4AG1C

Human chymase - fynomer complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
b'VTLFVALYDYNATRWTDLSFHKGEKFQILEFGPGDWWEARSLTTGETGYIPSNYVAPVDSIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMASE
molecule tags Hydrolase/de novo protein
source organism Homo sapiens
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
total genus 12
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2012-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4ag1C00
3O5ZA 1AWJA 3M0PA 1GRIA 5L23A 2EVRA 3VS5A 2OI3A 4OMOA 1KFZA 2NUZA 2JMCA 1GFDA 2LNHB 1E6GA 2O2OA 4GBQA 1OPLA 1ZBJA 2B86A 1YP5A 1G2BA 3UA7A 4RUGA 4AG2C 5FW9A 2O9SA 1SHFA 2KNBB 2X3WD 1X6GA 2CUDA 1HSQA 1TUCA 4D8KA 2V1QA 2A37A 1MUZA 2L3PA 2W0ZA 1GBRA 2DE0X 1Y0MA 2AKLA 1SPKA 2DYBA 2L2PA 3U23A 3R6NA 3RNJA 3VS1A 1UJYA 2KYMA 2RMOA 3H0IA 4RTVA 1KIKA 2JMAA 2J7IA 1Y57A 2KXCA 2K3BA 1NYGA 2D0NA 1A0NB 2EGCA 1UECA 4AFQC 3NPFA 3VS3A 1M8MA 2CH4A 1WA7A 5GJVB 3EG2A 1H3HA 2P4RA 4Z8AA 2HBWA 3VRZA 1U06A 2DL3A 1UFFA 2RN8A 2M51A 4IIOA 4KRTA 1I1JA 2DM1A 2KYBA 5FWCA 4HVWA 3VRYA 2L3SA 1S1NA 4LNPA 2EYZA 1X6BA 1B3QA 3TSZA 2J6KA 1VYVA 3FJ5A 4JPBW 4GLMA 1GCQC 1MV3A 2DA9A 4AG1C 1HJDA 4Z89A 2VVKA 4QT7A 1W1FA 1ZUYA 2IIMA 3UA6A 1ABOA 1M3BA 3M0SA 5GJWB 5IH2A 2PNIA 2M0YA 5IHIA 2XMFA 2LP5A 2LMJA 2EYWA 2HEQA 3I5RA 1NG2A 2CT4A 1TG0A 2YUPA 1RI9A 4OMMA 2SEMA 2EQIA 2EYXA 2KE9A 3VS0A 1UJ0A 4DEXA 5ECAA 1UHFA 1H8KA 3TVTA 4OMPA 1JEGA 4Z88A 4JZ3A 2ABLA 2LCSA 4WCIA 1I07A 3EHQA 2C0OA 2KRSA 2YDLA 2JM9A 1AOJA 2EYYA 4K11A 1WX6A 4OMLA 1JXOA 1K0XA 4E6RA 1QWFA 1JO8A 2CSQA 2F2XA 2RQWA 2CREA 4EIKA 2PZ1A 2I0NA 1NYFA 4CC2A 1B07A 1CKBA 5I22A 5IHKA 1ARKA 2LJ0A 1K4US 2L3QA 2CH4W 1XOVA 2FO0A 2DNUA 4F14A 4J9BA 1E6HA 2D8HA 1YWOA 1G83A 1ZUKA 2YUOA 1NLOC 2GGRA 3H41A 2KROA 2A08A 1NLPC 2NWMA 1BB9A 4AFUC 1WYXA 2GQIA 2A36A 3SEMA 1RUWA 2O88A 4JJBA 2DF6A 5FWBA 2G6FX 4LE9A 5HCKA 1BU1A 4JJCA 2VWFA 1GBQA 4JJDA 2EW3A 2L0AA 2LJ1A 1IO6A 4AFSC 1NM7A 3VS7A 2MOXA 4LN2A 2O31A 1UTIA 3ZL7C 2AZSA 4J9CA 2YUQA 4HXJA 1QWEA 2FPDA 1X2KA 1AD5A 1T0JA 2J05A 2LQWA 1X27A 2MIOA 2RQRA 2JT4A 2EGEA 3EGUA 1SRLA 1OPKA 1WXTA 2D8JA 2FG0A 4HCKA 4CC7A 3VS6A 3H0HA 1I0CA 1K76A 2DILA 1T0HA 2YUNA 1M3CA 1LCKA 2KEAA 2K7AA 2BZ8A 3GBQA 2E5KA 2EBPA 4DEYA 2DX1A 2KGTA 1AVZC 4RTYA 1UDLA 1SRMA 2KT8A 2KBTA 1U3OA 3I9QA 2JS2A 2JM8A 1NEBA 2BZXA 2J06A 2CDTA 3C0CA 4OMQA 2GNCA 4RTTA 4OMNA 2DRKA 2EPDA 4A63B 4F17A 2ROTA 3I35A 1MV0B 3REAB 4ZNXA 4J9EA 1WXBA 3NGPA 3ULRB 3VS4A 3NHNA 4HVVA 1YN8A 1UG1A 2AKKA 3I5SA 5I11A 2LZ6B 2DL8A 2H8HA 1WFWA 1W70A 3SHWA 1KJWA 4ESRA 2W10A 1T3LA 1VA7A 3LH5A 4M4ZA 2ED0A 1PRLC 2DL7A 1K1ZA 2LJ3A 1YNZA 2LX7A 1Z9QA 2DL4A 1K0SA 2CUBA 1U5SA 3QWXX 3PE0A 2DRMA 4FSSA 4RTZA 5IXBA 4AFZC 1CKAA 4X1VA 2FEIA 3VS2A 2DL5A 1X69A 3UATA 3H0FA 1RLQC 2K6DA 3M0QA 2RQUA 3IQLA 3PVQA 2GTJA 4J9GA 1J3TA 1PRMC 2J6OA 1VYUA 4CC4B 2FRWA 2D1XA 2JW4A 2OAWA 1PHTA 3M0UA 1WXUA 1M30A 3PVLA 4Y92A 2PTKA 2KR3A 1T3SA 4JZ4A 1ZSGA 2A28A 1HD3A 1PKSA 1GCPA 2K79A 3RBBB 2DBMA 2JS0A 2FPEA 1SSHA 1FYNA 1V1CA 2SRCA 2ROLA 3NMZC 4J9HA 2EGAA 3CQTA 1X2QA 4J9FA 4CC3A 1JXMA 1CSKA 2DLPA 2OJ2A 1PKTA 2X3XD 5IHNA 2CT3A 4J9IA 2JXBA 3QWYA 1EFNA 2RQVA 2MCNA 2RF0A 2K9GA 4D8DA 1QLYA 2ECZA 1ZX6A 1FMKA 3EHRA 1AZGB 2BTTA 1X43A 1OEBA 4F16A 1AZEA 1ZUUA 1JU5C 1UE9A 1WIEA 1KSWA 1PNJA 1QKWA 2DMOA 2VKNA 2F2WA 1BBZA 1BK2A 1Z9ZA 2KRNA 3UF4A 2AZVA 3TSWA 1UUEA 2K2MA 3REBB 1OOTA 1YCSB 3EG1A 4IIMA 2RNAA 2HCKA 4LUEA 2ESWA 1W6XA 2DBKA 2DVJA 3THKA 2YT6A 1GL5A 1RLPC 2KRMA 5IXFA 1AWOA 1AWXA 1PWTA 2HDAA 3KFVA 1YWPA 1WDXA 1AWWA 3JV3A 1WI7A 4RTXA 1GFCA 1JQQA 3EG0A 1SHGA 2CSIA 4ORZA 3EG3A 1M27C 4J9DA 4R0KA 2YSQA 1UGVA 2QDLA 3M0TA 1TUDA 4HVUA 1E7OA 1QCFA 2GTOA 2C0IA 2KT1A 3M0RA 2V1RA 1WLPB 2J6FA 2C0TA 2AK5A 4RTUA 1UHCA 1GCQA 1VYTA 2FPFA 1ZLMA 2JTEA 2GBQA 2LQNA 1OV3A 2RQTA 2ENMA 2BZYA 4LUDA 1H92A 1SEMA 1ABQA 2HSPA 1K9AA 2DJQA 2RPNA 1N5ZA 2FRYA 2F2VA 2EKHA 1M3AA 1NEGA 2KXDA 1AEYA 2ED1A 4RTWA 2O9VA 5EC7A 1QKXA 3A98A
chains in the Genus database with same CATH superfamily
1IREB 2P0KA 3EH1A 1AWJA 2M16A 5FROA 1GRIA 3J80E 3C95A 3QKJA 1VIEA 3DLLA 2EVRA 1S72Q 2L8DA 3VU3C 4FYVB 1Q86U 1GFDA 1VQMQ 3OYAA 1ZBJA 1M9SA 2E6NA 3CBMA 5GAOn 1QVFS 3CCMA 1M1FA 2E64A 4RUGA 4AG2C 2X3WD 3OYEA 2E6ZA 4FT2A 1N6AA 4M7AA 5GMKj 1Q81C 1YJNT 3EH2A 4OGCA 4M78G 2A37A 3OA6A 2DE0X 2L2PA 3V8LA 3EG9B 3JCMX 2YLBA 4XTZA 3RNJA 2RMOA 5I21A 4M77A 3RR6A 1RAIB 1ZA2B 1BI0A 5FU7B 5GAOl 3CPWA 1WHGA 3NPFA 1H3HA 2FZCB 1TTHB 2CGHA 4M7AD 1SG5A 3VRZA 4IIOA 5GANe 1D09B 3VRYA 2XDBA 1S1NA 4LNPA 2EYZA 1X6BA 3TSZA 1VYVA 3LH0A 4GLMA 1YI2Q 3OS5A 3OYNA 3RKYA 3CXCS 2FB7A 5D6WA 3JB9I 4E7JA 5GMKe 3G4SQ 4F7UF 4Z89A 3MCAB 3OYCA 1W1FA 1ABOA 1SSFA 2YHTA 5IH2A 4L5GA 4BY6B 3MO8A 2CP2A 1G5VA 4GY5A 2HEQA 2RI3A 1KK7A 5GAOp 2LDMA 1TG0A 1VQ9T 4F7UA 4OMMA 2SEMA 2EQIA 1VQ5T 4PFOA 1Q7YU 2EYXA 3HRUA 5LJ5j 4QQDA 4DEXA 4Z88A 2RHIA 2O01E 1YBYA 1I07A 3EHQA 4F7UE 2RB6A 2C0OA 2KRSA 3UPUA 1DJ7B 1Q81R 1WX6A 1N8RR 2EIFA 3E2UA 4MDXA 3X20B 3BDUA 1BKBA 2RQWA 2CREA 4EIKA 4CC2A 4ANJA 1K4US 1VQ7T 3QXEB 1XOVA 3TU4K 3NTHA 2DNUA 2JN0A 3VKIA 1LNXA 2YUOA 2ZZDA 1YJNQ 2RM4A 2NWMA 5KE2A 4JJBA 1GXIE 1R8OB 3OY9A 1M1KC 4E2FB 1B34A 1M90C 3MEAA 3V7CA 2D9TA 1UTIA 4ZTJA 3ZL7C 4BE2A 3P8HA 4HXJA 3BDLA 5HKCA 2R57A 3H8ZA 4HCCA 3INZA 1X2KA 4C92C 5HK0A 2J05A 1G3YA 3L2ZA 2XICA 1VQ4Q 2MPXC 3QZ9B 2JOYA 2RQRA 4KH0B 2JT4A 1W2BP 1ZSZB 4EMKB 1SRLA 1OPKA 2ATCB 4CC7A 2D8JA 2IG0A 3VS6A 3CCRQ 1YITA 2DILA 5LJ3j 5J26A 3QIIA 2V8IA 3NTIA 2COWA 1M3CA 2X4XA 2EQUA 1XTDA 2EBPA 4DEYA 5AYFA 2K4YA 2KGTA 4J83A 4A4FA 3RMQA 3RKWA 3I9QA 3JCMf 2JM8A 1NEBA 2BZXA 2J06A 4C0GA 1MMDA 3C0CA 3DB4A 3WXMB 1Q82C 2P0QA 4KUIA 4OMNA 3JCMJ 4M75G 4BACA 5GAOm 1RABB 3I35A 1KQSA 3GF5A 1M5Q1 4J6WA 5C0MA 5GAN6 2OTJA 3NGPA 3ULRB 4HVVA 3CMAA 1VQ4T 3SHWA 3X28B 3S6WA 1KJWA 3JCMd 5DY9A 8AT1B 3QDFA 4C5IA 1PRLC 1ZSZA 2DL7A 2WSCE 5GAMh 3G71A 1F1BB 2LX7A 2DL4A 3CCUQ 1K0SA 1OZ2A 2DRMA 4RTZA 3J7AF 4AFZC 4DBHA 1M1KR 2DL5A 1VQ8A 3UATA 2DYIA 2K6DA 2LC4A 4Y28E 3F70A 3PVQA 2OTLT 2GTJA 1VIFA 4J7IA 4XTVA 1VQ8T 1S72A 4QKUA 4KULA 3M0UA 2KR3A 2DEQA 4PFZA 3FIFA 3RMSA 3HRSA 2JJ9A 3JCMc 2EKOA 2D0QB 4XU3A 4BY6C 1NE8A 3UT1A 2K79A 3RBBB 3V7SA 5GAN7 2DBMA 2RHZA 5KH6A 2OTJQ 3JB9D 3OQ5A 1V1CA 1VQPQ 2ROLA 3P8DA 3NMZC 3JB9G 1QQJA 2EGAA 2K2VA 3CQTA 4J9FA 1Q82R 3CXCP 3M56A 4FIBA 2X3XD 2CT3A 1YHQA 4J9IA 1EFNA 3G4SA 4LXCA 3QG1A 4C92F 2HD0A 2JTMA 2RF0A 2RO0A 4DOVA 4D8DA 1WHLA 1IRXA 1FMKA 4MMKA 1AZGB 2MYSA 4PJOD 1JU5C 2Y4XA 5KYUA 2F2WA 1Z9ZA 3CCUA 3UF4A 2OTJT 3TSWA 5FRMA 1O9SA 3QHSA 4IIMA 2FVUA 2RNAA 1YJ9T 5GANd 1OQKA 1VQKT 1KQ2A 1D0ZA 2Z0WA 2DBKA 4C0DB 3THKA 2XI9A 3E19A 2QDYB 1KD1R 2KRMA 5IXFA 1YIJT 2LT4A 3KFVA 3I55Q 3JB9J 1TSFA 4JLGA 2CP7A 3X24B 3OYDA 1GFCA 5CKHA 1TOVA 1SHGA 2CSIA 3EG3A 2CS7A 1Y71A 3A8OB 1N27A 1WQWA 2YSQA 3I56Q 3N5BB 4PJJA 3M4GA 3M0TA 4EMKA 5L8RE 4F7UB 3ASKA 2RH2A 1E7OA 2KMTA 2V1RA 1WLPB 3TQ7P 2V8KA 4C92G 1RADB 3ME9A 1RAGB 2B8AA 4D6WA 2QTXA 4RTUA 2VGMA 4J7FA 2G3RA 5I2SA 1D0YA 5GAN3 1N9RA 3CCVQ 1OU8A 3CD6A 1XNIA 4O6JA 2DXBA 5C6SA 2FRYA 3AT1B 5CKBA 1I5OB 1M4ZA 1NPRA 4RTWA 1B34B 3E9FA 1QKXA 2ZPFB 1VQ6Q 3O5ZA 2DVEA 2CZ1B 2QG9B 3VS5A 4NS5A 4OMOA 1V76A 4C8QG 3LWIA 2NUZA 1E6GA 2VV5A 2O2OA 5LJ5h 3CD6T 2HL5C 4XU0A 2COZA 1JBMA 1YP5A 4PJLA 2FL7A 3UA7A 5FW9A 4JUVA 5D7UA 2E1HA 1NZ9A 1X6GA 3I56A 2CUDA 1WJRA 3JCMW 3M58A 5CIUA 4D8KA 6AT1B 2XDPA 2NUPA 2CYZB 1SPKA 1QP3A 2Y4YA 3HSBA 3VS1A 2F1LA 1K8AC 3H0IA 4RTVA 1UGQB 1AT1B 3UDCA 2CZ6B 2JMAA 4QVZA 5CQYA 4LDXA 2PUOB 3GIBA 2EGCA 4A4EA 4AFQC 1UB4A 3OMCA 5CK9A 2CH4A 3EG2A 2P4RA 1TU0B 1UFFA 4IKFA 4BDYA 4KRTA 1M2OA 3O8VA 3E9GA 3QUIA 4HCZA 2O4XA 3V8JA 1B7TA 2J6KA 3QPHA 4PJOA 1MV3A 1ZSZC 2RK1A 3OW2A 1HJDA 2BKDN 3CCQA 3JSCA 1S72T 4N0AC 3A8MB 3WVDB 1ZUYA 4L6V5 2RJCA 1M3BA 5GJWB 3KXTA 4PJOF 2PNIA 2M0YA 2XMFA 2LP5A 2LMJA 3HFNA 3I5RA 2CT4A 1RI9A 2KSSA 1X01A 2VASA 2DEUA 5CO7A 1BIBA 2M1HA 3TREA 3VS0A 1UEBA 5ECAA 3L1AA 1JEGA 2DERA 2ABLA 1BIAA 1MMAA 4M77D 3PT9A 1M1KU 4C0FA 3MP1A 4K11A 4OMLA 1K0XA 1WZOA 2CSQA 2F2XA 4PNOA 3PIOA 5LJ5f 4KGXB 1K9MU 1B07A 5I22A 4A4GA 5IHKA 4DQ2A 2LJ0A 4V2SA 2L3QA 3M5AA 3JCMQ 2FO0A 2D6FA 1FXXA 1QVGS 1G83A 1VQLQ 5FU6C 4LDYA 4M75D 1IGQA 1ZUKA 1NLOC 1VQ5Q 4PLIA 2KROA 4JRPA 4CRIA 1NLPC 3R6OA 4C5GA 4C8QB 1WYXA 2RJDA 2A36A 1KC8U 5KYWB 3CCRA 1YITQ 3OS0A 4M7AC 1BU1A 1ZA1B 1GBQA 4JJDA 2L0AA 5GAOr 3CCST 2OX7A 4LN2A 1QVGA 1IB8A 2AZSA 5IN1A 1EX4A 1YITT 2YUQA 1OZ3A 3JAME 2FYKA 1D0XA 1T0JA 1V29B 4KBMB 3RERA 1VQ9Q 2K5FA 4JRKA 1Q86C 3CCQQ 1UGSB 2PU9B 2EGEA 4C5HA 2WSFE 4HCKA 2FG0A 2H3EB 1K76A 1MGQA 1T0HA 3A8HB 2LVMA 3V7RA 5A0LA 1HYOA 5GANg 2VYTA 4M7AG 1AVZC 4RTYA 4XTWA 4C92D 1WNLA 1SRMA 2A7YA 2LCCA 2QQBA 1K73U 2CDTA 2GNCA 2F69A 4WTOB 1TH7A 1RAFB 2RD1A 4YTLA 1FMWA 4A63B 2QA4A 2E3HA 2QGGA 3CPWP 1MV0B 3CCVA 4OGEA 3C4SA 5A2QE 2QQ9A 4M7AB 1KG1A 4PJOE 1WXBA 1D1CA 1YN8A 2XU8A 2AKKA 2GF7A 3LYIA 3SWNC 4E7KA 1LPLA 4XU1A 3CCJT 4C8QD 1SF9A 1TWBA 4BUGA 1YNZA 4JJNK 4IUVA 4N4GA 1I4K1 4FSSA 2E41A 2FEIA 4X1VA 1BCOA 5KYYA 3VS2A 4JDSA 3H0FA 1QW1A 4FT4A 3CPWS 1KQSS 1OULA 1RLQC 2DPPB 2HL3A 2P0PA 4BD3A 9ATCB 2RQUA 5LJ5d 3OYYA 1ACMB 1I81A 1VQ6A 2D1XA 2JW4A 2OAWA 2QQSA 3CC2T 1P92A 1QVFP 2DFUA 1WXUA 3VJPA 2PTKA 2XIDA 2I2LA 4JZ4A 1ZSGA 3VV0A 2RK2A 5GMKm 3QZ5B 1BI3A 1KQSP 1VQ7A 4Q5WA 2CKKA 2LT1A 2DO3A 3GNFB 4A54A 3MKDA 3CCET 3OSVA 1H641 4J9HA 4CC3A 2ZPBB 4M7AF 2JTFA 1KD1U 2LTOA 3HTRA 4KUDK 1N8RU 1QVGP 1VQPT 3OBYA 4A4HA 2RQVA 3VUZA 1K9MR 4XK8E 4OB2B 1TS9A 2BE9B 3HKSA 4QQ6A 4RCBA 1QLYA 3ZBDA 2F5TX 4PJMA 3EGDA 1PSFA 3QJYA 1X43A 4LDVA 2KQWA 4N0AA 1N9SA 4M7DC 2O4XB 2E10A 4NL2A 1KSWA 2DMOA 2P84A 5D6YA 4AT1B 3CXCA 2AZVA 1SKUB 3REBB 4LDUA 3EG1A 1X75C 5DLQE 1M2VB 2QA4T 3G7ZA 4EMHA 2ZPGB 4LDWA 3MEVA 3CCJQ 2L5QA 5LJ3h 1AWOA 1AWXA 2QASA 1NBEB 4XU2A 3CMEA 3PMIA 2DTOA 1VQ5A 5GAN8 4KGVB 2HKQB 5CQXA 4M7AE 3JV3A 1WI7A 1K8AU 4M77B 1QMCA 2QI2A 4RG8A 2DD4A 4R0KA 1M27C 1OI1A 1UGVA 2QDLA 2JUFA 2R58A 3OW2P 2R5AA 1QCFA 1UGPB 5KCOA 3M54A 1Y7XA 2C0TA 4M7DG 2RHXA 1H3ZA 3EGXA 1UHCA 1M2VA 1GCQA 1VYTA 3CC4T 4XAXB 2KK4A 1ZLMA 1VQLA 2RHUA 1OV3A 4PJOG 2JVVA 3L2WA 1RAHB 4LUDA 2CP5A 2LX9A 1ABQA 2HSPA 3L2UA 2RPNA 1VQKQ 2CZ0B 2F2VA 1M3AA 4ELZC 3M55A 2O9VA 5GAMg 3A98A 3WVEB 4LD9K 3CCLT 2OI3A 2LRQA 3EFOA 3OBWA 1VQOQ 2V8JA 1ZHIA 4XTXA 1JRIA 2QEXA 2VB6A 3CCLQ 4II1A 1YJNA 1TUGB 2R5MA 2YRVA 3M4YA 1QP2A 1HSQA 1TUCA 7AT1B 4BI3A 2L3PA 1MUZA 2W0ZA 1GBRA 4F7UG 2KYMA 1KIKA 4ZGDB 1YCYA 3A5ZB 2DXCA 4RMOA 2J7IA 1LJOA 1YFNA 2K3BA 2KXCA 1NYGA 4OB0B 1YI2T 1A0NB 3MP6A 5LJ3e 2K5LA 4OB3B 1M8MA 4JLIA 3EFOB 1WA7A 5GJVB 5GANh 4A4KA 4M78B 4Z8AA 2E5QA 2YWWA 3M53A 1I1JA 2X4YA 4N4IA 5FWCA 4XTUA 4HVWA 4OVAA 3QBYA 3PMTA 1G3TA 1B3QA 4M78E 4MZTA 4ME7A 2PVDB 3FJ5A 4JPBW 1VQ4A 1KC8R 1QVPA 4M77C 4AG1C 4ATOA 3NTKA 3MHXA 2E70A 2L89A 4FYWB 3CC2A 2VVKA 2JNGA 4R55A 1Q86R 3FC3A 1Q82U 2XD0A 2HKNA 3DLMA 2IIMA 3M0SA 4C92E 5IHIA 2LCLA 1NG2A 2IVWA 2YUPA 5GMKh 1PD1A 4NL3A 2AHJB 3JCMb 1D1AA 1D3BA 2KE9A 1QCNA 1UJ0A 1U8RA 1LVKA 3H9NA 1UHFA 1H8KA 3RKXA 4JZ3A 2LCSA 4J8OA 4EDUA 2JM9A 4Z02A 2X9HA 1JXOA 1VUBA 4M7DB 2NUTA 3QDRB 3MPUB 2GFUA 3EFSA 3CCQT 2PZ1A 4HA8A 3G6EA 2I0NA 3LLRA 3VYHB 1VQOT 5GANj 1G3SA 2CH4W 4M77G 5LJ3g 5GAN2 4J9BA 1E6HA 1M1GA 1YWOA 2D8HA 2NYSA 1JJ2A 2DK3A 4C92A 1IZ6A 2GGRA 2A08A 1BB9A 3CC2Q 1EZZB 2GQIA 2O88A 3SEMA 1RUWA 4BE1A 4R56A 3OS2A 5FWBA 1FX7A 2G6FX 4LE9A 5HCKA 4JJCA 3QSUA 2LJ1A 1IO6A 1NM7A 2O31A 5KYWA 4J9CA 4EMGA 2FPDA 3FJPA 1AD5A 3DB3A 3Q1JA 3CCEA 2X4WA 5LJ3d 4ZN1A 1RL2A 2LQWA 1X27A 3CCUT 2HMAA 2ZPIB 3RESA 3LX7A 2MWOA 3FDRA 3OYKA 1WXTA 2JZ2A 1I0CA 4M77F 2YUNA 4PFPA 3BW1A 4M75B 3GBQA 3OYHA 3BE3A 1OX8A 1FWZA 1RI0A 3M9QA 3CEYA 3MEUA 4JRQA 1C1AA 4NOYA 2KT8A 2QAZA 1U3OA 4M75C 4OMQA 4RTTA 1YHQQ 4F17A 1K9MC 1N8RC 3REAB 4ZNXA 4DOWA 4J9EA 1D3BB 3C94A 1RACB 4DBRA 3VS4A 3JRZA 3NHNA 2GCXA 4FSXA 1WJQA 3QYHB 2HSEB 3FB9A 3CCJA 2DL8A 1W70A 4FM4B 3MP8A 1D1BA 2W10A 1VA7A 2ED0A 1I5LA 2ZGWA 4PKCC 2M0OA 1KC8C 3CCMT 4M7DD 1Z9QA 3CCSQ 2CUBA 4OMFB 4E47A 3D7SB 1CKAA 3X26B 3CCVT 2EJGA 3CCLA 2OTLA 2DKGA 1OX9A 2M9UA 3L2RA 2RHYA 5KCHA 1RAEB 1KD1C 4UC4A 1ZQ1A 2DZ9A 3LW5E 1J3TA 4ZN3A 1PRMC 2J6OA 1VYUA 2EQKA 1Y96B 1U1SA 2FRWA 4BI8B 3JB9H 5KYNA 1PHTA 3CCEQ 2XKOC 3G71Q 3ER0A 2EJ9A 3CPFA 2HNIA 4FW1A 2IPOB 2A28A 4M78A 1PKSA 5CKDA 1GCPA 1YJ9A 1BI1A 2JS0A 4HKEA 1WHMA 1SSHA 1FYNA 4OB1B 3L2QA 4M78F 5KE3A 1JXMA 1PCXA 2DLPA 1C6VX 1OYXA 1PKTA 2HAXA 2VUBA 5LJ3f 3OYGA 5IHNA 3CCSA 2JXBA 3G1JA 3QWYA 4L59A 4BE0A 1NJIR 2DD5A 2F5KA 2MCNA 2AIRB 1IGUA 2OAUA 2QK0A 1I8FA 5FRNA 4IURA 3OYLA 2K9GA 3PIPA 2ECZA 2L3RA 1ZX6A 3G71T 1BCMA 2HQHA 4J6XA 3CC4A 2BTTA 1WHJA 1OEBA 4F16A 3BFMA 5M9OA 1WIEA 1PNJA 1EIFA 5A0GA 2H3JA 1BK2A 2ZAEA 2BUDA 4C92B 3KBGA 2DETA 2EWNA 8ATCB 2K2MA 1OOTA 1YCSB 3OYBA 3DKMA 4ELYC 5FU7C 1MNEA 5CCAA 2HCKA 1R77A 3PTAA 4EMKC 2DVJA 3V8KA 3CMAQ 3PGGA 2YT6A 1BI2A 4DA4A 1OU9A 4QW2A 2XDDA 3HP9A 5GMKi 3QYGB 4TVRA 4BB7A 3CMET 5GAN4 3GPLA 4HT8A 2PQWA 3ZFJA 2VGNA 2E65A 2LQ8A 3BY7A 1O75A 3EG0A 4O5VA 4ORZA 4J9DA 1VQNQ 1Q95G 2VXEA 2MWPA 1YJWQ 2NUTB 2X4JA 3SDZA 2HBPA 4FL6A 4HVUA 4M77E 2GTOA 2KT1A 1WPYA 2J6FA 3OW2S 3SFMA 2C06A 4C0ZA 4PL6A 2YXYA 3C12A 3CBPA 2KDSA 2AT1B 3I55A 3SD4A 4QQGA 2FPFA 2MK5A 2JTEA 4OF1A 4Y91A 2LQNA 3CC7A 2KY9A 2RQTA 1R0CB 2BZYA 1C0MA 2ENMA 2LQKA 1W4SA 2P4TA 1SEMA 4PJNA 5KYUB 4ZGEB 4P5NA 1N5ZA 1K73R 4M75E 4E7ZA 1FMVA 2EKHA 3QO3A 4F04B 2VC8A 1NEGA 2RJEA 4C5EA 2ED1A 1VQPA 2WACA 4E7HA 5EC7A 1X6OA 2BIVA 4B9XA 3G6EQ 4PJOB 3M0PA 5L23A 4B6MA 1AHJB 2EYQA 1KFZA 4FYXB 1RAAB 4IUQA 2JMCA 2LNHB 1VQOA 4GBQA 2EFIA 1OPLA 2B86A 1VQMA 2EJFA 3OYIA 1WJSA 3G6ET 4ZTFA 1G2BA 2MI6A 2O9SA 1SHFA 2KNBB 3I56T 3FRNA 2QYZA 3EG9A 1NJIU 4HCBA 2X51A 2V1QA 2KVQG 1PSEA 1Y0MA 2AKLA 2DYBA 3U23A 1VQMT 3R6NA 1WHHA 3OYJA 1UJYA 2RI2A 5HY6A 4RKUE 4EPCA 4CI0C 1KHCA 5FLXE 5CR2A 1VQ6T 2NUPB 5CVIA 1YI2A 4B9WA 1Y57A 2D0NA 3VUBA 3CD6Q 1W2BS 1UECA 3OB9A 1G3WA 3SWNA 3VS3A 1MMGA 5A0DA 2YRCA 4C8QF 1M90R 2HBWA 3HFOA 1U06A 2DL3A 2RN8A 2M51A 3CC7T 2DM1A 2KYBA 4E7IA 2L3SA 2ZCFB 1PM3A 2QXFA 4C8QA 2YRDA 2QQAA 1GCQC 2QEXT 3JCMg 2DA9A 3UWNA 3CC7Q 2LNVA 2MF2A 3JCMP 1K73C 4QT7A 5D6XA 4J5YA 3SWNB 3UA6A 3EGXB 3PNWC 3HL8A 2EYWA 1Q7YR 3A8LB 4C0DC 5AT1B 1NPPA 2XK0A 1WGSA 2PUKB 2DTIA 3FLGA 3CCRT 4MDWA 3G4ST 4VUBA 4KT0E 3T9NA 3TVTA 4OMPA 3FEOA 4BDZA 4WCIA 2BE7D 1VQ9A 1VQLT 2YDLA 1AOJA 2EYYA 4E6RA 1QWFA 5KYXB 1JO8A 5DM7R 3CBOA 2GQVA 5GMKl 3L2VA 1NYFA 4M7DE 1CKBA 1PG5B 1ARKA 4GLKA 4IUTA 4F14A 3HHTB 4OP0A 3S3NA 1LOJA 4QVCA 2Y90A 3GP8A 3H41A 2DXUA 3J81E 3LGLA 2DIQA 1IHWA 3E1SA 1NJIC 4AFUC 1MHNA 2DF6A 2VWFA 2EW3A 1IXDA 1YHQT 4AFSC 3L42A 2DXTA 3VS7A 2MOXA 2K3YA 4A53A 3META 1QWEA 2K57A 5CAIA 1M8VA 5I2MA 4AMCA 4C8QC 3S3OA 4PLLA 2YLCA 2WSEE 2MIOA 4PK4A 4KGZB 2A0FB 3EGUA 2HQEA 4MZMA 1WQ7A 3H0HA 3URGA 5GAMf 2QTVA 1VQ7Q 3NFCA 2KEAA 1LCKA 1Q7YC 2K7AA 2BZ8A 3CMAT 2E5KA 3OYFA 1Q81U 1TXQA 2DX1A 1UDLA 2K5IA 4DBQA 1G8XA 2COYA 2GFAA 2KBTA 1Y07A 4J6YA 2JS2A 2V26A 4XTYA 3OS1A 1VQNA 2E4HA 5GAMd 2DRKA 2CP0A 2EPDA 5GAOq 1Y96A 3CCMQ 2ROTA 1JJ2S 5KYXA 3HRTA 5LJ5g 4DBFA 4M78D 2OTLQ 3M59A 1ZBXA 2K3XA 2DZCA 2KAFA 1MMNA 4E7SA 1UG1A 3I5SA 5I11A 2LZ6B 2H8HA 1WFWA 4X34A 4FU6A 4ESRA 1T3LA 3LH5A 4M4ZA 2FZKB 5KYYB 1K1ZA 1JB0E 2LJ3A 3OSSC 5GAMj 3CMEQ 1U5SA 1QVFA 3QWXX 4FW2A 3PE0A 4ZGJB 5IXBA 2DIGA 3TEEA 2DTHA 2M02A 4HT9A 1W2BA 1VQ8Q 1X69A 1PC0A 1UGRB 4N4HA 3M0QA 3P8BB 5J39A 3IQLA 1KQ1A 2HZYA 4IUPA 4FCYA 4J9GA 4CC4B 2DAQA 4KH1B 1HK9A 1M30A 3AHUA 3PVLA 4Y92A 1VOMA 1KHIA 1T3SA 2X35A 2VXFA 1HD3A 3OYMA 1PD0A 3I55T 1YJ9Q 1HXDA 1XQHA 3KUFA 1QCOA 3M57A 5EG2A 2FPEA 5IAYA 2SRCA 4FYYB 1K8AR 3A1PA 4M7DA 1X2QA 4X9DA 1CSKA 5LJ5e 2OJ2A 4M75A 2QA4Q 1IHVA 5DLOA 1U1TA 4M7DF 5CKEA 4JRIA 1YIJA 4BI4A 2FHDA 4M75F 5GANf 2RJFA 3A8GB 3EHRA 4JS5A 3EFRA 1M90U 2QQRA 1AZEA 1ZUUA 1UE9A 2RI5A 1QKWA 4RG2A 5GAMe 2VKNA 5CKFA 2RA2A 3PFSA 2XHCA 1BBZA 3LGFA 2KRNA 4QVDA 1UUEA 2MAMA 2DJZA 4JS4A 3VYGA 3S3MA 3MJXA 3TCJA 4C8QE 3H6ZA 5J3BA 4LUEA 2ESWA 5IT9E 1W6XA 3GNGA 3JCMV 2EAYA 2XG8D 1VQNT 3HPWA 1GL5A 3CC4Q 1R0BG 1RLPC 4WF2A 2E3IA 1PWTA 2HDAA 2KI7A 2CP6A 3JCMh 2FZGB 3JB9F 2QGFB 2EQJA 1YWPA 2PVOB 1WDXA 3MEWA 2HQXA 4E7LA 1AWWA 2MMPA 2PVGB 3JCMe 5FU6B 3ZEHA 4RTXA 1JQQA 4X9CA 2A3LA 2E12A 2QEXQ 3RDVA 1BYMA 3X25B 1YJWA 1VQKA 4MMLA 4RCCA 1TUDA 4XQ3A 1JJ2P 4MZPA 3EAEA 2C0IA 2NLUA 2ZPHB 3M0RA 2CP3A 4M78C 1WHKA 4LD6A 2AK5A 2EQMA 1YJWT 4IUUA 3LWHA 4PJOC 3QJ6A 2GBQA 2ZPEB 1H92A 3RIRA 5GAN5 1K9AA 2DJQA 3GLXA 2CZ7B 5HK3A 5LL6S 1MNDA 3OMGA 3RUXA 1YIJQ 1XJWB 2KXDA 1AEYA 3EGDB 3GOXA 3SB2A
chains in the Genus database with same CATH topology
3O5ZA 1AWJA 3M0PA 1GRIA 5L23A 2EVRA 3VS5A 2OI3A 4OMOA 1KFZA 2NUZA 2JMCA 1GFDA 2LNHB 1E6GA 2O2OA 4GBQA 1OPLA 1ZBJA 2B86A 1YP5A 1G2BA 3UA7A 4RUGA 4AG2C 5FW9A 2O9SA 1SHFA 2KNBB 2X3WD 1X6GA 2CUDA 1HSQA 1TUCA 4D8KA 2V1QA 2A37A 1MUZA 2L3PA 2W0ZA 1GBRA 2DE0X 1Y0MA 2AKLA 1SPKA 2DYBA 2L2PA 3U23A 3R6NA 3RNJA 3VS1A 1UJYA 2KYMA 2RMOA 3H0IA 4RTVA 1KIKA 2JMAA 2J7IA 1Y57A 2KXCA 2K3BA 1NYGA 2D0NA 1A0NB 2EGCA 1UECA 4AFQC 3NPFA 3VS3A 1M8MA 2CH4A 1WA7A 5GJVB 3EG2A 1H3HA 2P4RA 4Z8AA 2HBWA 3VRZA 1U06A 2DL3A 1UFFA 2RN8A 2M51A 4IIOA 4KRTA 1I1JA 2DM1A 2KYBA 5FWCA 4HVWA 3VRYA 2L3SA 1S1NA 4LNPA 2EYZA 1X6BA 1B3QA 3TSZA 2J6KA 1VYVA 3FJ5A 4JPBW 4GLMA 1GCQC 1MV3A 2DA9A 4AG1C 1HJDA 4Z89A 2VVKA 4QT7A 1W1FA 1ZUYA 2IIMA 3UA6A 1ABOA 1M3BA 3M0SA 5GJWB 5IH2A 2PNIA 2M0YA 5IHIA 2XMFA 2LP5A 2LMJA 2EYWA 2HEQA 3I5RA 1NG2A 2CT4A 1TG0A 2YUPA 1RI9A 4OMMA 2SEMA 2EQIA 2EYXA 2KE9A 3VS0A 1UJ0A 4DEXA 5ECAA 1UHFA 1H8KA 3TVTA 4OMPA 1JEGA 4Z88A 4JZ3A 2ABLA 2LCSA 4WCIA 1I07A 3EHQA 2C0OA 2KRSA 2YDLA 2JM9A 1AOJA 2EYYA 4K11A 1WX6A 4OMLA 1JXOA 1K0XA 4E6RA 1QWFA 1JO8A 2CSQA 2F2XA 2RQWA 2CREA 4EIKA 2PZ1A 2I0NA 1NYFA 4CC2A 1B07A 1CKBA 5I22A 5IHKA 1ARKA 2LJ0A 1K4US 2L3QA 2CH4W 1XOVA 2FO0A 2DNUA 4F14A 4J9BA 1E6HA 2D8HA 1YWOA 1G83A 1ZUKA 2YUOA 1NLOC 2GGRA 3H41A 2KROA 2A08A 1NLPC 2NWMA 1BB9A 4AFUC 1WYXA 2GQIA 2A36A 3SEMA 1RUWA 2O88A 4JJBA 2DF6A 5FWBA 2G6FX 4LE9A 5HCKA 1BU1A 4JJCA 2VWFA 1GBQA 4JJDA 2EW3A 2L0AA 2LJ1A 1IO6A 4AFSC 1NM7A 3VS7A 2MOXA 4LN2A 2O31A 1UTIA 3ZL7C 2AZSA 4J9CA 2YUQA 4HXJA 1QWEA 2FPDA 1X2KA 1AD5A 1T0JA 2J05A 2LQWA 1X27A 2MIOA 2RQRA 2JT4A 2EGEA 3EGUA 1SRLA 1OPKA 1WXTA 2D8JA 2FG0A 4HCKA 4CC7A 3VS6A 3H0HA 1I0CA 1K76A 2DILA 1T0HA 2YUNA 1M3CA 1LCKA 2KEAA 2K7AA 2BZ8A 3GBQA 2E5KA 2EBPA 4DEYA 2DX1A 2KGTA 1AVZC 4RTYA 1UDLA 1SRMA 2KT8A 2KBTA 1U3OA 3I9QA 2JS2A 2JM8A 1NEBA 2BZXA 2J06A 2CDTA 3C0CA 4OMQA 2GNCA 4RTTA 4OMNA 2DRKA 2EPDA 4A63B 4F17A 2ROTA 3I35A 1MV0B 3REAB 4ZNXA 4J9EA 1WXBA 3NGPA 3ULRB 3VS4A 3NHNA 4HVVA 1YN8A 1UG1A 2AKKA 3I5SA 5I11A 2LZ6B 2DL8A 2H8HA 1WFWA 1W70A 3SHWA 1KJWA 4ESRA 2W10A 1T3LA 1VA7A 3LH5A 4M4ZA 2ED0A 1PRLC 2DL7A 1K1ZA 2LJ3A 1YNZA 2LX7A 1Z9QA 2DL4A 1K0SA 2CUBA 1U5SA 3QWXX 3PE0A 2DRMA 4FSSA 4RTZA 5IXBA 4AFZC 1CKAA 4X1VA 2FEIA 3VS2A 2DL5A 1X69A 3UATA 3H0FA 1RLQC 2K6DA 3M0QA 2RQUA 3IQLA 3PVQA 2GTJA 4J9GA 1J3TA 1PRMC 2J6OA 1VYUA 4CC4B 2FRWA 2D1XA 2JW4A 2OAWA 1PHTA 3M0UA 1WXUA 1M30A 3PVLA 4Y92A 2PTKA 2KR3A 1T3SA 4JZ4A 1ZSGA 2A28A 1HD3A 1PKSA 1GCPA 2K79A 3RBBB 2DBMA 2JS0A 2FPEA 1SSHA 1FYNA 1V1CA 2SRCA 2ROLA 3NMZC 4J9HA 2EGAA 3CQTA 1X2QA 4J9FA 4CC3A 1JXMA 1CSKA 2DLPA 2OJ2A 1PKTA 2X3XD 5IHNA 2CT3A 4J9IA 2JXBA 3QWYA 1EFNA 2RQVA 2MCNA 2RF0A 2K9GA 4D8DA 1QLYA 2ECZA 1ZX6A 1FMKA 3EHRA 1AZGB 2BTTA 1X43A 1OEBA 4F16A 1AZEA 1ZUUA 1JU5C 1UE9A 1WIEA 1KSWA 1PNJA 1QKWA 2DMOA 2VKNA 2F2WA 1BBZA 1BK2A 1Z9ZA 2KRNA 3UF4A 2AZVA 3TSWA 1UUEA 2K2MA 3REBB 1OOTA 1YCSB 3EG1A 4IIMA 2RNAA 2HCKA 4LUEA 2ESWA 1W6XA 2DBKA 2DVJA 3THKA 2YT6A 1GL5A 1RLPC 2KRMA 5IXFA 1AWOA 1AWXA 1PWTA 2HDAA 3KFVA 1YWPA 1WDXA 1AWWA 3JV3A 1WI7A 4RTXA 1GFCA 1JQQA 3EG0A 1SHGA 2CSIA 4ORZA 3EG3A 1M27C 4J9DA 4R0KA 2YSQA 1UGVA 2QDLA 3M0TA 1TUDA 4HVUA 1E7OA 1QCFA 2GTOA 2C0IA 2KT1A 3M0RA 2V1RA 1WLPB 2J6FA 2C0TA 2AK5A 4RTUA 1UHCA 1GCQA 1VYTA 2FPFA 1ZLMA 2JTEA 2GBQA 2LQNA 1OV3A 2RQTA 2ENMA 2BZYA 4LUDA 1H92A 1SEMA 1ABQA 2HSPA 1K9AA 2DJQA 2RPNA 1N5ZA 2FRYA 2F2VA 2EKHA 1M3AA 1NEGA 2KXDA 1AEYA 2ED1A 4RTWA 2O9VA 5EC7A 1QKXA 3A98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5Z A;  1AWJ A;  3M0P A;  1GRI A;  5L23 A;  2EVR A;  3VS5 A;  2OI3 A;  4OMO A;  1KFZ A;  2NUZ A;  2JMC A;  1GFD A;  2LNH B;  1E6G A;  2O2O A;  4GBQ A;  1OPL A;  1ZBJ A;  2B86 A;  1YP5 A;  1G2B A;  3UA7 A;  4RUG A;  4AG2 C;  5FW9 A;  2O9S A;  1SHF A;  2KNB B;  2X3W D;  1X6G A;  2CUD A;  1HSQ A;  1TUC A;  4D8K A;  2V1Q A;  2A37 A;  1MUZ A;  2L3P A;  2W0Z A;  1GBR A;  2DE0 X;  1Y0M A;  2AKL A;  1SPK A;  2DYB A;  2L2P A;  3U23 A;  3R6N A;  3RNJ A;  3VS1 A;  1UJY A;  2KYM A;  2RMO A;  3H0I A;  4RTV A;  1KIK A;  2JMA A;  2J7I A;  1Y57 A;  2KXC A;  2K3B A;  1NYG A;  2D0N A;  1A0N B;  2EGC A;  1UEC A;  4AFQ C;  3NPF A;  3VS3 A;  1M8M A;  2CH4 A;  1WA7 A;  5GJV B;  3EG2 A;  1H3H A;  2P4R A;  4Z8A A;  2HBW A;  3VRZ A;  1U06 A;  2DL3 A;  1UFF A;  2RN8 A;  2M51 A;  4IIO A;  4KRT A;  1I1J A;  2DM1 A;  2KYB A;  5FWC A;  4HVW A;  3VRY A;  2L3S A;  1S1N A;  4LNP A;  2EYZ A;  1X6B A;  1B3Q A;  3TSZ A;  2J6K A;  1VYV A;  3FJ5 A;  4JPB W;  4GLM A;  1GCQ C;  1MV3 A;  2DA9 A;  4AG1 C;  1HJD A;  4Z89 A;  2VVK A;  4QT7 A;  1W1F A;  1ZUY A;  2IIM A;  3UA6 A;  1ABO A;  1M3B A;  3M0S A;  5GJW B;  5IH2 A;  2PNI A;  2M0Y A;  5IHI A;  2XMF A;  2LP5 A;  2LMJ A;  2EYW A;  2HEQ A;  3I5R A;  1NG2 A;  2CT4 A;  1TG0 A;  2YUP A;  1RI9 A;  4OMM A;  2SEM A;  2EQI A;  2EYX A;  2KE9 A;  3VS0 A;  1UJ0 A;  4DEX A;  5ECA A;  1UHF A;  1H8K A;  3TVT A;  4OMP A;  1JEG A;  4Z88 A;  4JZ3 A;  2ABL A;  2LCS A;  4WCI A;  1I07 A;  3EHQ A;  2C0O A;  2KRS A;  2YDL A;  2JM9 A;  1AOJ A;  2EYY A;  4K11 A;  1WX6 A;  4OML A;  1JXO A;  1K0X A;  4E6R A;  1QWF A;  1JO8 A;  2CSQ A;  2F2X A;  2RQW A;  2CRE A;  4EIK A;  2PZ1 A;  2I0N A;  1NYF A;  4CC2 A;  1B07 A;  1CKB A;  5I22 A;  5IHK A;  1ARK A;  2LJ0 A;  1K4U S;  2L3Q A;  2CH4 W;  1XOV A;  2FO0 A;  2DNU A;  4F14 A;  4J9B A;  1E6H A;  2D8H A;  1YWO A;  1G83 A;  1ZUK A;  2YUO A;  1NLO C;  2GGR A;  3H41 A;  2KRO A;  2A08 A;  1NLP C;  2NWM A;  1BB9 A;  4AFU C;  1WYX A;  2GQI A;  2A36 A;  3SEM A;  1RUW A;  2O88 A;  4JJB A;  2DF6 A;  5FWB A;  2G6F X;  4LE9 A;  5HCK A;  1BU1 A;  4JJC A;  2VWF A;  1GBQ A;  4JJD A;  2EW3 A;  2L0A A;  2LJ1 A;  1IO6 A;  4AFS C;  1NM7 A;  3VS7 A;  2MOX A;  4LN2 A;  2O31 A;  1UTI A;  3ZL7 C;  2AZS A;  4J9C A;  2YUQ A;  4HXJ A;  1QWE A;  2FPD A;  1X2K A;  1AD5 A;  1T0J A;  2J05 A;  2LQW A;  1X27 A;  2MIO A;  2RQR A;  2JT4 A;  2EGE A;  3EGU A;  1SRL A;  1OPK A;  1WXT A;  2D8J A;  2FG0 A;  4HCK A;  4CC7 A;  3VS6 A;  3H0H A;  1I0C A;  1K76 A;  2DIL A;  1T0H A;  2YUN A;  1M3C A;  1LCK A;  2KEA A;  2K7A A;  2BZ8 A;  3GBQ A;  2E5K A;  2EBP A;  4DEY A;  2DX1 A;  2KGT A;  1AVZ C;  4RTY A;  1UDL A;  1SRM A;  2KT8 A;  2KBT A;  1U3O A;  3I9Q A;  2JS2 A;  2JM8 A;  1NEB A;  2BZX A;  2J06 A;  2CDT A;  3C0C A;  4OMQ A;  2GNC A;  4RTT A;  4OMN A;  2DRK A;  2EPD A;  4A63 B;  4F17 A;  2ROT A;  3I35 A;  1MV0 B;  3REA B;  4ZNX A;  4J9E A;  1WXB A;  3NGP A;  3ULR B;  3VS4 A;  3NHN A;  4HVV A;  1YN8 A;  1UG1 A;  2AKK A;  3I5S A;  5I11 A;  2LZ6 B;  2DL8 A;  2H8H A;  1WFW A;  1W70 A;  3SHW A;  1KJW A;  4ESR A;  2W10 A;  1T3L A;  1VA7 A;  3LH5 A;  4M4Z A;  2ED0 A;  1PRL C;  2DL7 A;  1K1Z A;  2LJ3 A;  1YNZ A;  2LX7 A;  1Z9Q A;  2DL4 A;  1K0S A;  2CUB A;  1U5S A;  3QWX X;  3PE0 A;  2DRM A;  4FSS A;  4RTZ A;  5IXB A;  4AFZ C;  1CKA A;  4X1V A;  2FEI A;  3VS2 A;  2DL5 A;  1X69 A;  3UAT A;  3H0F A;  1RLQ C;  2K6D A;  3M0Q A;  2RQU A;  3IQL A;  3PVQ A;  2GTJ A;  4J9G A;  1J3T A;  1PRM C;  2J6O A;  1VYU A;  4CC4 B;  2FRW A;  2D1X A;  2JW4 A;  2OAW A;  1PHT A;  3M0U A;  1WXU A;  1M30 A;  3PVL A;  4Y92 A;  2PTK A;  2KR3 A;  1T3S A;  4JZ4 A;  1ZSG A;  2A28 A;  1HD3 A;  1PKS A;  1GCP A;  2K79 A;  3RBB B;  2DBM A;  2JS0 A;  2FPE A;  1SSH A;  1FYN A;  1V1C A;  2SRC A;  2ROL A;  3NMZ C;  4J9H A;  2EGA A;  3CQT A;  1X2Q A;  4J9F A;  4CC3 A;  1JXM A;  1CSK A;  2DLP A;  2OJ2 A;  1PKT A;  2X3X D;  5IHN A;  2CT3 A;  4J9I A;  2JXB A;  3QWY A;  1EFN A;  2RQV A;  2MCN A;  2RF0 A;  2K9G A;  4D8D A;  1QLY A;  2ECZ A;  1ZX6 A;  1FMK A;  3EHR A;  1AZG B;  2BTT A;  1X43 A;  1OEB A;  4F16 A;  1AZE A;  1ZUU A;  1JU5 C;  1UE9 A;  1WIE A;  1KSW A;  1PNJ A;  1QKW A;  2DMO A;  2VKN A;  2F2W A;  1BBZ A;  1BK2 A;  1Z9Z A;  2KRN A;  3UF4 A;  2AZV A;  3TSW A;  1UUE A;  2K2M A;  3REB B;  1OOT A;  1YCS B;  3EG1 A;  4IIM A;  2RNA A;  2HCK A;  4LUE A;  2ESW A;  1W6X A;  2DBK A;  2DVJ A;  3THK A;  2YT6 A;  1GL5 A;  1RLP C;  2KRM A;  5IXF A;  1AWO A;  1AWX A;  1PWT A;  2HDA A;  3KFV A;  1YWP A;  1WDX A;  1AWW A;  3JV3 A;  1WI7 A;  4RTX A;  1GFC A;  1JQQ A;  3EG0 A;  1SHG A;  2CSI A;  4ORZ A;  3EG3 A;  1M27 C;  4J9D A;  4R0K A;  2YSQ A;  1UGV A;  2QDL A;  3M0T A;  1TUD A;  4HVU A;  1E7O A;  1QCF A;  2GTO A;  2C0I A;  2KT1 A;  3M0R A;  2V1R A;  1WLP B;  2J6F A;  2C0T A;  2AK5 A;  4RTU A;  1UHC A;  1GCQ A;  1VYT A;  2FPF A;  1ZLM A;  2JTE A;  2GBQ A;  2LQN A;  1OV3 A;  2RQT A;  2ENM A;  2BZY A;  4LUD A;  1H92 A;  1SEM A;  1ABQ A;  2HSP A;  1K9A A;  2DJQ A;  2RPN A;  1N5Z A;  2FRY A;  2F2V A;  2EKH A;  1M3A A;  1NEG A;  2KXD A;  1AEY A;  2ED1 A;  4RTW A;  2O9V A;  5EC7 A;  1QKX A;  3A98 A; 
#chains in the Genus database with same CATH topology
 1IRE B;  2P0K A;  3EH1 A;  1AWJ A;  2M16 A;  5FRO A;  1GRI A;  3J80 E;  3C95 A;  3QKJ A;  1VIE A;  3DLL A;  2EVR A;  1S72 Q;  2L8D A;  3VU3 C;  4FYV B;  1Q86 U;  1GFD A;  1VQM Q;  3OYA A;  1ZBJ A;  1M9S A;  2E6N A;  3CBM A;  5GAO n;  1QVF S;  3CCM A;  1M1F A;  2E64 A;  4RUG A;  4AG2 C;  2X3W D;  3OYE A;  2E6Z A;  4FT2 A;  1N6A A;  4M7A A;  5GMK j;  1Q81 C;  1YJN T;  3EH2 A;  4OGC A;  4M78 G;  2A37 A;  3OA6 A;  2DE0 X;  2L2P A;  3V8L A;  3EG9 B;  3JCM X;  2YLB A;  4XTZ A;  3RNJ A;  2RMO A;  5I21 A;  4M77 A;  3RR6 A;  1RAI B;  1ZA2 B;  1BI0 A;  5FU7 B;  5GAO l;  3CPW A;  1WHG A;  3NPF A;  1H3H A;  2FZC B;  1TTH B;  2CGH A;  4M7A D;  1SG5 A;  3VRZ A;  4IIO A;  5GAN e;  1D09 B;  3VRY A;  2XDB A;  1S1N A;  4LNP A;  2EYZ A;  1X6B A;  3TSZ A;  1VYV A;  3LH0 A;  4GLM A;  1YI2 Q;  3OS5 A;  3OYN A;  3RKY A;  3CXC S;  2FB7 A;  5D6W A;  3JB9 I;  4E7J A;  5GMK e;  3G4S Q;  4F7U F;  4Z89 A;  3MCA B;  3OYC A;  1W1F A;  1ABO A;  1SSF A;  2YHT A;  5IH2 A;  4L5G A;  4BY6 B;  3MO8 A;  2CP2 A;  1G5V A;  4GY5 A;  2HEQ A;  2RI3 A;  1KK7 A;  5GAO p;  2LDM A;  1TG0 A;  1VQ9 T;  4F7U A;  4OMM A;  2SEM A;  2EQI A;  1VQ5 T;  4PFO A;  1Q7Y U;  2EYX A;  3HRU A;  5LJ5 j;  4QQD A;  4DEX A;  4Z88 A;  2RHI A;  2O01 E;  1YBY A;  1I07 A;  3EHQ A;  4F7U E;  2RB6 A;  2C0O A;  2KRS A;  3UPU A;  1DJ7 B;  1Q81 R;  1WX6 A;  1N8R R;  2EIF A;  3E2U A;  4MDX A;  3X20 B;  3BDU A;  1BKB A;  2RQW A;  2CRE A;  4EIK A;  4CC2 A;  4ANJ A;  1K4U S;  1VQ7 T;  3QXE B;  1XOV A;  3TU4 K;  3NTH A;  2DNU A;  2JN0 A;  3VKI A;  1LNX A;  2YUO A;  2ZZD A;  1YJN Q;  2RM4 A;  2NWM A;  5KE2 A;  4JJB A;  1GXI E;  1R8O B;  3OY9 A;  1M1K C;  4E2F B;  1B34 A;  1M90 C;  3MEA A;  3V7C A;  2D9T A;  1UTI A;  4ZTJ A;  3ZL7 C;  4BE2 A;  3P8H A;  4HXJ A;  3BDL A;  5HKC A;  2R57 A;  3H8Z A;  4HCC A;  3INZ A;  1X2K A;  4C92 C;  5HK0 A;  2J05 A;  1G3Y A;  3L2Z A;  2XIC A;  1VQ4 Q;  2MPX C;  3QZ9 B;  2JOY A;  2RQR A;  4KH0 B;  2JT4 A;  1W2B P;  1ZSZ B;  4EMK B;  1SRL A;  1OPK A;  2ATC B;  4CC7 A;  2D8J A;  2IG0 A;  3VS6 A;  3CCR Q;  1YIT A;  2DIL A;  5LJ3 j;  5J26 A;  3QII A;  2V8I A;  3NTI A;  2COW A;  1M3C A;  2X4X A;  2EQU A;  1XTD A;  2EBP A;  4DEY A;  5AYF A;  2K4Y A;  2KGT A;  4J83 A;  4A4F A;  3RMQ A;  3RKW A;  3I9Q A;  3JCM f;  2JM8 A;  1NEB A;  2BZX A;  2J06 A;  4C0G A;  1MMD A;  3C0C A;  3DB4 A;  3WXM B;  1Q82 C;  2P0Q A;  4KUI A;  4OMN A;  3JCM J;  4M75 G;  4BAC A;  5GAO m;  1RAB B;  3I35 A;  1KQS A;  3GF5 A;  1M5Q 1;  4J6W A;  5C0M A;  5GAN 6;  2OTJ A;  3NGP A;  3ULR B;  4HVV A;  3CMA A;  1VQ4 T;  3SHW A;  3X28 B;  3S6W A;  1KJW A;  3JCM d;  5DY9 A;  8AT1 B;  3QDF A;  4C5I A;  1PRL C;  1ZSZ A;  2DL7 A;  2WSC E;  5GAM h;  3G71 A;  1F1B B;  2LX7 A;  2DL4 A;  3CCU Q;  1K0S A;  1OZ2 A;  2DRM A;  4RTZ A;  3J7A F;  4AFZ C;  4DBH A;  1M1K R;  2DL5 A;  1VQ8 A;  3UAT A;  2DYI A;  2K6D A;  2LC4 A;  4Y28 E;  3F70 A;  3PVQ A;  2OTL T;  2GTJ A;  1VIF A;  4J7I A;  4XTV A;  1VQ8 T;  1S72 A;  4QKU A;  4KUL A;  3M0U A;  2KR3 A;  2DEQ A;  4PFZ A;  3FIF A;  3RMS A;  3HRS A;  2JJ9 A;  3JCM c;  2EKO A;  2D0Q B;  4XU3 A;  4BY6 C;  1NE8 A;  3UT1 A;  2K79 A;  3RBB B;  3V7S A;  5GAN 7;  2DBM A;  2RHZ A;  5KH6 A;  2OTJ Q;  3JB9 D;  3OQ5 A;  1V1C A;  1VQP Q;  2ROL A;  3P8D A;  3NMZ C;  3JB9 G;  1QQJ A;  2EGA A;  2K2V A;  3CQT A;  4J9F A;  1Q82 R;  3CXC P;  3M56 A;  4FIB A;  2X3X D;  2CT3 A;  1YHQ A;  4J9I A;  1EFN A;  3G4S A;  4LXC A;  3QG1 A;  4C92 F;  2HD0 A;  2JTM A;  2RF0 A;  2RO0 A;  4DOV A;  4D8D A;  1WHL A;  1IRX A;  1FMK A;  4MMK A;  1AZG B;  2MYS A;  4PJO D;  1JU5 C;  2Y4X A;  5KYU A;  2F2W A;  1Z9Z A;  3CCU A;  3UF4 A;  2OTJ T;  3TSW A;  5FRM A;  1O9S A;  3QHS A;  4IIM A;  2FVU A;  2RNA A;  1YJ9 T;  5GAN d;  1OQK A;  1VQK T;  1KQ2 A;  1D0Z A;  2Z0W A;  2DBK A;  4C0D B;  3THK A;  2XI9 A;  3E19 A;  2QDY B;  1KD1 R;  2KRM A;  5IXF A;  1YIJ T;  2LT4 A;  3KFV A;  3I55 Q;  3JB9 J;  1TSF A;  4JLG A;  2CP7 A;  3X24 B;  3OYD A;  1GFC A;  5CKH A;  1TOV A;  1SHG A;  2CSI A;  3EG3 A;  2CS7 A;  1Y71 A;  3A8O B;  1N27 A;  1WQW A;  2YSQ A;  3I56 Q;  3N5B B;  4PJJ A;  3M4G A;  3M0T A;  4EMK A;  5L8R E;  4F7U B;  3ASK A;  2RH2 A;  1E7O A;  2KMT A;  2V1R A;  1WLP B;  3TQ7 P;  2V8K A;  4C92 G;  1RAD B;  3ME9 A;  1RAG B;  2B8A A;  4D6W A;  2QTX A;  4RTU A;  2VGM A;  4J7F A;  2G3R A;  5I2S A;  1D0Y A;  5GAN 3;  1N9R A;  3CCV Q;  1OU8 A;  3CD6 A;  1XNI A;  4O6J A;  2DXB A;  5C6S A;  2FRY A;  3AT1 B;  5CKB A;  1I5O B;  1M4Z A;  1NPR A;  4RTW A;  1B34 B;  3E9F A;  1QKX A;  2ZPF B;  1VQ6 Q;  3O5Z A;  2DVE A;  2CZ1 B;  2QG9 B;  3VS5 A;  4NS5 A;  4OMO A;  1V76 A;  4C8Q G;  3LWI A;  2NUZ A;  1E6G A;  2VV5 A;  2O2O A;  5LJ5 h;  3CD6 T;  2HL5 C;  4XU0 A;  2COZ A;  1JBM A;  1YP5 A;  4PJL A;  2FL7 A;  3UA7 A;  5FW9 A;  4JUV A;  5D7U A;  2E1H A;  1NZ9 A;  1X6G A;  3I56 A;  2CUD A;  1WJR A;  3JCM W;  3M58 A;  5CIU A;  4D8K A;  6AT1 B;  2XDP A;  2NUP A;  2CYZ B;  1SPK A;  1QP3 A;  2Y4Y A;  3HSB A;  3VS1 A;  2F1L A;  1K8A C;  3H0I A;  4RTV A;  1UGQ B;  1AT1 B;  3UDC A;  2CZ6 B;  2JMA A;  4QVZ A;  5CQY A;  4LDX A;  2PUO B;  3GIB A;  2EGC A;  4A4E A;  4AFQ C;  1UB4 A;  3OMC A;  5CK9 A;  2CH4 A;  3EG2 A;  2P4R A;  1TU0 B;  1UFF A;  4IKF A;  4BDY A;  4KRT A;  1M2O A;  3O8V A;  3E9G A;  3QUI A;  4HCZ A;  2O4X A;  3V8J A;  1B7T A;  2J6K A;  3QPH A;  4PJO A;  1MV3 A;  1ZSZ C;  2RK1 A;  3OW2 A;  1HJD A;  2BKD N;  3CCQ A;  3JSC A;  1S72 T;  4N0A C;  3A8M B;  3WVD B;  1ZUY A;  4L6V 5;  2RJC A;  1M3B A;  5GJW B;  3KXT A;  4PJO F;  2PNI A;  2M0Y A;  2XMF A;  2LP5 A;  2LMJ A;  3HFN A;  3I5R A;  2CT4 A;  1RI9 A;  2KSS A;  1X01 A;  2VAS A;  2DEU A;  5CO7 A;  1BIB A;  2M1H A;  3TRE A;  3VS0 A;  1UEB A;  5ECA A;  3L1A A;  1JEG A;  2DER A;  2ABL A;  1BIA A;  1MMA A;  4M77 D;  3PT9 A;  1M1K U;  4C0F A;  3MP1 A;  4K11 A;  4OML A;  1K0X A;  1WZO A;  2CSQ A;  2F2X A;  4PNO A;  3PIO A;  5LJ5 f;  4KGX B;  1K9M U;  1B07 A;  5I22 A;  4A4G A;  5IHK A;  4DQ2 A;  2LJ0 A;  4V2S A;  2L3Q A;  3M5A A;  3JCM Q;  2FO0 A;  2D6F A;  1FXX A;  1QVG S;  1G83 A;  1VQL Q;  5FU6 C;  4LDY A;  4M75 D;  1IGQ A;  1ZUK A;  1NLO C;  1VQ5 Q;  4PLI A;  2KRO A;  4JRP A;  4CRI A;  1NLP C;  3R6O A;  4C5G A;  4C8Q B;  1WYX A;  2RJD A;  2A36 A;  1KC8 U;  5KYW B;  3CCR A;  1YIT Q;  3OS0 A;  4M7A C;  1BU1 A;  1ZA1 B;  1GBQ A;  4JJD A;  2L0A A;  5GAO r;  3CCS T;  2OX7 A;  4LN2 A;  1QVG A;  1IB8 A;  2AZS A;  5IN1 A;  1EX4 A;  1YIT T;  2YUQ A;  1OZ3 A;  3JAM E;  2FYK A;  1D0X A;  1T0J A;  1V29 B;  4KBM B;  3RER A;  1VQ9 Q;  2K5F A;  4JRK A;  1Q86 C;  3CCQ Q;  1UGS B;  2PU9 B;  2EGE A;  4C5H A;  2WSF E;  4HCK A;  2FG0 A;  2H3E B;  1K76 A;  1MGQ A;  1T0H A;  3A8H B;  2LVM A;  3V7R A;  5A0L A;  1HYO A;  5GAN g;  2VYT A;  4M7A G;  1AVZ C;  4RTY A;  4XTW A;  4C92 D;  1WNL A;  1SRM A;  2A7Y A;  2LCC A;  2QQB A;  1K73 U;  2CDT A;  2GNC A;  2F69 A;  4WTO B;  1TH7 A;  1RAF B;  2RD1 A;  4YTL A;  1FMW A;  4A63 B;  2QA4 A;  2E3H A;  2QGG A;  3CPW P;  1MV0 B;  3CCV A;  4OGE A;  3C4S A;  5A2Q E;  2QQ9 A;  4M7A B;  1KG1 A;  4PJO E;  1WXB A;  1D1C A;  1YN8 A;  2XU8 A;  2AKK A;  2GF7 A;  3LYI A;  3SWN C;  4E7K A;  1LPL A;  4XU1 A;  3CCJ T;  4C8Q D;  1SF9 A;  1TWB A;  4BUG A;  1YNZ A;  4JJN K;  4IUV A;  4N4G A;  1I4K 1;  4FSS A;  2E41 A;  2FEI A;  4X1V A;  1BCO A;  5KYY A;  3VS2 A;  4JDS A;  3H0F A;  1QW1 A;  4FT4 A;  3CPW S;  1KQS S;  1OUL A;  1RLQ C;  2DPP B;  2HL3 A;  2P0P A;  4BD3 A;  9ATC B;  2RQU A;  5LJ5 d;  3OYY A;  1ACM B;  1I81 A;  1VQ6 A;  2D1X A;  2JW4 A;  2OAW A;  2QQS A;  3CC2 T;  1P92 A;  1QVF P;  2DFU A;  1WXU A;  3VJP A;  2PTK A;  2XID A;  2I2L A;  4JZ4 A;  1ZSG A;  3VV0 A;  2RK2 A;  5GMK m;  3QZ5 B;  1BI3 A;  1KQS P;  1VQ7 A;  4Q5W A;  2CKK A;  2LT1 A;  2DO3 A;  3GNF B;  4A54 A;  3MKD A;  3CCE T;  3OSV A;  1H64 1;  4J9H A;  4CC3 A;  2ZPB B;  4M7A F;  2JTF A;  1KD1 U;  2LTO A;  3HTR A;  4KUD K;  1N8R U;  1QVG P;  1VQP T;  3OBY A;  4A4H A;  2RQV A;  3VUZ A;  1K9M R;  4XK8 E;  4OB2 B;  1TS9 A;  2BE9 B;  3HKS A;  4QQ6 A;  4RCB A;  1QLY A;  3ZBD A;  2F5T X;  4PJM A;  3EGD A;  1PSF A;  3QJY A;  1X43 A;  4LDV A;  2KQW A;  4N0A A;  1N9S A;  4M7D C;  2O4X B;  2E10 A;  4NL2 A;  1KSW A;  2DMO A;  2P84 A;  5D6Y A;  4AT1 B;  3CXC A;  2AZV A;  1SKU B;  3REB B;  4LDU A;  3EG1 A;  1X75 C;  5DLQ E;  1M2V B;  2QA4 T;  3G7Z A;  4EMH A;  2ZPG B;  4LDW A;  3MEV A;  3CCJ Q;  2L5Q A;  5LJ3 h;  1AWO A;  1AWX A;  2QAS A;  1NBE B;  4XU2 A;  3CME A;  3PMI A;  2DTO A;  1VQ5 A;  5GAN 8;  4KGV B;  2HKQ B;  5CQX A;  4M7A E;  3JV3 A;  1WI7 A;  1K8A U;  4M77 B;  1QMC A;  2QI2 A;  4RG8 A;  2DD4 A;  4R0K A;  1M27 C;  1OI1 A;  1UGV A;  2QDL A;  2JUF A;  2R58 A;  3OW2 P;  2R5A A;  1QCF A;  1UGP B;  5KCO A;  3M54 A;  1Y7X A;  2C0T A;  4M7D G;  2RHX A;  1H3Z A;  3EGX A;  1UHC A;  1M2V A;  1GCQ A;  1VYT A;  3CC4 T;  4XAX B;  2KK4 A;  1ZLM A;  1VQL A;  2RHU A;  1OV3 A;  4PJO G;  2JVV A;  3L2W A;  1RAH B;  4LUD A;  2CP5 A;  2LX9 A;  1ABQ A;  2HSP A;  3L2U A;  2RPN A;  1VQK Q;  2CZ0 B;  2F2V A;  1M3A A;  4ELZ C;  3M55 A;  2O9V A;  5GAM g;  3A98 A;  3WVE B;  4LD9 K;  3CCL T;  2OI3 A;  2LRQ A;  3EFO A;  3OBW A;  1VQO Q;  2V8J A;  1ZHI A;  4XTX A;  1JRI A;  2QEX A;  2VB6 A;  3CCL Q;  4II1 A;  1YJN A;  1TUG B;  2R5M A;  2YRV A;  3M4Y A;  1QP2 A;  1HSQ A;  1TUC A;  7AT1 B;  4BI3 A;  2L3P A;  1MUZ A;  2W0Z A;  1GBR A;  4F7U G;  2KYM A;  1KIK A;  4ZGD B;  1YCY A;  3A5Z B;  2DXC A;  4RMO A;  2J7I A;  1LJO A;  1YFN A;  2K3B A;  2KXC A;  1NYG A;  4OB0 B;  1YI2 T;  1A0N B;  3MP6 A;  5LJ3 e;  2K5L A;  4OB3 B;  1M8M A;  4JLI A;  3EFO B;  1WA7 A;  5GJV B;  5GAN h;  4A4K A;  4M78 B;  4Z8A A;  2E5Q A;  2YWW A;  3M53 A;  1I1J A;  2X4Y A;  4N4I A;  5FWC A;  4XTU A;  4HVW A;  4OVA A;  3QBY A;  3PMT A;  1G3T A;  1B3Q A;  4M78 E;  4MZT A;  4ME7 A;  2PVD B;  3FJ5 A;  4JPB W;  1VQ4 A;  1KC8 R;  1QVP A;  4M77 C;  4AG1 C;  4ATO A;  3NTK A;  3MHX A;  2E70 A;  2L89 A;  4FYW B;  3CC2 A;  2VVK A;  2JNG A;  4R55 A;  1Q86 R;  3FC3 A;  1Q82 U;  2XD0 A;  2HKN A;  3DLM A;  2IIM A;  3M0S A;  4C92 E;  5IHI A;  2LCL A;  1NG2 A;  2IVW A;  2YUP A;  5GMK h;  1PD1 A;  4NL3 A;  2AHJ B;  3JCM b;  1D1A A;  1D3B A;  2KE9 A;  1QCN A;  1UJ0 A;  1U8R A;  1LVK A;  3H9N A;  1UHF A;  1H8K A;  3RKX A;  4JZ3 A;  2LCS A;  4J8O A;  4EDU A;  2JM9 A;  4Z02 A;  2X9H A;  1JXO A;  1VUB A;  4M7D B;  2NUT A;  3QDR B;  3MPU B;  2GFU A;  3EFS A;  3CCQ T;  2PZ1 A;  4HA8 A;  3G6E A;  2I0N A;  3LLR A;  3VYH B;  1VQO T;  5GAN j;  1G3S A;  2CH4 W;  4M77 G;  5LJ3 g;  5GAN 2;  4J9B A;  1E6H A;  1M1G A;  1YWO A;  2D8H A;  2NYS A;  1JJ2 A;  2DK3 A;  4C92 A;  1IZ6 A;  2GGR A;  2A08 A;  1BB9 A;  3CC2 Q;  1EZZ B;  2GQI A;  2O88 A;  3SEM A;  1RUW A;  4BE1 A;  4R56 A;  3OS2 A;  5FWB A;  1FX7 A;  2G6F X;  4LE9 A;  5HCK A;  4JJC A;  3QSU A;  2LJ1 A;  1IO6 A;  1NM7 A;  2O31 A;  5KYW A;  4J9C A;  4EMG A;  2FPD A;  3FJP A;  1AD5 A;  3DB3 A;  3Q1J A;  3CCE A;  2X4W A;  5LJ3 d;  4ZN1 A;  1RL2 A;  2LQW A;  1X27 A;  3CCU T;  2HMA A;  2ZPI B;  3RES A;  3LX7 A;  2MWO A;  3FDR A;  3OYK A;  1WXT A;  2JZ2 A;  1I0C A;  4M77 F;  2YUN A;  4PFP A;  3BW1 A;  4M75 B;  3GBQ A;  3OYH A;  3BE3 A;  1OX8 A;  1FWZ A;  1RI0 A;  3M9Q A;  3CEY A;  3MEU A;  4JRQ A;  1C1A A;  4NOY A;  2KT8 A;  2QAZ A;  1U3O A;  4M75 C;  4OMQ A;  4RTT A;  1YHQ Q;  4F17 A;  1K9M C;  1N8R C;  3REA B;  4ZNX A;  4DOW A;  4J9E A;  1D3B B;  3C94 A;  1RAC B;  4DBR A;  3VS4 A;  3JRZ A;  3NHN A;  2GCX A;  4FSX A;  1WJQ A;  3QYH B;  2HSE B;  3FB9 A;  3CCJ A;  2DL8 A;  1W70 A;  4FM4 B;  3MP8 A;  1D1B A;  2W10 A;  1VA7 A;  2ED0 A;  1I5L A;  2ZGW A;  4PKC C;  2M0O A;  1KC8 C;  3CCM T;  4M7D D;  1Z9Q A;  3CCS Q;  2CUB A;  4OMF B;  4E47 A;  3D7S B;  1CKA A;  3X26 B;  3CCV T;  2EJG A;  3CCL A;  2OTL A;  2DKG A;  1OX9 A;  2M9U A;  3L2R A;  2RHY A;  5KCH A;  1RAE B;  1KD1 C;  4UC4 A;  1ZQ1 A;  2DZ9 A;  3LW5 E;  1J3T A;  4ZN3 A;  1PRM C;  2J6O A;  1VYU A;  2EQK A;  1Y96 B;  1U1S A;  2FRW A;  4BI8 B;  3JB9 H;  5KYN A;  1PHT A;  3CCE Q;  2XKO C;  3G71 Q;  3ER0 A;  2EJ9 A;  3CPF A;  2HNI A;  4FW1 A;  2IPO B;  2A28 A;  4M78 A;  1PKS A;  5CKD A;  1GCP A;  1YJ9 A;  1BI1 A;  2JS0 A;  4HKE A;  1WHM A;  1SSH A;  1FYN A;  4OB1 B;  3L2Q A;  4M78 F;  5KE3 A;  1JXM A;  1PCX A;  2DLP A;  1C6V X;  1OYX A;  1PKT A;  2HAX A;  2VUB A;  5LJ3 f;  3OYG A;  5IHN A;  3CCS A;  2JXB A;  3G1J A;  3QWY A;  4L59 A;  4BE0 A;  1NJI R;  2DD5 A;  2F5K A;  2MCN A;  2AIR B;  1IGU A;  2OAU A;  2QK0 A;  1I8F A;  5FRN A;  4IUR A;  3OYL A;  2K9G A;  3PIP A;  2ECZ A;  2L3R A;  1ZX6 A;  3G71 T;  1BCM A;  2HQH A;  4J6X A;  3CC4 A;  2BTT A;  1WHJ A;  1OEB A;  4F16 A;  3BFM A;  5M9O A;  1WIE A;  1PNJ A;  1EIF A;  5A0G A;  2H3J A;  1BK2 A;  2ZAE A;  2BUD A;  4C92 B;  3KBG A;  2DET A;  2EWN A;  8ATC B;  2K2M A;  1OOT A;  1YCS B;  3OYB A;  3DKM A;  4ELY C;  5FU7 C;  1MNE A;  5CCA A;  2HCK A;  1R77 A;  3PTA A;  4EMK C;  2DVJ A;  3V8K A;  3CMA Q;  3PGG A;  2YT6 A;  1BI2 A;  4DA4 A;  1OU9 A;  4QW2 A;  2XDD A;  3HP9 A;  5GMK i;  3QYG B;  4TVR A;  4BB7 A;  3CME T;  5GAN 4;  3GPL A;  4HT8 A;  2PQW A;  3ZFJ A;  2VGN A;  2E65 A;  2LQ8 A;  3BY7 A;  1O75 A;  3EG0 A;  4O5V A;  4ORZ A;  4J9D A;  1VQN Q;  1Q95 G;  2VXE A;  2MWP A;  1YJW Q;  2NUT B;  2X4J A;  3SDZ A;  2HBP A;  4FL6 A;  4HVU A;  4M77 E;  2GTO A;  2KT1 A;  1WPY A;  2J6F A;  3OW2 S;  3SFM A;  2C06 A;  4C0Z A;  4PL6 A;  2YXY A;  3C12 A;  3CBP A;  2KDS A;  2AT1 B;  3I55 A;  3SD4 A;  4QQG A;  2FPF A;  2MK5 A;  2JTE A;  4OF1 A;  4Y91 A;  2LQN A;  3CC7 A;  2KY9 A;  2RQT A;  1R0C B;  2BZY A;  1C0M A;  2ENM A;  2LQK A;  1W4S A;  2P4T A;  1SEM A;  4PJN A;  5KYU B;  4ZGE B;  4P5N A;  1N5Z A;  1K73 R;  4M75 E;  4E7Z A;  1FMV A;  2EKH A;  3QO3 A;  4F04 B;  2VC8 A;  1NEG A;  2RJE A;  4C5E A;  2ED1 A;  1VQP A;  2WAC A;  4E7H A;  5EC7 A;  1X6O A;  2BIV A;  4B9X A;  3G6E Q;  4PJO B;  3M0P A;  5L23 A;  4B6M A;  1AHJ B;  2EYQ A;  1KFZ A;  4FYX B;  1RAA B;  4IUQ A;  2JMC A;  2LNH B;  1VQO A;  4GBQ A;  2EFI A;  1OPL A;  2B86 A;  1VQM A;  2EJF A;  3OYI A;  1WJS A;  3G6E T;  4ZTF A;  1G2B A;  2MI6 A;  2O9S A;  1SHF A;  2KNB B;  3I56 T;  3FRN A;  2QYZ A;  3EG9 A;  1NJI U;  4HCB A;  2X51 A;  2V1Q A;  2KVQ G;  1PSE A;  1Y0M A;  2AKL A;  2DYB A;  3U23 A;  1VQM T;  3R6N A;  1WHH A;  3OYJ A;  1UJY A;  2RI2 A;  5HY6 A;  4RKU E;  4EPC A;  4CI0 C;  1KHC A;  5FLX E;  5CR2 A;  1VQ6 T;  2NUP B;  5CVI A;  1YI2 A;  4B9W A;  1Y57 A;  2D0N A;  3VUB A;  3CD6 Q;  1W2B S;  1UEC A;  3OB9 A;  1G3W A;  3SWN A;  3VS3 A;  1MMG A;  5A0D A;  2YRC A;  4C8Q F;  1M90 R;  2HBW A;  3HFO A;  1U06 A;  2DL3 A;  2RN8 A;  2M51 A;  3CC7 T;  2DM1 A;  2KYB A;  4E7I A;  2L3S A;  2ZCF B;  1PM3 A;  2QXF A;  4C8Q A;  2YRD A;  2QQA A;  1GCQ C;  2QEX T;  3JCM g;  2DA9 A;  3UWN A;  3CC7 Q;  2LNV A;  2MF2 A;  3JCM P;  1K73 C;  4QT7 A;  5D6X A;  4J5Y A;  3SWN B;  3UA6 A;  3EGX B;  3PNW C;  3HL8 A;  2EYW A;  1Q7Y R;  3A8L B;  4C0D C;  5AT1 B;  1NPP A;  2XK0 A;  1WGS A;  2PUK B;  2DTI A;  3FLG A;  3CCR T;  4MDW A;  3G4S T;  4VUB A;  4KT0 E;  3T9N A;  3TVT A;  4OMP A;  3FEO A;  4BDZ A;  4WCI A;  2BE7 D;  1VQ9 A;  1VQL T;  2YDL A;  1AOJ A;  2EYY A;  4E6R A;  1QWF A;  5KYX B;  1JO8 A;  5DM7 R;  3CBO A;  2GQV A;  5GMK l;  3L2V A;  1NYF A;  4M7D E;  1CKB A;  1PG5 B;  1ARK A;  4GLK A;  4IUT A;  4F14 A;  3HHT B;  4OP0 A;  3S3N A;  1LOJ A;  4QVC A;  2Y90 A;  3GP8 A;  3H41 A;  2DXU A;  3J81 E;  3LGL A;  2DIQ A;  1IHW A;  3E1S A;  1NJI C;  4AFU C;  1MHN A;  2DF6 A;  2VWF A;  2EW3 A;  1IXD A;  1YHQ T;  4AFS C;  3L42 A;  2DXT A;  3VS7 A;  2MOX A;  2K3Y A;  4A53 A;  3MET A;  1QWE A;  2K57 A;  5CAI A;  1M8V A;  5I2M A;  4AMC A;  4C8Q C;  3S3O A;  4PLL A;  2YLC A;  2WSE E;  2MIO A;  4PK4 A;  4KGZ B;  2A0F B;  3EGU A;  2HQE A;  4MZM A;  1WQ7 A;  3H0H A;  3URG A;  5GAM f;  2QTV A;  1VQ7 Q;  3NFC A;  2KEA A;  1LCK A;  1Q7Y C;  2K7A A;  2BZ8 A;  3CMA T;  2E5K A;  3OYF A;  1Q81 U;  1TXQ A;  2DX1 A;  1UDL A;  2K5I A;  4DBQ A;  1G8X A;  2COY A;  2GFA A;  2KBT A;  1Y07 A;  4J6Y A;  2JS2 A;  2V26 A;  4XTY A;  3OS1 A;  1VQN A;  2E4H A;  5GAM d;  2DRK A;  2CP0 A;  2EPD A;  5GAO q;  1Y96 A;  3CCM Q;  2ROT A;  1JJ2 S;  5KYX A;  3HRT A;  5LJ5 g;  4DBF A;  4M78 D;  2OTL Q;  3M59 A;  1ZBX A;  2K3X A;  2DZC A;  2KAF A;  1MMN A;  4E7S A;  1UG1 A;  3I5S A;  5I11 A;  2LZ6 B;  2H8H A;  1WFW A;  4X34 A;  4FU6 A;  4ESR A;  1T3L A;  3LH5 A;  4M4Z A;  2FZK B;  5KYY B;  1K1Z A;  1JB0 E;  2LJ3 A;  3OSS C;  5GAM j;  3CME Q;  1U5S A;  1QVF A;  3QWX X;  4FW2 A;  3PE0 A;  4ZGJ B;  5IXB A;  2DIG A;  3TEE A;  2DTH A;  2M02 A;  4HT9 A;  1W2B A;  1VQ8 Q;  1X69 A;  1PC0 A;  1UGR B;  4N4H A;  3M0Q A;  3P8B B;  5J39 A;  3IQL A;  1KQ1 A;  2HZY A;  4IUP A;  4FCY A;  4J9G A;  4CC4 B;  2DAQ A;  4KH1 B;  1HK9 A;  1M30 A;  3AHU A;  3PVL A;  4Y92 A;  1VOM A;  1KHI A;  1T3S A;  2X35 A;  2VXF A;  1HD3 A;  3OYM A;  1PD0 A;  3I55 T;  1YJ9 Q;  1HXD A;  1XQH A;  3KUF A;  1QCO A;  3M57 A;  5EG2 A;  2FPE A;  5IAY A;  2SRC A;  4FYY B;  1K8A R;  3A1P A;  4M7D A;  1X2Q A;  4X9D A;  1CSK A;  5LJ5 e;  2OJ2 A;  4M75 A;  2QA4 Q;  1IHV A;  5DLO A;  1U1T A;  4M7D F;  5CKE A;  4JRI A;  1YIJ A;  4BI4 A;  2FHD A;  4M75 F;  5GAN f;  2RJF A;  3A8G B;  3EHR A;  4JS5 A;  3EFR A;  1M90 U;  2QQR A;  1AZE A;  1ZUU A;  1UE9 A;  2RI5 A;  1QKW A;  4RG2 A;  5GAM e;  2VKN A;  5CKF A;  2RA2 A;  3PFS A;  2XHC A;  1BBZ A;  3LGF A;  2KRN A;  4QVD A;  1UUE A;  2MAM A;  2DJZ A;  4JS4 A;  3VYG A;  3S3M A;  3MJX A;  3TCJ A;  4C8Q E;  3H6Z A;  5J3B A;  4LUE A;  2ESW A;  5IT9 E;  1W6X A;  3GNG A;  3JCM V;  2EAY A;  2XG8 D;  1VQN T;  3HPW A;  1GL5 A;  3CC4 Q;  1R0B G;  1RLP C;  4WF2 A;  2E3I A;  1PWT A;  2HDA A;  2KI7 A;  2CP6 A;  3JCM h;  2FZG B;  3JB9 F;  2QGF B;  2EQJ A;  1YWP A;  2PVO B;  1WDX A;  3MEW A;  2HQX A;  4E7L A;  1AWW A;  2MMP A;  2PVG B;  3JCM e;  5FU6 B;  3ZEH A;  4RTX A;  1JQQ A;  4X9C A;  2A3L A;  2E12 A;  2QEX Q;  3RDV A;  1BYM A;  3X25 B;  1YJW A;  1VQK A;  4MML A;  4RCC A;  1TUD A;  4XQ3 A;  1JJ2 P;  4MZP A;  3EAE A;  2C0I A;  2NLU A;  2ZPH B;  3M0R A;  2CP3 A;  4M78 C;  1WHK A;  4LD6 A;  2AK5 A;  2EQM A;  1YJW T;  4IUU A;  3LWH A;  4PJO C;  3QJ6 A;  2GBQ A;  2ZPE B;  1H92 A;  3RIR A;  5GAN 5;  1K9A A;  2DJQ A;  3GLX A;  2CZ7 B;  5HK3 A;  5LL6 S;  1MND A;  3OMG A;  3RUX A;  1YIJ Q;  1XJW B;  2KXD A;  1AEY A;  3EGD B;  3GOX A;  3SB2 A; 
#chains in the Genus database with same CATH homology
 3O5Z A;  1AWJ A;  3M0P A;  1GRI A;  5L23 A;  2EVR A;  3VS5 A;  2OI3 A;  4OMO A;  1KFZ A;  2NUZ A;  2JMC A;  1GFD A;  2LNH B;  1E6G A;  2O2O A;  4GBQ A;  1OPL A;  1ZBJ A;  2B86 A;  1YP5 A;  1G2B A;  3UA7 A;  4RUG A;  4AG2 C;  5FW9 A;  2O9S A;  1SHF A;  2KNB B;  2X3W D;  1X6G A;  2CUD A;  1HSQ A;  1TUC A;  4D8K A;  2V1Q A;  2A37 A;  1MUZ A;  2L3P A;  2W0Z A;  1GBR A;  2DE0 X;  1Y0M A;  2AKL A;  1SPK A;  2DYB A;  2L2P A;  3U23 A;  3R6N A;  3RNJ A;  3VS1 A;  1UJY A;  2KYM A;  2RMO A;  3H0I A;  4RTV A;  1KIK A;  2JMA A;  2J7I A;  1Y57 A;  2KXC A;  2K3B A;  1NYG A;  2D0N A;  1A0N B;  2EGC A;  1UEC A;  4AFQ C;  3NPF A;  3VS3 A;  1M8M A;  2CH4 A;  1WA7 A;  5GJV B;  3EG2 A;  1H3H A;  2P4R A;  4Z8A A;  2HBW A;  3VRZ A;  1U06 A;  2DL3 A;  1UFF A;  2RN8 A;  2M51 A;  4IIO A;  4KRT A;  1I1J A;  2DM1 A;  2KYB A;  5FWC A;  4HVW A;  3VRY A;  2L3S A;  1S1N A;  4LNP A;  2EYZ A;  1X6B A;  1B3Q A;  3TSZ A;  2J6K A;  1VYV A;  3FJ5 A;  4JPB W;  4GLM A;  1GCQ C;  1MV3 A;  2DA9 A;  4AG1 C;  1HJD A;  4Z89 A;  2VVK A;  4QT7 A;  1W1F A;  1ZUY A;  2IIM A;  3UA6 A;  1ABO A;  1M3B A;  3M0S A;  5GJW B;  5IH2 A;  2PNI A;  2M0Y A;  5IHI A;  2XMF A;  2LP5 A;  2LMJ A;  2EYW A;  2HEQ A;  3I5R A;  1NG2 A;  2CT4 A;  1TG0 A;  2YUP A;  1RI9 A;  4OMM A;  2SEM A;  2EQI A;  2EYX A;  2KE9 A;  3VS0 A;  1UJ0 A;  4DEX A;  5ECA A;  1UHF A;  1H8K A;  3TVT A;  4OMP A;  1JEG A;  4Z88 A;  4JZ3 A;  2ABL A;  2LCS A;  4WCI A;  1I07 A;  3EHQ A;  2C0O A;  2KRS A;  2YDL A;  2JM9 A;  1AOJ A;  2EYY A;  4K11 A;  1WX6 A;  4OML A;  1JXO A;  1K0X A;  4E6R A;  1QWF A;  1JO8 A;  2CSQ A;  2F2X A;  2RQW A;  2CRE A;  4EIK A;  2PZ1 A;  2I0N A;  1NYF A;  4CC2 A;  1B07 A;  1CKB A;  5I22 A;  5IHK A;  1ARK A;  2LJ0 A;  1K4U S;  2L3Q A;  2CH4 W;  1XOV A;  2FO0 A;  2DNU A;  4F14 A;  4J9B A;  1E6H A;  2D8H A;  1YWO A;  1G83 A;  1ZUK A;  2YUO A;  1NLO C;  2GGR A;  3H41 A;  2KRO A;  2A08 A;  1NLP C;  2NWM A;  1BB9 A;  4AFU C;  1WYX A;  2GQI A;  2A36 A;  3SEM A;  1RUW A;  2O88 A;  4JJB A;  2DF6 A;  5FWB A;  2G6F X;  4LE9 A;  5HCK A;  1BU1 A;  4JJC A;  2VWF A;  1GBQ A;  4JJD A;  2EW3 A;  2L0A A;  2LJ1 A;  1IO6 A;  4AFS C;  1NM7 A;  3VS7 A;  2MOX A;  4LN2 A;  2O31 A;  1UTI A;  3ZL7 C;  2AZS A;  4J9C A;  2YUQ A;  4HXJ A;  1QWE A;  2FPD A;  1X2K A;  1AD5 A;  1T0J A;  2J05 A;  2LQW A;  1X27 A;  2MIO A;  2RQR A;  2JT4 A;  2EGE A;  3EGU A;  1SRL A;  1OPK A;  1WXT A;  2D8J A;  2FG0 A;  4HCK A;  4CC7 A;  3VS6 A;  3H0H A;  1I0C A;  1K76 A;  2DIL A;  1T0H A;  2YUN A;  1M3C A;  1LCK A;  2KEA A;  2K7A A;  2BZ8 A;  3GBQ A;  2E5K A;  2EBP A;  4DEY A;  2DX1 A;  2KGT A;  1AVZ C;  4RTY A;  1UDL A;  1SRM A;  2KT8 A;  2KBT A;  1U3O A;  3I9Q A;  2JS2 A;  2JM8 A;  1NEB A;  2BZX A;  2J06 A;  2CDT A;  3C0C A;  4OMQ A;  2GNC A;  4RTT A;  4OMN A;  2DRK A;  2EPD A;  4A63 B;  4F17 A;  2ROT A;  3I35 A;  1MV0 B;  3REA B;  4ZNX A;  4J9E A;  1WXB A;  3NGP A;  3ULR B;  3VS4 A;  3NHN A;  4HVV A;  1YN8 A;  1UG1 A;  2AKK A;  3I5S A;  5I11 A;  2LZ6 B;  2DL8 A;  2H8H A;  1WFW A;  1W70 A;  3SHW A;  1KJW A;  4ESR A;  2W10 A;  1T3L A;  1VA7 A;  3LH5 A;  4M4Z A;  2ED0 A;  1PRL C;  2DL7 A;  1K1Z A;  2LJ3 A;  1YNZ A;  2LX7 A;  1Z9Q A;  2DL4 A;  1K0S A;  2CUB A;  1U5S A;  3QWX X;  3PE0 A;  2DRM A;  4FSS A;  4RTZ A;  5IXB A;  4AFZ C;  1CKA A;  4X1V A;  2FEI A;  3VS2 A;  2DL5 A;  1X69 A;  3UAT A;  3H0F A;  1RLQ C;  2K6D A;  3M0Q A;  2RQU A;  3IQL A;  3PVQ A;  2GTJ A;  4J9G A;  1J3T A;  1PRM C;  2J6O A;  1VYU A;  4CC4 B;  2FRW A;  2D1X A;  2JW4 A;  2OAW A;  1PHT A;  3M0U A;  1WXU A;  1M30 A;  3PVL A;  4Y92 A;  2PTK A;  2KR3 A;  1T3S A;  4JZ4 A;  1ZSG A;  2A28 A;  1HD3 A;  1PKS A;  1GCP A;  2K79 A;  3RBB B;  2DBM A;  2JS0 A;  2FPE A;  1SSH A;  1FYN A;  1V1C A;  2SRC A;  2ROL A;  3NMZ C;  4J9H A;  2EGA A;  3CQT A;  1X2Q A;  4J9F A;  4CC3 A;  1JXM A;  1CSK A;  2DLP A;  2OJ2 A;  1PKT A;  2X3X D;  5IHN A;  2CT3 A;  4J9I A;  2JXB A;  3QWY A;  1EFN A;  2RQV A;  2MCN A;  2RF0 A;  2K9G A;  4D8D A;  1QLY A;  2ECZ A;  1ZX6 A;  1FMK A;  3EHR A;  1AZG B;  2BTT A;  1X43 A;  1OEB A;  4F16 A;  1AZE A;  1ZUU A;  1JU5 C;  1UE9 A;  1WIE A;  1KSW A;  1PNJ A;  1QKW A;  2DMO A;  2VKN A;  2F2W A;  1BBZ A;  1BK2 A;  1Z9Z A;  2KRN A;  3UF4 A;  2AZV A;  3TSW A;  1UUE A;  2K2M A;  3REB B;  1OOT A;  1YCS B;  3EG1 A;  4IIM A;  2RNA A;  2HCK A;  4LUE A;  2ESW A;  1W6X A;  2DBK A;  2DVJ A;  3THK A;  2YT6 A;  1GL5 A;  1RLP C;  2KRM A;  5IXF A;  1AWO A;  1AWX A;  1PWT A;  2HDA A;  3KFV A;  1YWP A;  1WDX A;  1AWW A;  3JV3 A;  1WI7 A;  4RTX A;  1GFC A;  1JQQ A;  3EG0 A;  1SHG A;  2CSI A;  4ORZ A;  3EG3 A;  1M27 C;  4J9D A;  4R0K A;  2YSQ A;  1UGV A;  2QDL A;  3M0T A;  1TUD A;  4HVU A;  1E7O A;  1QCF A;  2GTO A;  2C0I A;  2KT1 A;  3M0R A;  2V1R A;  1WLP B;  2J6F A;  2C0T A;  2AK5 A;  4RTU A;  1UHC A;  1GCQ A;  1VYT A;  2FPF A;  1ZLM A;  2JTE A;  2GBQ A;  2LQN A;  1OV3 A;  2RQT A;  2ENM A;  2BZY A;  4LUD A;  1H92 A;  1SEM A;  1ABQ A;  2HSP A;  1K9A A;  2DJQ A;  2RPN A;  1N5Z A;  2FRY A;  2F2V A;  2EKH A;  1M3A A;  1NEG A;  2KXD A;  1AEY A;  2ED1 A;  4RTW A;  2O9V A;  5EC7 A;  1QKX A;  3A98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...