4AFIA

Complex between vamp7 longin domain and fragment of delta-adaptin from ap3
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
155
structure length
155
Chain Sequence
TPGVEHIPVVQIDLSVPLKVPGLPMSDQYVKLEEAMAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFSFLNEVKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AP-3 COMPLEX SUBUNIT DELTA-1, VESICLE-ASSOCIATED MEMBRANE PR
publication title Structural Basis of the Intracellular Sorting of the Snare Vamp7 by the Ap3 Adaptor Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis
total genus 40
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4afiA00
3EGXC 1H8MA 1IOUA 2NUPC 4B93A 3BW6A 2NUTC 2VX8A 3KYQA 2DMWA 3EGDC 4AFIA 1IFQA
chains in the Genus database with same CATH superfamily
3ZCZA 4HP9A 4EBLA 1N4OA 4Y0UA 5CHJA 4LLOB 1FSYA 2Q9MA 3PBOA 3VE4A 2HV1A 4E3JA 1FQGA 1ES3A 2M1CA 5FDHA 4L0LA 4RQ9A 4GHIA 2PU2A 2E8JA 4WF0A 3SOIA 1K56D 4MN7A 4WZ5A 2ZM0A 3TE8A 1O7EA 1E4DA 1LSWA 4CLCE 3MZEA 3E2KA 2X71A 2Y79A 4UAAA 3SH9A 1E25A 3LIEA 4UQIM 2WGWB 4WLAA 3PBNA 4XT2A 2Y2IA 3CUEC 4E04A 4DMZA 3MKEA 3LR4A 3NI9A 2V8CA 3FG8A 3QNCA 1MWTA 3ZG0A 4HBUA 2V8FA 1KGGA 4K0XA 3S7OA 3O3VA 4RVAA 5A8BA 1BULA 2P9VB 4DKIA 3A3JA 3NIAA 3UPOA 3SZTA 2P04A 1L3LA 1XFNA 3OPPA 3BEBA 1CF0A 3LYXA 3G6OA 1PW8A 2EX8A 2Y2MA 2WYXA 4IBRA 1SCWA 1VEUA 5FATA 1MKMA 2HJEA 2ZC4B 1PZOA 2B5RA 2W3EA 4ZJ2A 4N92A 3CHWP 3Q1FA 4OLDA 2HJ9C 3FWLA 2CC1A 5HW3A 1H8ZA 4D2OA 5G18A 1XP4A 4JF5A 2I72A 4OQIA 4HOIA 3VE3A 5FQQA 5IU1A 4Y5FA 2Y4AA 4ZJ1A 1N9BA 2Z6DA 3LUQA 4HESA 4OPYA 4C75A 1YM1A 4O0PA 4BBVA 1T1CA 4PAUA 2FFFB 3IX8A 3OPLA 1CQAA 3UE6A 2VGLM 3A3FA 2GJ3A 1ES4A 3DTMA 1IYPA 2ZL1A 3C38A 5TBMB 1IKIA 5J4EA 2J8YA 4Z9QA 4BBUA 1GSVA 3QP8A 3BLSA 2EWVA 1YSPA 4EUZA 2XEPA 5KMWA 4CPKA 3RXXA 3T4SA 1LT0A 4LPZA 1MWUA 3VFHA 5M18A 3IF6B 1NZUA 2P74A 3T1XA 2GZAA 2P7JA 2HDRA 2JBFA 4NXGA 3B47A 3CLOA 4S2JA 5HWVA 1Z09A 1PWGA 1WA9A 1CI9A 1FSWA 4IHQA 2XRNA 1KE3A 3MXRA 1Q2QA 4EU0A 4RYEA 2UV0E 1LSVA 1ZG4A 4Y13A 2YKFA 2HF6A 5DTTA 2O9BA 1STZA 4KQDA 4F94A 3CUEA 1MBLA 5HAQA 4GOGA 1ZHHB 5F83A 1HVBA 3CPTB 4GS9B 3HBRA 3E0YA 3V3SA 1HD8A 1G6OA 3HUNA 4P6ZM 3OPHA 4LRYC 5HD3A 3BFDA 4S2KA 2W1RA 1YLYA 2IA2A 4DXBA 1OMEA 2W27A 2JN7A 1NWZA 4HY8A 4WEKA 2O0YA 2V0WA 3T50A 3IXBA 4JXVA 3VOLA 1IELA 3EQUA 4Q0HA 3VV4A 3P7NA 2J9OA 5AQ7A 2ZQ8A 2W0NA 1S0WA 4JF4A 3BWLA 4WEJA 2WUQA 1IKGA 3NJAA 4GZBA 3KYEA 3FYZA 4LCLA 2GDNA 5F1FA 2XROA 1HZOA 1PYYA 4H8RA 3U4LP 3N7WA 1PRQA 1DJCA 1BLPA 4CLCD 1OJ5A 1MXOA 1OPXA 3RXWA 4PPRA 2Y55A 5CRFA 1PW1A 3D72A 4A5RA 4R4SA 4PM5A 1FOFA 1P97A 2DMWA 5CGXA 1BYWA 3IXHA 1JWPA 3K3CA 4WBGA 5AVFA 4EERA 1WYCA 4FCFA 4OP5A 3WRTA 1IFQA 2W1TB 3CWFA 4WN5A 2DCFA 4HJ6A 4OONA 2W3FA 3EGXC 5DFYA 1ERQA 3C4PA 3QP5A 3PYPA 4LV0A 4YOFA 4KZ4A 3H7WB 3A3DA 1P9RA 1ZTUA 2Y2NA 3EQVA 3NY4A 4YNRA 4R3BA 3ZNTA 1QMFA 4ID4A 1SHVA 5F6AA 4YFMA 4DRTA 3SS3A 1N9NA 3IF6C 4Y7PA 2HP6A 1RP5A 1GSXA 2Y59A 5HSQA 3F1OB 3SH8A 1D1JA 3BLMA 3UY6A 4JLFA 3LO7A 2A49A 3VP3A 3UPPA 3A0VA 4E3NA 5A90A 5K5BA 1KGFA 2M7VA 3AGEA 3HLWA 3T1RA 4PHTA 4CQHA 2EFXA 3UDFA 3IHAA 2Y2OA 2WGWA 1PIOA 4Z1WA 1CJFA 5HARA 3PAGA 3MKFA 4WMCA 1BUEA 4JXGA 4LRXC 2PD7A 3B33A 1XA7A 1N9OA 2Y2LA 1S4RA 3UMEA 3S1YA 3NDGA 1IEMA 2WKEA 4NXEA 4PKYA 4WUJA 4PM8A 2P9VA 1GA0A 4GN2A 5KSCA 4BJPA 3LI9A 5DF8A 1TDLA 4EUVA 2K31A 5CGWA 1K6RA 5CEBA 4U0XA 4KZAA 4Q8IA 4B9OA 2BTFP 3MR0A 4MMNA 3LY4A 1ESIA 1ESUA 2WZZA 3LIBA 4UEYA 4HBTA 4BQMA 4NETA 3W8KA 2BASA 3C8CA 1YAXA 4Y0TA 3V50A 2L1MA 4JGRA 3MXQA 4FSFA 4BL2A 4MDZA 1EI5A 3GSGA 3ZDJA 5I94A 4KQQA 4HEFA 3JVUA 2Q0OA 2QMIA 4L9FA 4QWOA 2ZLYA 2ZC6B 4LRZE 3T4TA 1G6AA 3SW1A 4JGQA 3H9WA 1FR6A 4X56A 4ARZB 3C5AA 2EWWA 3OCLA 3KX0X 4B4XA 3UE1A 4OQHA 2WGVA 3HVFA 4WM9A 5I5LA 5TBMA 2Z2MB 5GLBA 4DE3A 4DJ2A 2Y2GA 4BLMA 3F1PB 2XH9A 3SH7A 4MEZA 2WKPA 5HL6A 4KG2A 2OOLA 4KZ7A 2A24B 3PBSA 5A92A 3V5MA 3IF6A 4RA7A 4ZRRA 5AVEA 5HZHA 1VETA 2VLGA 1LI9A 5DF7A 3OBFA 5EPHA 5CX7A 2PR6A 4G3KA 4JGPA 2W3DA 2WAEA 1KOUA 2ZQAA 2PHYA 4GKUA 5F1GA 4KZ8A 3BFFA 4K91A 4EEUA 2VEAA 1BLHA 1G28A 2VZWA 1P0ZA 3Q82A 1EW0A 3N4IA 2BLSA 2Y2QA 3CPTA 4GS9A 4M3KA 3V39A 4C6YA 1VM1A 1OTEA 3OCNA 3DAVA 4QB8A 1K25A 3KYQA 5EVLA 1ES5A 3GQZA 2ACGA 4IBXA 5DJTA 3BYDA 5U47A 3LEQA 1K6SA 1WYBA 4S2NC 3T4QA 2KLIA 1XPBA 1IYSA 3G32A 1PZPA 4S2MA 5KZHA 1PNEA 1TF1A 2PD8A 4OOMA 3TSGA 4P0MA 4HIAA 5KSHA 3RJUA 4MN6A 5L10A 1FR1A 3LI8A 2A2LA 3C7VA 4KZ5A 1S1YA 4GLQA 3CZDA 3V3RA 1V9YA 5C5KA 2HDUA 1D06A 3ZYTA 1VB6A 2JKTI 3OZHA 2IWCA 3AGFA 1QMEA 2QWSA 4HH3A 2V1BA 5FI6A 3G2ZA 4E3OA 1NJ4A 2B95A 5DF9A 1K54C 1OT9A 2PR5A 5TJJA 5HAPA 1ALQA 4P6BA 5GL9A 5FSRA 2V1ZA 4OPQA 5F5YA 4KUOA 3G34A 3ZG8B 3UB9A 3TG9A 2W1TA 2VV8A 3TRCA 3G4PA 1NRFA 4E3KA 3BQAA 5CTNA 4GB7A 1KE0A 4X55A 3MMHA 2WZXA 4QHCA 1L0GA 3HLCA 1TS0A 3R7WB 2FFYA 3LICA 2ZM2A 5F82A 2Y2HA 3H7WA 4K0WA 3FKVA 3NHQA 5HL1A 4CLCB 2JKRI 3H82B 4I5SA 1H0MA 1M40A 2PRFA 1TEMA 3T4LA 3HUOA 2QPNA 1XJ6A 4LGWA 3IHBA 3WS0A 3F1OA 3WWXA 4ZDXA 1WE4A 1M6KA 4GCZA 4U3TA 4BD1A 5EUAA 1BSGA 1W63Q 2PBYA 1F98A 4Y17A 2XA7M 3FKWA 2ZMVA 4P87A 3TW8A 2ZM8A 2NUTC 1FILA 1CK3A 4JF6A 1DP6A 2Z2LB 3C2WA 4LCMA 2K2NA 3W4QA 3PTEA 4NEED 3W2ZA 4Y0OA 4S2OA 4EETB 4FD8A 4LV1A 4YINA 2INWA 5FA7A 4FH4A 3MBZA 4S2NA 3LIFA 2NUPC 4DJ3A 3DWZA 1K55C 4HJ3A 1W63M 2VX8A 2M7UA 5GHYA 3P09A 4EXOA 2JKGA 4OOYA 1K56A 4ZJ3A 2HDQA 4ETZA 2XD1A 3LR5A 4MLLA 3K2NA 2R78A 1AXBA 5HD5A 1X0OA 3WS1A 2O9AA 2ZD8A 3EEHA 4C3QA 2PT7A 2VA0A 3KYZA 5L2FA 4PM7A 4DDSA 3GV9A 1K54A 4Y15A 4MBKA 3S7PA 1C3BA 3N8SA 4MBFA 3KSGA 3ZG9B 4OOLA 4O8GA 3C4OA 1D7EA 1YPRA 2QJ5A 1K4EA 4JXSA 5JYOA 1NLYA 4Y2FA 3UPNA 2JKFA 2D01A 3CJMA 1FIKA 3MZFA 4K08A 4ZTKA 4OLGA 5FQMA 4UA7A 2ZC7A 4KZ3A 3QP2A 3G31A 1CEFA 5DTSA 4S2PA 2PBDP 3M6HA 1BLSA 4QD4A 1BT5A 3O86A 4WZ4A 3LFVA 5EOEA 1BLCA 1UGUA 1NYMA 3PHYA 2ZMAA 3F1PA 1YLJA 2WADA 4PM9A 3DTEA 3EEAA 1JTGA 2A24A 4RX3A 1MPLA 1YLZA 4DE0A 4CLCC 2FH5A 3LIAA 4OPZA 3ZVTA 4QY5A 3O88A 5L09A 2LB9A 4NK3A 3ZGAB 4OPRA 4KZBA 1OTDA 4S2IA 4N1XA 3MQOA 1E3UD 4BWIA 4XT2B 1PI4A 1S4SA 3RTYA 1XFQA 1L0DA 4MBHA 3R4KA 3KO6A 3BECA 4P85A 2BG1A 4IUKA 2VJWA 3MQ0A 2X02A 3PBRA 4BMWA 2W3HA 2HP5A 1OTAA 3IWOA 2HGVA 3DW0A 4WL9A 1G5UA 5EV0A 1TD5A 1K55A 5TGFA 1GSWA 4Q0JA 5FQIA 2MJ6A 3S7QA 4R70A 3FPWA 3UB5P 1V9ZA 3E4QA 4ZAMA 3FV7A 3P01A 4I3IA 1Y54A 1IYQA 4M4XA 5EM1A 5EVID 2CMNA 1JTDA 3HLGA 1DJBA 4IVIA 3IWQA 3HLFA 2WAFA 3S22A 4OP8A 5GLDA 3OC2A 1XA1A 3BRMA 3UN7A 1JWVA 1KDSA 4OQGA 4GDBA 4UQIS 4I39A 4OH0A 2UWXA 1UWPX 2Y2KA 5G4YA 2R9WA 1ONHA 1LL5A 1NY0A 3QNBA 1CEGA 1MY8A 1L0EA 4WYYA 4B4ZA 3M6BA 2H10A 1JVJA 2WKIA 3O87A 4E3IA 1JWZA 4MNRA 3ZG7B 2WGIA 3G2YA 3WS4A 3VOZA 2KOIA 3U2AA 1NXYA 1BTLA 1LI0A 2O9CA 1HLUP 3F1NB 1YLWA 1O07A 5HDCA 3NDEA 5KIZA 2EA9A 4GNUA 4II7A 1KGEA 4PMAA 3IT9A 3MFDA 3R7WA 2C6WB 2EXAA 3SS5A 4LV3A 3UB7A 3Q07A 2WKQA 2WKHA 4IVKA 5LBRA 5MC7A 4CLCA 5J3WA 5HWWA 4JBFA 3H82A 2HPBA 2OAQ1 4RX2A 4R6LA 1GA9A 3ICYA 3GRJA 3UDXA 4WZ5C 2WKRA 2YKHA 2H0TA 1OT6A 4LV2A 4KQRA 4HP4A 4WELA 2H5SA 4PKYG 2B18A 3LR0A 1RCJA 3PXPA 3T1QB 1J9MA 1KVLA 1LHYA 1XJ3A 3T12B 4GD6A 4R4RA 5E2GA 3K3DA 2XD5A 1BZAA 3JYIA 3DTIA 2O99A 2I9VA 3T4JA 3E2LA 2VGLS 5G4ZA 1DJAA 5FAOA 1LSXA 1H8YA 3NOPC 2D02A 4KENB 3IH8A 4KG5A 4MN5A 1W7FA 3VSKA 3BFGA 5AQ9A 3GMWA 4KUKA 4OKPA 2H28A 3OPRA 3UB6A 2C5WB 3DTKA 4KZ6A 1GHIA 2XDMA 4BBTA 3M2KA 3VP1A 3LR3A 3Q7VB 5BOHA 5E2HA 1XJ2A 4MCWA 5GLAA 3NOTC 1PI5A 3HUMA 4JXWA 4LENA 3GECA 3PBTA 1YSQA 1HTZA 1ONGA 4KG6A 3PR6A 1W8YA 5FQJA 2J3TD 5IT5A 3DWKA 3IWIA 5CXWA 3LGOA 5E2EA 4BENA 2HZ5A 3WRZA 2VGJA 4E3MA 4XXRA 2HDSA 1DY6A 1A0KA 4UA9A 4IJGA 1LL8A 1S6RA 2W3GA 1SKOB 3UE3A 1YQSA 2IWBA 4QY6A 5E2FA 4P6ZS 3IQAA 4EW7A 1SDNA 4F3LB 3A0SA 2VK3A 4YWZA 5FAPA 1KDWA 1S1ZA 1IOUA 4FH2A 1PFLA 3MF0A 3EOIA 2EX9A 1K0KA 2JCHA 1I2SA 3EGDC 2G2UA 1MC0A 4UHUA 1F2KA 5FQ9A 4XUXA 2PU4A 5FAQA 2OV5A 5FEGA 3MS6A 4EESA 3T4OA 4X1MA 1FCOA 3B42A 5HFOA 4E6WA 5CERA 4R3AA 2Z6CA 3MQQA 4HJ4A 1ACFA 5M19A 1F5MA 2ZMFA 2ZQDA 4I3AA 1TS7A 4Y3IA 3ZQ5A 2Y8HA 5CTMA 3IX4A 5AQAA 1I2WA 2EFUA 2IWDA 1PWCA 2GNXA 3BW6A 4EEPA 2OSUA 2DRWA 4H6JB 3EWKA 3O5YA 2ZOIA 3AGDA 3VSLA 1XX2A 4GW9A 1T1AA 5FI7A 3IS2B 3VFFA 2XF3A 2V0UA 2PYPA 4EQ1A 5FEFA 1EWZA 3KSHA 2QKPA 4G3VA 2G7UA 1L0FA 3CG5A 3PAEA 3FPVA 4ME4A 2OWHA 1VQQA 3HREA 2V20A 4Q0IA 2OLUA 1U60A 3A3EA 3MFXA 1I5QA 3HCYA 3T1SA 1P9WA 4OVDA 3LIDA 2Y2PA 4X25A 1ODVA 5CEDA 3DBAA 5DTKA 2VV7A 1ZC2A 1MKIA 3N8LA 3LCEA 5CGSA 3QP4A 3BM6A 1TS6A 3JVVA 1Z6FA 1SZVA 2J9PA 5DFXA 3NC8A 1H3QA 1Y28A 3VMAA 4FTXA 4QJGA 3MSHA 2L4RA 1XGJA 2X01A 4AFIA 2ZC3B 3N8RA 5TR7A 5GHZA 1Q2PA 5DKLA 2AVXA 4B88A 1YMSA 1YLTA 4JPMA 1AWIA 3ZG5A 2RL3A 3S7NA 3GDIA 4GD8A 3A3IA 3Q7ZA 4DN0A 3F1NA 5EVIB 3D9YA 4X6TA 3UMDA 2B02A 1LL9A 4DE2A 1W79A 3NBLA 3GR2A 4O01A 1XJ4A 1VETB 1NRJA 5TFQA 1OTIA 2J3WA 3WS5A 3BY9A 3W4OA 1XGIA 4E6XA 2ZQ9A 1H5XA 1OTBA 4JKTA 4S2LA 4N9LA 1CI8A 1DP8A 2ZOHA 3N6IA 4EBPA 1MWSA 1ZG6A 4ESPA 1XXMA 5HDDA 2V2FF 3IBJA 1OJGA 1ES2A 1Y4OA 3JPUA 3GTCA 3ZHHA 4R1GA 3IXGA 4WMCD 3S4XA 4ARZA 3QHYA 5CECA 5A93A 4UA6A 5DJUA 4DF6A 2XFSA 2XFTA 1S66L 4N1HA 2DNSA 1GHPA 4NG2A 4GDNA 5FDSA 2OLVA 2HP9A 2KDKA 4R0QA 3NCKA 4CJNA 4ETXA 3IF5A 4KZ9A 3C30A 3CITA 4GHIB 4BL3A 5E43A 4JGOA 1GHMA 3RH8B 4EWFA 4EQIA 3UB8A 1TS8A 5JYPA 2OAP1 3PBQA 2RCXA 3NECA 5GLCA 3HJKA 4HQAA 1MWRA 4NKPA 4XUZA 5GHXA 3ITBA 5CHUA 1FCNA 3E98A 4O7DA 5EFWA 2PDRA 3HLBA 2EX2A 3Q7VA 5HPIA 2VGKA 4R3JA 4HH2A 3L7HA 2VKSA 3KSIA 2K7SA 2XSSA 1EROA 3E4OA 4EV4A 2PYRA 3MZDA 5HAIA 2J80A 5D3OA 3B3XA 4KQOA 1RGYA 3W4PA 1K57C 2H0YA 2QJ7A 2G2WA 2PAVP 2LB5A 5IS1A 4GJ4A 1SKOA 1SKFA 1YMXA 3UE0A 1VHMA 1J3WA 2OWJA 2QYBA 4I38A 3I7JA 2XLNA 4F3LA 1VEUB 5L07A 4B93A 5J8XA 2A3UA 3L9KA 1T18A 4G3WA 4EBNA 2R9XA 3IXDA 4X69A 5DVAA 5EECA 1NLZA 3VP0A 3MXSA 5EVIC 5IHVA 4E3LA 2Q9NA 4QU3A 1SDEA 2E8IA 3BJNA 4HI4A 1JNUA 5AJGA 1MZUA 3LEZA 3QP1A 1PWDA 3RFBA 5EVEA 2JKTM 1S67L 2QZ6A 3HLDA 2L0WA 3VOYA 1GCEA 3D3OA 3CI6A 3ZNYA 3CAXA 4FUWA 5FASA 4LFUA 2ZL1B 2ZQ7A 2XK1A 4BD0A 1H8MA 2XGNA 3C7UA 1YLPA 4NXBA 3UO9A 1IYOA 1K4FA 2XR0A 1L2SA 4H6JA 5HDSA 5AQBA 2JC7A 4DE1A 3KSFA 4DXCA 1K38A 3HLEA 3IS2A 3CMZA 2GX5A 3IBRA 5HPFA 2ZBBA 1F9IA 3V67A 1DRMA 1KVMA 1ZKJA 3BFCA 3A0RA 5F69A 3G30A 3OOVA 3ULFA 2JKRM 4L9GA 5EOOA 1UWNX 4OQ0A 3UNWA 4I3JA 4N9KA 2ZC5B 2WK0A 4X53A 1T1BA 2JE5A 4R23A 3FZCA 3TJZC 1E3UA 1T19A 4FOFA 1N9LA 5F68A 5J7EA 3BY8A 3IH9A 3BFEA 1W8QA 3FC7A 2EXBA 2XA7S 4HNBA 1TVFA 5EM0A 1YT4A 3UDIA 1K57A 2ZJ9A 4U0TA 3G35A 4R38A 3GVBA 5M1AA 1YKDA 2FZ0A 5CHMA 5FI2A 4IUHA 5EE8A 2KX6A 5A91A 3VP4A 1NZOA 5HX9A 3NULA 2V9AA 5FL3A 1ERMA 3BQ8A 5L8MA 4X68A 2VV6A 1G68A 2XQZA 3SS4A 1RGZA 5DKKA 5EVIA 2J7VA 2V1AA 2ZQCA 1KE4A 3NOUC 3E4PA 1FCMA 1LLBA 3LY3A 4HHDA 4NXFA 3ZVWA 4X1LA 2J3TC 3D4FA 3HL9A 2Y2JA 3P98A 1W5DA 5HWTA 3VP2A 3T4KA 3ZFZA 3ISGA 3WS2A 4IEDA 4L9EA 4PM6A 3ITAA 3Q81A 3IX3A 3M2JA 4QPRA 2P08A 2Y91A 3MJQA 2JHEA 3HJIA 4D60A 1NYYA 5FQKA 1TDGA 3QP6A 3TOIA 2EX6A 2QHKA 1XKZA 3OLOA 4ZBEA 1DP9A 4DDYA
chains in the Genus database with same CATH topology
1Y28A 2K31A 4HP9A 2L4RA 4B9OA 3MR0A 2LB9A 4LLOB 4MMNA 1OTDA 3PBOA 4AFIA 3MQOA 3VE4A 2HV1A 4BWIA 3LIBA 4XT2B 4UEYA 1S4SA 3RTYA 1XFQA 2M1CA 3R4KA 2BASA 3C8CA 3KO6A 4L0LA 1YAXA 4RQ9A 4GHIA 5DKLA 2L1MA 4JGRA 3MXQA 4FSFA 4WF0A 4IUKA 4MDZA 2VJWA 3GDIA 3S7NA 4MN7A 3MQ0A 3JVUA 3TE8A 4DN0A 3PBRA 4BMWA 3F1NA 1LSWA 2W3HA 4L9FA 4CLCE 3UMDA 1OTAA 2B02A 4LRZE 3T4TA 3SW1A 4JGQA 2HGVA 2Y79A 3H9WA 4O01A 3LIEA 4WL9A 4UQIM 1XJ4A 4WLAA 4ARZB 1NRJA 2EWWA 3OCLA 3KX0X 1TD5A 1OTIA 2J3WA 1GSWA 3PBNA 4Q0JA 4XT2A 3BY9A 2MJ6A 3CUEC 3S7QA 4E04A 4R70A 4DMZA 3LR4A 3FPWA 5I5LA 5TBMA 1V9ZA 3FG8A 3E4QA 1OTBA 3P01A 1DP8A 4I3IA 4DJ2A 2ZOHA 4M4XA 3F1PB 2CMNA 5HDDA 3S7OA 5A8BA 3IBJA 2WKPA 1OJGA 5HL6A 3OC2A 2OOLA 2A24B 2P04A 3PBSA 1XFNA 4ZRRA 3LYXA 3G6OA 5AVEA 4ARZA 5HZHA 2VLGA 4UQIS 4I39A 5DJUA 1UWPX 5G4YA 3OBFA 1S66L 1MKMA 5CX7A 2PR6A 2HJEA 2W3EA 4G3KA 2KDKA 4JGPA 4ETXA 2HJ9C 3C30A 2W3DA 3CITA 1KOUA 4GHIB 4JGOA 2PHYA 3RH8B 3UB8A 4HOIA 3VE3A 1TS8A 5IU1A 4Y5FA 2KOIA 3U2AA 4EEUA 2OAP1 3PBQA 2VEAA 1G28A 2O9CA 1P0ZA 2VZWA 2Z6DA 3LUQA 3HJKA 3F1NB 4HQAA 4NKPA 1EW0A 5HDCA 4O0PA 4GS9A 5KIZA 4BBVA 1OTEA 2EA9A 3E98A 3OCNA 5EFWA 2PDRA 1T1CA 4PAUA 5HPIA 3KYQA 4II7A 4HH2A 3R7WA 2VKSA 5DJTA 3KSIA 3UE6A 2VGLM 3T4QA 2K7SA 2GJ3A 2KLIA 3UB7A 2XSSA 2WKQA 3E4OA 3C38A 5LBRA 5TBMB 5MC7A 5J4EA 4CLCA 2PYRA 5J3WA 5HWWA 3H82A 2J80A 2OAQ1 4BBUA 1GSVA 1TF1A 2PD8A 3ICYA 4OOMA 4R6LA 4KQOA 2EWVA 1YSPA 4HIAA 2WKRA 2YKHA 5KSHA 1OT6A 3T4SA 1LT0A 4LPZA 4HP4A 4MN6A 4WELA 2QJ7A 4PKYG 2B18A 3LR0A 3LI8A 3PXPA 2A2LA 1S1YA 2LB5A 1XJ3A 5IS1A 4GJ4A 4GLQA 1V9YA 5C5KA 2GZAA 2P7JA 1D06A 1VHMA 3ZYTA 2OWJA 1VB6A 4NXGA 2QYBA 3K3DA 2JKTI 4I38A 3B47A 3CLOA 2O99A 2I9VA 3T4JA 4F3LA 4B93A 2QWSA 4HH3A 2V1BA 2VGLS 5G4ZA 5HWVA 1T18A 4G3WA 1WA9A 5DF9A 1LSXA 4IHQA 1OT9A 2PR5A 2XRNA 5TJJA 4EU0A 3NOPC 2D02A 1LSVA 1NLZA 4MN5A 5F5YA 4KUOA 2YKFA 2HF6A 4KUKA 2O9BA 3UB9A 1STZA 2H28A 4KQDA 3CUEA 2W1TA 3UB6A 3BJNA 4HI4A 1JNUA 5AJGA 1MZUA 2VV8A 3TRCA 3BQAA 1ZHHB 3RFBA 2JKTM 1S67L 4BBTA 3MMHA 4GS9B 3E0YA 3LR3A 2L0WA 1TS0A 1G6OA 4P6ZM 4LRYC 3D3OA 5HD3A 3CI6A 3CAXA 3R7WB 2W1RA 1XJ2A 4MCWA 2IA2A 3LICA 3NOTC 2W27A 2JN7A 1NWZA 4HY8A 4WEKA 2O0YA 2V0WA 3T50A 3VOLA 3H7WA 3GECA 3PBTA 1YSQA 3EQUA 4Q0HA 3NHQA 4CLCB 3VV4A 2JKRI 3P7NA 3H82B 1H8MA 3PR6A 4I5SA 2J3TD 4NXBA 2W0NA 5IT5A 3T4LA 3BWLA 4WEJA 1XJ6A 4H6JA 5HDSA 3NJAA 3F1OA 4GCZA 3KSFA 4IJGA 1LL8A 2W3GA 3UE3A 1W63Q 2XROA 3IS2A 2GX5A 3IBRA 1F98A 5HPFA 4P6ZS 2XA7M 2ZBBA 1F9IA 2ZMVA 4EW7A 3V67A 3TW8A 4CLCD 1DRMA 1OJ5A 3A0SA 4F3LB 4YWZA 2NUTC 1OPXA 3A0RA 1S1ZA 5F69A 3OOVA 3ULFA 2JKRM 4L9GA 3D72A 1IOUA 1UWNX 1P97A 2DMWA 1BYWA 1DP6A 3MF0A 4I3JA 3C2WA 2K2NA 3K3CA 3EOIA 5AVFA 4NEED 3W2ZA 1T1BA 3EGDC 4EERA 4EETB 1MC0A 3TJZC 2INWA 1IFQA 2W1TB 3LIFA 1T19A 2NUPC 4FOFA 1N9LA 5F68A 4EESA 3T4OA 3BY8A 5J7EA 3B42A 4DJ3A 3CWFA 4HJ3A 4R3AA 1W63M 2VX8A 4WN5A 2M7UA 2Z6CA 3MQQA 3FC7A 4HJ6A 4HJ4A 2W3FA 3EGXC 2XA7S 5DFYA 4HNBA 4EXOA 3PYPA 4YOFA 1F5MA 2ZMFA 4ETZA 3LR5A 4R38A 3K2NA 3H7WB 2R78A 4I3AA 1YKDA 2FZ0A 5HD5A 4IUHA 1TS7A 2KX6A 1X0OA 4Y3IA 1P9RA 3ZQ5A 1ZTUA 2O9AA 2Y8HA 3EQVA 4YNRA 3EEHA 2PT7A 2VA0A 5F6AA 3KYZA 2V9AA 5FL3A 1N9NA 2GNXA 3BW6A 4EEPA 1GSXA 4H6JB 3EWKA 5HSQA 3BQ8A 3F1OB 3O5YA 2ZOIA 3S7PA 5L8MA 4GW9A 2VV6A 3KSGA 1T1AA 5DKKA 3IS2B 3A0VA 2V0UA 4OOLA 4O8GA 5K5BA 1D7EA 2M7VA 2PYPA 2QJ5A 4EQ1A 3KSHA 4CQHA 2QKPA 4PHTA 1NLYA 4G3VA 2G7UA 4Y2FA 2V1AA 2D01A 3FPVA 4ME4A 3NOUC 2OWHA 3E4PA 4K08A 4Z1WA 4HHDA 4NXFA 4Q0IA 2J3TC 4LRXC 5HWTA 2PD7A 3MFXA 3B33A 3T4KA 1N9OA 3HCYA 3LFVA 4L9EA 1P9WA 1UGUA 3LIDA 1ODVA 4QPRA 3PHYA 2P08A 1S4RA 3F1PA 3DBAA 3UMEA 2VV7A 4NXEA 4PKYA 3MJQA 4WUJA 2JHEA 3HJIA 1TS6A 3JVVA 4BJPA 3EEAA 3LI9A 2A24A 5DFXA 2QHKA 3OLOA 1H3QA 4EUVA 1DP9A 4CLCC 2FH5A 3LIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EGX C;  1H8M A;  1IOU A;  2NUP C;  4B93 A;  3BW6 A;  2NUT C;  2VX8 A;  3KYQ A;  2DMW A;  3EGD C;  4AFI A;  1IFQ A; 
#chains in the Genus database with same CATH topology
 3ZCZ A;  4HP9 A;  4EBL A;  1N4O A;  4Y0U A;  5CHJ A;  4LLO B;  1FSY A;  2Q9M A;  3PBO A;  3VE4 A;  2HV1 A;  4E3J A;  1FQG A;  1ES3 A;  2M1C A;  5FDH A;  4L0L A;  4RQ9 A;  4GHI A;  2PU2 A;  2E8J A;  4WF0 A;  3SOI A;  1K56 D;  4MN7 A;  4WZ5 A;  2ZM0 A;  3TE8 A;  1O7E A;  1E4D A;  1LSW A;  4CLC E;  3MZE A;  3E2K A;  2X71 A;  2Y79 A;  4UAA A;  3SH9 A;  1E25 A;  3LIE A;  4UQI M;  2WGW B;  4WLA A;  3PBN A;  4XT2 A;  2Y2I A;  3CUE C;  4E04 A;  4DMZ A;  3MKE A;  3LR4 A;  3NI9 A;  2V8C A;  3FG8 A;  3QNC A;  1MWT A;  3ZG0 A;  4HBU A;  2V8F A;  1KGG A;  4K0X A;  3S7O A;  3O3V A;  4RVA A;  5A8B A;  1BUL A;  2P9V B;  4DKI A;  3A3J A;  3NIA A;  3UPO A;  3SZT A;  2P04 A;  1L3L A;  1XFN A;  3OPP A;  3BEB A;  1CF0 A;  3LYX A;  3G6O A;  1PW8 A;  2EX8 A;  2Y2M A;  2WYX A;  4IBR A;  1SCW A;  1VEU A;  5FAT A;  1MKM A;  2HJE A;  2ZC4 B;  1PZO A;  2B5R A;  2W3E A;  4ZJ2 A;  4N92 A;  3CHW P;  3Q1F A;  4OLD A;  2HJ9 C;  3FWL A;  2CC1 A;  5HW3 A;  1H8Z A;  4D2O A;  5G18 A;  1XP4 A;  4JF5 A;  2I72 A;  4OQI A;  4HOI A;  3VE3 A;  5FQQ A;  5IU1 A;  4Y5F A;  2Y4A A;  4ZJ1 A;  1N9B A;  2Z6D A;  3LUQ A;  4HES A;  4OPY A;  4C75 A;  1YM1 A;  4O0P A;  4BBV A;  1T1C A;  4PAU A;  2FFF B;  3IX8 A;  3OPL A;  1CQA A;  3UE6 A;  2VGL M;  3A3F A;  2GJ3 A;  1ES4 A;  3DTM A;  1IYP A;  2ZL1 A;  3C38 A;  5TBM B;  1IKI A;  5J4E A;  2J8Y A;  4Z9Q A;  4BBU A;  1GSV A;  3QP8 A;  3BLS A;  2EWV A;  1YSP A;  4EUZ A;  2XEP A;  5KMW A;  4CPK A;  3RXX A;  3T4S A;  1LT0 A;  4LPZ A;  1MWU A;  3VFH A;  5M18 A;  3IF6 B;  1NZU A;  2P74 A;  3T1X A;  2GZA A;  2P7J A;  2HDR A;  2JBF A;  4NXG A;  3B47 A;  3CLO A;  4S2J A;  5HWV A;  1Z09 A;  1PWG A;  1WA9 A;  1CI9 A;  1FSW A;  4IHQ A;  2XRN A;  1KE3 A;  3MXR A;  1Q2Q A;  4EU0 A;  4RYE A;  2UV0 E;  1LSV A;  1ZG4 A;  4Y13 A;  2YKF A;  2HF6 A;  5DTT A;  2O9B A;  1STZ A;  4KQD A;  4F94 A;  3CUE A;  1MBL A;  5HAQ A;  4GOG A;  1ZHH B;  5F83 A;  1HVB A;  3CPT B;  4GS9 B;  3HBR A;  3E0Y A;  3V3S A;  1HD8 A;  1G6O A;  3HUN A;  4P6Z M;  3OPH A;  4LRY C;  5HD3 A;  3BFD A;  4S2K A;  2W1R A;  1YLY A;  2IA2 A;  4DXB A;  1OME A;  2W27 A;  2JN7 A;  1NWZ A;  4HY8 A;  4WEK A;  2O0Y A;  2V0W A;  3T50 A;  3IXB A;  4JXV A;  3VOL A;  1IEL A;  3EQU A;  4Q0H A;  3VV4 A;  3P7N A;  2J9O A;  5AQ7 A;  2ZQ8 A;  2W0N A;  1S0W A;  4JF4 A;  3BWL A;  4WEJ A;  2WUQ A;  1IKG A;  3NJA A;  4GZB A;  3KYE A;  3FYZ A;  4LCL A;  2GDN A;  5F1F A;  2XRO A;  1HZO A;  1PYY A;  4H8R A;  3U4L P;  3N7W A;  1PRQ A;  1DJC A;  1BLP A;  4CLC D;  1OJ5 A;  1MXO A;  1OPX A;  3RXW A;  4PPR A;  2Y55 A;  5CRF A;  1PW1 A;  3D72 A;  4A5R A;  4R4S A;  4PM5 A;  1FOF A;  1P97 A;  2DMW A;  5CGX A;  1BYW A;  3IXH A;  1JWP A;  3K3C A;  4WBG A;  5AVF A;  4EER A;  1WYC A;  4FCF A;  4OP5 A;  3WRT A;  1IFQ A;  2W1T B;  3CWF A;  4WN5 A;  2DCF A;  4HJ6 A;  4OON A;  2W3F A;  3EGX C;  5DFY A;  1ERQ A;  3C4P A;  3QP5 A;  3PYP A;  4LV0 A;  4YOF A;  4KZ4 A;  3H7W B;  3A3D A;  1P9R A;  1ZTU A;  2Y2N A;  3EQV A;  3NY4 A;  4YNR A;  4R3B A;  3ZNT A;  1QMF A;  4ID4 A;  1SHV A;  5F6A A;  4YFM A;  4DRT A;  3SS3 A;  1N9N A;  3IF6 C;  4Y7P A;  2HP6 A;  1RP5 A;  1GSX A;  2Y59 A;  5HSQ A;  3F1O B;  3SH8 A;  1D1J A;  3BLM A;  3UY6 A;  4JLF A;  3LO7 A;  2A49 A;  3VP3 A;  3UPP A;  3A0V A;  4E3N A;  5A90 A;  5K5B A;  1KGF A;  2M7V A;  3AGE A;  3HLW A;  3T1R A;  4PHT A;  4CQH A;  2EFX A;  3UDF A;  3IHA A;  2Y2O A;  2WGW A;  1PIO A;  4Z1W A;  1CJF A;  5HAR A;  3PAG A;  3MKF A;  4WMC A;  1BUE A;  4JXG A;  4LRX C;  2PD7 A;  3B33 A;  1XA7 A;  1N9O A;  2Y2L A;  1S4R A;  3UME A;  3S1Y A;  3NDG A;  1IEM A;  2WKE A;  4NXE A;  4PKY A;  4WUJ A;  4PM8 A;  2P9V A;  1GA0 A;  4GN2 A;  5KSC A;  4BJP A;  3LI9 A;  5DF8 A;  1TDL A;  4EUV A;  2K31 A;  5CGW A;  1K6R A;  5CEB A;  4U0X A;  4KZA A;  4Q8I A;  4B9O A;  2BTF P;  3MR0 A;  4MMN A;  3LY4 A;  1ESI A;  1ESU A;  2WZZ A;  3LIB A;  4UEY A;  4HBT A;  4BQM A;  4NET A;  3W8K A;  2BAS A;  3C8C A;  1YAX A;  4Y0T A;  3V50 A;  2L1M A;  4JGR A;  3MXQ A;  4FSF A;  4BL2 A;  4MDZ A;  1EI5 A;  3GSG A;  3ZDJ A;  5I94 A;  4KQQ A;  4HEF A;  3JVU A;  2Q0O A;  2QMI A;  4L9F A;  4QWO A;  2ZLY A;  2ZC6 B;  4LRZ E;  3T4T A;  1G6A A;  3SW1 A;  4JGQ A;  3H9W A;  1FR6 A;  4X56 A;  4ARZ B;  3C5A A;  2EWW A;  3OCL A;  3KX0 X;  4B4X A;  3UE1 A;  4OQH A;  2WGV A;  3HVF A;  4WM9 A;  5I5L A;  5TBM A;  2Z2M B;  5GLB A;  4DE3 A;  4DJ2 A;  2Y2G A;  4BLM A;  3F1P B;  2XH9 A;  3SH7 A;  4MEZ A;  2WKP A;  5HL6 A;  4KG2 A;  2OOL A;  4KZ7 A;  2A24 B;  3PBS A;  5A92 A;  3V5M A;  3IF6 A;  4RA7 A;  4ZRR A;  5AVE A;  5HZH A;  1VET A;  2VLG A;  1LI9 A;  5DF7 A;  3OBF A;  5EPH A;  5CX7 A;  2PR6 A;  4G3K A;  4JGP A;  2W3D A;  2WAE A;  1KOU A;  2ZQA A;  2PHY A;  4GKU A;  5F1G A;  4KZ8 A;  3BFF A;  4K91 A;  4EEU A;  2VEA A;  1BLH A;  1G28 A;  2VZW A;  1P0Z A;  3Q82 A;  1EW0 A;  3N4I A;  2BLS A;  2Y2Q A;  3CPT A;  4GS9 A;  4M3K A;  3V39 A;  4C6Y A;  1VM1 A;  1OTE A;  3OCN A;  3DAV A;  4QB8 A;  1K25 A;  3KYQ A;  5EVL A;  1ES5 A;  3GQZ A;  2ACG A;  4IBX A;  5DJT A;  3BYD A;  5U47 A;  3LEQ A;  1K6S A;  1WYB A;  4S2N C;  3T4Q A;  2KLI A;  1XPB A;  1IYS A;  3G32 A;  1PZP A;  4S2M A;  5KZH A;  1PNE A;  1TF1 A;  2PD8 A;  4OOM A;  3TSG A;  4P0M A;  4HIA A;  5KSH A;  3RJU A;  4MN6 A;  5L10 A;  1FR1 A;  3LI8 A;  2A2L A;  3C7V A;  4KZ5 A;  1S1Y A;  4GLQ A;  3CZD A;  3V3R A;  1V9Y A;  5C5K A;  2HDU A;  1D06 A;  3ZYT A;  1VB6 A;  2JKT I;  3OZH A;  2IWC A;  3AGF A;  1QME A;  2QWS A;  4HH3 A;  2V1B A;  5FI6 A;  3G2Z A;  4E3O A;  1NJ4 A;  2B95 A;  5DF9 A;  1K54 C;  1OT9 A;  2PR5 A;  5TJJ A;  5HAP A;  1ALQ A;  4P6B A;  5GL9 A;  5FSR A;  2V1Z A;  4OPQ A;  5F5Y A;  4KUO A;  3G34 A;  3ZG8 B;  3UB9 A;  3TG9 A;  2W1T A;  2VV8 A;  3TRC A;  3G4P A;  1NRF A;  4E3K A;  3BQA A;  5CTN A;  4GB7 A;  1KE0 A;  4X55 A;  3MMH A;  2WZX A;  4QHC A;  1L0G A;  3HLC A;  1TS0 A;  3R7W B;  2FFY A;  3LIC A;  2ZM2 A;  5F82 A;  2Y2H A;  3H7W A;  4K0W A;  3FKV A;  3NHQ A;  5HL1 A;  4CLC B;  2JKR I;  3H82 B;  4I5S A;  1H0M A;  1M40 A;  2PRF A;  1TEM A;  3T4L A;  3HUO A;  2QPN A;  1XJ6 A;  4LGW A;  3IHB A;  3WS0 A;  3F1O A;  3WWX A;  4ZDX A;  1WE4 A;  1M6K A;  4GCZ A;  4U3T A;  4BD1 A;  5EUA A;  1BSG A;  1W63 Q;  2PBY A;  1F98 A;  4Y17 A;  2XA7 M;  3FKW A;  2ZMV A;  4P87 A;  3TW8 A;  2ZM8 A;  2NUT C;  1FIL A;  1CK3 A;  4JF6 A;  1DP6 A;  2Z2L B;  3C2W A;  4LCM A;  2K2N A;  3W4Q A;  3PTE A;  4NEE D;  3W2Z A;  4Y0O A;  4S2O A;  4EET B;  4FD8 A;  4LV1 A;  4YIN A;  2INW A;  5FA7 A;  4FH4 A;  3MBZ A;  4S2N A;  3LIF A;  2NUP C;  4DJ3 A;  3DWZ A;  1K55 C;  4HJ3 A;  1W63 M;  2VX8 A;  2M7U A;  5GHY A;  3P09 A;  4EXO A;  2JKG A;  4OOY A;  1K56 A;  4ZJ3 A;  2HDQ A;  4ETZ A;  2XD1 A;  3LR5 A;  4MLL A;  3K2N A;  2R78 A;  1AXB A;  5HD5 A;  1X0O A;  3WS1 A;  2O9A A;  2ZD8 A;  3EEH A;  4C3Q A;  2PT7 A;  2VA0 A;  3KYZ A;  5L2F A;  4PM7 A;  4DDS A;  3GV9 A;  1K54 A;  4Y15 A;  4MBK A;  3S7P A;  1C3B A;  3N8S A;  4MBF A;  3KSG A;  3ZG9 B;  4OOL A;  4O8G A;  3C4O A;  1D7E A;  1YPR A;  2QJ5 A;  1K4E A;  4JXS A;  5JYO A;  1NLY A;  4Y2F A;  3UPN A;  2JKF A;  2D01 A;  3CJM A;  1FIK A;  3MZF A;  4K08 A;  4ZTK A;  4OLG A;  5FQM A;  4UA7 A;  2ZC7 A;  4KZ3 A;  3QP2 A;  3G31 A;  1CEF A;  5DTS A;  4S2P A;  2PBD P;  3M6H A;  1BLS A;  4QD4 A;  1BT5 A;  3O86 A;  4WZ4 A;  3LFV A;  5EOE A;  1BLC A;  1UGU A;  1NYM A;  3PHY A;  2ZMA A;  3F1P A;  1YLJ A;  2WAD A;  4PM9 A;  3DTE A;  3EEA A;  1JTG A;  2A24 A;  4RX3 A;  1MPL A;  1YLZ A;  4DE0 A;  4CLC C;  2FH5 A;  3LIA A;  4OPZ A;  3ZVT A;  4QY5 A;  3O88 A;  5L09 A;  2LB9 A;  4NK3 A;  3ZGA B;  4OPR A;  4KZB A;  1OTD A;  4S2I A;  4N1X A;  3MQO A;  1E3U D;  4BWI A;  4XT2 B;  1PI4 A;  1S4S A;  3RTY A;  1XFQ A;  1L0D A;  4MBH A;  3R4K A;  3KO6 A;  3BEC A;  4P85 A;  2BG1 A;  4IUK A;  2VJW A;  3MQ0 A;  2X02 A;  3PBR A;  4BMW A;  2W3H A;  2HP5 A;  1OTA A;  3IWO A;  2HGV A;  3DW0 A;  4WL9 A;  1G5U A;  5EV0 A;  1TD5 A;  1K55 A;  5TGF A;  1GSW A;  4Q0J A;  5FQI A;  2MJ6 A;  3S7Q A;  4R70 A;  3FPW A;  3UB5 P;  1V9Z A;  3E4Q A;  4ZAM A;  3FV7 A;  3P01 A;  4I3I A;  1Y54 A;  1IYQ A;  4M4X A;  5EM1 A;  5EVI D;  2CMN A;  1JTD A;  3HLG A;  1DJB A;  4IVI A;  3IWQ A;  3HLF A;  2WAF A;  3S22 A;  4OP8 A;  5GLD A;  3OC2 A;  1XA1 A;  3BRM A;  3UN7 A;  1JWV A;  1KDS A;  4OQG A;  4GDB A;  4UQI S;  4I39 A;  4OH0 A;  2UWX A;  1UWP X;  2Y2K A;  5G4Y A;  2R9W A;  1ONH A;  1LL5 A;  1NY0 A;  3QNB A;  1CEG A;  1MY8 A;  1L0E A;  4WYY A;  4B4Z A;  3M6B A;  2H10 A;  1JVJ A;  2WKI A;  3O87 A;  4E3I A;  1JWZ A;  4MNR A;  3ZG7 B;  2WGI A;  3G2Y A;  3WS4 A;  3VOZ A;  2KOI A;  3U2A A;  1NXY A;  1BTL A;  1LI0 A;  2O9C A;  1HLU P;  3F1N B;  1YLW A;  1O07 A;  5HDC A;  3NDE A;  5KIZ A;  2EA9 A;  4GNU A;  4II7 A;  1KGE A;  4PMA A;  3IT9 A;  3MFD A;  3R7W A;  2C6W B;  2EXA A;  3SS5 A;  4LV3 A;  3UB7 A;  3Q07 A;  2WKQ A;  2WKH A;  4IVK A;  5LBR A;  5MC7 A;  4CLC A;  5J3W A;  5HWW A;  4JBF A;  3H82 A;  2HPB A;  2OAQ 1;  4RX2 A;  4R6L A;  1GA9 A;  3ICY A;  3GRJ A;  3UDX A;  4WZ5 C;  2WKR A;  2YKH A;  2H0T A;  1OT6 A;  4LV2 A;  4KQR A;  4HP4 A;  4WEL A;  2H5S A;  4PKY G;  2B18 A;  3LR0 A;  1RCJ A;  3PXP A;  3T1Q B;  1J9M A;  1KVL A;  1LHY A;  1XJ3 A;  3T12 B;  4GD6 A;  4R4R A;  5E2G A;  3K3D A;  2XD5 A;  1BZA A;  3JYI A;  3DTI A;  2O99 A;  2I9V A;  3T4J A;  3E2L A;  2VGL S;  5G4Z A;  1DJA A;  5FAO A;  1LSX A;  1H8Y A;  3NOP C;  2D02 A;  4KEN B;  3IH8 A;  4KG5 A;  4MN5 A;  1W7F A;  3VSK A;  3BFG A;  5AQ9 A;  3GMW A;  4KUK A;  4OKP A;  2H28 A;  3OPR A;  3UB6 A;  2C5W B;  3DTK A;  4KZ6 A;  1GHI A;  2XDM A;  4BBT A;  3M2K A;  3VP1 A;  3LR3 A;  3Q7V B;  5BOH A;  5E2H A;  1XJ2 A;  4MCW A;  5GLA A;  3NOT C;  1PI5 A;  3HUM A;  4JXW A;  4LEN A;  3GEC A;  3PBT A;  1YSQ A;  1HTZ A;  1ONG A;  4KG6 A;  3PR6 A;  1W8Y A;  5FQJ A;  2J3T D;  5IT5 A;  3DWK A;  3IWI A;  5CXW A;  3LGO A;  5E2E A;  4BEN A;  2HZ5 A;  3WRZ A;  2VGJ A;  4E3M A;  4XXR A;  2HDS A;  1DY6 A;  1A0K A;  4UA9 A;  4IJG A;  1LL8 A;  1S6R A;  2W3G A;  1SKO B;  3UE3 A;  1YQS A;  2IWB A;  4QY6 A;  5E2F A;  4P6Z S;  3IQA A;  4EW7 A;  1SDN A;  4F3L B;  3A0S A;  2VK3 A;  4YWZ A;  5FAP A;  1KDW A;  1S1Z A;  1IOU A;  4FH2 A;  1PFL A;  3MF0 A;  3EOI A;  2EX9 A;  1K0K A;  2JCH A;  1I2S A;  3EGD C;  2G2U A;  1MC0 A;  4UHU A;  1F2K A;  5FQ9 A;  4XUX A;  2PU4 A;  5FAQ A;  2OV5 A;  5FEG A;  3MS6 A;  4EES A;  3T4O A;  4X1M A;  1FCO A;  3B42 A;  5HFO A;  4E6W A;  5CER A;  4R3A A;  2Z6C A;  3MQQ A;  4HJ4 A;  1ACF A;  5M19 A;  1F5M A;  2ZMF A;  2ZQD A;  4I3A A;  1TS7 A;  4Y3I A;  3ZQ5 A;  2Y8H A;  5CTM A;  3IX4 A;  5AQA A;  1I2W A;  2EFU A;  2IWD A;  1PWC A;  2GNX A;  3BW6 A;  4EEP A;  2OSU A;  2DRW A;  4H6J B;  3EWK A;  3O5Y A;  2ZOI A;  3AGD A;  3VSL A;  1XX2 A;  4GW9 A;  1T1A A;  5FI7 A;  3IS2 B;  3VFF A;  2XF3 A;  2V0U A;  2PYP A;  4EQ1 A;  5FEF A;  1EWZ A;  3KSH A;  2QKP A;  4G3V A;  2G7U A;  1L0F A;  3CG5 A;  3PAE A;  3FPV A;  4ME4 A;  2OWH A;  1VQQ A;  3HRE A;  2V20 A;  4Q0I A;  2OLU A;  1U60 A;  3A3E A;  3MFX A;  1I5Q A;  3HCY A;  3T1S A;  1P9W A;  4OVD A;  3LID A;  2Y2P A;  4X25 A;  1ODV A;  5CED A;  3DBA A;  5DTK A;  2VV7 A;  1ZC2 A;  1MKI A;  3N8L A;  3LCE A;  5CGS A;  3QP4 A;  3BM6 A;  1TS6 A;  3JVV A;  1Z6F A;  1SZV A;  2J9P A;  5DFX A;  3NC8 A;  1H3Q A;  1Y28 A;  3VMA A;  4FTX A;  4QJG A;  3MSH A;  2L4R A;  1XGJ A;  2X01 A;  4AFI A;  2ZC3 B;  3N8R A;  5TR7 A;  5GHZ A;  1Q2P A;  5DKL A;  2AVX A;  4B88 A;  1YMS A;  1YLT A;  4JPM A;  1AWI A;  3ZG5 A;  2RL3 A;  3S7N A;  3GDI A;  4GD8 A;  3A3I A;  3Q7Z A;  4DN0 A;  3F1N A;  5EVI B;  3D9Y A;  4X6T A;  3UMD A;  2B02 A;  1LL9 A;  4DE2 A;  1W79 A;  3NBL A;  3GR2 A;  4O01 A;  1XJ4 A;  1VET B;  1NRJ A;  5TFQ A;  1OTI A;  2J3W A;  3WS5 A;  3BY9 A;  3W4O A;  1XGI A;  4E6X A;  2ZQ9 A;  1H5X A;  1OTB A;  4JKT A;  4S2L A;  4N9L A;  1CI8 A;  1DP8 A;  2ZOH A;  3N6I A;  4EBP A;  1MWS A;  1ZG6 A;  4ESP A;  1XXM A;  5HDD A;  2V2F F;  3IBJ A;  1OJG A;  1ES2 A;  1Y4O A;  3JPU A;  3GTC A;  3ZHH A;  4R1G A;  3IXG A;  4WMC D;  3S4X A;  4ARZ A;  3QHY A;  5CEC A;  5A93 A;  4UA6 A;  5DJU A;  4DF6 A;  2XFS A;  2XFT A;  1S66 L;  4N1H A;  2DNS A;  1GHP A;  4NG2 A;  4GDN A;  5FDS A;  2OLV A;  2HP9 A;  2KDK A;  4R0Q A;  3NCK A;  4CJN A;  4ETX A;  3IF5 A;  4KZ9 A;  3C30 A;  3CIT A;  4GHI B;  4BL3 A;  5E43 A;  4JGO A;  1GHM A;  3RH8 B;  4EWF A;  4EQI A;  3UB8 A;  1TS8 A;  5JYP A;  2OAP 1;  3PBQ A;  2RCX A;  3NEC A;  5GLC A;  3HJK A;  4HQA A;  1MWR A;  4NKP A;  4XUZ A;  5GHX A;  3ITB A;  5CHU A;  1FCN A;  3E98 A;  4O7D A;  5EFW A;  2PDR A;  3HLB A;  2EX2 A;  3Q7V A;  5HPI A;  2VGK A;  4R3J A;  4HH2 A;  3L7H A;  2VKS A;  3KSI A;  2K7S A;  2XSS A;  1ERO A;  3E4O A;  4EV4 A;  2PYR A;  3MZD A;  5HAI A;  2J80 A;  5D3O A;  3B3X A;  4KQO A;  1RGY A;  3W4P A;  1K57 C;  2H0Y A;  2QJ7 A;  2G2W A;  2PAV P;  2LB5 A;  5IS1 A;  4GJ4 A;  1SKO A;  1SKF A;  1YMX A;  3UE0 A;  1VHM A;  1J3W A;  2OWJ A;  2QYB A;  4I38 A;  3I7J A;  2XLN A;  4F3L A;  1VEU B;  5L07 A;  4B93 A;  5J8X A;  2A3U A;  3L9K A;  1T18 A;  4G3W A;  4EBN A;  2R9X A;  3IXD A;  4X69 A;  5DVA A;  5EEC A;  1NLZ A;  3VP0 A;  3MXS A;  5EVI C;  5IHV A;  4E3L A;  2Q9N A;  4QU3 A;  1SDE A;  2E8I A;  3BJN A;  4HI4 A;  1JNU A;  5AJG A;  1MZU A;  3LEZ A;  3QP1 A;  1PWD A;  3RFB A;  5EVE A;  2JKT M;  1S67 L;  2QZ6 A;  3HLD A;  2L0W A;  3VOY A;  1GCE A;  3D3O A;  3CI6 A;  3ZNY A;  3CAX A;  4FUW A;  5FAS A;  4LFU A;  2ZL1 B;  2ZQ7 A;  2XK1 A;  4BD0 A;  1H8M A;  2XGN A;  3C7U A;  1YLP A;  4NXB A;  3UO9 A;  1IYO A;  1K4F A;  2XR0 A;  1L2S A;  4H6J A;  5HDS A;  5AQB A;  2JC7 A;  4DE1 A;  3KSF A;  4DXC A;  1K38 A;  3HLE A;  3IS2 A;  3CMZ A;  2GX5 A;  3IBR A;  5HPF A;  2ZBB A;  1F9I A;  3V67 A;  1DRM A;  1KVM A;  1ZKJ A;  3BFC A;  3A0R A;  5F69 A;  3G30 A;  3OOV A;  3ULF A;  2JKR M;  4L9G A;  5EOO A;  1UWN X;  4OQ0 A;  3UNW A;  4I3J A;  4N9K A;  2ZC5 B;  2WK0 A;  4X53 A;  1T1B A;  2JE5 A;  4R23 A;  3FZC A;  3TJZ C;  1E3U A;  1T19 A;  4FOF A;  1N9L A;  5F68 A;  5J7E A;  3BY8 A;  3IH9 A;  3BFE A;  1W8Q A;  3FC7 A;  2EXB A;  2XA7 S;  4HNB A;  1TVF A;  5EM0 A;  1YT4 A;  3UDI A;  1K57 A;  2ZJ9 A;  4U0T A;  3G35 A;  4R38 A;  3GVB A;  5M1A A;  1YKD A;  2FZ0 A;  5CHM A;  5FI2 A;  4IUH A;  5EE8 A;  2KX6 A;  5A91 A;  3VP4 A;  1NZO A;  5HX9 A;  3NUL A;  2V9A A;  5FL3 A;  1ERM A;  3BQ8 A;  5L8M A;  4X68 A;  2VV6 A;  1G68 A;  2XQZ A;  3SS4 A;  1RGZ A;  5DKK A;  5EVI A;  2J7V A;  2V1A A;  2ZQC A;  1KE4 A;  3NOU C;  3E4P A;  1FCM A;  1LLB A;  3LY3 A;  4HHD A;  4NXF A;  3ZVW A;  4X1L A;  2J3T C;  3D4F A;  3HL9 A;  2Y2J A;  3P98 A;  1W5D A;  5HWT A;  3VP2 A;  3T4K A;  3ZFZ A;  3ISG A;  3WS2 A;  4IED A;  4L9E A;  4PM6 A;  3ITA A;  3Q81 A;  3IX3 A;  3M2J A;  4QPR A;  2P08 A;  2Y91 A;  3MJQ A;  2JHE A;  3HJI A;  4D60 A;  1NYY A;  5FQK A;  1TDG A;  3QP6 A;  3TOI A;  2EX6 A;  2QHK A;  1XKZ A;  3OLO A;  4ZBE A;  1DP9 A;  4DDY A; 
#chains in the Genus database with same CATH homology
 1Y28 A;  2K31 A;  4HP9 A;  2L4R A;  4B9O A;  3MR0 A;  2LB9 A;  4LLO B;  4MMN A;  1OTD A;  3PBO A;  4AFI A;  3MQO A;  3VE4 A;  2HV1 A;  4BWI A;  3LIB A;  4XT2 B;  4UEY A;  1S4S A;  3RTY A;  1XFQ A;  2M1C A;  3R4K A;  2BAS A;  3C8C A;  3KO6 A;  4L0L A;  1YAX A;  4RQ9 A;  4GHI A;  5DKL A;  2L1M A;  4JGR A;  3MXQ A;  4FSF A;  4WF0 A;  4IUK A;  4MDZ A;  2VJW A;  3GDI A;  3S7N A;  4MN7 A;  3MQ0 A;  3JVU A;  3TE8 A;  4DN0 A;  3PBR A;  4BMW A;  3F1N A;  1LSW A;  2W3H A;  4L9F A;  4CLC E;  3UMD A;  1OTA A;  2B02 A;  4LRZ E;  3T4T A;  3SW1 A;  4JGQ A;  2HGV A;  2Y79 A;  3H9W A;  4O01 A;  3LIE A;  4WL9 A;  4UQI M;  1XJ4 A;  4WLA A;  4ARZ B;  1NRJ A;  2EWW A;  3OCL A;  3KX0 X;  1TD5 A;  1OTI A;  2J3W A;  1GSW A;  3PBN A;  4Q0J A;  4XT2 A;  3BY9 A;  2MJ6 A;  3CUE C;  3S7Q A;  4E04 A;  4R70 A;  4DMZ A;  3LR4 A;  3FPW A;  5I5L A;  5TBM A;  1V9Z A;  3FG8 A;  3E4Q A;  1OTB A;  3P01 A;  1DP8 A;  4I3I A;  4DJ2 A;  2ZOH A;  4M4X A;  3F1P B;  2CMN A;  5HDD A;  3S7O A;  5A8B A;  3IBJ A;  2WKP A;  1OJG A;  5HL6 A;  3OC2 A;  2OOL A;  2A24 B;  2P04 A;  3PBS A;  1XFN A;  4ZRR A;  3LYX A;  3G6O A;  5AVE A;  4ARZ A;  5HZH A;  2VLG A;  4UQI S;  4I39 A;  5DJU A;  1UWP X;  5G4Y A;  3OBF A;  1S66 L;  1MKM A;  5CX7 A;  2PR6 A;  2HJE A;  2W3E A;  4G3K A;  2KDK A;  4JGP A;  4ETX A;  2HJ9 C;  3C30 A;  2W3D A;  3CIT A;  1KOU A;  4GHI B;  4JGO A;  2PHY A;  3RH8 B;  3UB8 A;  4HOI A;  3VE3 A;  1TS8 A;  5IU1 A;  4Y5F A;  2KOI A;  3U2A A;  4EEU A;  2OAP 1;  3PBQ A;  2VEA A;  1G28 A;  2O9C A;  1P0Z A;  2VZW A;  2Z6D A;  3LUQ A;  3HJK A;  3F1N B;  4HQA A;  4NKP A;  1EW0 A;  5HDC A;  4O0P A;  4GS9 A;  5KIZ A;  4BBV A;  1OTE A;  2EA9 A;  3E98 A;  3OCN A;  5EFW A;  2PDR A;  1T1C A;  4PAU A;  5HPI A;  3KYQ A;  4II7 A;  4HH2 A;  3R7W A;  2VKS A;  5DJT A;  3KSI A;  3UE6 A;  2VGL M;  3T4Q A;  2K7S A;  2GJ3 A;  2KLI A;  3UB7 A;  2XSS A;  2WKQ A;  3E4O A;  3C38 A;  5LBR A;  5TBM B;  5MC7 A;  5J4E A;  4CLC A;  2PYR A;  5J3W A;  5HWW A;  3H82 A;  2J80 A;  2OAQ 1;  4BBU A;  1GSV A;  1TF1 A;  2PD8 A;  3ICY A;  4OOM A;  4R6L A;  4KQO A;  2EWV A;  1YSP A;  4HIA A;  2WKR A;  2YKH A;  5KSH A;  1OT6 A;  3T4S A;  1LT0 A;  4LPZ A;  4HP4 A;  4MN6 A;  4WEL A;  2QJ7 A;  4PKY G;  2B18 A;  3LR0 A;  3LI8 A;  3PXP A;  2A2L A;  1S1Y A;  2LB5 A;  1XJ3 A;  5IS1 A;  4GJ4 A;  4GLQ A;  1V9Y A;  5C5K A;  2GZA A;  2P7J A;  1D06 A;  1VHM A;  3ZYT A;  2OWJ A;  1VB6 A;  4NXG A;  2QYB A;  3K3D A;  2JKT I;  4I38 A;  3B47 A;  3CLO A;  2O99 A;  2I9V A;  3T4J A;  4F3L A;  4B93 A;  2QWS A;  4HH3 A;  2V1B A;  2VGL S;  5G4Z A;  5HWV A;  1T18 A;  4G3W A;  1WA9 A;  5DF9 A;  1LSX A;  4IHQ A;  1OT9 A;  2PR5 A;  2XRN A;  5TJJ A;  4EU0 A;  3NOP C;  2D02 A;  1LSV A;  1NLZ A;  4MN5 A;  5F5Y A;  4KUO A;  2YKF A;  2HF6 A;  4KUK A;  2O9B A;  3UB9 A;  1STZ A;  2H28 A;  4KQD A;  3CUE A;  2W1T A;  3UB6 A;  3BJN A;  4HI4 A;  1JNU A;  5AJG A;  1MZU A;  2VV8 A;  3TRC A;  3BQA A;  1ZHH B;  3RFB A;  2JKT M;  1S67 L;  4BBT A;  3MMH A;  4GS9 B;  3E0Y A;  3LR3 A;  2L0W A;  1TS0 A;  1G6O A;  4P6Z M;  4LRY C;  3D3O A;  5HD3 A;  3CI6 A;  3CAX A;  3R7W B;  2W1R A;  1XJ2 A;  4MCW A;  2IA2 A;  3LIC A;  3NOT C;  2W27 A;  2JN7 A;  1NWZ A;  4HY8 A;  4WEK A;  2O0Y A;  2V0W A;  3T50 A;  3VOL A;  3H7W A;  3GEC A;  3PBT A;  1YSQ A;  3EQU A;  4Q0H A;  3NHQ A;  4CLC B;  3VV4 A;  2JKR I;  3P7N A;  3H82 B;  1H8M A;  3PR6 A;  4I5S A;  2J3T D;  4NXB A;  2W0N A;  5IT5 A;  3T4L A;  3BWL A;  4WEJ A;  1XJ6 A;  4H6J A;  5HDS A;  3NJA A;  3F1O A;  4GCZ A;  3KSF A;  4IJG A;  1LL8 A;  2W3G A;  3UE3 A;  1W63 Q;  2XRO A;  3IS2 A;  2GX5 A;  3IBR A;  1F98 A;  5HPF A;  4P6Z S;  2XA7 M;  2ZBB A;  1F9I A;  2ZMV A;  4EW7 A;  3V67 A;  3TW8 A;  4CLC D;  1DRM A;  1OJ5 A;  3A0S A;  4F3L B;  4YWZ A;  2NUT C;  1OPX A;  3A0R A;  1S1Z A;  5F69 A;  3OOV A;  3ULF A;  2JKR M;  4L9G A;  3D72 A;  1IOU A;  1UWN X;  1P97 A;  2DMW A;  1BYW A;  1DP6 A;  3MF0 A;  4I3J A;  3C2W A;  2K2N A;  3K3C A;  3EOI A;  5AVF A;  4NEE D;  3W2Z A;  1T1B A;  3EGD C;  4EER A;  4EET B;  1MC0 A;  3TJZ C;  2INW A;  1IFQ A;  2W1T B;  3LIF A;  1T19 A;  2NUP C;  4FOF A;  1N9L A;  5F68 A;  4EES A;  3T4O A;  3BY8 A;  5J7E A;  3B42 A;  4DJ3 A;  3CWF A;  4HJ3 A;  4R3A A;  1W63 M;  2VX8 A;  4WN5 A;  2M7U A;  2Z6C A;  3MQQ A;  3FC7 A;  4HJ6 A;  4HJ4 A;  2W3F A;  3EGX C;  2XA7 S;  5DFY A;  4HNB A;  4EXO A;  3PYP A;  4YOF A;  1F5M A;  2ZMF A;  4ETZ A;  3LR5 A;  4R38 A;  3K2N A;  3H7W B;  2R78 A;  4I3A A;  1YKD A;  2FZ0 A;  5HD5 A;  4IUH A;  1TS7 A;  2KX6 A;  1X0O A;  4Y3I A;  1P9R A;  3ZQ5 A;  1ZTU A;  2O9A A;  2Y8H A;  3EQV A;  4YNR A;  3EEH A;  2PT7 A;  2VA0 A;  5F6A A;  3KYZ A;  2V9A A;  5FL3 A;  1N9N A;  2GNX A;  3BW6 A;  4EEP A;  1GSX A;  4H6J B;  3EWK A;  5HSQ A;  3BQ8 A;  3F1O B;  3O5Y A;  2ZOI A;  3S7P A;  5L8M A;  4GW9 A;  2VV6 A;  3KSG A;  1T1A A;  5DKK A;  3IS2 B;  3A0V A;  2V0U A;  4OOL A;  4O8G A;  5K5B A;  1D7E A;  2M7V A;  2PYP A;  2QJ5 A;  4EQ1 A;  3KSH A;  4CQH A;  2QKP A;  4PHT A;  1NLY A;  4G3V A;  2G7U A;  4Y2F A;  2V1A A;  2D01 A;  3FPV A;  4ME4 A;  3NOU C;  2OWH A;  3E4P A;  4K08 A;  4Z1W A;  4HHD A;  4NXF A;  4Q0I A;  2J3T C;  4LRX C;  5HWT A;  2PD7 A;  3MFX A;  3B33 A;  3T4K A;  1N9O A;  3HCY A;  3LFV A;  4L9E A;  1P9W A;  1UGU A;  3LID A;  1ODV A;  4QPR A;  3PHY A;  2P08 A;  1S4R A;  3F1P A;  3DBA A;  3UME A;  2VV7 A;  4NXE A;  4PKY A;  3MJQ A;  4WUJ A;  2JHE A;  3HJI A;  1TS6 A;  3JVV A;  4BJP A;  3EEA A;  3LI9 A;  2A24 A;  5DFX A;  2QHK A;  3OLO A;  1H3Q A;  4EUV A;  1DP9 A;  4CLC C;  2FH5 A;  3LIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...