4AFHA

Capitella teleta achbp in complex with lobeline
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
213
structure length
213
Chain Sequence
b'SNGLMAKRLRRELLNTYEQLGKSGLPFLDDIGKVDVKFGLSLQLLKSIEQRGMGFNSIGTFKAIVKLSWVDTILRWDPEPPFDFQKIEISPDEIWTPDIKLFNSVDLDMTLDRTTQAIVFSNGTVLWIPPAVLKVLCVSQDDVDSCHFQFGSWVYSVDEVDIHFMDDKAEVLLDFYQDSLEILENSAQRQEVVYPCCESAYVEMKYLLALRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACHBP
publication title Molecular Actions of Smoking Cessation Drugs at Alpha4Beta2 Nicotinic Receptors Defined in Crystal Structures of a Homologous Binding Protein.
pubmed doi rcsb
source organism Capitella teleta
molecule tags Acetylcholine-binding protein
total genus 47
structure length 213
sequence length 213
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4afhA00
2YN6A 3T4MA 5J5FA 3SQ6A 2BG9C 5AINA 5AFJA 4XK9A 2BYNA 2BYQA 2Y54A 4UM1A 2Y56A 3U8JA 3UU3A 3U8NA 5L47A 5LXBA 3RIFA 5AFMA 3UQ7A 5IUXA 2XNTA 3C79A 2XQAA 4QABA 5BRXA 5HEHA 3WTLA 3WIPA 4NPPA 3RI5A 4ZRUA 4ZJSA 2C9TA 2BYPA 4UM3S 5AFMB 2XQ6A 3PMZA 4ILBA 5TVCA 3TLTA 5AFHA 1UV6A 4HFHA 5SYOA 5HEJA 2XZ6A 4TNVA 5HCJA 3WTJA 5BP0A 5LG3A 4D01A 2WZYA 3EAMA 2XQ9A 4HFEA 4PIRA 4UXUA 2XQ5A 4FRRA 3UU6A 3WTOA 4NZBA 2XZ5A 4AFTA 4X5TA 4QACA 5HEGA 3UU4A 5KZUA 4QH4A 2ZJUA 3PEOA 2XQ8A 4QAAA 4ZJTA 5AFNA 3ZDGA 4COFA 4IL4A 2QC1B 4F8HA 1I9BA 2WN9A 1UW6A 4ZK4A 3LSVA 3RIAA 3U8LA 5J5GA 2X00A 3WTMA 2WNLA 3WTKA 5J0ZA 3WTIA 4IL9A 3IGQA 2VL0A 4EZ1A 5JMEA 4WV9A 5L4EA 4BFQA 3JADA 4A97A 3ZDHA 4UM3P 2WNJA 2XNUA 5L4HA 2UZ6A 4HFCA 2BG9A 2YKSA 5KE4A 3SIOA 4ZZCA 3U8MA 2W8GA 2WNCA 3C84A 2YMDA 5CO5A 2XNVA 4A98A 3UU8A 1UX2A 3GUAA 2XQ3A 3U8KA 3JAFA 2YMEA 3P4WA 4ZR6A 2W8FA 4HFBA 3UQ4A 2BG9E 2XQ4A 3RQUA 4AFGA 3EI0A 5AFKA 4ZZBA 4LMKA 4LMJA 4HFDA 3WTHA 3JAEA 4HFIA 4ILCA 5HEUA 4BQTA 4IREA 2Y7YA 4TNWA 4XHEA 5J5IA 2BYSA 2YOEA 2XYSA 3TLWA 2XYTA 5HCMA 5CFBA 3WTNA 3RQWA 4ILAA 4TWFA 2BR8A 3SQ9A 4B5DA 2XQ7A 2PGZA 4UY2A 3TLSA 4QH5A 3TLVA 4ZK1A 2PH9A 5HEOA 3TLUA 2BG9B 4TWHA 4Z90A 3RHWA 3UU5A 3EHZA 4TWDA 4ALXA 2ZJVA 2X00D 2BJ0A 2Y58A 4HQPA 5BW2A 2Y57A 3SH1A 3ZKRA 5FJVA 4DBMA 2BYRA 3UUBA 4QH1A 5J5HA 4UM3A 4AFHA 3P50A 5AFLA 4Z91A 2BR7A 4LMLA
chains in the Genus database with same CATH superfamily
2YN6A 3T4MA 5J5FA 3SQ6A 2BG9C 5AINA 5AFJA 4XK9A 2BYNA 2BYQA 2Y54A 4UM1A 2Y56A 3U8JA 3UU3A 3U8NA 5L47A 5LXBA 3RIFA 5AFMA 3UQ7A 5IUXA 2XNTA 3C79A 2XQAA 4QABA 5BRXA 5HEHA 3WTLA 3WIPA 4NPPA 3RI5A 4ZRUA 4ZJSA 2C9TA 2BYPA 4UM3S 5AFMB 2XQ6A 3PMZA 4ILBA 5TVCA 3TLTA 5AFHA 1UV6A 4HFHA 5SYOA 5HEJA 2XZ6A 4TNVA 5HCJA 3WTJA 5BP0A 5LG3A 4D01A 2WZYA 3EAMA 2XQ9A 4HFEA 4PIRA 4UXUA 2XQ5A 4FRRA 3UU6A 3WTOA 4NZBA 2XZ5A 4AFTA 4X5TA 4QACA 5HEGA 3UU4A 5KZUA 4QH4A 2ZJUA 3PEOA 2XQ8A 4QAAA 4ZJTA 5AFNA 3ZDGA 4COFA 4IL4A 2QC1B 4F8HA 1I9BA 2WN9A 1UW6A 4ZK4A 3LSVA 3RIAA 3U8LA 5J5GA 2X00A 3WTMA 2WNLA 3WTKA 5J0ZA 3WTIA 4IL9A 3IGQA 2VL0A 4EZ1A 5JMEA 4WV9A 5L4EA 4BFQA 3JADA 4A97A 3ZDHA 4UM3P 2WNJA 2XNUA 5L4HA 2UZ6A 4HFCA 2BG9A 2YKSA 5KE4A 3SIOA 4ZZCA 3U8MA 2W8GA 2WNCA 3C84A 2YMDA 5CO5A 2XNVA 4A98A 3UU8A 1UX2A 3GUAA 2XQ3A 3U8KA 3JAFA 2YMEA 3P4WA 4ZR6A 2W8FA 4HFBA 3UQ4A 2BG9E 2XQ4A 3RQUA 4AFGA 3EI0A 5AFKA 4ZZBA 4LMKA 4LMJA 4HFDA 3WTHA 3JAEA 4HFIA 4ILCA 5HEUA 4BQTA 4IREA 2Y7YA 4TNWA 4XHEA 5J5IA 2BYSA 2YOEA 2XYSA 3TLWA 2XYTA 5HCMA 5CFBA 3WTNA 3RQWA 4ILAA 4TWFA 2BR8A 3SQ9A 4B5DA 2XQ7A 2PGZA 4UY2A 3TLSA 4QH5A 3TLVA 4ZK1A 2PH9A 5HEOA 3TLUA 2BG9B 4TWHA 4Z90A 3RHWA 3UU5A 3EHZA 4TWDA 4ALXA 2ZJVA 2X00D 2BJ0A 2Y58A 4HQPA 5BW2A 2Y57A 3SH1A 3ZKRA 5FJVA 4DBMA 2BYRA 3UUBA 4QH1A 5J5HA 4UM3A 4AFHA 3P50A 5AFLA 4Z91A 2BR7A 4LMLA
chains in the Genus database with same CATH topology
2YN6A 3T4MA 5J5FA 3SQ6A 2BG9C 5AINA 5AFJA 4XK9A 2BYNA 2BYQA 2Y54A 4UM1A 2Y56A 3U8JA 3UU3A 3U8NA 5L47A 5LXBA 3RIFA 5AFMA 3UQ7A 5IUXA 2XNTA 3C79A 2XQAA 4QABA 5BRXA 5HEHA 3WTLA 3WIPA 4NPPA 3RI5A 4ZRUA 4ZJSA 2C9TA 2BYPA 4UM3S 5AFMB 2XQ6A 3PMZA 4ILBA 5TVCA 3TLTA 5AFHA 1UV6A 4HFHA 5SYOA 5HEJA 2XZ6A 4TNVA 5HCJA 3WTJA 5BP0A 5LG3A 4D01A 2WZYA 3EAMA 2XQ9A 4HFEA 4PIRA 4UXUA 2XQ5A 4FRRA 3UU6A 3WTOA 4NZBA 2XZ5A 4AFTA 4X5TA 4QACA 5HEGA 3UU4A 5KZUA 4QH4A 2ZJUA 3PEOA 2XQ8A 4QAAA 4ZJTA 5AFNA 3ZDGA 4COFA 4IL4A 2QC1B 4F8HA 1I9BA 2WN9A 1UW6A 4ZK4A 3LSVA 3RIAA 3U8LA 5J5GA 2X00A 3WTMA 2WNLA 3WTKA 5J0ZA 3WTIA 4IL9A 3IGQA 2VL0A 4EZ1A 5JMEA 4WV9A 5L4EA 4BFQA 3JADA 4A97A 3ZDHA 4UM3P 2WNJA 2XNUA 5L4HA 2UZ6A 4HFCA 2BG9A 2YKSA 5KE4A 3SIOA 4ZZCA 3U8MA 2W8GA 2WNCA 3C84A 2YMDA 5CO5A 2XNVA 4A98A 3UU8A 1UX2A 3GUAA 2XQ3A 3U8KA 3JAFA 2YMEA 3P4WA 4ZR6A 2W8FA 4HFBA 3UQ4A 2BG9E 2XQ4A 3RQUA 4AFGA 3EI0A 5AFKA 4ZZBA 4LMKA 4LMJA 4HFDA 3WTHA 3JAEA 4HFIA 4ILCA 5HEUA 4BQTA 4IREA 2Y7YA 4TNWA 4XHEA 5J5IA 2BYSA 2YOEA 2XYSA 3TLWA 2XYTA 5HCMA 5CFBA 3WTNA 3RQWA 4ILAA 4TWFA 2BR8A 3SQ9A 4B5DA 2XQ7A 2PGZA 4UY2A 3TLSA 4QH5A 3TLVA 4ZK1A 2PH9A 5HEOA 3TLUA 2BG9B 4TWHA 4Z90A 3RHWA 3UU5A 3EHZA 4TWDA 4ALXA 2ZJVA 2X00D 2BJ0A 2Y58A 4HQPA 5BW2A 2Y57A 3SH1A 3ZKRA 5FJVA 4DBMA 2BYRA 3UUBA 4QH1A 5J5HA 4UM3A 4AFHA 3P50A 5AFLA 4Z91A 2BR7A 4LMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YN6 A;  3T4M A;  5J5F A;  3SQ6 A;  2BG9 C;  5AIN A;  5AFJ A;  4XK9 A;  2BYN A;  2BYQ A;  2Y54 A;  4UM1 A;  2Y56 A;  3U8J A;  3UU3 A;  3U8N A;  5L47 A;  5LXB A;  3RIF A;  5AFM A;  3UQ7 A;  5IUX A;  2XNT A;  3C79 A;  2XQA A;  4QAB A;  5BRX A;  5HEH A;  3WTL A;  3WIP A;  4NPP A;  3RI5 A;  4ZRU A;  4ZJS A;  2C9T A;  2BYP A;  4UM3 S;  5AFM B;  2XQ6 A;  3PMZ A;  4ILB A;  5TVC A;  3TLT A;  5AFH A;  1UV6 A;  4HFH A;  5SYO A;  5HEJ A;  2XZ6 A;  4TNV A;  5HCJ A;  3WTJ A;  5BP0 A;  5LG3 A;  4D01 A;  2WZY A;  3EAM A;  2XQ9 A;  4HFE A;  4PIR A;  4UXU A;  2XQ5 A;  4FRR A;  3UU6 A;  3WTO A;  4NZB A;  2XZ5 A;  4AFT A;  4X5T A;  4QAC A;  5HEG A;  3UU4 A;  5KZU A;  4QH4 A;  2ZJU A;  3PEO A;  2XQ8 A;  4QAA A;  4ZJT A;  5AFN A;  3ZDG A;  4COF A;  4IL4 A;  2QC1 B;  4F8H A;  1I9B A;  2WN9 A;  1UW6 A;  4ZK4 A;  3LSV A;  3RIA A;  3U8L A;  5J5G A;  2X00 A;  3WTM A;  2WNL A;  3WTK A;  5J0Z A;  3WTI A;  4IL9 A;  3IGQ A;  2VL0 A;  4EZ1 A;  5JME A;  4WV9 A;  5L4E A;  4BFQ A;  3JAD A;  4A97 A;  3ZDH A;  4UM3 P;  2WNJ A;  2XNU A;  5L4H A;  2UZ6 A;  4HFC A;  2BG9 A;  2YKS A;  5KE4 A;  3SIO A;  4ZZC A;  3U8M A;  2W8G A;  2WNC A;  3C84 A;  2YMD A;  5CO5 A;  2XNV A;  4A98 A;  3UU8 A;  1UX2 A;  3GUA A;  2XQ3 A;  3U8K A;  3JAF A;  2YME A;  3P4W A;  4ZR6 A;  2W8F A;  4HFB A;  3UQ4 A;  2BG9 E;  2XQ4 A;  3RQU A;  4AFG A;  3EI0 A;  5AFK A;  4ZZB A;  4LMK A;  4LMJ A;  4HFD A;  3WTH A;  3JAE A;  4HFI A;  4ILC A;  5HEU A;  4BQT A;  4IRE A;  2Y7Y A;  4TNW A;  4XHE A;  5J5I A;  2BYS A;  2YOE A;  2XYS A;  3TLW A;  2XYT A;  5HCM A;  5CFB A;  3WTN A;  3RQW A;  4ILA A;  4TWF A;  2BR8 A;  3SQ9 A;  4B5D A;  2XQ7 A;  2PGZ A;  4UY2 A;  3TLS A;  4QH5 A;  3TLV A;  4ZK1 A;  2PH9 A;  5HEO A;  3TLU A;  2BG9 B;  4TWH A;  4Z90 A;  3RHW A;  3UU5 A;  3EHZ A;  4TWD A;  4ALX A;  2ZJV A;  2X00 D;  2BJ0 A;  2Y58 A;  4HQP A;  5BW2 A;  2Y57 A;  3SH1 A;  3ZKR A;  5FJV A;  4DBM A;  2BYR A;  3UUB A;  4QH1 A;  5J5H A;  4UM3 A;  4AFH A;  3P50 A;  5AFL A;  4Z91 A;  2BR7 A;  4LML A; 
#chains in the Genus database with same CATH topology
 2YN6 A;  3T4M A;  5J5F A;  3SQ6 A;  2BG9 C;  5AIN A;  5AFJ A;  4XK9 A;  2BYN A;  2BYQ A;  2Y54 A;  4UM1 A;  2Y56 A;  3U8J A;  3UU3 A;  3U8N A;  5L47 A;  5LXB A;  3RIF A;  5AFM A;  3UQ7 A;  5IUX A;  2XNT A;  3C79 A;  2XQA A;  4QAB A;  5BRX A;  5HEH A;  3WTL A;  3WIP A;  4NPP A;  3RI5 A;  4ZRU A;  4ZJS A;  2C9T A;  2BYP A;  4UM3 S;  5AFM B;  2XQ6 A;  3PMZ A;  4ILB A;  5TVC A;  3TLT A;  5AFH A;  1UV6 A;  4HFH A;  5SYO A;  5HEJ A;  2XZ6 A;  4TNV A;  5HCJ A;  3WTJ A;  5BP0 A;  5LG3 A;  4D01 A;  2WZY A;  3EAM A;  2XQ9 A;  4HFE A;  4PIR A;  4UXU A;  2XQ5 A;  4FRR A;  3UU6 A;  3WTO A;  4NZB A;  2XZ5 A;  4AFT A;  4X5T A;  4QAC A;  5HEG A;  3UU4 A;  5KZU A;  4QH4 A;  2ZJU A;  3PEO A;  2XQ8 A;  4QAA A;  4ZJT A;  5AFN A;  3ZDG A;  4COF A;  4IL4 A;  2QC1 B;  4F8H A;  1I9B A;  2WN9 A;  1UW6 A;  4ZK4 A;  3LSV A;  3RIA A;  3U8L A;  5J5G A;  2X00 A;  3WTM A;  2WNL A;  3WTK A;  5J0Z A;  3WTI A;  4IL9 A;  3IGQ A;  2VL0 A;  4EZ1 A;  5JME A;  4WV9 A;  5L4E A;  4BFQ A;  3JAD A;  4A97 A;  3ZDH A;  4UM3 P;  2WNJ A;  2XNU A;  5L4H A;  2UZ6 A;  4HFC A;  2BG9 A;  2YKS A;  5KE4 A;  3SIO A;  4ZZC A;  3U8M A;  2W8G A;  2WNC A;  3C84 A;  2YMD A;  5CO5 A;  2XNV A;  4A98 A;  3UU8 A;  1UX2 A;  3GUA A;  2XQ3 A;  3U8K A;  3JAF A;  2YME A;  3P4W A;  4ZR6 A;  2W8F A;  4HFB A;  3UQ4 A;  2BG9 E;  2XQ4 A;  3RQU A;  4AFG A;  3EI0 A;  5AFK A;  4ZZB A;  4LMK A;  4LMJ A;  4HFD A;  3WTH A;  3JAE A;  4HFI A;  4ILC A;  5HEU A;  4BQT A;  4IRE A;  2Y7Y A;  4TNW A;  4XHE A;  5J5I A;  2BYS A;  2YOE A;  2XYS A;  3TLW A;  2XYT A;  5HCM A;  5CFB A;  3WTN A;  3RQW A;  4ILA A;  4TWF A;  2BR8 A;  3SQ9 A;  4B5D A;  2XQ7 A;  2PGZ A;  4UY2 A;  3TLS A;  4QH5 A;  3TLV A;  4ZK1 A;  2PH9 A;  5HEO A;  3TLU A;  2BG9 B;  4TWH A;  4Z90 A;  3RHW A;  3UU5 A;  3EHZ A;  4TWD A;  4ALX A;  2ZJV A;  2X00 D;  2BJ0 A;  2Y58 A;  4HQP A;  5BW2 A;  2Y57 A;  3SH1 A;  3ZKR A;  5FJV A;  4DBM A;  2BYR A;  3UUB A;  4QH1 A;  5J5H A;  4UM3 A;  4AFH A;  3P50 A;  5AFL A;  4Z91 A;  2BR7 A;  4LML A; 
#chains in the Genus database with same CATH homology
 2YN6 A;  3T4M A;  5J5F A;  3SQ6 A;  2BG9 C;  5AIN A;  5AFJ A;  4XK9 A;  2BYN A;  2BYQ A;  2Y54 A;  4UM1 A;  2Y56 A;  3U8J A;  3UU3 A;  3U8N A;  5L47 A;  5LXB A;  3RIF A;  5AFM A;  3UQ7 A;  5IUX A;  2XNT A;  3C79 A;  2XQA A;  4QAB A;  5BRX A;  5HEH A;  3WTL A;  3WIP A;  4NPP A;  3RI5 A;  4ZRU A;  4ZJS A;  2C9T A;  2BYP A;  4UM3 S;  5AFM B;  2XQ6 A;  3PMZ A;  4ILB A;  5TVC A;  3TLT A;  5AFH A;  1UV6 A;  4HFH A;  5SYO A;  5HEJ A;  2XZ6 A;  4TNV A;  5HCJ A;  3WTJ A;  5BP0 A;  5LG3 A;  4D01 A;  2WZY A;  3EAM A;  2XQ9 A;  4HFE A;  4PIR A;  4UXU A;  2XQ5 A;  4FRR A;  3UU6 A;  3WTO A;  4NZB A;  2XZ5 A;  4AFT A;  4X5T A;  4QAC A;  5HEG A;  3UU4 A;  5KZU A;  4QH4 A;  2ZJU A;  3PEO A;  2XQ8 A;  4QAA A;  4ZJT A;  5AFN A;  3ZDG A;  4COF A;  4IL4 A;  2QC1 B;  4F8H A;  1I9B A;  2WN9 A;  1UW6 A;  4ZK4 A;  3LSV A;  3RIA A;  3U8L A;  5J5G A;  2X00 A;  3WTM A;  2WNL A;  3WTK A;  5J0Z A;  3WTI A;  4IL9 A;  3IGQ A;  2VL0 A;  4EZ1 A;  5JME A;  4WV9 A;  5L4E A;  4BFQ A;  3JAD A;  4A97 A;  3ZDH A;  4UM3 P;  2WNJ A;  2XNU A;  5L4H A;  2UZ6 A;  4HFC A;  2BG9 A;  2YKS A;  5KE4 A;  3SIO A;  4ZZC A;  3U8M A;  2W8G A;  2WNC A;  3C84 A;  2YMD A;  5CO5 A;  2XNV A;  4A98 A;  3UU8 A;  1UX2 A;  3GUA A;  2XQ3 A;  3U8K A;  3JAF A;  2YME A;  3P4W A;  4ZR6 A;  2W8F A;  4HFB A;  3UQ4 A;  2BG9 E;  2XQ4 A;  3RQU A;  4AFG A;  3EI0 A;  5AFK A;  4ZZB A;  4LMK A;  4LMJ A;  4HFD A;  3WTH A;  3JAE A;  4HFI A;  4ILC A;  5HEU A;  4BQT A;  4IRE A;  2Y7Y A;  4TNW A;  4XHE A;  5J5I A;  2BYS A;  2YOE A;  2XYS A;  3TLW A;  2XYT A;  5HCM A;  5CFB A;  3WTN A;  3RQW A;  4ILA A;  4TWF A;  2BR8 A;  3SQ9 A;  4B5D A;  2XQ7 A;  2PGZ A;  4UY2 A;  3TLS A;  4QH5 A;  3TLV A;  4ZK1 A;  2PH9 A;  5HEO A;  3TLU A;  2BG9 B;  4TWH A;  4Z90 A;  3RHW A;  3UU5 A;  3EHZ A;  4TWD A;  4ALX A;  2ZJV A;  2X00 D;  2BJ0 A;  2Y58 A;  4HQP A;  5BW2 A;  2Y57 A;  3SH1 A;  3ZKR A;  5FJV A;  4DBM A;  2BYR A;  3UUB A;  4QH1 A;  5J5H A;  4UM3 A;  4AFH A;  3P50 A;  5AFL A;  4Z91 A;  2BR7 A;  4LML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...