4AFIA

Complex between vamp7 longin domain and fragment of delta-adaptin from ap3
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
155
structure length
155
Chain Sequence
TPGVEHIPVVQIDLSVPLKVPGLPMSDQYVKLEEAMAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFSFLNEVKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of the Intracellular Sorting of the Snare Vamp7 by the Ap3 Adaptor Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis
molecule keywords AP-3 COMPLEX SUBUNIT DELTA-1, VESICLE-ASSOCIATED MEMBRANE PR
total genus 40
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4afiA00
2DMWA 1IFQA 2NUPC 4B93A 3EGXC 1IOUA 3EGDC 3BW6A 2VX8A 3KYQA 2NUTC 4AFIA 1H8MA
chains in the Genus database with same CATH superfamily
5EVLA 3G2YA 4MCWA 4II7A 3MQOA 4Y3IA 2PDRA 3ZVTA 4OQ0A 1BZAA 3HVFA 1H0MA 4DKIA 2UWXA 1K54C 2FFFB 2MJ6A 4MNRA 1ERQA 4WMCD 4UAAA 5GLBA 1V9ZA 2H10A 1FILA 2JN7A 4EW7A 4XUXA 3MKFA 1KE4A 1BLHA 4PPRA 5IT5A 1MWUA 3ZFZA 4GJ4A 4X69A 1XGJA 2P04A 1IELA 1XFQA 1IKGA 2O9AA 3K2NA 1XXMA 3S7QA 4GD6A 3B47A 1DJCA 4EETB 1Y28A 3HUMA 3I7JA 3Q07A 2ZLYA 5E2FA 3K3DA 4BQMA 4K08A 3IF6B 1K6RA 3IH8A 2X71A 4LPZA 2GNXA 1W5DA 1PYYA 2KOIA 5HFOA 1DP8A 5KSHA 1HLUP 2QHKA 1K56D 3NECA 3F1NA 5GHXA 4C3QA 4I5SA 4QHCA 3K3CA 1XJ4A 3FG8A 4P85A 1ERMA 4JXGA 3VP4A 4Q8IA 1XJ3A 5EVIB 4OKPA 4YWZA 2L1MA 2P9VA 4Y17A 3RH8B 3FPVA 4KZ4A 1A0KA 1JNUA 3GV9A 1DY6A 1NWZA 2WADA 1OTIA 3QHYA 3UDIA 1KE0A 4WBGA 5G18A 1G28A 1S1YA 1ACFA 4E6WA 3UE3A 4B88A 3UMEA 4E3KA 3A3EA 3MKEA 5DKKA 3TJZC 1YLWA 3QP6A 4U0TA 1IFQA 3Q82A 5FATA 1K56A 4PM7A 4CPKA 4FUWA 2J3WA 2W1TA 1VHMA 5GL9A 2W0NA 3G32A 3GVBA 5EOOA 4CJNA 4YINA 4R1GA 3MBZA 4GCZA 2B18A 2HP9A 4ZTKA 2PD8A 3UB7A 3NJAA 4JXSA 1NJ4A 1PIOA 2M7UA 5FEGA 1NRJA 2Y59A 1C3BA 2Y2NA 3KYZA 3A3IA 1ONGA 2PBDP 2XFTA 2O9BA 1XA7A 2ZL1B 4GDBA 3PAEA 3E98A 4OQIA 5A91A 1T18A 4ZJ1A 3CJMA 2E8IA 4MN6A 4DE1A 3S7OA 1T1BA 3FYZA 2BASA 2JKRI 4ZJ3A 5EOEA 4ID4A 1PNEA 2OLUA 5TBMB 3P09A 2I72A 5HX9A 4OQGA 2M7VA 3W8KA 2EFUA 3BLMA 2HJ9C 1LL9A 2G2WA 1NRFA 2VJWA 3PAGA 3Q1FA 3ZG9B 1DJBA 2Y2PA 3OLOA 1I5QA 5FQ9A 4EEPA 2XR0A 1VETA 4P87A 3MZFA 4CLCE 3ZG8B 3WS4A 4EQ1A 4UQIM 5AQ7A 5J4EA 1BT5A 3BM6A 4DRTA 5HSQA 2R78A 2V8FA 3EQUA 4R0QA 1L0GA 2PU2A 3P98A 4KQOA 3T50A 5M1AA 4HJ6A 3VP3A 4GNUA 1MWRA 2WGWB 1KVLA 1MWSA 3LICA 1ESIA 4D60A 4Y2FA 3C2WA 2VKSA 4GN2A 3R7WA 4OP8A 1SKOA 5EVIC 3IQAA 3MR0A 3C30A 1Q2QA 4IUKA 3T4OA 2INWA 1K55A 2V0WA 5CHMA 3TSGA 3HJKA 3C38A 1KDWA 2LB5A 3O3VA 4Q0HA 2O9CA 3CHWP 3CPTA 1IEMA 3IX8A 2ZM8A 4EERA 5IS1A 1GSVA 3LIFA 4LFUA 4ESPA 2PYPA 1BULA 3BFDA 1MWTA 1BYWA 1G6AA 4PAUA 4OVDA 2XF3A 2QZ6A 2XFSA 4JGQA 4BL2A 4P0MA 3C7VA 5HAIA 1BSGA 3PR6A 3HLFA 4OPRA 2O0YA 1V9YA 4P6ZM 4OLDA 5DFXA 1J9MA 4GS9B 4HBUA 4WEKA 3IWQA 2HDUA 5KSCA 5FAOA 2WUQA 4XT2B 3MQ0A 1IKIA 4ETXA 1JWVA 4JGOA 4QD4A 3E4QA 4MBKA 3EGXC 3KYQA 3B42A 3BY8A 5HZHA 3WWXA 3HLEA 2Z2LB 4R3BA 4XXRA 1JTGA 1OJGA 4DF6A 1K6SA 5FDHA 3A3DA 2Z6DA 1IYSA 4FH4A 4Q0JA 2GX5A 3N8SA 3T1SA 4B4XA 1TD5A 2CC1A 1MXOA 1H8MA 2P7JA 4EUVA 1PZOA 5E2GA 2IWCA 4DE3A 3IS2A 2HJEA 5DVAA 3NCKA 3G35A 1L3LA 4X1LA 1YQSA 2Y4AA 4R3JA 1XP4A 3NDGA 5CXWA 3CWFA 2IWDA 2LB9A 1GA9A 2ZQ7A 1Y4OA 1YM1A 2RCXA 5FSRA 4PM5A 2WGIA 5FEFA 4ME4A 2ZM2A 1M6KA 1S66L 4HP9A 3SZTA 5J7EA 4OH0A 4NK3A 2M1CA 1W7FA 5J3WA 1XA1A 3VOLA 5A93A 2HV1A 3S7PA 1VEUB 3DTEA 1VEUA 3N8RA 3ZDJA 2QJ7A 3S4XA 5F82A 3IF6C 2WYXA 4K0WA 3FV7A 4ZJ2A 5KZHA 3NOPC 4NXGA 1D7EA 1H8YA 2Q9MA 5HWWA 1OPXA 1S1ZA 1PW1A 5M18A 1I2SA 3QP4A 3LO7A 5HARA 1ZKJA 5AQBA 3O87A 2V8CA 4NXBA 3V5MA 3CI6A 4DE0A 3IT9A 2KLIA 1PI4A 2XA7S 5F69A 4X56A 4WN5A 2HZ5A 3NDEA 1MPLA 4S2LA 2BTFP 4S2OA 1GHPA 1UWPX 4OPZA 5BOHA 4KZBA 5EM1A 4BBUA 3WRTA 3RTYA 1XJ6A 5L10A 2AVXA 2HP5A 1IYOA 2VK3A 2ZL1A 3H82B 1BLSA 3PBOA 3CUEA 3DTMA 3G4PA 5CECA 1GSXA 1JVJA 5L2FA 3MXSA 3N4IA 2HDSA 1PRQA 2Y2IA 2XH9A 5TGFA 1VETB 4D2OA 1TDGA 3ULFA 3UE0A 3M2KA 3W4QA 5MC7A 2PHYA 1KE3A 4LV0A 3IX3A 1LL5A 4KUKA 2L4RA 2J9OA 2VGLS 4MBFA 3WRZA 4DE2A 3PBTA 1K4EA 4LCLA 1K55C 1K38A 4Y7PA 3MZDA 3QP5A 4DJ3A 2WGVA 2WKPA 2ZC7A 1MZUA 4WUJA 4I3AA 3LR3A 4WL9A 3LR4A 4ZBEA 4S2PA 2ZC5B 2HGVA 2WGWA 4ZDXA 1HZOA 3TOIA 3D4FA 1FR1A 2P9VB 3ZVWA 1YSPA 3LFVA 2QJ5A 3UN7A 4XUZA 1G68A 4P6BA 1YMXA 3CAXA 2Y2KA 2E8JA 1GHMA 2A24B 3KSIA 1MY8A 4I3JA 1QMEA 3MXQA 3IBRA 1M40A 3P01A 3C8CA 4NETA 3IHAA 5CGWA 2ACGA 5FQQA 1P97A 1RP5A 4BENA 3HL9A 3UNWA 5CGSA 2V9AA 3KSGA 3Q7VA 1TF1A 4KZ8A 3TW8A 3T1XA 2Y2OA 3Q81A 4HESA 1F98A 2HDQA 2EX9A 3JPUA 3ICYA 4JF5A 2XRNA 1LI0A 2Q9NA 3P7NA 5L07A 2ZBBA 4F94A 1ZC2A 3IX4A 3BQAA 4IHQA 4GDNA 1E4DA 4BBVA 5EV0A 1CI8A 1TEMA 3MXRA 4UA9A 2J80A 1BLPA 2FZ0A 3DTKA 3LCEA 3JVVA 2V1ZA 3PBNA 1NLYA 2EXBA 1YPRA 4RX2A 4P6ZS 1W8QA 1CI9A 1XX2A 3T12B 4HJ3A 4E6XA 1SHVA 3V39A 4O01A 3BFCA 2D02A 3T4QA 5A8BA 3DW0A 4OQHA 2H0YA 2J9PA 4ZRRA 4B9OA 3LIBA 4OOMA 4H6JB 5A90A 4HQAA 3F1PB 3T4KA 5FASA 2J7VA 1ALQA 5FDSA 1Z6FA 4JXVA 2W1RA 2ZJ9A 3KSHA 5DJUA 3SH8A 3MMHA 2K7SA 3FZCA 1ES5A 3OPRA 4Q0IA 1CQAA 5EUAA 1HTZA 3WS1A 2WKIA 3IWIA 3T1QB 5KIZA 1D06A 3JVUA 1ES4A 3CZDA 3NHQA 2VGJA 5HPIA 1H8ZA 4UA7A 4G3VA 1GCEA 5FAQA 1G5UA 4LRZE 3GR2A 3BLSA 1H3QA 2QMIA 1QMFA 3HUNA 3JYIA 2JKGA 2EFXA 1VB6A 3T4LA 1MBLA 5FAPA 1HD8A 2VV8A 5E2EA 2WAEA 4BWIA 1NLZA 4RX3A 5JYPA 4WLAA 2W1TB 1FR6A 2A24A 3DBAA 5EVID 3VSLA 3BECA 3W4PA 3HLWA 3SW1A 2JKRM 4JGRA 1JWZA 4MBHA 5C5KA 4WZ5C 3NY4A 2WKEA 4JF6A 5GHZA 1L0EA 5U47A 3N8LA 1YSQA 4R70A 3G31A 4HIAA 1KGFA 3HLGA 4R4SA 2P08A 3L9KA 4UHUA 1LSWA 4GHIA 2CMNA 4FH2A 1NYMA 4O7DA 5FL3A 3UB8A 5EVEA 4MDZA 1E25A 5EPHA 2K2NA 3GECA 4OPQA 3E2KA 3UY6A 5FQJA 4U3TA 3WS2A 4BL3A 1DJAA 4OP5A 3VE3A 4I39A 3CPTB 4X25A 1UGUA 4HEFA 2OAQ1 4GKUA 4Y15A 5E2HA 4LV1A 3PTEA 2DNSA 3V67A 2XK1A 3VE4A 1OTDA 4CLCB 1XKZA 2W3FA 4B4ZA 4X1MA 3PHYA 3KYEA 1VM1A 1S67L 4JLFA 4R4RA 4PM8A 1E3UD 3LY4A 5DJTA 4E3MA 1WYCA 2OAP1 1MKMA 1N4OA 3KSFA 4O0PA 2VZWA 5A92A 4I3IA 3F1OA 2V1AA 2VEAA 1K4FA 3F1NB 3SS4A 2XD5A 1DP9A 3FC7A 2NUTC 5KMWA 3QNCA 3PYPA 3ZG0A 1ZHHB 1KVMA 3HLBA 3IXHA 1EWZA 3A3JA 2ZMVA 2W3GA 3PBRA 2D01A 4HH3A 2IA2A 3DAVA 3QP8A 5CGXA 5EFWA 4OOLA 4Z1WA 2DCFA 3VP2A 3VOZA 2FFYA 3IXDA 3IF5A 5TR7A 5DFYA 1T1AA 1XPBA 4NXEA 2ZQCA 1H5XA 3IS2B 1GHIA 2EWVA 4B93A 5FQMA 3FPWA 1XJ2A 3UDXA 2XROA 5E43A 2B02A 4ETZA 4C6YA 4HH2A 1LSVA 3M6BA 3S22A 3EEHA 1AWIA 2W3EA 3E2LA 5HWTA 5GLAA 3UB6A 2I9VA 5M19A 3OZHA 5F83A 2WZXA 3ITAA 2RL3A 1YLYA 1FIKA 5L09A 1K57A 3G34A 1EROA 3LIAA 4Y0TA 1FCMA 4EWFA 2ZOIA 4X6TA 4BBTA 5HW3A 4N9KA 3ZNTA 3CMZA 4UA6A 2ZM0A 2ZOHA 4MEZA 3UPPA 5G4YA 3C7UA 1STZA 1SKFA 4KG2A 5F5YA 2ZMFA 2GDNA 2X02A 3LR5A 2V1BA 2Y55A 5J8XA 1YLJA 2VV7A 5FA7A 3D9YA 3HJIA 5CERA 2H0TA 2W27A 1J3WA 4RYEA 3MF0A 3ZNYA 3B33A 4LENA 3VFFA 4E3JA 4GD8A 2KDKA 1JTDA 3F1PA 2IWBA 3SS5A 1RCJA 2PYRA 4S2MA 4OPYA 3ZHHA 5L8MA 5DKLA 2A49A 2QPNA 1SDEA 3U4LP 2VGKA 2DRWA 2VLGA 3UMDA 3MSHA 4KZ5A 3H9WA 1IYQA 4S2NC 4O8GA 4X68A 4WZ5A 2ZQ8A 4GW9A 3A0RA 1I2WA 1F2KA 3UO9A 2WKHA 1ES3A 3BFGA 5FI2A 3Q7ZA 4PHTA 3T4JA 3W4OA 2Q0OA 5K5BA 4DJ2A 4EEUA 1TS7A 1N9OA 2JKFA 2PR5A 4WMCA 3C4PA 4YOFA 3V50A 1YKDA 3LY3A 2PU4A 5I94A 1EI5A 4HNBA 3NI9A 5CTMA 4GS9A 1TS6A 2HP6A 5FQIA 1T1CA 4IUHA 4QB8A 1K25A 5F6AA 3G6OA 3E0YA 3HCYA 1NZOA 4EBPA 2GZAA 3H7WB 3NIAA 2XDMA 4WM9A 1OJ5A 3IXBA 2DMWA 4WEJA 1HVBA 3BRMA 3MQQA 2Y8HA 5HDSA 4L0LA 5FI6A 5CEDA 2EXAA 1CEGA 4BMWA 3NULA 2Y2QA 1P9RA 1ZG6A 5HPFA 4IEDA 2VA0A 1FQGA 4QWOA 1Y54A 5DTTA 2QYBA 5IHVA 4F3LA 4KENB 2ZC4B 4F3LB 3G2ZA 4N92A 4FSFA 4LRYC 4DN0A 3VP1A 1N9BA 3EGDC 3RJUA 1U60A 3C4OA 4JKTA 5F68A 1Q2PA 3VMAA 3FKWA 3SOIA 3T4SA 3LYXA 3ZCZA 1L0DA 1TS0A 3EEAA 5GHYA 3EWKA 1TDLA 4Y0OA 5DF8A 1ZG4A 4QY6A 4YNRA 2OV5A 4GOGA 3FKVA 2V2FF 4PKYG 2WK0A 3A3FA 3H82A 2WKRA 3W2ZA 3DWZA 3SS3A 4JXWA 1FOFA 4QU3A 2X01A 4WELA 1FSWA 3GSGA 3T1RA 3BWLA 3E4OA 4M3KA 1OMEA 1MKIA 3O86A 4MLLA 2JKTM 4HY8A 3KX0X 3MJQA 3T4TA 1S4SA 2ZQDA 3OOVA 4Y0UA 1W79A 4S2NA 5EECA 1BLCA 2Y91A 4WZ4A 2HDRA 5EVIA 1IOUA 3AGDA 5FI7A 4QJGA 2OSUA 3HLCA 2XA7M 4MN7A 5CHJA 4HP4A 5CHUA 2JBFA 3A0VA 1SDNA 1VQQA 4ARZA 2UV0E 1G6OA 2W3HA 2XD1A 1OT6A 2YKHA 3MFDA 4E3NA 1YLZA 3DTIA 3VSKA 2OWJA 3KO6A 3LIDA 3C5AA 1PZPA 4E3OA 4DXCA 2PR6A 4EBLA 3PBSA 4FCFA 3G30A 1RGYA 3AGFA 1RGZA 1TS8A 4OONA 5DF9A 1YAXA 1L2SA 3HBRA 1D1JA 4UEYA 4WF0A 4PMAA 3GTCA 2EX6A 2XLNA 3D3OA 3LEZA 4KG5A 4Z9QA 1JWPA 2QKPA 2XSSA 4NEED 2WKQA 3ZG7B 1E3UA 3LI9A 3RFBA 2XQZA 1P0ZA 1N9NA 1LSXA 4X53A 4NG2A 3L7HA 3BQ8A 4LRXC 2Z6CA 5TFQA 1X0OA 4FTXA 3S1YA 1ZTUA 4EU0A 1CEFA 5EM0A 1KOUA 4LV3A 1KGEA 2PT7A 1F9IA 1PI5A 1EW0A 3EQVA 4EV4A 1XFNA 5GLDA 4LLOB 4E04A 4ZAMA 4FD8A 3VP0A 1OT9A 1SKOB 5DTKA 1N9LA 2HF6A 3QP2A 4BD1A 1S4RA 3IWOA 2A3UA 3R4KA 4S2IA 1NYYA 3NC8A 3RXWA 5IU1A 3O88A 4HOIA 1WYBA 3IHBA 3GDIA 1NY0A 1ONHA 4S2JA 3E4PA 5I5LA 2NUPC 2JHEA 2G7UA 4K91A 5HWVA 4EUZA 5CX7A 1FCNA 3OCLA 3AGEA 3VV4A 4GB7A 5HDDA 1YT4A 5TJJA 1K54A 1XGIA 2ZD8A 2YKFA 3EOIA 2J3TD 4KUOA 4KZ9A 4HHDA 3ITBA 4JF4A 1YMSA 5HAQA 3PXPA 4R38A 1ESUA 1F5MA 3UDFA 3TE8A 1SCWA 3MZEA 5DTSA 3HLDA 3IF6A 4E3LA 3LIEA 1OTAA 2ZC3B 3QNBA 1TVFA 2PD7A 4KZ3A 4R3AA 3Q7VB 3TRCA 2Y2JA 1BUEA 2ZQAA 3UPNA 3DWKA 3OCNA 2ZMAA 3LI8A 3LUQA 1NZUA 3CITA 4KQDA 4IBRA 4IJGA 4DDSA 3VOYA 4JPMA 1K57C 1S6RA 4KZ6A 2OLVA 4H6JA 4L9GA 2JKTI 4GLQA 1W63Q 2WZZA 1S0WA 3GQZA 3B3XA 3UPOA 2EX8A 4EQIA 3UE6A 3O5YA 1LI9A 4LV2A 3ZYTA 4G3KA 3LR0A 2B95A 3GMWA 1FSYA 3TG9A 3BYDA 4N1XA 1DRMA 4KZ7A 1CJFA 1PFLA 1PWCA 1GA0A 3ISGA 1YLTA 5AQ9A 4XT2A 4KQQA 4WYYA 5AJGA 5G4ZA 4BJPA 1OTEA 3BFEA 1O7EA 3BW6A 2XGNA 4NKPA 4E3IA 3OC2A 3IXGA 1LT0A 2V0UA 2A2LA 3V3RA 4L9EA 1W63M 2V20A 5CRFA 2Y2LA 4YFMA 4AFIA 4PKYA 1CK3A 5HDCA 3ZGAB 2GJ3A 2C5WB 3WS5A 1IYPA 3WS0A 2Y2GA 2EA9A 4PM6A 3RXXA 4CQHA 2P74A 4DXBA 3M6HA 2JCHA 5JYOA 4PM9A 3BY9A 4DMZA 4CLCC 5F1FA 2PAVP 3UE1A 2VX8A 4EESA 1DP6A 4X55A 3MS6A 3NOUC 5HD5A 2ZQ9A 4GHIB 4S2KA 3UB9A 3VFHA 3IH9A 3U2AA 3N6IA 2PRFA 4IBXA 3H7WA 2J8YA 1K0KA 1YLPA 2H28A 4UQIS 4HI4A 2Y2MA 5AVFA 5CTNA 1WE4A 2ZC6B 3LEQA 4Y13A 1P9WA 1BTLA 1O07A 2XEPA 4C75A 3R7WB 1AXBA 2O99A 4KG6A 5FQKA 3A0SA 3FWLA 2VGLM 4N9LA 2H5SA 2OOLA 3MFXA 3ZG5A 5TBMA 3D72A 4H8RA 1WA9A 3QP1A 3CUEC 1SZVA 3NBLA 4JGPA 3SH7A 4NXFA 2J3TC 4BD0A 2R9XA 1PWDA 4HBTA 1PW8A 2W3DA 3BEBA 4G3WA 2WAFA 3CG5A 3GRJA 3BJNA 2L0WA 1PWGA 3ZQ5A 3BFFA 3UB5P 1L0FA 4K0XA 4JBFA 1KGGA 4MN5A 4RVAA 4EBNA 1MC0A 4CLCD 3F1OB 2EWWA 1W8YA 2K31A 3OPLA 2B5RA 4A5RA 3IBJA 3SH9A 4EXOA 1Z09A 4GZBA 5GLCA 4RA7A 4R6LA 5EE8A 4U0XA 4OLGA 1GSWA 4R23A 1UWNX 4OOYA 4MMNA 1OTBA 3CLOA 3OPHA 1ODVA 5DF7A 1NXYA 4LCMA 3OBFA 1CF0A 3V3SA 3S7NA 5HAPA 1ES2A 1LL8A 2QWSA 2Y2HA 3HREA 2EX2A 2FH5A 4KZAA 3N7WA 5LBRA 4RQ9A 2R9WA 3HUOA 4BLMA 5F1GA 2G2UA 3NOTC 1LLBA 5HL1A 2BLSA 2KX6A 5D3OA 2JC7A 2VV6A 4ARZB 1KDSA 2OWHA 2C6WB 1LHYA 3M2JA 4N1HA 5AQAA 2Y79A 5HL6A 2PBYA 4IVKA 2Z2MB 3PBQA 3OPPA 4Y5FA 4CLCA 4LGWA 4IVIA 5AVEA 2BG1A 1FCOA 4FOFA 4DDYA 2HPBA 4HJ4A 4I38A 2JE5A 4QY5A 4QPRA 5CEBA 4M4XA 1T19A 3LGOA 4L9FA 5HD3A 4KQRA
chains in the Genus database with same CATH topology
1OJGA 4HP4A 3A0VA 4GHIA 4ARZA 2CMNA 1G6OA 2W3HA 5FL3A 4MCWA 1OT6A 3UB8A 4II7A 2YKHA 3MQOA 4MDZA 2Z6DA 4Y3IA 2PDRA 4Q0JA 2OWJA 2GX5A 3KO6A 3LIDA 2K2NA 3GECA 2PR6A 1TD5A 3PBSA 1H8MA 2P7JA 3VE3A 1TS8A 5DF9A 1YAXA 4EUVA 4I39A 2MJ6A 1UGUA 4UEYA 2OAQ1 3IS2A 2HJEA 4WF0A 1V9ZA 2JN7A 3D3OA 4EW7A 3V67A 3VE4A 2QKPA 2XSSA 4NEED 2WKQA 1OTDA 4CLCB 3RFBA 3LI9A 2W3FA 5IT5A 1P0ZA 1N9NA 4GJ4A 1LSXA 2P04A 3PHYA 1XFQA 3BQ8A 4LRXC 1S67L 2O9AA 3K2NA 2Z6CA 3CWFA 2LB9A 3S7QA 1X0OA 3B47A 1ZTUA 5DJTA 4EU0A 4EETB 1Y28A 1KOUA 3K3DA 2PT7A 4K08A 2OAP1 1MKMA 1F9IA 1EW0A 3EQVA 3KSFA 4O0PA 2VZWA 1XFNA 4I3IA 3F1OA 2V1AA 2VEAA 4ME4A 4LLOB 4LPZA 1S66L 3F1NB 4E04A 2GNXA 1DP9A 3FC7A 1OT9A 2NUTC 2KOIA 1N9LA 1DP8A 2HF6A 5KSHA 1S4RA 3PYPA 4HP9A 5J7EA 2QHKA 5J3WA 2M1CA 1ZHHB 3R4KA 3VOLA 3F1NA 2HV1A 4I5SA 3S7PA 5IU1A 2ZMVA 2W3GA 4HOIA 3K3CA 3PBRA 2QJ7A 2D01A 3GDIA 5I5LA 3E4PA 2NUPC 1XJ4A 3FG8A 2IA2A 4HH3A 2JHEA 2G7UA 5HWVA 5CX7A 3NOPC 5EFWA 4OOLA 4NXGA 4Z1WA 3OCLA 3VV4A 1XJ3A 5HDDA 5TJJA 2YKFA 4YWZA 1D7EA 1T1AA 3EOIA 2L1MA 5DFYA 2J3TD 4KUOA 4NXEA 1OPXA 5HWWA 1S1ZA 4HHDA 3PXPA 4R38A 1F5MA 3RH8B 3FPVA 3IS2B 3TE8A 2EWVA 4B93A 3FPWA 1XJ2A 2XROA 1JNUA 2B02A 4NXBA 4ETZA 3CI6A 4HH2A 1NWZA 3LIEA 1OTAA 2KLIA 1LSVA 1OTIA 2XA7S 5F69A 2PD7A 4WN5A 3EEHA 4R3AA 3TRCA 2W3EA 5HWTA 3UB6A 2I9VA 1G28A 1S1YA 1UWPX 3OCNA 3UE3A 3UMEA 4BBUA 3RTYA 1XJ6A 3LI8A 3LUQA 3LIAA 5DKKA 3TJZC 3CITA 2ZOIA 4BBTA 4KQDA 3H82B 4IJGA 3PBOA 3CUEA 1IFQA 1GSXA 4H6JA 4L9GA 2JKTI 2ZOHA 4GLQA 1W63Q 5G4YA 3ULFA 2J3WA 2W1TA 1STZA 1VHMA 3UE6A 3O5YA 2W0NA 3ZYTA 5MC7A 2PHYA 4G3KA 3LR0A 5F5YA 2ZMFA 4KUKA 2L4RA 4GCZA 2B18A 1DRMA 2PD8A 2VGLS 3LR5A 2V1BA 3PBTA 3UB7A 3NJAA 4XT2A 2VV7A 4DJ3A 2WKPA 1MZUA 4WUJA 5AJGA 4I3AA 5G4ZA 3LR3A 2M7UA 4BJPA 4WL9A 1NRJA 3HJIA 3LR4A 2HGVA 1OTEA 3KYZA 2W27A 3BW6A 3MF0A 3B33A 1YSPA 3LFVA 2KDKA 4NKPA 3OC2A 2QJ5A 3F1PA 1LT0A 2V0UA 2A2LA 4L9EA 2O9BA 1W63M 2PYRA 3CAXA 4AFIA 4PKYA 5HDCA 3E98A 1T18A 2A24B 2GJ3A 3KSIA 4I3JA 5L8MA 3MXQA 3IBRA 5DKLA 3P01A 4MN6A 3C8CA 2EA9A 4CQHA 3S7OA 2VLGA 1T1BA 3UMDA 1P97A 2BASA 2JKRI 3H9WA 2V9AA 3KSGA 4O8GA 3BY9A 4DMZA 4CLCC 4GW9A 1TF1A 3A0RA 5TBMB 3TW8A 2VX8A 4EESA 1DP6A 3NOUC 5HD5A 1F98A 4GHIB 3UB9A 3ICYA 3U2AA 4PHTA 2XRNA 3T4JA 2M7VA 3H7WA 2HJ9C 5K5BA 3P7NA 2ZBBA 2H28A 2VJWA 4UQIS 4EEUA 1TS7A 1N9OA 4HI4A 5AVFA 3BQAA 4IHQA 4BBVA 2PR5A 1P9WA 3OLOA 4YOFA 1YKDA 3R7WB 2J80A 2O99A 2FZ0A 4EEPA 3A0SA 2VGLM 4CLCE 2OOLA 3MFXA 4EQ1A 3JVVA 4HNBA 4UQIM 3PBNA 4GS9A 1TS6A 5TBMA 3D72A 1NLYA 5J4EA 1WA9A 1T1CA 3CUEC 5HSQA 4P6ZS 4IUHA 4JGPA 4NXFA 2J3TC 2R78A 3EQUA 5F6AA 3G6OA 3E0YA 3HCYA 4HJ3A 2W3DA 2GZAA 3H7WB 4KQOA 3T50A 4O01A 4G3WA 4HJ6A 2D02A 3T4QA 5A8BA 1OJ5A 4ZRRA 4WEJA 2DMWA 4B9OA 3BJNA 2L0WA 3LIBA 3ZQ5A 4OOMA 3MQQA 2Y8HA 3LICA 5HDSA 4H6JB 4L0LA 4MN5A 4Y2FA 1MC0A 4CLCD 3F1OB 3C2WA 3F1PB 2VKSA 4HQAA 2EWWA 3T4KA 4BMWA 2K31A 3IBJA 3R7WA 1P9RA 4EXOA 5HPFA 2VA0A 2W1RA 3KSHA 4R6LA 5DJUA 3MR0A 3C30A 3MMHA 2K7SA 4IUKA 2QYBA 2INWA 3T4OA 2V0WA 4F3LA 1GSWA 4Q0IA 4F3LB 4FSFA 4LRYC 4DN0A 1UWNX 3EGDC 3HJKA 4MMNA 3C38A 1OTBA 2LB5A 3CLOA 5KIZA 1D06A 4Q0HA 2O9CA 3JVUA 1ODVA 5F68A 4EERA 5IS1A 1GSVA 3LIFA 3NHQA 2PYPA 3OBFA 3T4SA 3S7NA 1BYWA 5HPIA 3LYXA 4PAUA 1LL8A 2QWSA 1TS0A 3EEAA 3EWKA 4G3VA 2FH5A 4JGQA 4YNRA 4LRZE 1H3QA 4PKYG 3H82A 5LBRA 4RQ9A 2WKRA 3W2ZA 3PR6A 1VB6A 3T4LA 3NOTC 2VV8A 4WELA 2KX6A 4BWIA 1NLZA 2VV6A 4ARZB 2O0YA 3BWLA 3E4OA 1V9YA 2OWHA 4P6ZM 4WLAA 2W1TB 5DFXA 2A24A 2Y79A 3DBAA 4GS9B 5HL6A 4WEKA 2JKTM 4HY8A 3PBQA 3KX0X 3SW1A 3MJQA 2JKRM 3T4TA 4JGRA 1S4SA 3OOVA 4Y5FA 5C5KA 4CLCA 5AVEA 4XT2B 3MQ0A 4FOFA 4ETXA 4HJ4A 4I38A 4JGOA 3E4QA 1YSQA 4R70A 3EGXC 1IOUA 3KYQA 4QPRA 3B42A 4M4XA 4HIAA 1T19A 2XA7M 4MN7A 2P08A 3BY8A 5HZHA 4L9FA 5HD3A 1LSWA 4DJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMW A;  1IFQ A;  2NUP C;  4B93 A;  3EGX C;  1IOU A;  3EGD C;  3BW6 A;  2VX8 A;  3KYQ A;  2NUT C;  4AFI A;  1H8M A; 
#chains in the Genus database with same CATH topology
 5EVL A;  3G2Y A;  4MCW A;  4II7 A;  3MQO A;  4Y3I A;  2PDR A;  3ZVT A;  4OQ0 A;  1BZA A;  3HVF A;  1H0M A;  4DKI A;  2UWX A;  1K54 C;  2FFF B;  2MJ6 A;  4MNR A;  1ERQ A;  4WMC D;  4UAA A;  5GLB A;  1V9Z A;  2H10 A;  1FIL A;  2JN7 A;  4EW7 A;  4XUX A;  3MKF A;  1KE4 A;  1BLH A;  4PPR A;  5IT5 A;  1MWU A;  3ZFZ A;  4GJ4 A;  4X69 A;  1XGJ A;  2P04 A;  1IEL A;  1XFQ A;  1IKG A;  2O9A A;  3K2N A;  1XXM A;  3S7Q A;  4GD6 A;  3B47 A;  1DJC A;  4EET B;  1Y28 A;  3HUM A;  3I7J A;  3Q07 A;  2ZLY A;  5E2F A;  3K3D A;  4BQM A;  4K08 A;  3IF6 B;  1K6R A;  3IH8 A;  2X71 A;  4LPZ A;  2GNX A;  1W5D A;  1PYY A;  2KOI A;  5HFO A;  1DP8 A;  5KSH A;  1HLU P;  2QHK A;  1K56 D;  3NEC A;  3F1N A;  5GHX A;  4C3Q A;  4I5S A;  4QHC A;  3K3C A;  1XJ4 A;  3FG8 A;  4P85 A;  1ERM A;  4JXG A;  3VP4 A;  4Q8I A;  1XJ3 A;  5EVI B;  4OKP A;  4YWZ A;  2L1M A;  2P9V A;  4Y17 A;  3RH8 B;  3FPV A;  4KZ4 A;  1A0K A;  1JNU A;  3GV9 A;  1DY6 A;  1NWZ A;  2WAD A;  1OTI A;  3QHY A;  3UDI A;  1KE0 A;  4WBG A;  5G18 A;  1G28 A;  1S1Y A;  1ACF A;  4E6W A;  3UE3 A;  4B88 A;  3UME A;  4E3K A;  3A3E A;  3MKE A;  5DKK A;  3TJZ C;  1YLW A;  3QP6 A;  4U0T A;  1IFQ A;  3Q82 A;  5FAT A;  1K56 A;  4PM7 A;  4CPK A;  4FUW A;  2J3W A;  2W1T A;  1VHM A;  5GL9 A;  2W0N A;  3G32 A;  3GVB A;  5EOO A;  4CJN A;  4YIN A;  4R1G A;  3MBZ A;  4GCZ A;  2B18 A;  2HP9 A;  4ZTK A;  2PD8 A;  3UB7 A;  3NJA A;  4JXS A;  1NJ4 A;  1PIO A;  2M7U A;  5FEG A;  1NRJ A;  2Y59 A;  1C3B A;  2Y2N A;  3KYZ A;  3A3I A;  1ONG A;  2PBD P;  2XFT A;  2O9B A;  1XA7 A;  2ZL1 B;  4GDB A;  3PAE A;  3E98 A;  4OQI A;  5A91 A;  1T18 A;  4ZJ1 A;  3CJM A;  2E8I A;  4MN6 A;  4DE1 A;  3S7O A;  1T1B A;  3FYZ A;  2BAS A;  2JKR I;  4ZJ3 A;  5EOE A;  4ID4 A;  1PNE A;  2OLU A;  5TBM B;  3P09 A;  2I72 A;  5HX9 A;  4OQG A;  2M7V A;  3W8K A;  2EFU A;  3BLM A;  2HJ9 C;  1LL9 A;  2G2W A;  1NRF A;  2VJW A;  3PAG A;  3Q1F A;  3ZG9 B;  1DJB A;  2Y2P A;  3OLO A;  1I5Q A;  5FQ9 A;  4EEP A;  2XR0 A;  1VET A;  4P87 A;  3MZF A;  4CLC E;  3ZG8 B;  3WS4 A;  4EQ1 A;  4UQI M;  5AQ7 A;  5J4E A;  1BT5 A;  3BM6 A;  4DRT A;  5HSQ A;  2R78 A;  2V8F A;  3EQU A;  4R0Q A;  1L0G A;  2PU2 A;  3P98 A;  4KQO A;  3T50 A;  5M1A A;  4HJ6 A;  3VP3 A;  4GNU A;  1MWR A;  2WGW B;  1KVL A;  1MWS A;  3LIC A;  1ESI A;  4D60 A;  4Y2F A;  3C2W A;  2VKS A;  4GN2 A;  3R7W A;  4OP8 A;  1SKO A;  5EVI C;  3IQA A;  3MR0 A;  3C30 A;  1Q2Q A;  4IUK A;  3T4O A;  2INW A;  1K55 A;  2V0W A;  5CHM A;  3TSG A;  3HJK A;  3C38 A;  1KDW A;  2LB5 A;  3O3V A;  4Q0H A;  2O9C A;  3CHW P;  3CPT A;  1IEM A;  3IX8 A;  2ZM8 A;  4EER A;  5IS1 A;  1GSV A;  3LIF A;  4LFU A;  4ESP A;  2PYP A;  1BUL A;  3BFD A;  1MWT A;  1BYW A;  1G6A A;  4PAU A;  4OVD A;  2XF3 A;  2QZ6 A;  2XFS A;  4JGQ A;  4BL2 A;  4P0M A;  3C7V A;  5HAI A;  1BSG A;  3PR6 A;  3HLF A;  4OPR A;  2O0Y A;  1V9Y A;  4P6Z M;  4OLD A;  5DFX A;  1J9M A;  4GS9 B;  4HBU A;  4WEK A;  3IWQ A;  2HDU A;  5KSC A;  5FAO A;  2WUQ A;  4XT2 B;  3MQ0 A;  1IKI A;  4ETX A;  1JWV A;  4JGO A;  4QD4 A;  3E4Q A;  4MBK A;  3EGX C;  3KYQ A;  3B42 A;  3BY8 A;  5HZH A;  3WWX A;  3HLE A;  2Z2L B;  4R3B A;  4XXR A;  1JTG A;  1OJG A;  4DF6 A;  1K6S A;  5FDH A;  3A3D A;  2Z6D A;  1IYS A;  4FH4 A;  4Q0J A;  2GX5 A;  3N8S A;  3T1S A;  4B4X A;  1TD5 A;  2CC1 A;  1MXO A;  1H8M A;  2P7J A;  4EUV A;  1PZO A;  5E2G A;  2IWC A;  4DE3 A;  3IS2 A;  2HJE A;  5DVA A;  3NCK A;  3G35 A;  1L3L A;  4X1L A;  1YQS A;  2Y4A A;  4R3J A;  1XP4 A;  3NDG A;  5CXW A;  3CWF A;  2IWD A;  2LB9 A;  1GA9 A;  2ZQ7 A;  1Y4O A;  1YM1 A;  2RCX A;  5FSR A;  4PM5 A;  2WGI A;  5FEF A;  4ME4 A;  2ZM2 A;  1M6K A;  1S66 L;  4HP9 A;  3SZT A;  5J7E A;  4OH0 A;  4NK3 A;  2M1C A;  1W7F A;  5J3W A;  1XA1 A;  3VOL A;  5A93 A;  2HV1 A;  3S7P A;  1VEU B;  3DTE A;  1VEU A;  3N8R A;  3ZDJ A;  2QJ7 A;  3S4X A;  5F82 A;  3IF6 C;  2WYX A;  4K0W A;  3FV7 A;  4ZJ2 A;  5KZH A;  3NOP C;  4NXG A;  1D7E A;  1H8Y A;  2Q9M A;  5HWW A;  1OPX A;  1S1Z A;  1PW1 A;  5M18 A;  1I2S A;  3QP4 A;  3LO7 A;  5HAR A;  1ZKJ A;  5AQB A;  3O87 A;  2V8C A;  4NXB A;  3V5M A;  3CI6 A;  4DE0 A;  3IT9 A;  2KLI A;  1PI4 A;  2XA7 S;  5F69 A;  4X56 A;  4WN5 A;  2HZ5 A;  3NDE A;  1MPL A;  4S2L A;  2BTF P;  4S2O A;  1GHP A;  1UWP X;  4OPZ A;  5BOH A;  4KZB A;  5EM1 A;  4BBU A;  3WRT A;  3RTY A;  1XJ6 A;  5L10 A;  2AVX A;  2HP5 A;  1IYO A;  2VK3 A;  2ZL1 A;  3H82 B;  1BLS A;  3PBO A;  3CUE A;  3DTM A;  3G4P A;  5CEC A;  1GSX A;  1JVJ A;  5L2F A;  3MXS A;  3N4I A;  2HDS A;  1PRQ A;  2Y2I A;  2XH9 A;  5TGF A;  1VET B;  4D2O A;  1TDG A;  3ULF A;  3UE0 A;  3M2K A;  3W4Q A;  5MC7 A;  2PHY A;  1KE3 A;  4LV0 A;  3IX3 A;  1LL5 A;  4KUK A;  2L4R A;  2J9O A;  2VGL S;  4MBF A;  3WRZ A;  4DE2 A;  3PBT A;  1K4E A;  4LCL A;  1K55 C;  1K38 A;  4Y7P A;  3MZD A;  3QP5 A;  4DJ3 A;  2WGV A;  2WKP A;  2ZC7 A;  1MZU A;  4WUJ A;  4I3A A;  3LR3 A;  4WL9 A;  3LR4 A;  4ZBE A;  4S2P A;  2ZC5 B;  2HGV A;  2WGW A;  4ZDX A;  1HZO A;  3TOI A;  3D4F A;  1FR1 A;  2P9V B;  3ZVW A;  1YSP A;  3LFV A;  2QJ5 A;  3UN7 A;  4XUZ A;  1G68 A;  4P6B A;  1YMX A;  3CAX A;  2Y2K A;  2E8J A;  1GHM A;  2A24 B;  3KSI A;  1MY8 A;  4I3J A;  1QME A;  3MXQ A;  3IBR A;  1M40 A;  3P01 A;  3C8C A;  4NET A;  3IHA A;  5CGW A;  2ACG A;  5FQQ A;  1P97 A;  1RP5 A;  4BEN A;  3HL9 A;  3UNW A;  5CGS A;  2V9A A;  3KSG A;  3Q7V A;  1TF1 A;  4KZ8 A;  3TW8 A;  3T1X A;  2Y2O A;  3Q81 A;  4HES A;  1F98 A;  2HDQ A;  2EX9 A;  3JPU A;  3ICY A;  4JF5 A;  2XRN A;  1LI0 A;  2Q9N A;  3P7N A;  5L07 A;  2ZBB A;  4F94 A;  1ZC2 A;  3IX4 A;  3BQA A;  4IHQ A;  4GDN A;  1E4D A;  4BBV A;  5EV0 A;  1CI8 A;  1TEM A;  3MXR A;  4UA9 A;  2J80 A;  1BLP A;  2FZ0 A;  3DTK A;  3LCE A;  3JVV A;  2V1Z A;  3PBN A;  1NLY A;  2EXB A;  1YPR A;  4RX2 A;  4P6Z S;  1W8Q A;  1CI9 A;  1XX2 A;  3T12 B;  4HJ3 A;  4E6X A;  1SHV A;  3V39 A;  4O01 A;  3BFC A;  2D02 A;  3T4Q A;  5A8B A;  3DW0 A;  4OQH A;  2H0Y A;  2J9P A;  4ZRR A;  4B9O A;  3LIB A;  4OOM A;  4H6J B;  5A90 A;  4HQA A;  3F1P B;  3T4K A;  5FAS A;  2J7V A;  1ALQ A;  5FDS A;  1Z6F A;  4JXV A;  2W1R A;  2ZJ9 A;  3KSH A;  5DJU A;  3SH8 A;  3MMH A;  2K7S A;  3FZC A;  1ES5 A;  3OPR A;  4Q0I A;  1CQA A;  5EUA A;  1HTZ A;  3WS1 A;  2WKI A;  3IWI A;  3T1Q B;  5KIZ A;  1D06 A;  3JVU A;  1ES4 A;  3CZD A;  3NHQ A;  2VGJ A;  5HPI A;  1H8Z A;  4UA7 A;  4G3V A;  1GCE A;  5FAQ A;  1G5U A;  4LRZ E;  3GR2 A;  3BLS A;  1H3Q A;  2QMI A;  1QMF A;  3HUN A;  3JYI A;  2JKG A;  2EFX A;  1VB6 A;  3T4L A;  1MBL A;  5FAP A;  1HD8 A;  2VV8 A;  5E2E A;  2WAE A;  4BWI A;  1NLZ A;  4RX3 A;  5JYP A;  4WLA A;  2W1T B;  1FR6 A;  2A24 A;  3DBA A;  5EVI D;  3VSL A;  3BEC A;  3W4P A;  3HLW A;  3SW1 A;  2JKR M;  4JGR A;  1JWZ A;  4MBH A;  5C5K A;  4WZ5 C;  3NY4 A;  2WKE A;  4JF6 A;  5GHZ A;  1L0E A;  5U47 A;  3N8L A;  1YSQ A;  4R70 A;  3G31 A;  4HIA A;  1KGF A;  3HLG A;  4R4S A;  2P08 A;  3L9K A;  4UHU A;  1LSW A;  4GHI A;  2CMN A;  4FH2 A;  1NYM A;  4O7D A;  5FL3 A;  3UB8 A;  5EVE A;  4MDZ A;  1E25 A;  5EPH A;  2K2N A;  3GEC A;  4OPQ A;  3E2K A;  3UY6 A;  5FQJ A;  4U3T A;  3WS2 A;  4BL3 A;  1DJA A;  4OP5 A;  3VE3 A;  4I39 A;  3CPT B;  4X25 A;  1UGU A;  4HEF A;  2OAQ 1;  4GKU A;  4Y15 A;  5E2H A;  4LV1 A;  3PTE A;  2DNS A;  3V67 A;  2XK1 A;  3VE4 A;  1OTD A;  4CLC B;  1XKZ A;  2W3F A;  4B4Z A;  4X1M A;  3PHY A;  3KYE A;  1VM1 A;  1S67 L;  4JLF A;  4R4R A;  4PM8 A;  1E3U D;  3LY4 A;  5DJT A;  4E3M A;  1WYC A;  2OAP 1;  1MKM A;  1N4O A;  3KSF A;  4O0P A;  2VZW A;  5A92 A;  4I3I A;  3F1O A;  2V1A A;  2VEA A;  1K4F A;  3F1N B;  3SS4 A;  2XD5 A;  1DP9 A;  3FC7 A;  2NUT C;  5KMW A;  3QNC A;  3PYP A;  3ZG0 A;  1ZHH B;  1KVM A;  3HLB A;  3IXH A;  1EWZ A;  3A3J A;  2ZMV A;  2W3G A;  3PBR A;  2D01 A;  4HH3 A;  2IA2 A;  3DAV A;  3QP8 A;  5CGX A;  5EFW A;  4OOL A;  4Z1W A;  2DCF A;  3VP2 A;  3VOZ A;  2FFY A;  3IXD A;  3IF5 A;  5TR7 A;  5DFY A;  1T1A A;  1XPB A;  4NXE A;  2ZQC A;  1H5X A;  3IS2 B;  1GHI A;  2EWV A;  4B93 A;  5FQM A;  3FPW A;  1XJ2 A;  3UDX A;  2XRO A;  5E43 A;  2B02 A;  4ETZ A;  4C6Y A;  4HH2 A;  1LSV A;  3M6B A;  3S22 A;  3EEH A;  1AWI A;  2W3E A;  3E2L A;  5HWT A;  5GLA A;  3UB6 A;  2I9V A;  5M19 A;  3OZH A;  5F83 A;  2WZX A;  3ITA A;  2RL3 A;  1YLY A;  1FIK A;  5L09 A;  1K57 A;  3G34 A;  1ERO A;  3LIA A;  4Y0T A;  1FCM A;  4EWF A;  2ZOI A;  4X6T A;  4BBT A;  5HW3 A;  4N9K A;  3ZNT A;  3CMZ A;  4UA6 A;  2ZM0 A;  2ZOH A;  4MEZ A;  3UPP A;  5G4Y A;  3C7U A;  1STZ A;  1SKF A;  4KG2 A;  5F5Y A;  2ZMF A;  2GDN A;  2X02 A;  3LR5 A;  2V1B A;  2Y55 A;  5J8X A;  1YLJ A;  2VV7 A;  5FA7 A;  3D9Y A;  3HJI A;  5CER A;  2H0T A;  2W27 A;  1J3W A;  4RYE A;  3MF0 A;  3ZNY A;  3B33 A;  4LEN A;  3VFF A;  4E3J A;  4GD8 A;  2KDK A;  1JTD A;  3F1P A;  2IWB A;  3SS5 A;  1RCJ A;  2PYR A;  4S2M A;  4OPY A;  3ZHH A;  5L8M A;  5DKL A;  2A49 A;  2QPN A;  1SDE A;  3U4L P;  2VGK A;  2DRW A;  2VLG A;  3UMD A;  3MSH A;  4KZ5 A;  3H9W A;  1IYQ A;  4S2N C;  4O8G A;  4X68 A;  4WZ5 A;  2ZQ8 A;  4GW9 A;  3A0R A;  1I2W A;  1F2K A;  3UO9 A;  2WKH A;  1ES3 A;  3BFG A;  5FI2 A;  3Q7Z A;  4PHT A;  3T4J A;  3W4O A;  2Q0O A;  5K5B A;  4DJ2 A;  4EEU A;  1TS7 A;  1N9O A;  2JKF A;  2PR5 A;  4WMC A;  3C4P A;  4YOF A;  3V50 A;  1YKD A;  3LY3 A;  2PU4 A;  5I94 A;  1EI5 A;  4HNB A;  3NI9 A;  5CTM A;  4GS9 A;  1TS6 A;  2HP6 A;  5FQI A;  1T1C A;  4IUH A;  4QB8 A;  1K25 A;  5F6A A;  3G6O A;  3E0Y A;  3HCY A;  1NZO A;  4EBP A;  2GZA A;  3H7W B;  3NIA A;  2XDM A;  4WM9 A;  1OJ5 A;  3IXB A;  2DMW A;  4WEJ A;  1HVB A;  3BRM A;  3MQQ A;  2Y8H A;  5HDS A;  4L0L A;  5FI6 A;  5CED A;  2EXA A;  1CEG A;  4BMW A;  3NUL A;  2Y2Q A;  1P9R A;  1ZG6 A;  5HPF A;  4IED A;  2VA0 A;  1FQG A;  4QWO A;  1Y54 A;  5DTT A;  2QYB A;  5IHV A;  4F3L A;  4KEN B;  2ZC4 B;  4F3L B;  3G2Z A;  4N92 A;  4FSF A;  4LRY C;  4DN0 A;  3VP1 A;  1N9B A;  3EGD C;  3RJU A;  1U60 A;  3C4O A;  4JKT A;  5F68 A;  1Q2P A;  3VMA A;  3FKW A;  3SOI A;  3T4S A;  3LYX A;  3ZCZ A;  1L0D A;  1TS0 A;  3EEA A;  5GHY A;  3EWK A;  1TDL A;  4Y0O A;  5DF8 A;  1ZG4 A;  4QY6 A;  4YNR A;  2OV5 A;  4GOG A;  3FKV A;  2V2F F;  4PKY G;  2WK0 A;  3A3F A;  3H82 A;  2WKR A;  3W2Z A;  3DWZ A;  3SS3 A;  4JXW A;  1FOF A;  4QU3 A;  2X01 A;  4WEL A;  1FSW A;  3GSG A;  3T1R A;  3BWL A;  3E4O A;  4M3K A;  1OME A;  1MKI A;  3O86 A;  4MLL A;  2JKT M;  4HY8 A;  3KX0 X;  3MJQ A;  3T4T A;  1S4S A;  2ZQD A;  3OOV A;  4Y0U A;  1W79 A;  4S2N A;  5EEC A;  1BLC A;  2Y91 A;  4WZ4 A;  2HDR A;  5EVI A;  1IOU A;  3AGD A;  5FI7 A;  4QJG A;  2OSU A;  3HLC A;  2XA7 M;  4MN7 A;  5CHJ A;  4HP4 A;  5CHU A;  2JBF A;  3A0V A;  1SDN A;  1VQQ A;  4ARZ A;  2UV0 E;  1G6O A;  2W3H A;  2XD1 A;  1OT6 A;  2YKH A;  3MFD A;  4E3N A;  1YLZ A;  3DTI A;  3VSK A;  2OWJ A;  3KO6 A;  3LID A;  3C5A A;  1PZP A;  4E3O A;  4DXC A;  2PR6 A;  4EBL A;  3PBS A;  4FCF A;  3G30 A;  1RGY A;  3AGF A;  1RGZ A;  1TS8 A;  4OON A;  5DF9 A;  1YAX A;  1L2S A;  3HBR A;  1D1J A;  4UEY A;  4WF0 A;  4PMA A;  3GTC A;  2EX6 A;  2XLN A;  3D3O A;  3LEZ A;  4KG5 A;  4Z9Q A;  1JWP A;  2QKP A;  2XSS A;  4NEE D;  2WKQ A;  3ZG7 B;  1E3U A;  3LI9 A;  3RFB A;  2XQZ A;  1P0Z A;  1N9N A;  1LSX A;  4X53 A;  4NG2 A;  3L7H A;  3BQ8 A;  4LRX C;  2Z6C A;  5TFQ A;  1X0O A;  4FTX A;  3S1Y A;  1ZTU A;  4EU0 A;  1CEF A;  5EM0 A;  1KOU A;  4LV3 A;  1KGE A;  2PT7 A;  1F9I A;  1PI5 A;  1EW0 A;  3EQV A;  4EV4 A;  1XFN A;  5GLD A;  4LLO B;  4E04 A;  4ZAM A;  4FD8 A;  3VP0 A;  1OT9 A;  1SKO B;  5DTK A;  1N9L A;  2HF6 A;  3QP2 A;  4BD1 A;  1S4R A;  3IWO A;  2A3U A;  3R4K A;  4S2I A;  1NYY A;  3NC8 A;  3RXW A;  5IU1 A;  3O88 A;  4HOI A;  1WYB A;  3IHB A;  3GDI A;  1NY0 A;  1ONH A;  4S2J A;  3E4P A;  5I5L A;  2NUP C;  2JHE A;  2G7U A;  4K91 A;  5HWV A;  4EUZ A;  5CX7 A;  1FCN A;  3OCL A;  3AGE A;  3VV4 A;  4GB7 A;  5HDD A;  1YT4 A;  5TJJ A;  1K54 A;  1XGI A;  2ZD8 A;  2YKF A;  3EOI A;  2J3T D;  4KUO A;  4KZ9 A;  4HHD A;  3ITB A;  4JF4 A;  1YMS A;  5HAQ A;  3PXP A;  4R38 A;  1ESU A;  1F5M A;  3UDF A;  3TE8 A;  1SCW A;  3MZE A;  5DTS A;  3HLD A;  3IF6 A;  4E3L A;  3LIE A;  1OTA A;  2ZC3 B;  3QNB A;  1TVF A;  2PD7 A;  4KZ3 A;  4R3A A;  3Q7V B;  3TRC A;  2Y2J A;  1BUE A;  2ZQA A;  3UPN A;  3DWK A;  3OCN A;  2ZMA A;  3LI8 A;  3LUQ A;  1NZU A;  3CIT A;  4KQD A;  4IBR A;  4IJG A;  4DDS A;  3VOY A;  4JPM A;  1K57 C;  1S6R A;  4KZ6 A;  2OLV A;  4H6J A;  4L9G A;  2JKT I;  4GLQ A;  1W63 Q;  2WZZ A;  1S0W A;  3GQZ A;  3B3X A;  3UPO A;  2EX8 A;  4EQI A;  3UE6 A;  3O5Y A;  1LI9 A;  4LV2 A;  3ZYT A;  4G3K A;  3LR0 A;  2B95 A;  3GMW A;  1FSY A;  3TG9 A;  3BYD A;  4N1X A;  1DRM A;  4KZ7 A;  1CJF A;  1PFL A;  1PWC A;  1GA0 A;  3ISG A;  1YLT A;  5AQ9 A;  4XT2 A;  4KQQ A;  4WYY A;  5AJG A;  5G4Z A;  4BJP A;  1OTE A;  3BFE A;  1O7E A;  3BW6 A;  2XGN A;  4NKP A;  4E3I A;  3OC2 A;  3IXG A;  1LT0 A;  2V0U A;  2A2L A;  3V3R A;  4L9E A;  1W63 M;  2V20 A;  5CRF A;  2Y2L A;  4YFM A;  4AFI A;  4PKY A;  1CK3 A;  5HDC A;  3ZGA B;  2GJ3 A;  2C5W B;  3WS5 A;  1IYP A;  3WS0 A;  2Y2G A;  2EA9 A;  4PM6 A;  3RXX A;  4CQH A;  2P74 A;  4DXB A;  3M6H A;  2JCH A;  5JYO A;  4PM9 A;  3BY9 A;  4DMZ A;  4CLC C;  5F1F A;  2PAV P;  3UE1 A;  2VX8 A;  4EES A;  1DP6 A;  4X55 A;  3MS6 A;  3NOU C;  5HD5 A;  2ZQ9 A;  4GHI B;  4S2K A;  3UB9 A;  3VFH A;  3IH9 A;  3U2A A;  3N6I A;  2PRF A;  4IBX A;  3H7W A;  2J8Y A;  1K0K A;  1YLP A;  2H28 A;  4UQI S;  4HI4 A;  2Y2M A;  5AVF A;  5CTN A;  1WE4 A;  2ZC6 B;  3LEQ A;  4Y13 A;  1P9W A;  1BTL A;  1O07 A;  2XEP A;  4C75 A;  3R7W B;  1AXB A;  2O99 A;  4KG6 A;  5FQK A;  3A0S A;  3FWL A;  2VGL M;  4N9L A;  2H5S A;  2OOL A;  3MFX A;  3ZG5 A;  5TBM A;  3D72 A;  4H8R A;  1WA9 A;  3QP1 A;  3CUE C;  1SZV A;  3NBL A;  4JGP A;  3SH7 A;  4NXF A;  2J3T C;  4BD0 A;  2R9X A;  1PWD A;  4HBT A;  1PW8 A;  2W3D A;  3BEB A;  4G3W A;  2WAF A;  3CG5 A;  3GRJ A;  3BJN A;  2L0W A;  1PWG A;  3ZQ5 A;  3BFF A;  3UB5 P;  1L0F A;  4K0X A;  4JBF A;  1KGG A;  4MN5 A;  4RVA A;  4EBN A;  1MC0 A;  4CLC D;  3F1O B;  2EWW A;  1W8Y A;  2K31 A;  3OPL A;  2B5R A;  4A5R A;  3IBJ A;  3SH9 A;  4EXO A;  1Z09 A;  4GZB A;  5GLC A;  4RA7 A;  4R6L A;  5EE8 A;  4U0X A;  4OLG A;  1GSW A;  4R23 A;  1UWN X;  4OOY A;  4MMN A;  1OTB A;  3CLO A;  3OPH A;  1ODV A;  5DF7 A;  1NXY A;  4LCM A;  3OBF A;  1CF0 A;  3V3S A;  3S7N A;  5HAP A;  1ES2 A;  1LL8 A;  2QWS A;  2Y2H A;  3HRE A;  2EX2 A;  2FH5 A;  4KZA A;  3N7W A;  5LBR A;  4RQ9 A;  2R9W A;  3HUO A;  4BLM A;  5F1G A;  2G2U A;  3NOT C;  1LLB A;  5HL1 A;  2BLS A;  2KX6 A;  5D3O A;  2JC7 A;  2VV6 A;  4ARZ B;  1KDS A;  2OWH A;  2C6W B;  1LHY A;  3M2J A;  4N1H A;  5AQA A;  2Y79 A;  5HL6 A;  2PBY A;  4IVK A;  2Z2M B;  3PBQ A;  3OPP A;  4Y5F A;  4CLC A;  4LGW A;  4IVI A;  5AVE A;  2BG1 A;  1FCO A;  4FOF A;  4DDY A;  2HPB A;  4HJ4 A;  4I38 A;  2JE5 A;  4QY5 A;  4QPR A;  5CEB A;  4M4X A;  1T19 A;  3LGO A;  4L9F A;  5HD3 A;  4KQR A; 
#chains in the Genus database with same CATH homology
 1OJG A;  4HP4 A;  3A0V A;  4GHI A;  4ARZ A;  2CMN A;  1G6O A;  2W3H A;  5FL3 A;  4MCW A;  1OT6 A;  3UB8 A;  4II7 A;  2YKH A;  3MQO A;  4MDZ A;  2Z6D A;  4Y3I A;  2PDR A;  4Q0J A;  2OWJ A;  2GX5 A;  3KO6 A;  3LID A;  2K2N A;  3GEC A;  2PR6 A;  1TD5 A;  3PBS A;  1H8M A;  2P7J A;  3VE3 A;  1TS8 A;  5DF9 A;  1YAX A;  4EUV A;  4I39 A;  2MJ6 A;  1UGU A;  4UEY A;  2OAQ 1;  3IS2 A;  2HJE A;  4WF0 A;  1V9Z A;  2JN7 A;  3D3O A;  4EW7 A;  3V67 A;  3VE4 A;  2QKP A;  2XSS A;  4NEE D;  2WKQ A;  1OTD A;  4CLC B;  3RFB A;  3LI9 A;  2W3F A;  5IT5 A;  1P0Z A;  1N9N A;  4GJ4 A;  1LSX A;  2P04 A;  3PHY A;  1XFQ A;  3BQ8 A;  4LRX C;  1S67 L;  2O9A A;  3K2N A;  2Z6C A;  3CWF A;  2LB9 A;  3S7Q A;  1X0O A;  3B47 A;  1ZTU A;  5DJT A;  4EU0 A;  4EET B;  1Y28 A;  1KOU A;  3K3D A;  2PT7 A;  4K08 A;  2OAP 1;  1MKM A;  1F9I A;  1EW0 A;  3EQV A;  3KSF A;  4O0P A;  2VZW A;  1XFN A;  4I3I A;  3F1O A;  2V1A A;  2VEA A;  4ME4 A;  4LLO B;  4LPZ A;  1S66 L;  3F1N B;  4E04 A;  2GNX A;  1DP9 A;  3FC7 A;  1OT9 A;  2NUT C;  2KOI A;  1N9L A;  1DP8 A;  2HF6 A;  5KSH A;  1S4R A;  3PYP A;  4HP9 A;  5J7E A;  2QHK A;  5J3W A;  2M1C A;  1ZHH B;  3R4K A;  3VOL A;  3F1N A;  2HV1 A;  4I5S A;  3S7P A;  5IU1 A;  2ZMV A;  2W3G A;  4HOI A;  3K3C A;  3PBR A;  2QJ7 A;  2D01 A;  3GDI A;  5I5L A;  3E4P A;  2NUP C;  1XJ4 A;  3FG8 A;  2IA2 A;  4HH3 A;  2JHE A;  2G7U A;  5HWV A;  5CX7 A;  3NOP C;  5EFW A;  4OOL A;  4NXG A;  4Z1W A;  3OCL A;  3VV4 A;  1XJ3 A;  5HDD A;  5TJJ A;  2YKF A;  4YWZ A;  1D7E A;  1T1A A;  3EOI A;  2L1M A;  5DFY A;  2J3T D;  4KUO A;  4NXE A;  1OPX A;  5HWW A;  1S1Z A;  4HHD A;  3PXP A;  4R38 A;  1F5M A;  3RH8 B;  3FPV A;  3IS2 B;  3TE8 A;  2EWV A;  4B93 A;  3FPW A;  1XJ2 A;  2XRO A;  1JNU A;  2B02 A;  4NXB A;  4ETZ A;  3CI6 A;  4HH2 A;  1NWZ A;  3LIE A;  1OTA A;  2KLI A;  1LSV A;  1OTI A;  2XA7 S;  5F69 A;  2PD7 A;  4WN5 A;  3EEH A;  4R3A A;  3TRC A;  2W3E A;  5HWT A;  3UB6 A;  2I9V A;  1G28 A;  1S1Y A;  1UWP X;  3OCN A;  3UE3 A;  3UME A;  4BBU A;  3RTY A;  1XJ6 A;  3LI8 A;  3LUQ A;  3LIA A;  5DKK A;  3TJZ C;  3CIT A;  2ZOI A;  4BBT A;  4KQD A;  3H82 B;  4IJG A;  3PBO A;  3CUE A;  1IFQ A;  1GSX A;  4H6J A;  4L9G A;  2JKT I;  2ZOH A;  4GLQ A;  1W63 Q;  5G4Y A;  3ULF A;  2J3W A;  2W1T A;  1STZ A;  1VHM A;  3UE6 A;  3O5Y A;  2W0N A;  3ZYT A;  5MC7 A;  2PHY A;  4G3K A;  3LR0 A;  5F5Y A;  2ZMF A;  4KUK A;  2L4R A;  4GCZ A;  2B18 A;  1DRM A;  2PD8 A;  2VGL S;  3LR5 A;  2V1B A;  3PBT A;  3UB7 A;  3NJA A;  4XT2 A;  2VV7 A;  4DJ3 A;  2WKP A;  1MZU A;  4WUJ A;  5AJG A;  4I3A A;  5G4Z A;  3LR3 A;  2M7U A;  4BJP A;  4WL9 A;  1NRJ A;  3HJI A;  3LR4 A;  2HGV A;  1OTE A;  3KYZ A;  2W27 A;  3BW6 A;  3MF0 A;  3B33 A;  1YSP A;  3LFV A;  2KDK A;  4NKP A;  3OC2 A;  2QJ5 A;  3F1P A;  1LT0 A;  2V0U A;  2A2L A;  4L9E A;  2O9B A;  1W63 M;  2PYR A;  3CAX A;  4AFI A;  4PKY A;  5HDC A;  3E98 A;  1T18 A;  2A24 B;  2GJ3 A;  3KSI A;  4I3J A;  5L8M A;  3MXQ A;  3IBR A;  5DKL A;  3P01 A;  4MN6 A;  3C8C A;  2EA9 A;  4CQH A;  3S7O A;  2VLG A;  1T1B A;  3UMD A;  1P97 A;  2BAS A;  2JKR I;  3H9W A;  2V9A A;  3KSG A;  4O8G A;  3BY9 A;  4DMZ A;  4CLC C;  4GW9 A;  1TF1 A;  3A0R A;  5TBM B;  3TW8 A;  2VX8 A;  4EES A;  1DP6 A;  3NOU C;  5HD5 A;  1F98 A;  4GHI B;  3UB9 A;  3ICY A;  3U2A A;  4PHT A;  2XRN A;  3T4J A;  2M7V A;  3H7W A;  2HJ9 C;  5K5B A;  3P7N A;  2ZBB A;  2H28 A;  2VJW A;  4UQI S;  4EEU A;  1TS7 A;  1N9O A;  4HI4 A;  5AVF A;  3BQA A;  4IHQ A;  4BBV A;  2PR5 A;  1P9W A;  3OLO A;  4YOF A;  1YKD A;  3R7W B;  2J80 A;  2O99 A;  2FZ0 A;  4EEP A;  3A0S A;  2VGL M;  4CLC E;  2OOL A;  3MFX A;  4EQ1 A;  3JVV A;  4HNB A;  4UQI M;  3PBN A;  4GS9 A;  1TS6 A;  5TBM A;  3D72 A;  1NLY A;  5J4E A;  1WA9 A;  1T1C A;  3CUE C;  5HSQ A;  4P6Z S;  4IUH A;  4JGP A;  4NXF A;  2J3T C;  2R78 A;  3EQU A;  5F6A A;  3G6O A;  3E0Y A;  3HCY A;  4HJ3 A;  2W3D A;  2GZA A;  3H7W B;  4KQO A;  3T50 A;  4O01 A;  4G3W A;  4HJ6 A;  2D02 A;  3T4Q A;  5A8B A;  1OJ5 A;  4ZRR A;  4WEJ A;  2DMW A;  4B9O A;  3BJN A;  2L0W A;  3LIB A;  3ZQ5 A;  4OOM A;  3MQQ A;  2Y8H A;  3LIC A;  5HDS A;  4H6J B;  4L0L A;  4MN5 A;  4Y2F A;  1MC0 A;  4CLC D;  3F1O B;  3C2W A;  3F1P B;  2VKS A;  4HQA A;  2EWW A;  3T4K A;  4BMW A;  2K31 A;  3IBJ A;  3R7W A;  1P9R A;  4EXO A;  5HPF A;  2VA0 A;  2W1R A;  3KSH A;  4R6L A;  5DJU A;  3MR0 A;  3C30 A;  3MMH A;  2K7S A;  4IUK A;  2QYB A;  2INW A;  3T4O A;  2V0W A;  4F3L A;  1GSW A;  4Q0I A;  4F3L B;  4FSF A;  4LRY C;  4DN0 A;  1UWN X;  3EGD C;  3HJK A;  4MMN A;  3C38 A;  1OTB A;  2LB5 A;  3CLO A;  5KIZ A;  1D06 A;  4Q0H A;  2O9C A;  3JVU A;  1ODV A;  5F68 A;  4EER A;  5IS1 A;  1GSV A;  3LIF A;  3NHQ A;  2PYP A;  3OBF A;  3T4S A;  3S7N A;  1BYW A;  5HPI A;  3LYX A;  4PAU A;  1LL8 A;  2QWS A;  1TS0 A;  3EEA A;  3EWK A;  4G3V A;  2FH5 A;  4JGQ A;  4YNR A;  4LRZ E;  1H3Q A;  4PKY G;  3H82 A;  5LBR A;  4RQ9 A;  2WKR A;  3W2Z A;  3PR6 A;  1VB6 A;  3T4L A;  3NOT C;  2VV8 A;  4WEL A;  2KX6 A;  4BWI A;  1NLZ A;  2VV6 A;  4ARZ B;  2O0Y A;  3BWL A;  3E4O A;  1V9Y A;  2OWH A;  4P6Z M;  4WLA A;  2W1T B;  5DFX A;  2A24 A;  2Y79 A;  3DBA A;  4GS9 B;  5HL6 A;  4WEK A;  2JKT M;  4HY8 A;  3PBQ A;  3KX0 X;  3SW1 A;  3MJQ A;  2JKR M;  3T4T A;  4JGR A;  1S4S A;  3OOV A;  4Y5F A;  5C5K A;  4CLC A;  5AVE A;  4XT2 B;  3MQ0 A;  4FOF A;  4ETX A;  4HJ4 A;  4I38 A;  4JGO A;  3E4Q A;  1YSQ A;  4R70 A;  3EGX C;  1IOU A;  3KYQ A;  4QPR A;  3B42 A;  4M4X A;  4HIA A;  1T19 A;  2XA7 M;  4MN7 A;  2P08 A;  3BY8 A;  5HZH A;  4L9F A;  5HD3 A;  1LSW A;  4DJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...