4AFHA

Capitella teleta achbp in complex with lobeline
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
213
structure length
213
Chain Sequence
SNGLMAKRLRRELLNTYEQLGKSGLPFLDDIGKVDVKFGLSLQLLKSIEQRGMGFNSIGTFKAIVKLSWVDTILRWDPEPPFDFQKIEISPDEIWTPDIKLFNSVDLDMTLDRTTQAIVFSNGTVLWIPPAVLKVLCVSQDDVDSCHFQFGSWVYSVDEVDIHFMDDKAEVLLDFYQDSLEILENSAQRQEVVYPCCESAYVEMKYLLALRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACHBP
publication title Molecular Actions of Smoking Cessation Drugs at Alpha4Beta2 Nicotinic Receptors Defined in Crystal Structures of a Homologous Binding Protein.
pubmed doi rcsb
source organism Capitella teleta
molecule tags Acetylcholine-binding protein
total genus 47
structure length 213
sequence length 213
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4afhA00
4ZRUA 5LG3A 4LMKA 4UM3S 3WTMA 2XNTA 4QABA 2ZJVA 3UU6A 4D01A 2Y58A 5JMEA 2BYPA 3C84A 5HCMA 2WNJA 3JAFA 3RI5A 4HQPA 4X5TA 4AFTA 2XNVA 4TNWA 3WTKA 5AFMA 2VL0A 4A97A 5L47A 2YMEA 3UQ7A 3WTLA 5J0ZA 2BG9A 2XYTA 2XZ6A 3UU3A 2W8FA 5HEJA 3WTHA 3RHWA 5AFLA 4ILAA 4IREA 4QACA 4TWDA 5LXBA 2WZYA 2WN9A 2XQ5A 2XNUA 5HEGA 4EZ1A 5KE4A 4HFDA 3WTJA 2BYRA 4UM3P 5J5HA 3SQ9A 4FRRA 4ILCA 4UXUA 2XQAA 4ZR6A 3TLUA 4QH4A 2X00A 5J5GA 3RQUA 3JADA 3TLVA 4Z90A 4PIRA 2WNCA 4LMJA 3LSVA 5AFNA 5HEHA 1UW6A 2BYQA 2UZ6A 2XQ9A 3SIOA 3ZDGA 4TWHA 5HCJA 3GUAA 2Y7YA 3WTNA 2BR8A 4ZK4A 2QC1B 5CO5A 4B5DA 4BQTA 4QAAA 5HEUA 5J5IA 2BR7A 3U8JA 2YKSA 2X00D 2PGZA 3U8NA 3EHZA 3T4MA 5AFJA 5L4EA 3TLTA 3ZKRA 1I9BA 2WNLA 2YOEA 4BFQA 4Z91A 2YMDA 1UX2A 4ZZBA 3U8MA 3P50A 5TVCA 3TLWA 4IL4A 4QH5A 3TLSA 4ALXA 4NZBA 2YN6A 3EAMA 4XK9A 4ZJTA 5FJVA 5HEOA 5BRXA 4AFGA 4ZZCA 5L4HA 3UU4A 2XQ3A 2Y56A 2BYSA 4IL9A 4WV9A 4ZK1A 3RIAA 4A98A 4TWFA 3RIFA 5AFMB 4XHEA 2W8GA 5BP0A 4ILBA 4TNVA 2BG9B 2XYSA 4ZJSA 3UU8A 4HFEA 3U8KA 2PH9A 3PEOA 5CFBA 4COFA 5SYOA 5IUXA 4HFCA 4HFIA 5J5FA 3UU5A 3WIPA 3JAEA 2BJ0A 4UY2A 3WTIA 4DBMA 4NPPA 5AFHA 3IGQA 3P4WA 3PMZA 3RQWA 4F8HA 5BW2A 3U8LA 2BG9C 4UM1A 3SQ6A 2BG9E 5AINA 5KZUA 2C9TA 3UQ4A 4UM3A 3ZDHA 4HFHA 4HFBA 1UV6A 2XQ6A 4QH1A 4AFHA 5AFKA 3SH1A 2XQ7A 4LMLA 3UUBA 2XQ8A 2XQ4A 3EI0A 2Y57A 3C79A 3WTOA 2ZJUA 2Y54A 2BYNA 2XZ5A
chains in the Genus database with same CATH superfamily
4ZRUA 5LG3A 4LMKA 4UM3S 3WTMA 2XNTA 4QABA 2ZJVA 3UU6A 4D01A 2Y58A 5JMEA 2BYPA 3C84A 5HCMA 2WNJA 3JAFA 3RI5A 4HQPA 4X5TA 4AFTA 2XNVA 4TNWA 3WTKA 5AFMA 2VL0A 4A97A 5L47A 2YMEA 3UQ7A 3WTLA 5J0ZA 2BG9A 2XYTA 2XZ6A 3UU3A 2W8FA 5HEJA 3WTHA 3RHWA 5AFLA 4ILAA 4IREA 4QACA 4TWDA 5LXBA 2WZYA 2WN9A 2XQ5A 2XNUA 5HEGA 4EZ1A 5KE4A 4HFDA 3WTJA 2BYRA 4UM3P 5J5HA 3SQ9A 4FRRA 4ILCA 4UXUA 2XQAA 4ZR6A 3TLUA 4QH4A 2X00A 5J5GA 3RQUA 3JADA 3TLVA 4Z90A 4PIRA 2WNCA 4LMJA 3LSVA 5AFNA 5HEHA 1UW6A 2BYQA 2UZ6A 2XQ9A 3SIOA 3ZDGA 4TWHA 5HCJA 3GUAA 2Y7YA 3WTNA 2BR8A 4ZK4A 2QC1B 5CO5A 4B5DA 4BQTA 4QAAA 5HEUA 5J5IA 2BR7A 3U8JA 2YKSA 2X00D 2PGZA 3U8NA 3EHZA 3T4MA 5AFJA 5L4EA 3TLTA 3ZKRA 1I9BA 2WNLA 2YOEA 4BFQA 4Z91A 2YMDA 1UX2A 4ZZBA 3U8MA 3P50A 5TVCA 3TLWA 4IL4A 4QH5A 3TLSA 4ALXA 4NZBA 2YN6A 3EAMA 4XK9A 4ZJTA 5FJVA 5HEOA 5BRXA 4AFGA 4ZZCA 5L4HA 3UU4A 2XQ3A 2Y56A 2BYSA 4IL9A 4WV9A 4ZK1A 3RIAA 4A98A 4TWFA 3RIFA 5AFMB 4XHEA 2W8GA 5BP0A 4ILBA 4TNVA 2BG9B 2XYSA 4ZJSA 3UU8A 4HFEA 3U8KA 2PH9A 3PEOA 5CFBA 4COFA 5SYOA 5IUXA 4HFCA 4HFIA 5J5FA 3UU5A 3WIPA 3JAEA 2BJ0A 4UY2A 3WTIA 4DBMA 4NPPA 5AFHA 3IGQA 3P4WA 3PMZA 3RQWA 4F8HA 5BW2A 3U8LA 2BG9C 4UM1A 3SQ6A 2BG9E 5AINA 5KZUA 2C9TA 3UQ4A 4UM3A 3ZDHA 4HFHA 4HFBA 1UV6A 2XQ6A 4QH1A 4AFHA 5AFKA 3SH1A 2XQ7A 4LMLA 3UUBA 2XQ8A 2XQ4A 3EI0A 2Y57A 3C79A 3WTOA 2ZJUA 2Y54A 2BYNA 2XZ5A
chains in the Genus database with same CATH topology
4ZRUA 5LG3A 4LMKA 4UM3S 3WTMA 2XNTA 4QABA 2ZJVA 3UU6A 4D01A 2Y58A 5JMEA 2BYPA 3C84A 5HCMA 2WNJA 3JAFA 3RI5A 4HQPA 4X5TA 4AFTA 2XNVA 4TNWA 3WTKA 5AFMA 2VL0A 4A97A 5L47A 2YMEA 3UQ7A 3WTLA 5J0ZA 2BG9A 2XYTA 2XZ6A 3UU3A 2W8FA 5HEJA 3WTHA 3RHWA 5AFLA 4ILAA 4IREA 4QACA 4TWDA 5LXBA 2WZYA 2WN9A 2XQ5A 2XNUA 5HEGA 4EZ1A 5KE4A 4HFDA 3WTJA 2BYRA 4UM3P 5J5HA 3SQ9A 4FRRA 4ILCA 4UXUA 2XQAA 4ZR6A 3TLUA 4QH4A 2X00A 5J5GA 3RQUA 3JADA 3TLVA 4Z90A 4PIRA 2WNCA 4LMJA 3LSVA 5AFNA 5HEHA 1UW6A 2BYQA 2UZ6A 2XQ9A 3SIOA 3ZDGA 4TWHA 5HCJA 3GUAA 2Y7YA 3WTNA 2BR8A 4ZK4A 2QC1B 5CO5A 4B5DA 4BQTA 4QAAA 5HEUA 5J5IA 2BR7A 3U8JA 2YKSA 2X00D 2PGZA 3U8NA 3EHZA 3T4MA 5AFJA 5L4EA 3TLTA 3ZKRA 1I9BA 2WNLA 2YOEA 4BFQA 4Z91A 2YMDA 1UX2A 4ZZBA 3U8MA 3P50A 5TVCA 3TLWA 4IL4A 4QH5A 3TLSA 4ALXA 4NZBA 2YN6A 3EAMA 4XK9A 4ZJTA 5FJVA 5HEOA 5BRXA 4AFGA 4ZZCA 5L4HA 3UU4A 2XQ3A 2Y56A 2BYSA 4IL9A 4WV9A 4ZK1A 3RIAA 4A98A 4TWFA 3RIFA 5AFMB 4XHEA 2W8GA 5BP0A 4ILBA 4TNVA 2BG9B 2XYSA 4ZJSA 3UU8A 4HFEA 3U8KA 2PH9A 3PEOA 5CFBA 4COFA 5SYOA 5IUXA 4HFCA 4HFIA 5J5FA 3UU5A 3WIPA 3JAEA 2BJ0A 4UY2A 3WTIA 4DBMA 4NPPA 5AFHA 3IGQA 3P4WA 3PMZA 3RQWA 4F8HA 5BW2A 3U8LA 2BG9C 4UM1A 3SQ6A 2BG9E 5AINA 5KZUA 2C9TA 3UQ4A 4UM3A 3ZDHA 4HFHA 4HFBA 1UV6A 2XQ6A 4QH1A 4AFHA 5AFKA 3SH1A 2XQ7A 4LMLA 3UUBA 2XQ8A 2XQ4A 3EI0A 2Y57A 3C79A 3WTOA 2ZJUA 2Y54A 2BYNA 2XZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZRU A;  5LG3 A;  4LMK A;  4UM3 S;  3WTM A;  2XNT A;  4QAB A;  2ZJV A;  3UU6 A;  4D01 A;  2Y58 A;  5JME A;  2BYP A;  3C84 A;  5HCM A;  2WNJ A;  3JAF A;  3RI5 A;  4HQP A;  4X5T A;  4AFT A;  2XNV A;  4TNW A;  3WTK A;  5AFM A;  2VL0 A;  4A97 A;  5L47 A;  2YME A;  3UQ7 A;  3WTL A;  5J0Z A;  2BG9 A;  2XYT A;  2XZ6 A;  3UU3 A;  2W8F A;  5HEJ A;  3WTH A;  3RHW A;  5AFL A;  4ILA A;  4IRE A;  4QAC A;  4TWD A;  5LXB A;  2WZY A;  2WN9 A;  2XQ5 A;  2XNU A;  5HEG A;  4EZ1 A;  5KE4 A;  4HFD A;  3WTJ A;  2BYR A;  4UM3 P;  5J5H A;  3SQ9 A;  4FRR A;  4ILC A;  4UXU A;  2XQA A;  4ZR6 A;  3TLU A;  4QH4 A;  2X00 A;  5J5G A;  3RQU A;  3JAD A;  3TLV A;  4Z90 A;  4PIR A;  2WNC A;  4LMJ A;  3LSV A;  5AFN A;  5HEH A;  1UW6 A;  2BYQ A;  2UZ6 A;  2XQ9 A;  3SIO A;  3ZDG A;  4TWH A;  5HCJ A;  3GUA A;  2Y7Y A;  3WTN A;  2BR8 A;  4ZK4 A;  2QC1 B;  5CO5 A;  4B5D A;  4BQT A;  4QAA A;  5HEU A;  5J5I A;  2BR7 A;  3U8J A;  2YKS A;  2X00 D;  2PGZ A;  3U8N A;  3EHZ A;  3T4M A;  5AFJ A;  5L4E A;  3TLT A;  3ZKR A;  1I9B A;  2WNL A;  2YOE A;  4BFQ A;  4Z91 A;  2YMD A;  1UX2 A;  4ZZB A;  3U8M A;  3P50 A;  5TVC A;  3TLW A;  4IL4 A;  4QH5 A;  3TLS A;  4ALX A;  4NZB A;  2YN6 A;  3EAM A;  4XK9 A;  4ZJT A;  5FJV A;  5HEO A;  5BRX A;  4AFG A;  4ZZC A;  5L4H A;  3UU4 A;  2XQ3 A;  2Y56 A;  2BYS A;  4IL9 A;  4WV9 A;  4ZK1 A;  3RIA A;  4A98 A;  4TWF A;  3RIF A;  5AFM B;  4XHE A;  2W8G A;  5BP0 A;  4ILB A;  4TNV A;  2BG9 B;  2XYS A;  4ZJS A;  3UU8 A;  4HFE A;  3U8K A;  2PH9 A;  3PEO A;  5CFB A;  4COF A;  5SYO A;  5IUX A;  4HFC A;  4HFI A;  5J5F A;  3UU5 A;  3WIP A;  3JAE A;  2BJ0 A;  4UY2 A;  3WTI A;  4DBM A;  4NPP A;  5AFH A;  3IGQ A;  3P4W A;  3PMZ A;  3RQW A;  4F8H A;  5BW2 A;  3U8L A;  2BG9 C;  4UM1 A;  3SQ6 A;  2BG9 E;  5AIN A;  5KZU A;  2C9T A;  3UQ4 A;  4UM3 A;  3ZDH A;  4HFH A;  4HFB A;  1UV6 A;  2XQ6 A;  4QH1 A;  4AFH A;  5AFK A;  3SH1 A;  2XQ7 A;  4LML A;  3UUB A;  2XQ8 A;  2XQ4 A;  3EI0 A;  2Y57 A;  3C79 A;  3WTO A;  2ZJU A;  2Y54 A;  2BYN A;  2XZ5 A; 
#chains in the Genus database with same CATH topology
 4ZRU A;  5LG3 A;  4LMK A;  4UM3 S;  3WTM A;  2XNT A;  4QAB A;  2ZJV A;  3UU6 A;  4D01 A;  2Y58 A;  5JME A;  2BYP A;  3C84 A;  5HCM A;  2WNJ A;  3JAF A;  3RI5 A;  4HQP A;  4X5T A;  4AFT A;  2XNV A;  4TNW A;  3WTK A;  5AFM A;  2VL0 A;  4A97 A;  5L47 A;  2YME A;  3UQ7 A;  3WTL A;  5J0Z A;  2BG9 A;  2XYT A;  2XZ6 A;  3UU3 A;  2W8F A;  5HEJ A;  3WTH A;  3RHW A;  5AFL A;  4ILA A;  4IRE A;  4QAC A;  4TWD A;  5LXB A;  2WZY A;  2WN9 A;  2XQ5 A;  2XNU A;  5HEG A;  4EZ1 A;  5KE4 A;  4HFD A;  3WTJ A;  2BYR A;  4UM3 P;  5J5H A;  3SQ9 A;  4FRR A;  4ILC A;  4UXU A;  2XQA A;  4ZR6 A;  3TLU A;  4QH4 A;  2X00 A;  5J5G A;  3RQU A;  3JAD A;  3TLV A;  4Z90 A;  4PIR A;  2WNC A;  4LMJ A;  3LSV A;  5AFN A;  5HEH A;  1UW6 A;  2BYQ A;  2UZ6 A;  2XQ9 A;  3SIO A;  3ZDG A;  4TWH A;  5HCJ A;  3GUA A;  2Y7Y A;  3WTN A;  2BR8 A;  4ZK4 A;  2QC1 B;  5CO5 A;  4B5D A;  4BQT A;  4QAA A;  5HEU A;  5J5I A;  2BR7 A;  3U8J A;  2YKS A;  2X00 D;  2PGZ A;  3U8N A;  3EHZ A;  3T4M A;  5AFJ A;  5L4E A;  3TLT A;  3ZKR A;  1I9B A;  2WNL A;  2YOE A;  4BFQ A;  4Z91 A;  2YMD A;  1UX2 A;  4ZZB A;  3U8M A;  3P50 A;  5TVC A;  3TLW A;  4IL4 A;  4QH5 A;  3TLS A;  4ALX A;  4NZB A;  2YN6 A;  3EAM A;  4XK9 A;  4ZJT A;  5FJV A;  5HEO A;  5BRX A;  4AFG A;  4ZZC A;  5L4H A;  3UU4 A;  2XQ3 A;  2Y56 A;  2BYS A;  4IL9 A;  4WV9 A;  4ZK1 A;  3RIA A;  4A98 A;  4TWF A;  3RIF A;  5AFM B;  4XHE A;  2W8G A;  5BP0 A;  4ILB A;  4TNV A;  2BG9 B;  2XYS A;  4ZJS A;  3UU8 A;  4HFE A;  3U8K A;  2PH9 A;  3PEO A;  5CFB A;  4COF A;  5SYO A;  5IUX A;  4HFC A;  4HFI A;  5J5F A;  3UU5 A;  3WIP A;  3JAE A;  2BJ0 A;  4UY2 A;  3WTI A;  4DBM A;  4NPP A;  5AFH A;  3IGQ A;  3P4W A;  3PMZ A;  3RQW A;  4F8H A;  5BW2 A;  3U8L A;  2BG9 C;  4UM1 A;  3SQ6 A;  2BG9 E;  5AIN A;  5KZU A;  2C9T A;  3UQ4 A;  4UM3 A;  3ZDH A;  4HFH A;  4HFB A;  1UV6 A;  2XQ6 A;  4QH1 A;  4AFH A;  5AFK A;  3SH1 A;  2XQ7 A;  4LML A;  3UUB A;  2XQ8 A;  2XQ4 A;  3EI0 A;  2Y57 A;  3C79 A;  3WTO A;  2ZJU A;  2Y54 A;  2BYN A;  2XZ5 A; 
#chains in the Genus database with same CATH homology
 4ZRU A;  5LG3 A;  4LMK A;  4UM3 S;  3WTM A;  2XNT A;  4QAB A;  2ZJV A;  3UU6 A;  4D01 A;  2Y58 A;  5JME A;  2BYP A;  3C84 A;  5HCM A;  2WNJ A;  3JAF A;  3RI5 A;  4HQP A;  4X5T A;  4AFT A;  2XNV A;  4TNW A;  3WTK A;  5AFM A;  2VL0 A;  4A97 A;  5L47 A;  2YME A;  3UQ7 A;  3WTL A;  5J0Z A;  2BG9 A;  2XYT A;  2XZ6 A;  3UU3 A;  2W8F A;  5HEJ A;  3WTH A;  3RHW A;  5AFL A;  4ILA A;  4IRE A;  4QAC A;  4TWD A;  5LXB A;  2WZY A;  2WN9 A;  2XQ5 A;  2XNU A;  5HEG A;  4EZ1 A;  5KE4 A;  4HFD A;  3WTJ A;  2BYR A;  4UM3 P;  5J5H A;  3SQ9 A;  4FRR A;  4ILC A;  4UXU A;  2XQA A;  4ZR6 A;  3TLU A;  4QH4 A;  2X00 A;  5J5G A;  3RQU A;  3JAD A;  3TLV A;  4Z90 A;  4PIR A;  2WNC A;  4LMJ A;  3LSV A;  5AFN A;  5HEH A;  1UW6 A;  2BYQ A;  2UZ6 A;  2XQ9 A;  3SIO A;  3ZDG A;  4TWH A;  5HCJ A;  3GUA A;  2Y7Y A;  3WTN A;  2BR8 A;  4ZK4 A;  2QC1 B;  5CO5 A;  4B5D A;  4BQT A;  4QAA A;  5HEU A;  5J5I A;  2BR7 A;  3U8J A;  2YKS A;  2X00 D;  2PGZ A;  3U8N A;  3EHZ A;  3T4M A;  5AFJ A;  5L4E A;  3TLT A;  3ZKR A;  1I9B A;  2WNL A;  2YOE A;  4BFQ A;  4Z91 A;  2YMD A;  1UX2 A;  4ZZB A;  3U8M A;  3P50 A;  5TVC A;  3TLW A;  4IL4 A;  4QH5 A;  3TLS A;  4ALX A;  4NZB A;  2YN6 A;  3EAM A;  4XK9 A;  4ZJT A;  5FJV A;  5HEO A;  5BRX A;  4AFG A;  4ZZC A;  5L4H A;  3UU4 A;  2XQ3 A;  2Y56 A;  2BYS A;  4IL9 A;  4WV9 A;  4ZK1 A;  3RIA A;  4A98 A;  4TWF A;  3RIF A;  5AFM B;  4XHE A;  2W8G A;  5BP0 A;  4ILB A;  4TNV A;  2BG9 B;  2XYS A;  4ZJS A;  3UU8 A;  4HFE A;  3U8K A;  2PH9 A;  3PEO A;  5CFB A;  4COF A;  5SYO A;  5IUX A;  4HFC A;  4HFI A;  5J5F A;  3UU5 A;  3WIP A;  3JAE A;  2BJ0 A;  4UY2 A;  3WTI A;  4DBM A;  4NPP A;  5AFH A;  3IGQ A;  3P4W A;  3PMZ A;  3RQW A;  4F8H A;  5BW2 A;  3U8L A;  2BG9 C;  4UM1 A;  3SQ6 A;  2BG9 E;  5AIN A;  5KZU A;  2C9T A;  3UQ4 A;  4UM3 A;  3ZDH A;  4HFH A;  4HFB A;  1UV6 A;  2XQ6 A;  4QH1 A;  4AFH A;  5AFK A;  3SH1 A;  2XQ7 A;  4LML A;  3UUB A;  2XQ8 A;  2XQ4 A;  3EI0 A;  2Y57 A;  3C79 A;  3WTO A;  2ZJU A;  2Y54 A;  2BYN A;  2XZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...