 4JTNA 1UL9A 2ET1A 2C0ZA 1SLLA 3BIWE 4DMIA 1H4GA 4Q1PA 4L99A 2IXHA 1TQ5A 4BLJA 1W6NB 4X6QB 3KCCA 3CLPA 3ZN5A 5K0UC 2NP0A 4YW5A 4ES8A 2VW1A 4M3CB 1PK6C 1YWKA 3KMHA 1EAH2 3H0OA 4YVSC 1CPMA 4FPOB 1RIRA 2R30A 2WT2A 3X29B 3J8F3 1QH7A 2ZGSA 4FQ4A 4OI1A 3WVJA 1YYNA 2XPJA 2A7AA 2JG8B 3IPVA 4C0BA 3VBHA 1H30A 3KCYA 5GZDA 4RA0A 3WV6A 2ZACA 1N1YA 3J8F1 4B7KA 2CGOA 2XBO3 1PZ9A 5GZEA 3AKSA 4NN0A 1AR62 4MUVA 4AFAA 4GMP3 1O3QA 1YHFA 5D1IA 2ZGNA 4EN7B 1BJQA 1UZYA 1PVC3 2XKOA 4MLOA 1W6QB 1KDKA 2EVXA 1QMJA 4KGQA 3ZFEA 3BALA 2GNTA 1F8VA 3AYDA 2BVVA 4HVOA 2Q30A 1GFF2 5GM0A 4LBQA 1BBT2 1OQEA 4MXVA 4LBKA 1PVC1 4LR4A 3M3QA 2AYHA 1V6MA 3S30A 1ULCA 2A5ZA 2ZX3A 1H8TB 2PN5A 3VUOA 3JU9A 2GNDA 4BQ1A 5FDBA 4FQZA 4YNIA 5J3UA 1FMD2 5EYXA 4RGGA 1MZ6A 3PHMA 5EYYA 1VAMA 1KRIA 2X29A 3PVOA 2WS92 1DQ4A 2R063 2ZJCA 1OA2A 4ATEA 4ES9A 3NAPB 2R072 1Y3TA 3LWCA 4I0AA 1QJX2 3RPQA 4FSJA 2RM22 1UCXA 2W08A 3POWA 4QPGA 5FO7B 4R9BA 1KJLA 3ZIWA 1BKZA 2IXJA 2D40A 2GALA 1VJ2A 1BCXA 4XXPA 4IV1A 4YVWB 3ZMNA 5FOBB 1YJLA 1WD3A 1WA4A 1OPMA 4YM3A 1FT9A 1YJKA 4PIXA 1PGW1 5ACA2 3RJRA 1QU0A 1CR7A 3WW4A 1OLQA 1LOGA 3AFKA 3PJQA 4AVTA 3SNMA 2P34A 2D5FA 4EN9B 1W6NA 1V9U2 3RJ2X 1GR3A 2FZ1A 2WZR2 3DPRC 5FTTC 4Z2WA 4M3CA 3CL1A 3EJKA 4H7LA 1ND3C 3CEWA 1UAIA 1ZBE1 2ZKNA 3V64A 3N3HA 4LNVA 4KNCA 4FXGB 4META 3WX5A 4PDWB 2OZ6A 1H1IA 3J4UH 1QJU3 2JG8A 3NV4A 2R043 3VZLA 1V6NA 3KT1A 5DZGA 2W0XA 5CBLA 3KLSA 4XF9A 1MZ5A 2D7FA 1QJU1 1ZZ9A 3E5XA 4L2NA 5EWSA 2R041 3DGTA 4FBFA 3MIHA 2FZ2A 2O8OA 2CY6A 3RSJA 5FQ0B 1Q8QA 1WW6A 1W6QA 5HCFA 3VN4A 3AZXA 4B4RA 5KHIA 3KM5A 4FPGA 3RNSA 3VZMA 2DU0A 1VBC3 2X5IC 3PVBB 3TYJA 5JMCA 4LHKA 1RUE2 4KWLA 3MLKA 1OOPC 1VB2A 1JW6A 1RVF3 1OA3A 1XNCA 3ES4A 3BPZA 5B2GB 4Q27A 1H8TA 1N1TA 1RUC3 2UU8A 1VBC1 2CNAA 2XJQA 1DQ2A 1GSLA 3M3EA 4R4XA 4JDMA 5AVAA 5JIAA 1A6CA 1UPIA 1JTZX 2RMU1 2ET7A 1RVF1 2A3YA 5J37A 4XYXA 1QOOA 1RUC1 2ERFA 5BPXA 5KHHA 1YUDA 3U11A 4EN6B 5J7MA 4YG6A 1OHFA 3WW2A 4N9IA 3PLQA 1KS4A 2B39A 5CU1A 5CFDC 3NAPA 2N7GA 2DCKA 1HKDA 1AYN1 4QPYA 4E2GA 1XQNA 1RUH3 3ILRA 4D3WA 5JZGC 2WZPP 4DZGA 1ZX5A 4IERA 1K5MB 3E97A 5CFCB 3QBQA 2UWCA 4YVWA 1C3HA 3VBUB 2EAAA 4RHV3 4Q0VA 3H7YA 3EXUA 1ND2C 1U12A 2AGSA 5JWPA 1D2QA 4KQ7A 1IPJA 1O4YA 2CTVA 2DCTA 3MF6A 1SBEA 3H7JA 1WBFA 1MEC3 3D8CA 4UW6A 4X8PA 3QCWA 4RHV1 2IXCA 3LOIA 1NY71 1NOVA 2GMPA 1NLRA 4AI2A 2UURA 1WLTA 3T1LA 2WLQA 4XPVA 3P3PA 4LT5A 2FMDA 1MEC1 2GNMA 3KGZA 1LHUA 4PDWA 5L73A 1L3JA 2ENRA 2PHFA 1DQ1A 3R4DB 4IV1C 4LA3A 3AMPA 4XHBA 4P5HA 2DUQA 3RYKA 1ONAA 3J8F2 3WHTA 1DDLA 3KCXA 5T5LA 4Q2FA 2ARXA 3N7JA 3WHUA 4XFBA 4BOWA 1QOSA 2GNBA 1DGLA 3MPPG 1VBE1 1ENXA 2VMIA 3MLLA 3W59A 1F2NA 5FQ0A 1MR5A 1H9PA 3AKTA 2UY8A 4L97A 5C6CA 5J48A 1RUOA 4INDA 4Y4YA 4UBGA 3THPA 1FPN3 2BFUL 1W0PA 1PMIA 4XJ9A 2CAUA 5BNPB 1RUF3 5K9YA 5E89A 2PAMA 2GU9A 1PVC2 2WFF3 3FJSA 3ELNA 3FFZA 2OYZA 3GALA 2B45X 1FPN1 2OUJA 3ZSJA 3OY8B 1JXNA 5C9AB 1RUF1 4E4DX 1AX0A 3DUIA 1O5UA 1W0OA 4OULA 4BLIA 1DG6A 2WFF1 3VHNA 3QLQA 1DIWA 4K8FA 3LA7A 1LGBA 2VVFA 3USUB 2GZWA 1ZRDA 4XJUA 3B02A 2Q5TA 4XBQA 3AKRA 3UKTA 4WVWA 4MGKE 1WLWA 4AEMA 3OTFA 2IXKA 1OD5A 5A3LA 5C4WC 3ILNA 1W2UA 4LBNA 1PVXA 4YW3A 4QU2A 1BK1A 3M70A 2DCJA 1ZVFA 1K5MA 5CFCA 4JCKA 4LA2A 5KHJA 3VBUA 2P2KA 4NHKA 3JD73 4XE9A 1HQLA 1FI2A 5HXVA 4MGYE 1LODA 1LGNA 5D8AC 4J1XA 1MACA 5LRSA 5BNOC 1GKBA 5JOZA 1RUI3 2ES3A 1YFUA 3H1YA 3JD71 2QVSB 2EF6A 4FVVA 5J36A 4FP3A 1CIWA 1Y43B 5K0UB 3HIFA 1ALYA 4HK9A 3LA3A 2NLRA 4YYOA 2Q1MA 1ZZBA 1PK6B 2RE9A 4YVSB 1YI7A 4K20A 1RUI1 1F9KA 2R6QA 4E9KA 3QH7A 4ISQA 4E4ZA 4EJRA 4AW7A 2O1QA 4YVWC 3N7KA 2BW8A 2QNKA 3G6JB 2HEVF 4A2UA 2ZX0A 3WLUA 1U0AA 3M3CA 1QJU2 1CAUB 1DQ6A 3WD5A 5EJ3A 5L36A 2R042 1I1EA 2EAKA 4H3WA 2XL9A 4IEXA 4BWOA 2B7YA 1AXZA 3WDXA 1LEDA 3SCGA 1LESA 5FAXA 3ZYGA 2HWF3 1R1A1 2A6YA 2QQPA 4YGBA 4Q1RA 5BNPA 2VOVA 4HFSA 1URXA 4FPEA 2PHXA 4WVMA 2QDRA 2NQYA 4XFFA 4TLFA 1IGOA 2DFCA 1R1ZA 3OPZA 4GH4C 4O9EA 1XNDA 2WQZC 2HWF1 1SLIA 1VBC2 2PA7A 3TNPB 1V6OA 3OY8A 1H0BA 1AF9A 3RYPA 3SLIA 4AK3A 5C9AA 1G9BA 4IETA 2DF7A 3WINE 1PZ8A 1QQP3 3ETQA 4AFCA 1PHMA 1NXMA 1RVF2 3AX4A 2ZHLA 1PGSA 4JQRA 1AL23 3USUA 1RUC2 2G9GA 2JE7A 4L9BA 4R52A 1G9FA 3AB0A 4IEZA 5AFBA 4B7EA 4Q0SA 4IEUA 3WP6A 4AI8A 4EWEA 2YGMA 4AHWA 3B9IA 1A78A 1QQP1 4YZ5A 1VB4A 2YPJA 2BTVC 1AL21 1RUJ3 2BEOA 2WINB 4GKYA 2ZMKA 3AP4A 4QGLA 2C1FA 4GXLA 1OLRA 5IK8A 5GLTA 4TSVA 1SLTA 2KA3A 2QJVA 3V0AB 2FMYA 1FMD3 3ASIA 5C8CB 3R4UA 2VNGA 4HETA 3VDDC 4Y1UA 4OI2A 4DINB 3TN93 4H14A 1JYCA 4OHWA 3BODA 2WA4A 3TWIA 4AEJA 2SLIA 3MZHA 3HAGA 1QNWA 1YFXA 1QJX3 2XHKA 2RM23 1J3PA 1VBD3 4K6BA 4RHV2 2XVGA 1NY72 1DGWA 4I09A 3TN91 1LULA 5K0UA 4L11A 2WFPA 3DPRB 1PK6A 4YVSA 3VL8A 1MEC2 1VBD1 1PNFA 2ZGOA 3MIGA 2D3RA 2XH6A 1Q5OA 1YCIA 4Y1XA 5CB7A 5K8SA 2RS53 1WMFA 4QT6A 4CDUC 5CFCC 1JYIA 1H2LA 1O7FA 3H50A 1OFSA 1XXNA 4LHLA 1Q3EA 5I0RA 1ENQA 4HLTA 2A3WA 4WM8C 4FTSA 1CAUA 1WCDJ 2RS51 1YLLA 4QQPA 4RQPC 1VBE2 1Y7BA 4TWTA 3U07A 2ZGUA 2OIIA 4MX3A 4YW2A 1FX5A 5GLUA 4N53C 4RD7A 3VHRA 4N9HA 2YY1A 1UKGA 4LLOA 3WXPA 4FP2A 2OVUA 1QOTA 2FQPA 3S6PA 2AREA 2NYYA 5KXEA 3RG0A 1REFA 4EN8B 3O0XA 3RS6A 2OA2A 1O5LA 3LSDA 4JC1A 2ZGLA 1N1SA 2HWB3 3LZZA 1OOPB 2R0HA 3UJOA 3R4SA 4Z92B 5KXBA 1FPN2 3VGIA 4QX5A 1RUF2 4AFDA 4V1PA 3I4IA 2HWB1 2IXIA 4PQ9A 3FC0A 5KHKA 4TZDA 2WFF2 1LB2A 3ZPYA 2ILMA 2XJUA 3AKPA 1IS5A 1UD1A 2AENA 4L8QA 3MIDA 4FPKA 5DXDA 4LBOA 2GN7A 5H9PA 4UW4A 5CFDB 3VHPA 3NO8A 4G4FA 5DDJ3 1QJZA 2VULA 3H1MA 1QNYA 5BNPC 4JRLA 3NKGA 1BEV3 2E9QA 1LU2A 2Y0OA 1CJPA 4M0NA 4YLZA 5JZGB 4W6XA 1AVBA 3V0AA