4AG1C

Human chymase - fynomer complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
VTLFVALYDYNATRWTDLSFHKGEKFQILEFGPGDWWEARSLTTGETGYIPSNYVAPVDSIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMASE
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/de novo protein
total genus 12
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2012-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4ag1C00
1OV3A 2CREA 2L2PA 2MCNA 2KGTA 3TSZA 4RTTA 5FWBA 4J9DA 1J3TA 3EG1A 1G83A 2JS2A 1VYTA 3UATA 2CUBA 2D8HA 2KNBB 4J9CA 3VS3A 1UFFA 2DILA 2EBPA 1GCPA 1SHGA 1W1FA 2EKHA 1PWTA 3C0CA 5IHKA 1I1JA 4RUGA 1UJYA 4LN2A 2A28A 3CQTA 1RI9A 1X2KA 2JMAA 4WCIA 4ZNXA 1VYUA 4J9BA 1ZUUA 2IIMA 4E6RA 1X6BA 2FPEA 4F17A 2GTOA 5EC7A 2O9SA 2DL4A 3VRYA 2A37A 2HSPA 3M0TA 1M3BA 3M0PA 1B3QA 1WX6A 1X2QA 2ECZA 1XOVA 1UUEA 1E6GA 4HVWA 2EGEA 1AEYA 1T0HA 2CSIA 2EYZA 1I0CA 2F2VA 1ABQA 1BU1A 2JM9A 2OJ2A 2JW4A 1AWJA 3UA6A 2AZSA 5GJVB 2NWMA 3R6NA 1X6GA 1YCSB 2A08A 2L0AA 2K79A 3GBQA 1AWWA 4IIMA 2M0YA 2JTEA 4JZ3A 1V1CA 2LJ0A 1BBZA 4AFUC 1K0XA 3M0UA 1U5SA 3U23A 2RQWA 4HCKA 2DF6A 2F2XA 1SEMA 2GBQA 2YT6A 3M0RA 1SRLA 4DEXA 2ESWA 1UE9A 4OMOA 1PRMC 2J05A 2M51A 3NPFA 4LUDA 3TSWA 2YDLA 2DMOA 4OMLA 3EG0A 2LCSA 2AK5A 1NEGA 2LQNA 4JPBW 2ENMA 2YUNA 3ULRB 2F2WA 2KE9A 2DL5A 3QWXX 4LNPA 1NG2A 2DVJA 1JU5C 4RTXA 1TUCA 1QCFA 2KXCA 1EFNA 2KEAA 4RTWA 3VS0A 2HDAA 2LZ6B 1ZBJA 2RQVA 1YNZA 2BTTA 3NHNA 2VKNA 4HXJA 2EGCA 1GBQA 1NYFA 1WA7A 1GCQA 1UHFA 2LQWA 2DL7A 3EHQA 3UA7A 1H8KA 4J9EA 1PRLC 4D8KA 1HSQA 1K76A 2DBMA 4OMPA 3VS6A 2E5KA 3NGPA 1SPKA 2FO0A 2YUOA 1A0NB 2V1RA 2J6OA 2RQUA 5IXFA 2L3PA 4JJBA 4J9FA 1IO6A 1VYVA 2KRNA 4K11A 4M4ZA 2KT1A 2ROTA 1K0SA 3I35A 1YP5A 1PKTA 3TVTA 2CT4A 2DRKA 2C0OA 4OMMA 4JZ4A 2OAWA 3M0SA 1WXBA 2DYBA 1T3SA 5IXBA 2ABLA 2RF0A 2DE0X 3H41A 1WI7A 3JV3A 3KFVA 3I5SA 1MV0B 1S1NA 2DL8A 5IHIA 2CH4W 2CUDA 1WLPB 1SSHA 4HVVA 3M0QA 2I0NA 3VS7A 4RTUA 4AG2C 2DL3A 1KSWA 1SRMA 3I9QA 3VS5A 1Y0MA 4OMNA 1I07A 3A98A 1PHTA 1Z9QA 2FG0A 2JS0A 3FJ5A 2AZVA 2D8JA 4RTYA 5GJWB 1T0JA 1GL5A 2HCKA 2L3SA 1U06A 2HBWA 1OPLA 2JMCA 1YWPA 2BZXA 3REAB 2AKKA 1NLOC 2OI3A 3VS4A 4A63B 1M3CA 1K4US 2EVRA 1GFDA 1QLYA 3LH5A 2B86A 2YUPA 3RNJA 2DRMA 2D1XA 4AG1C 2FRWA 1X69A 1ARKA 2PZ1A 2GGRA 4F16A 1KFZA 3IQLA 1T3LA 3RBBB 2P4RA 2K2MA 2MOXA 4RTZA 1YN8A 1PKSA 1WFWA 2GTJA 2KRMA 1ABOA 3VRZA 1JQQA 1KIKA 1X27A 2DLPA 1YWOA 1G2BA 1AZEA 1Z9ZA 1PNJA 4RTVA 4CC7A 1AOJA 1H3HA 2NUZA 2KYMA 1UTIA 2J7IA 1H92A 1E7OA 2LJ3A 1QWFA 4J9HA 1QWEA 1OPKA 2SEMA 3VS1A 2EPDA 2EW3A 3PE0A 4CC2A 1MUZA 1UJ0A 2PTKA 1UHCA 2GNCA 1K9AA 4J9GA 2L3QA 1X43A 2O88A 1OEBA 3REBB 1AVZC 2VWFA 3EG2A 3EHRA 4EIKA 1NEBA 1NLPC 1RUWA 1M3AA 1WDXA 4AFQC 3NMZC 2CSQA 2EYXA 4IIOA 1WXTA 2LJ1A 5ECAA 5IH2A 3O5ZA 1AZGB 1GRIA 3EGUA 2SRCA 4DEYA 2CDTA 2LX7A 1AWOA 2KT8A 3H0FA 5I11A 1FMKA 2RNAA 4GBQA 4LUEA 4CC3A 2RN8A 1VA7A 1K1ZA 1HD3A 2RQTA 1CKAA 2A36A 2H8HA 3H0HA 1UG1A 2CH4A 4HVUA 5FW9A 4QT7A 2DJQA 4AFSC 3QWYA 1GCQC 1UGVA 5I22A 4AFZC 2ED1A 2KRSA 3PVQA 2KR3A 2K7AA 1NM7A 2EYWA 4OMQA 1BB9A 1ZUKA 2CT3A 2JT4A 2FEIA 1NYGA 2X3WD 3ZL7C 1TG0A 1CSKA 5FWCA 1JEGA 2X3XD 2DM1A 3SEMA 2O31A 2C0IA 2K6DA 1HJDA 2G6FX 2D0NA 1FYNA 1TUDA 4X1VA 1ZLMA 2W0ZA 4GLMA 2DBKA 2BZ8A 2V1QA 2EYYA 4FSSA 4KRTA 1JO8A 2K9GA 3VS2A 2ROLA 2LP5A 2KXDA 2JM8A 4Z8AA 3SHWA 4Z89A 1GFCA 1U3OA 2W10A 1GBRA 2HEQA 1JXOA 2O9VA 4ORZA 1RLQC 2JXBA 1M30A 1LCKA 2YSQA 5HCKA 1M27C 1Y57A 4JJDA 2J6KA 4J9IA 3THKA 1WXUA 1B07A 3EG3A 2VVKA 1OOTA 3I5RA 1RLPC 2EGAA 2DNUA 4ESRA 2AKLA 2YUQA 1JXMA 1ZX6A 1KJWA 2J06A 3UF4A 2KROA 1WYXA 1QKWA 2BZYA 2K3BA 2J6FA 2EQIA 2FRYA 2GQIA 1AD5A 5IHNA 1E6HA 2PNIA 2DA9A 2MIOA 3PVLA 2LMJA 2C0TA 1MV3A 1CKBA 4Y92A 4F14A 2FPFA 1WIEA 4Z88A 1ZSGA 2O2OA 2RQRA 1QKXA 1UDLA 3H0IA 4D8DA 2RMOA 2QDLA 2RPNA 1M8MA 2KBTA 4JJCA 1ZUYA 4LE9A 2XMFA 2KYBA 4R0KA 5L23A 4CC4B 1UECA 1BK2A 2FPDA 1AWXA 1SHFA 2ED0A 2LNHB 1W70A 1W6XA 1N5ZA 2DX1A
chains in the Genus database with same CATH superfamily
3UDCA 1R8OB 1OV3A 2CREA 2RA2A 2F1LA 2WSCE 3MEVA 1K8AU 3DLMA 4RTTA 3TSZA 4M7DB 4X34A 2V8JA 1VYTA 5A0GA 2QEXQ 1RAFB 2P0KA 4ANJA 5GAN7 3JCMX 4J9CA 4JUVA 3VJPA 1UFFA 3BDUA 3LW5E 4MZTA 6AT1B 2EKHA 4E7KA 2A3LA 1K73C 1UJYA 4LN2A 2X4JA 3QO3A 3E1SA 1WHLA 4PJOD 1G3TA 2IIMA 4QQGA 3M5AA 1QQJA 5EC7A 1VQ9A 1TUGB 3HFOA 1M3BA 3OMGA 3BFMA 3OBYA 4BD3A 1UUEA 4M7AC 1YBYA 1E6GA 4M78F 4JS4A 1AEYA 5AYFA 4HT8A 3L2VA 1TTHB 1ABQA 4C8QG 2JM9A 1VIFA 5D7UA 4KUIA 2L0AA 2QQ9A 4LDYA 2OTJT 1HYOA 3L2UA 3GBQA 4M7AE 1WNLA 3CMAT 2JTEA 4JZ3A 1VQ9Q 2LJ0A 1K0XA 4PFZA 1U5SA 3JB9I 4B6MA 4HCKA 4E7IA 3CPFA 1MGQA 2F2XA 4FYYB 1RABB 5FLXE 1K8AR 4F7UF 1SRLA 1K73U 2EJ9A 2ESWA 4TVRA 1D1CA 5GAN4 4XTXA 2M51A 2QG9B 4FSXA 3TSWA 4M78B 3QUIA 3S3NA 5IAYA 3GPLA 2LQNA 1B34B 5CR2A 1KG1A 2YUNA 5CQXA 1RL2A 4WF2A 5GAOm 4FT2A 4MZPA 2DVJA 3QHSA 5LL6S 1RAEB 2KXCA 5KH6A 3OW2A 3H6ZA 3VS0A 2P0PA 2DD5A 3RR6A 2ZZDA 1IGQA 1Y07A 4XU3A 3SDZA 2KK4A 4F7UB 2KMTA 3OYNA 2LQWA 3EHQA 3MJXA 2X4YA 2FB7A 1H8KA 2VGMA 2G3RA 1PRLC 1NBEB 5LJ5e 4LDVA 3CMET 3KBGA 3V7CA 5FROA 1A0NB 3FB9A 2P0QA 1Y96A 1IO6A 1W2BA 3VKIA 3M53A 2QK0A 4M4ZA 2R5AA 2RJDA 3I35A 1S72A 3O8VA 2DTIA 2MWOA 2DRKA 1RAAB 3C4SA 4OMMA 4JZ4A 2CP0A 2DYBA 1K73R 3EFOB 3JV3A 5DLOA 3RKXA 1S1NA 5IHIA 3JB9D 3PIOA 1TWBA 2CUDA 3JRZA 1SSHA 4HVVA 2I0NA 4AG2C 3RUXA 1SRMA 3I9QA 3VS5A 1Y0MA 1S72Q 3HRTA 1VUBA 1Z9QA 4PLLA 1M90C 1X6OA 5CAIA 1FX7A 3HRUA 2HCKA 2HBWA 1OPLA 3JCMb 2DK3A 2AKKA 3D7SB 4EMGA 2DIQA 2WSEE 3UWNA 1OX9A 4DQ2A 1ZA1B 2YRCA 3RNJA 2DRMA 4ZTFA 3EFRA 4FYVB 1ARKA 2PZ1A 2E1HA 2LQKA 3A8HB 3S3OA 1OZ3A 2P4RA 1BI1A 4M7DD 2K2MA 4C92F 1QP3A 1WFWA 2GTJA 5KE2A 2RHZA 4M75A 1ABOA 2L3RA 4QVCA 1X27A 1KIKA 2D6FA 5KYXB 3VV0A 3VUBA 1AZEA 1PNJA 2ATCB 1AHJB 1UTIA 1YJWT 3MKDA 3C12A 2V8KA 3L42A 3OYJA 1E7OA 2E10A 4M77D 1M90U 1UGRB 2QQSA 1VQ6T 2RHXA 1M4ZA 4PKCC 1O75A 4CC2A 2DETA 1UJ0A 4PFPA 1UHCA 2EJGA 2GNCA 3I56A 3REBB 2GFUA 2VWFA 2K2VA 1NEBA 2K3YA 1VQOT 1NZ9A 4C92B 1R0CB 4QVDA 2CSQA 4A4EA 3FRNA 4HA8A 3AHUA 1VQ5T 2LJ1A 1VQLA 1YJNT 2HKQB 2RO0A 5C6SA 3CCET 2KT8A 3H0FA 1VQ4A 5I11A 2K3XA 4C5EA 3I56Q 2CZ7B 4J6XA 5KYWA 3P8HA 2RN8A 1HD3A 4ATOA 5KYYB 3CCRA 4KBMB 3OYDA 3EGDA 2RD1A 3VYGA 4IUPA 4HVUA 2DJQA 1IB8A 3OYMA 3NTIA 1VQLQ 4RKUE 2KRSA 1N8RC 2FYKA 4PLIA 4BI4A 1VQ4Q 1ZUKA 3FDRA 1NYGA 4C5HA 4B9WA 4KUDK 2MWPA 1W4SA 3CCRQ 2HL5C 2P4TA 4M78C 1BI2A 2O31A 3RMSA 1KHIA 4LD9K 2C0IA 2K6DA 1M90R 2K5IA 4C8QF 1FYNA 2W0ZA 1P92A 4N4GA 2HQXA 4M78E 4Z8AA 1GFCA 1VQKT 1C0MA 3PGGA 2QTXA 2EQKA 1PSEA 4Y28E 3CCLT 5FU7B 2M9UA 2NUTA 2HQEA 1VQ7T 2JN0A 2VVKA 4X9DA 3I5RA 1VIEA 2JVVA 1JXMA 2EFIA 1KJWA 3LLRA 1WYXA 3HTRA 3M4GA 3LGLA 1N8RU 2VASA 2K5FA 3X20B 4C8QB 4F7UE 5GAN6 3JCMc 3OYFA 3FLGA 2OTJA 1G3SA 3PVLA 1RI0A 1NPPA 1CKBA 3CMAA 3QKJA 2ZPGB 2FPFA 1R77A 1M1KC 5DLQE 3H0IA 4D8DA 5C0MA 1LPLA 4BUGA 4M75G 4CC4B 3BW1A 1AWXA 2OTJQ 4XAXB 4ZN3A 4QVZA 3RDVA 3CMAQ 2LQ8A 2Y4XA 3JCMe 2EWNA 3DKMA 3E19A 1D1AA 4F04B 2LTOA 2KGTA 4OP0A 2L5QA 2X4XA 3EG1A 1G83A 5CKHA 3OSVA 7AT1B 2D8HA 5LJ3f 1N27A 2EQJA 2DILA 1X01A 3CC2T 4C0GA 3CCJT 1V29B 3LGFA 1I1JA 1IXDA 4OGCA 4RUGA 4PJOA 3E2UA 1RI9A 1X2KA 3H8ZA 3G6EA 2JMAA 4WCIA 4RMOA 4DA4A 5GMKh 1ZUUA 1M1KU 4E6RA 2HBPA 1N8RR 3PFSA 2O9SA 4BI8B 2DL4A 2YHTA 3ER0A 1YIJT 3CMEA 3M0PA 1I5LA 4E7HA 1WX6A 2ECZA 1XOVA 1D3BB 3MPUB 1H641 3QIIA 5GAMf 2XKOC 3OS0A 8AT1B 3MP1A 4EMKA 2NWMA 1X6GA 2A08A 1PD1A 3G6EQ 5GAMd 3TREA 3EFSA 4IIMA 3QZ9B 2EJFA 4C92D 3NTKA 5EG2A 1JRIA 3CMEQ 2KVQG 4ZGEB 2DF6A 3TQ7P 3PTAA 2GBQA 2BKDN 5LJ3g 3OA6A 4XTWA 4KT0E 4OMOA 5AT1B 5KE3A 3GNGA 4VUBA 1PRMC 1VQLT 2J05A 3FEOA 3HSBA 2YDLA 5GANd 2QASA 2LCSA 5L8RE 4R56A 3TEEA 2NUPB 1ACMB 1VQ4T 2ZPFB 1I5OB 1SSFA 4RG2A 1MMNA 5LJ3h 2JNGA 2XHCA 1ZBXA 3EG9A 2JJ9A 3QDFA 4PNOA 4LDXA 1TUCA 2IPOB 1LNXA 2YRDA 5KCHA 5HK3A 1M1KR 1TS9A 3QZ5B 1XTDA 2LT1A 1YNZA 4XQ3A 2EGCA 1KD1U 1GBQA 1NYFA 2BUDA 1GCQA 2E3IA 4NS5A 2DZ9A 4LXCA 3HFNA 2EQMA 2DL7A 1LVKA 1G3YA 2QYZA 4A4KA 2KI7A 4RCBA 2E5KA 3MEAA 1SPKA 2YUOA 1YJWA 2X4WA 2V1RA 2RQUA 2DEQA 5IXFA 5GAMh 4J9FA 1M5Q1 2EYQA 1VQ6A 2KRNA 2NYSA 3PIPA 4FW1A 2KT1A 2NUPA 2ROTA 1K0SA 2LCCA 1WJRA 2CT4A 2DTHA 4MMKA 1RAGB 1QP2A 2CZ1B 3M0SA 4XTYA 1VQOA 1WXBA 2VYTA 4M7AD 1UEBA 5FU7C 3M56A 3H41A 1WHMA 1VQ8A 3I5SA 3OS2A 5GAOr 1VQ5A 3T9NA 2AHJB 2K57A 1YJWQ 2CZ0B 3VS7A 4RTUA 1KSWA 1YJNA 2DIGA 4XU0A 3L2ZA 1JBMA 1VQ6Q 3JB9H 4OMNA 3CCEA 2VB6A 2QA4A 2QDYB 2YXYA 1U8RA 1PHTA 4JRKA 5A2QE 1KQ2A 4C8QC 2D8JA 1D09B 4RTYA 4E47A 1M2VA 1T0JA 2O4XA 4C5GA 1VQOQ 4PJOG 4ME7A 4QW2A 1VQ8Q 3C95A 2MI6A 2QQBA 3HRSA 1VQ5Q 2OI3A 3VS4A 2VC8A 1KD1R 1HXDA 4A63B 2DAQA 2L8DA 3SD4A 4C8QE 5I21A 3JAME 1K4US 3X26B 3G7ZA 4JS5A 2ZCFB 1YJNQ 2B86A 2YUPA 4AG1C 3JCMQ 2E12A 3BDLA 3CCEQ 2HL3A 2FRWA 2QA4Q 1X69A 2F5TX 1V76A 1KHCA 3QJYA 1Q82C 3GF5A 2JTMA 2MOXA 1Y96B 3OW2P 2COYA 1M9SA 4LDWA 5GAN3 4EMKC 2LNVA 3VRZA 4EDUA 3GLXA 2ZPEB 4NOYA 1H3HA 1VQKA 4M77A 2J7IA 4BDYA 1WHGA 1H92A 4X9CA 1N9SA 2LJ3A 3CCLA 4J9HA 1QWEA 2E6NA 4D6WA 1UB4A 1MUZA 1QVFA 2JUFA 2QGGA 1WQ7A 1R0BG 2L3QA 1X43A 1VQ7A 1ZA2B 1OEBA 4M75F 1W2BP 3G6ET 2WSFE 3EHRA 3EG2A 1SKUB 1U1TA 4FU6A 1RUWA 4N0AA 3NMZC 3DLLA 3J7AF 4BE0A 4II1A 1VQKQ 4JRPA 1F1BB 5ECAA 5IH2A 1WPYA 3O5ZA 1AZGB 5J26A 4HCCA 3CCLQ 2L89A 1Q82U 2SRCA 3PMIA 4HCBA 2CDTA 2LX7A 2DKGA 3L2RA 2E5QA 5CCAA 3M57A 1VQ7Q 4CC3A 2A7YA 4KH0B 2XIDA 1K1ZA 5GAOn 2XDBA 2RQTA 3CBPA 1Y7XA 2QI2A 2X35A 4CI0C 1OZ2A 2M0OA 4AFSC 3WVDB 1GCQC 1UGVA 2RHYA 4M75B 5I22A 1LOJA 2ED1A 3OW2S 3PVQA 2CYZB 5LJ5f 4ZGDB 3DB4A 4YTLA 1BB9A 5LJ5d 2JT4A 2DPPB 2KQWA 2X3WD 3ZL7C 1KK7A 1EIFA 1KQSA 5FWCA 2MK5A 1JEGA 2DM1A 4JJNK 3JCMV 5IN1A 1TSFA 2IG0A 3CBOA 3CC2A 1BI0A 3OBWA 4FYWB 3ZBDA 3V8LA 2DBKA 3CCJA 2DXUA 3JB9G 2Y90A 1JO8A 2R57A 3NTHA 1W2BS 4MDXA 1GBRA 3META 4ORZA 4IUQA 2CS7A 2RHIA 2VXFA 1LCKA 3CPWA 5HCKA 2JZ2A 4E7JA 2M02A 1YIJA 1Y57A 3GOXA 3CC2Q 1Q82R 5KYNA 3RIRA 1WXUA 1B07A 3EG3A 1OOTA 1RLPC 2EGAA 3CCJQ 1EZZB 1M2OA 5KYWB 2YUQA 1M1GA 3G1JA 3EGDB 3F70A 3HL8A 5IHNA 1E6HA 1D0YA 2DA9A 2MIOA 2PNIA 2RJFA 2Z0WA 1YIJQ 3VYHB 1WIEA 1ZSGA 3MP8A 3CXCA 2FL7A 2RMOA 2QDLA 1RAIB 1ZUYA 4LE9A 2XMFA 2KYBA 5L23A 4FT4A 1VQ8T 4HT9A 5LJ5h 1K9MC 1BK2A 1SHFA 2ED0A 2LNHB 1W70A 2NLUA 2RHUA 1JJ2A 5GMKj 4NL3A 2L2PA 4BE1A 2QA4T 2MCNA 3A1PA 2DERA 1G5VA 3PT9A 5FWBA 4J9DA 4R55A 4A4FA 2VV5A 2JS2A 3M9QA 3QDRB 2HSEB 3UATA 4PK4A 3QYHB 1QCNA 2EBPA 2NUTB 1YFNA 1GCPA 2RM4A 3I55A 4O5VA 3QG1A 1NE8A 1SHGA 1PWTA 5HKCA 2LT4A 3DB3A 3CCMT 4M78D 4N0AC 1FMVA 4BY6B 1OYXA 4ZNXA 1VYUA 4GLKA 1X6BA 4IUUA 4DOWA 1Q81U 3RERA 1BI3A 3KXTA 3I55Q 4A4HA 4FCYA 1ZSZA 2EGEA 2PVDB 5CKBA 1K9MU 1T0HA 2RK2A 2CSIA 2EYZA 1I0CA 3JCMW 1BU1A 4PJOF 2JW4A 1AWJA 2DXTA 3UA6A 3TCJA 5GAOp 1YCSB 2DXCA 3HPWA 2OTLA 2KDSA 3A8GB 1OI1A 1PD0A 1V1CA 3VU3C 3M0UA 5LJ3j 3U23A 2RQWA 2LX9A 1SEMA 2YT6A 3SWNA 3V7SA 2HQHA 3OYYA 4DEXA 2EIFA 3CCVT 4XU2A 2OTLQ 1MMDA 4OMLA 2AK5A 4JPBW 4PJOB 3ULRB 2KE9A 2DL5A 9ATCB 2DD4A 4LNPA 4PL6A 1JU5C 4E7SA 4J83A 5CKDA 3M54A 4JLGA 1GXIE 1MNEA 5GAMj 3OS5A 4RTWA 4DBQA 4NL2A 1ZBJA 3NHNA 4M75C 2VKNA 1QVGA 2MPXC 5LJ3e 5I2MA 2XD0A 4DBHA 1K9MR 4EMKB 2ZPIB 1VQMT 2V8IA 3MHXA 2HD0A 3FIFA 2EQUA 2BIVA 4M75E 2XK0A 4J9EA 2X51A 3SFMA 1VQPT 1HSQA 1K76A 2HZYA 4OMPA 1QW1A 3VS6A 5CQYA 3NGPA 4BDZA 3X28B 3JB9J 4K11A 4MMLA 1DJ7B 3WXMB 5IT9E 3URGA 4M7AA 3KUFA 3TVTA 3WVEB 3EH2A 1RADB 2C0OA 2RI5A 3JCMJ 1RACB 5IXBA 2RF0A 3JCMf 1WI7A 3M4YA 3KFVA 4OF1A 4L5GA 5GAN5 2DL8A 3JCMd 2CKKA 2DFUA 1IZ6A 2HKNA 1VQNT 1OX8A 1WJSA 3EG9B 2FVUA 5A0DA 3CBMA 3RMQA 2E3HA 5J39A 2FG0A 3RESA 2AZVA 3MEUA 1GL5A 1KD1C 1U06A 4PJLA 1I4K1 3JB9F 1WJQA 2YRVA 3GP8A 1YWPA 2BZXA 2PUOB 3REAB 1NLOC 1IGUA 3HP9A 1ZQ1A 1C1AA 3NFCA 1D0ZA 2EVRA 4CRIA 1GFDA 2LDMA 1WHHA 2FZKB 4OB0B 1WZOA 5DY9A 1JB0E 2D1XA 1NPRA 5HY6A 4LD6A 5GANf 2XG8D 1T3LA 3ZEHA 2LVMA 4RTZA 1YN8A 2RB6A 4OB3B 2KRMA 2XDDA 1JQQA 4KGXB 2C06A 5CK9A 1YWOA 2ZGWA 4RCCA 3E9GA 4RTVA 1AOJA 2NUZA 2KYMA 1MMGA 3A8LB 3H9NA 3G71T 4FIBA 3CCQT 3I55T 2PU9B 3M55A 3MP6A 3J80E 1QWFA 3CC7Q 2ZAEA 2SEMA 3VS1A 2RH2A 2EPDA 2OAUA 3PE0A 5GAMg 3OYIA 2MMPA 3OQ5A 1WGSA 2QXFA 4J9GA 3LWHA 3JCMh 4BY6C 1BYMA 4EIKA 1UGPB 3OYEA 1M2VB 2DTOA 2O4XB 1M3AA 1WDXA 2EYXA 4IIOA 2AIRB 2EAYA 4M77F 1Q95G 3CCST 4RG8A 2PUKB 4DEYA 2HNIA 4A54A 2K5LA 1AWOA 1YJ9T 1FMKA 4GBQA 3MCAB 5GANg 3OMCA 5J3BA 3JCMP 4E2FB 2OTLT 3CD6T 2A36A 4PFOA 2CH4A 2F69A 5FRMA 5FW9A 4QT7A 1QVPA 3CCUT 2E64A 2O01E 5KYUB 3E9FA 4QQDA 4C8QD 2KR3A 2K7AA 3L2WA 1EX4A 1XNIA 1NM7A 5GANh 4GY5A 4M77B 4KH1B 1FXXA 2DEUA 1TG0A 1KQ1A 5KCOA 1CSKA 1PC0A 3OS1A 1X75C 1MMAA 1I81A 3SEMA 4M7AG 1FMWA 4L59A 4AMCA 1HJDA 4C0ZA 4PJOC 3G4ST 4GLMA 3RKYA 2BZ8A 2Y4YA 2V1QA 2EYYA 4KRTA 1BCMA 3VS2A 2M16A 2LP5A 2KXDA 3CCMA 4FM4B 4OGEA 3CC4T 3SHWA 4Z89A 2RK1A 1U3OA 2W10A 4PJOE 4M7DA 4OVAA 1RLQC 4BACA 2RI2A 4KULA 4QQ6A 1M30A 1TU0B 2R5MA 5M9OA 1UGSB 1M27C 3S6WA 4BE2A 1TH7A 4DOVA 2J6KA 2M1HA 1BIAA 5KYUA 1ZHIA 1I8FA 2QTVA 4ELYC 4ESRA 1QVFP 4A4GA 1BCOA 5LJ5j 3CCMQ 2ZPBB 2KROA 1QKWA 4IUVA 4C0DB 2J6FA 2COWA 2EQIA 1YHQT 4KGVB 5CKEA 2DYIA 1AD5A 2WACA 4B9XA 2LMJA 2C0TA 4OB2B 3QSUA 4F14A 1Q86C 2RJEA 3HHTB 3GIBA 5FU6C 1UDLA 5CKFA 4IKFA 2RPNA 2A0FB 4Y91A 5GAOl 3INZA 2R58A 1UECA 3CCVA 2KSSA 1N5ZA 2DX1A 2JTFA 2H3EB 2GCXA 4FYXB 3A8OB 4J6YA 1J3TA 3PNWC 4JLIA 5CVIA 4PJJA 1OQKA 2CUBA 3TU4K 2KNBB 3VS3A 1KQSP 2QQAA 4OMFB 3CCVQ 4HCZA 4M78A 1W1FA 5FRNA 3C0CA 5IHKA 1QCOA 1D1BA 3V7RA 1B34A 2XI9A 1O9SA 3P8BB 2A28A 3CQTA 2XU8A 1OULA 1VQMA 2OX7A 2CGHA 4J9BA 1Q86U 1QVFS 3UPUA 1H3ZA 3SB2A 2FPEA 4F17A 2GTOA 3CC7T 3BY7A 1VQPA 1PCXA 2A37A 2HSPA 3M0TA 1B3QA 2I2LA 2XICA 3CPWP 1X2QA 4QKUA 4HVWA 4FW2A 1YITT 4C0FA 2F2VA 3A5ZB 2CP6A 4F7UA 2OJ2A 3QBYA 3Q1JA 2AZSA 5GJVB 4P5NA 3R6NA 1VQMQ 2CP5A 1YI2T 4N4HA 2K79A 2YLBA 5GAN8 2F5KA 1AWWA 2M0YA 5DM7R 1IRXA 1C6VX 1VQPQ 3QYGB 3EAEA 1BBZA 2XDPA 4AFUC 5GMKm 2CP2A 3OYBA 1YCYA 1G3WA 1VQNA 2QEXT 3M0RA 4IURA 2QQRA 1N9RA 2MYSA 5GMKl 2K4YA 3CXCP 1UE9A 4LDUA 3NPFA 4LUDA 3EFOA 2YLCA 2DMOA 4XTZA 5LJ5g 3EG0A 4ZGJB 1NEGA 1KC8C 3OB9A 2ENMA 1KQSS 1M8VA 4M7DG 2F2WA 4ELZC 2FZCB 3QWXX 2MF2A 4M7DC 1NG2A 3EGXB 4EPCA 1Q81C 1VQNQ 4RTXA 1JJ2P 4J5YA 4PJNA 1QCFA 1Q86R 1EFNA 2KEAA 2HAXA 2HDAA 4WTOB 2LZ6B 4ZTJA 2B8AA 1IREB 2RQVA 2BTTA 1WHJA 4M7DE 4KGZB 2MAMA 4HXJA 1ZSZB 2CP7A 2E4HA 5GMKi 1WA7A 4M77G 3CPWS 2RI3A 3OYAA 1UHFA 2P84A 1WHKA 4M77C 3UA7A 1FWZA 1MNDA 1VQ9T 5CIUA 1N6AA 4D8KA 2DBMA 2DVEA 4XTUA 3G71A 3V8JA 2FO0A 4BB7A 2J6OA 3CCQA 4M77E 3V8KA 2L3PA 4JJBA 3PMTA 2E41A 1VYVA 4JRQA 2LC4A 2IVWA 3P8DA 3S3MA 3SWNB 1YP5A 2DXBA 4MDWA 1WQWA 2D9TA 1PKTA 1BKBA 5GAN2 1KC8U 2GF7A 5D6XA 5KYXA 3EGXA 2OAWA 2KY9A 1TOVA 1T3SA 2ABLA 4C5IA 2DE0X 4XK8E 3CXCS 3M58A 1MV0B 2E65A 4J6WA 2CH4W 3G71Q 1PG5B 1Q7YC 3LH0A 1WLPB 4Z02A 3CCSA 3M0QA 4EMHA 3CCQQ 3J81E 2DL3A 1VOMA 2VXEA 4MZMA 1YJ9A 2CP3A 5GMKe 1I07A 3OYLA 3A98A 3N5BB 4C0DC 2JS0A 4M78G 4M7AF 3FJ5A 1JJ2S 3ZFJA 5GJWB 4C92A 2L3SA 2EKOA 2DO3A 2JMCA 2GQVA 3CD6A 2PVOB 3GNFB 1BIBA 3CCUA 1HK9A 1PM3A 4Q5WA 3RKWA 3FC3A 1M3CA 4E7ZA 3CCSQ 1RAHB 1QLYA 3LH5A 3QPHA 2DZCA 1YJ9Q 2KAFA 3R6OA 1KFZA 4F16A 2GGRA 4OB1B 1Y71A 3IQLA 2GFAA 5KYYA 4XTVA 4PJMA 3RBBB 2DJZA 4F7UG 1PKSA 1MHNA 3CD6Q 1LJOA 3OYHA 3G4SA 3CCUQ 4M7AB 1QVGP 3C94A 2DLPA 1Q7YU 1NJIC 1G2BA 5A0LA 4M75D 1KC8R 1Z9ZA 4CC7A 3CC4A 1XJWB 2YWWA 3LX7A 2COZA 3L1AA 3LYIA 1Q81R 1TXQA 1OPKA 1PSFA 2BE9B 3LWIA 3AT1B 2EW3A 1S72T 2PTKA 3ASKA 5HK0A 4DBRA 1K9AA 3MEWA 3G4SQ 3EH1A 2O88A 1AVZC 1NLPC 2FHDA 4AFQC 3CC4Q 3X24B 3JSCA 1WXTA 3QXEB 1YHQA 2QAZA 1GRIA 3EGUA 5GANj 3MO8A 1SF9A 3M59A 4A53A 4J7FA 5I2SA 2RNAA 4LUEA 5GAOq 1M1FA 5FU6B 1VA7A 1OU8A 3OYCA 1CKAA 2X9HA 1NJIU 2H8HA 3H0HA 1UG1A 2H3JA 4BI3A 4C8QA 5D6WA 5GAMe 4UC4A 1YHQQ 1U1SA 5LJ3d 3QWYA 2LRQA 2VGNA 3OYGA 4O6JA 4AFZC 1IHVA 2ZPHB 4JRIA 2EYWA 4OMQA 1Q7YR 2QGFB 1QVGS 2CT3A 4J8OA 2FEIA 4IUTA 2BE7D 4AT1B 5D6YA 2X3XD 3QJ6A 4ZN1A 2LCLA 5CO7A 4N4IA 2G6FX 2D0NA 1TUDA 4X1VA 1ZLMA 5GANe 4FSSA 2K9GA 2ROLA 2JM8A 1QMCA 1B7TA 2CZ6B 2V26A 2HEQA 1JXOA 2O9VA 2JXBA 2AT1B 1XQHA 1G8XA 2YSQA 1IHWA 2RJCA 2HMAA 3OYKA 3CC7A 4J7IA 2D0QB 2PQWA 1SG5A 1ZSZC 2E70A 4V2SA 1AT1B 1K8AC 4JJDA 3I56T 4L6V5 4J9IA 3THKA 3FJPA 4C92G 8ATCB 3CEYA 2DNUA 2AKLA 3OSSC 1YITA 4C92C 1D0XA 1ZX6A 2J06A 3JCMg 3UF4A 4JDSA 2BZYA 2K3BA 4FL6A 2FRYA 2GQIA 4DBFA 4E7LA 4HKEA 1YI2A 1NJIR 4M7DF 1OU9A 3BE3A 1MV3A 4C92E 2FZGB 4Y92A 3UT1A 3VUZA 3SWNC 4Z88A 2JOYA 2O2OA 3HKSA 1D3BA 2VUBA 3ME9A 2RQRA 1QKXA 3X25B 3CCRT 2QEXA 1YITQ 1M8MA 2KBTA 4JJCA 3OY9A 3L2QA 4R0KA 2PVGB 1UGQB 3A8MB 1YI2Q 2E6ZA 2FPDA 4XU1A 1W6XA 3VRYA
chains in the Genus database with same CATH topology
1OV3A 2CREA 2L2PA 2MCNA 2KGTA 3TSZA 4RTTA 5FWBA 4J9DA 1J3TA 3EG1A 1G83A 2JS2A 1VYTA 3UATA 2CUBA 2D8HA 2KNBB 4J9CA 3VS3A 1UFFA 2DILA 2EBPA 1GCPA 1SHGA 1W1FA 2EKHA 1PWTA 3C0CA 5IHKA 1I1JA 4RUGA 1UJYA 4LN2A 2A28A 3CQTA 1RI9A 1X2KA 2JMAA 4WCIA 4ZNXA 1VYUA 4J9BA 1ZUUA 2IIMA 4E6RA 1X6BA 2FPEA 4F17A 2GTOA 5EC7A 2O9SA 2DL4A 3VRYA 2A37A 2HSPA 3M0TA 1M3BA 3M0PA 1B3QA 1WX6A 1X2QA 2ECZA 1XOVA 1UUEA 1E6GA 4HVWA 2EGEA 1AEYA 1T0HA 2CSIA 2EYZA 1I0CA 2F2VA 1ABQA 1BU1A 2JM9A 2OJ2A 2JW4A 1AWJA 3UA6A 2AZSA 5GJVB 2NWMA 3R6NA 1X6GA 1YCSB 2A08A 2L0AA 2K79A 3GBQA 1AWWA 4IIMA 2M0YA 2JTEA 4JZ3A 1V1CA 2LJ0A 1BBZA 4AFUC 1K0XA 3M0UA 1U5SA 3U23A 2RQWA 4HCKA 2DF6A 2F2XA 1SEMA 2GBQA 2YT6A 3M0RA 1SRLA 4DEXA 2ESWA 1UE9A 4OMOA 1PRMC 2J05A 2M51A 3NPFA 4LUDA 3TSWA 2YDLA 2DMOA 4OMLA 3EG0A 2LCSA 2AK5A 1NEGA 2LQNA 4JPBW 2ENMA 2YUNA 3ULRB 2F2WA 2KE9A 2DL5A 3QWXX 4LNPA 1NG2A 2DVJA 1JU5C 4RTXA 1TUCA 1QCFA 2KXCA 1EFNA 2KEAA 4RTWA 3VS0A 2HDAA 2LZ6B 1ZBJA 2RQVA 1YNZA 2BTTA 3NHNA 2VKNA 4HXJA 2EGCA 1GBQA 1NYFA 1WA7A 1GCQA 1UHFA 2LQWA 2DL7A 3EHQA 3UA7A 1H8KA 4J9EA 1PRLC 4D8KA 1HSQA 1K76A 2DBMA 4OMPA 3VS6A 2E5KA 3NGPA 1SPKA 2FO0A 2YUOA 1A0NB 2V1RA 2J6OA 2RQUA 5IXFA 2L3PA 4JJBA 4J9FA 1IO6A 1VYVA 2KRNA 4K11A 4M4ZA 2KT1A 2ROTA 1K0SA 3I35A 1YP5A 1PKTA 3TVTA 2CT4A 2DRKA 2C0OA 4OMMA 4JZ4A 2OAWA 3M0SA 1WXBA 2DYBA 1T3SA 5IXBA 2ABLA 2RF0A 2DE0X 3H41A 1WI7A 3JV3A 3KFVA 3I5SA 1MV0B 1S1NA 2DL8A 5IHIA 2CH4W 2CUDA 1WLPB 1SSHA 4HVVA 3M0QA 2I0NA 3VS7A 4RTUA 4AG2C 2DL3A 1KSWA 1SRMA 3I9QA 3VS5A 1Y0MA 4OMNA 1I07A 3A98A 1PHTA 1Z9QA 2FG0A 2JS0A 3FJ5A 2AZVA 2D8JA 4RTYA 5GJWB 1T0JA 1GL5A 2HCKA 2L3SA 1U06A 2HBWA 1OPLA 2JMCA 1YWPA 2BZXA 3REAB 2AKKA 1NLOC 2OI3A 3VS4A 4A63B 1M3CA 1K4US 2EVRA 1GFDA 1QLYA 3LH5A 2B86A 2YUPA 3RNJA 2DRMA 2D1XA 4AG1C 2FRWA 1X69A 1ARKA 2PZ1A 2GGRA 4F16A 1KFZA 3IQLA 1T3LA 3RBBB 2P4RA 2K2MA 2MOXA 4RTZA 1YN8A 1PKSA 1WFWA 2GTJA 2KRMA 1ABOA 3VRZA 1JQQA 1KIKA 1X27A 2DLPA 1YWOA 1G2BA 1AZEA 1Z9ZA 1PNJA 4RTVA 4CC7A 1AOJA 1H3HA 2NUZA 2KYMA 1UTIA 2J7IA 1H92A 1E7OA 2LJ3A 1QWFA 4J9HA 1QWEA 1OPKA 2SEMA 3VS1A 2EPDA 2EW3A 3PE0A 4CC2A 1MUZA 1UJ0A 2PTKA 1UHCA 2GNCA 1K9AA 4J9GA 2L3QA 1X43A 2O88A 1OEBA 3REBB 1AVZC 2VWFA 3EG2A 3EHRA 4EIKA 1NEBA 1NLPC 1RUWA 1M3AA 1WDXA 4AFQC 3NMZC 2CSQA 2EYXA 4IIOA 1WXTA 2LJ1A 5ECAA 5IH2A 3O5ZA 1AZGB 1GRIA 3EGUA 2SRCA 4DEYA 2CDTA 2LX7A 1AWOA 2KT8A 3H0FA 5I11A 1FMKA 2RNAA 4GBQA 4LUEA 4CC3A 2RN8A 1VA7A 1K1ZA 1HD3A 2RQTA 1CKAA 2A36A 2H8HA 3H0HA 1UG1A 2CH4A 4HVUA 5FW9A 4QT7A 2DJQA 4AFSC 3QWYA 1GCQC 1UGVA 5I22A 4AFZC 2ED1A 2KRSA 3PVQA 2KR3A 2K7AA 1NM7A 2EYWA 4OMQA 1BB9A 1ZUKA 2CT3A 2JT4A 2FEIA 1NYGA 2X3WD 3ZL7C 1TG0A 1CSKA 5FWCA 1JEGA 2X3XD 2DM1A 3SEMA 2O31A 2C0IA 2K6DA 1HJDA 2G6FX 2D0NA 1FYNA 1TUDA 4X1VA 1ZLMA 2W0ZA 4GLMA 2DBKA 2BZ8A 2V1QA 2EYYA 4FSSA 4KRTA 1JO8A 2K9GA 3VS2A 2ROLA 2LP5A 2KXDA 2JM8A 4Z8AA 3SHWA 4Z89A 1GFCA 1U3OA 2W10A 1GBRA 2HEQA 1JXOA 2O9VA 4ORZA 1RLQC 2JXBA 1M30A 1LCKA 2YSQA 5HCKA 1M27C 1Y57A 4JJDA 2J6KA 4J9IA 3THKA 1WXUA 1B07A 3EG3A 2VVKA 1OOTA 3I5RA 1RLPC 2EGAA 2DNUA 4ESRA 2AKLA 2YUQA 1JXMA 1ZX6A 1KJWA 2J06A 3UF4A 2KROA 1WYXA 1QKWA 2BZYA 2K3BA 2J6FA 2EQIA 2FRYA 2GQIA 1AD5A 5IHNA 1E6HA 2PNIA 2DA9A 2MIOA 3PVLA 2LMJA 2C0TA 1MV3A 1CKBA 4Y92A 4F14A 2FPFA 1WIEA 4Z88A 1ZSGA 2O2OA 2RQRA 1QKXA 1UDLA 3H0IA 4D8DA 2RMOA 2QDLA 2RPNA 1M8MA 2KBTA 4JJCA 1ZUYA 4LE9A 2XMFA 2KYBA 4R0KA 5L23A 4CC4B 1UECA 1BK2A 2FPDA 1AWXA 1SHFA 2ED0A 2LNHB 1W70A 1W6XA 1N5ZA 2DX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OV3 A;  2CRE A;  2L2P A;  2MCN A;  2KGT A;  3TSZ A;  4RTT A;  5FWB A;  4J9D A;  1J3T A;  3EG1 A;  1G83 A;  2JS2 A;  1VYT A;  3UAT A;  2CUB A;  2D8H A;  2KNB B;  4J9C A;  3VS3 A;  1UFF A;  2DIL A;  2EBP A;  1GCP A;  1SHG A;  1W1F A;  2EKH A;  1PWT A;  3C0C A;  5IHK A;  1I1J A;  4RUG A;  1UJY A;  4LN2 A;  2A28 A;  3CQT A;  1RI9 A;  1X2K A;  2JMA A;  4WCI A;  4ZNX A;  1VYU A;  4J9B A;  1ZUU A;  2IIM A;  4E6R A;  1X6B A;  2FPE A;  4F17 A;  2GTO A;  5EC7 A;  2O9S A;  2DL4 A;  3VRY A;  2A37 A;  2HSP A;  3M0T A;  1M3B A;  3M0P A;  1B3Q A;  1WX6 A;  1X2Q A;  2ECZ A;  1XOV A;  1UUE A;  1E6G A;  4HVW A;  2EGE A;  1AEY A;  1T0H A;  2CSI A;  2EYZ A;  1I0C A;  2F2V A;  1ABQ A;  1BU1 A;  2JM9 A;  2OJ2 A;  2JW4 A;  1AWJ A;  3UA6 A;  2AZS A;  5GJV B;  2NWM A;  3R6N A;  1X6G A;  1YCS B;  2A08 A;  2L0A A;  2K79 A;  3GBQ A;  1AWW A;  4IIM A;  2M0Y A;  2JTE A;  4JZ3 A;  1V1C A;  2LJ0 A;  1BBZ A;  4AFU C;  1K0X A;  3M0U A;  1U5S A;  3U23 A;  2RQW A;  4HCK A;  2DF6 A;  2F2X A;  1SEM A;  2GBQ A;  2YT6 A;  3M0R A;  1SRL A;  4DEX A;  2ESW A;  1UE9 A;  4OMO A;  1PRM C;  2J05 A;  2M51 A;  3NPF A;  4LUD A;  3TSW A;  2YDL A;  2DMO A;  4OML A;  3EG0 A;  2LCS A;  2AK5 A;  1NEG A;  2LQN A;  4JPB W;  2ENM A;  2YUN A;  3ULR B;  2F2W A;  2KE9 A;  2DL5 A;  3QWX X;  4LNP A;  1NG2 A;  2DVJ A;  1JU5 C;  4RTX A;  1TUC A;  1QCF A;  2KXC A;  1EFN A;  2KEA A;  4RTW A;  3VS0 A;  2HDA A;  2LZ6 B;  1ZBJ A;  2RQV A;  1YNZ A;  2BTT A;  3NHN A;  2VKN A;  4HXJ A;  2EGC A;  1GBQ A;  1NYF A;  1WA7 A;  1GCQ A;  1UHF A;  2LQW A;  2DL7 A;  3EHQ A;  3UA7 A;  1H8K A;  4J9E A;  1PRL C;  4D8K A;  1HSQ A;  1K76 A;  2DBM A;  4OMP A;  3VS6 A;  2E5K A;  3NGP A;  1SPK A;  2FO0 A;  2YUO A;  1A0N B;  2V1R A;  2J6O A;  2RQU A;  5IXF A;  2L3P A;  4JJB A;  4J9F A;  1IO6 A;  1VYV A;  2KRN A;  4K11 A;  4M4Z A;  2KT1 A;  2ROT A;  1K0S A;  3I35 A;  1YP5 A;  1PKT A;  3TVT A;  2CT4 A;  2DRK A;  2C0O A;  4OMM A;  4JZ4 A;  2OAW A;  3M0S A;  1WXB A;  2DYB A;  1T3S A;  5IXB A;  2ABL A;  2RF0 A;  2DE0 X;  3H41 A;  1WI7 A;  3JV3 A;  3KFV A;  3I5S A;  1MV0 B;  1S1N A;  2DL8 A;  5IHI A;  2CH4 W;  2CUD A;  1WLP B;  1SSH A;  4HVV A;  3M0Q A;  2I0N A;  3VS7 A;  4RTU A;  4AG2 C;  2DL3 A;  1KSW A;  1SRM A;  3I9Q A;  3VS5 A;  1Y0M A;  4OMN A;  1I07 A;  3A98 A;  1PHT A;  1Z9Q A;  2FG0 A;  2JS0 A;  3FJ5 A;  2AZV A;  2D8J A;  4RTY A;  5GJW B;  1T0J A;  1GL5 A;  2HCK A;  2L3S A;  1U06 A;  2HBW A;  1OPL A;  2JMC A;  1YWP A;  2BZX A;  3REA B;  2AKK A;  1NLO C;  2OI3 A;  3VS4 A;  4A63 B;  1M3C A;  1K4U S;  2EVR A;  1GFD A;  1QLY A;  3LH5 A;  2B86 A;  2YUP A;  3RNJ A;  2DRM A;  2D1X A;  4AG1 C;  2FRW A;  1X69 A;  1ARK A;  2PZ1 A;  2GGR A;  4F16 A;  1KFZ A;  3IQL A;  1T3L A;  3RBB B;  2P4R A;  2K2M A;  2MOX A;  4RTZ A;  1YN8 A;  1PKS A;  1WFW A;  2GTJ A;  2KRM A;  1ABO A;  3VRZ A;  1JQQ A;  1KIK A;  1X27 A;  2DLP A;  1YWO A;  1G2B A;  1AZE A;  1Z9Z A;  1PNJ A;  4RTV A;  4CC7 A;  1AOJ A;  1H3H A;  2NUZ A;  2KYM A;  1UTI A;  2J7I A;  1H92 A;  1E7O A;  2LJ3 A;  1QWF A;  4J9H A;  1QWE A;  1OPK A;  2SEM A;  3VS1 A;  2EPD A;  2EW3 A;  3PE0 A;  4CC2 A;  1MUZ A;  1UJ0 A;  2PTK A;  1UHC A;  2GNC A;  1K9A A;  4J9G A;  2L3Q A;  1X43 A;  2O88 A;  1OEB A;  3REB B;  1AVZ C;  2VWF A;  3EG2 A;  3EHR A;  4EIK A;  1NEB A;  1NLP C;  1RUW A;  1M3A A;  1WDX A;  4AFQ C;  3NMZ C;  2CSQ A;  2EYX A;  4IIO A;  1WXT A;  2LJ1 A;  5ECA A;  5IH2 A;  3O5Z A;  1AZG B;  1GRI A;  3EGU A;  2SRC A;  4DEY A;  2CDT A;  2LX7 A;  1AWO A;  2KT8 A;  3H0F A;  5I11 A;  1FMK A;  2RNA A;  4GBQ A;  4LUE A;  4CC3 A;  2RN8 A;  1VA7 A;  1K1Z A;  1HD3 A;  2RQT A;  1CKA A;  2A36 A;  2H8H A;  3H0H A;  1UG1 A;  2CH4 A;  4HVU A;  5FW9 A;  4QT7 A;  2DJQ A;  4AFS C;  3QWY A;  1GCQ C;  1UGV A;  5I22 A;  4AFZ C;  2ED1 A;  2KRS A;  3PVQ A;  2KR3 A;  2K7A A;  1NM7 A;  2EYW A;  4OMQ A;  1BB9 A;  1ZUK A;  2CT3 A;  2JT4 A;  2FEI A;  1NYG A;  2X3W D;  3ZL7 C;  1TG0 A;  1CSK A;  5FWC A;  1JEG A;  2X3X D;  2DM1 A;  3SEM A;  2O31 A;  2C0I A;  2K6D A;  1HJD A;  2G6F X;  2D0N A;  1FYN A;  1TUD A;  4X1V A;  1ZLM A;  2W0Z A;  4GLM A;  2DBK A;  2BZ8 A;  2V1Q A;  2EYY A;  4FSS A;  4KRT A;  1JO8 A;  2K9G A;  3VS2 A;  2ROL A;  2LP5 A;  2KXD A;  2JM8 A;  4Z8A A;  3SHW A;  4Z89 A;  1GFC A;  1U3O A;  2W10 A;  1GBR A;  2HEQ A;  1JXO A;  2O9V A;  4ORZ A;  1RLQ C;  2JXB A;  1M30 A;  1LCK A;  2YSQ A;  5HCK A;  1M27 C;  1Y57 A;  4JJD A;  2J6K A;  4J9I A;  3THK A;  1WXU A;  1B07 A;  3EG3 A;  2VVK A;  1OOT A;  3I5R A;  1RLP C;  2EGA A;  2DNU A;  4ESR A;  2AKL A;  2YUQ A;  1JXM A;  1ZX6 A;  1KJW A;  2J06 A;  3UF4 A;  2KRO A;  1WYX A;  1QKW A;  2BZY A;  2K3B A;  2J6F A;  2EQI A;  2FRY A;  2GQI A;  1AD5 A;  5IHN A;  1E6H A;  2PNI A;  2DA9 A;  2MIO A;  3PVL A;  2LMJ A;  2C0T A;  1MV3 A;  1CKB A;  4Y92 A;  4F14 A;  2FPF A;  1WIE A;  4Z88 A;  1ZSG A;  2O2O A;  2RQR A;  1QKX A;  1UDL A;  3H0I A;  4D8D A;  2RMO A;  2QDL A;  2RPN A;  1M8M A;  2KBT A;  4JJC A;  1ZUY A;  4LE9 A;  2XMF A;  2KYB A;  4R0K A;  5L23 A;  4CC4 B;  1UEC A;  1BK2 A;  2FPD A;  1AWX A;  1SHF A;  2ED0 A;  2LNH B;  1W70 A;  1W6X A;  1N5Z A;  2DX1 A; 
#chains in the Genus database with same CATH topology
 3UDC A;  1R8O B;  1OV3 A;  2CRE A;  2RA2 A;  2F1L A;  2WSC E;  3MEV A;  1K8A U;  3DLM A;  4RTT A;  3TSZ A;  4M7D B;  4X34 A;  2V8J A;  1VYT A;  5A0G A;  2QEX Q;  1RAF B;  2P0K A;  4ANJ A;  5GAN 7;  3JCM X;  4J9C A;  4JUV A;  3VJP A;  1UFF A;  3BDU A;  3LW5 E;  4MZT A;  6AT1 B;  2EKH A;  4E7K A;  2A3L A;  1K73 C;  1UJY A;  4LN2 A;  2X4J A;  3QO3 A;  3E1S A;  1WHL A;  4PJO D;  1G3T A;  2IIM A;  4QQG A;  3M5A A;  1QQJ A;  5EC7 A;  1VQ9 A;  1TUG B;  3HFO A;  1M3B A;  3OMG A;  3BFM A;  3OBY A;  4BD3 A;  1UUE A;  4M7A C;  1YBY A;  1E6G A;  4M78 F;  4JS4 A;  1AEY A;  5AYF A;  4HT8 A;  3L2V A;  1TTH B;  1ABQ A;  4C8Q G;  2JM9 A;  1VIF A;  5D7U A;  4KUI A;  2L0A A;  2QQ9 A;  4LDY A;  2OTJ T;  1HYO A;  3L2U A;  3GBQ A;  4M7A E;  1WNL A;  3CMA T;  2JTE A;  4JZ3 A;  1VQ9 Q;  2LJ0 A;  1K0X A;  4PFZ A;  1U5S A;  3JB9 I;  4B6M A;  4HCK A;  4E7I A;  3CPF A;  1MGQ A;  2F2X A;  4FYY B;  1RAB B;  5FLX E;  1K8A R;  4F7U F;  1SRL A;  1K73 U;  2EJ9 A;  2ESW A;  4TVR A;  1D1C A;  5GAN 4;  4XTX A;  2M51 A;  2QG9 B;  4FSX A;  3TSW A;  4M78 B;  3QUI A;  3S3N A;  5IAY A;  3GPL A;  2LQN A;  1B34 B;  5CR2 A;  1KG1 A;  2YUN A;  5CQX A;  1RL2 A;  4WF2 A;  5GAO m;  4FT2 A;  4MZP A;  2DVJ A;  3QHS A;  5LL6 S;  1RAE B;  2KXC A;  5KH6 A;  3OW2 A;  3H6Z A;  3VS0 A;  2P0P A;  2DD5 A;  3RR6 A;  2ZZD A;  1IGQ A;  1Y07 A;  4XU3 A;  3SDZ A;  2KK4 A;  4F7U B;  2KMT A;  3OYN A;  2LQW A;  3EHQ A;  3MJX A;  2X4Y A;  2FB7 A;  1H8K A;  2VGM A;  2G3R A;  1PRL C;  1NBE B;  5LJ5 e;  4LDV A;  3CME T;  3KBG A;  3V7C A;  5FRO A;  1A0N B;  3FB9 A;  2P0Q A;  1Y96 A;  1IO6 A;  1W2B A;  3VKI A;  3M53 A;  2QK0 A;  4M4Z A;  2R5A A;  2RJD A;  3I35 A;  1S72 A;  3O8V A;  2DTI A;  2MWO A;  2DRK A;  1RAA B;  3C4S A;  4OMM A;  4JZ4 A;  2CP0 A;  2DYB A;  1K73 R;  3EFO B;  3JV3 A;  5DLO A;  3RKX A;  1S1N A;  5IHI A;  3JB9 D;  3PIO A;  1TWB A;  2CUD A;  3JRZ A;  1SSH A;  4HVV A;  2I0N A;  4AG2 C;  3RUX A;  1SRM A;  3I9Q A;  3VS5 A;  1Y0M A;  1S72 Q;  3HRT A;  1VUB A;  1Z9Q A;  4PLL A;  1M90 C;  1X6O A;  5CAI A;  1FX7 A;  3HRU A;  2HCK A;  2HBW A;  1OPL A;  3JCM b;  2DK3 A;  2AKK A;  3D7S B;  4EMG A;  2DIQ A;  2WSE E;  3UWN A;  1OX9 A;  4DQ2 A;  1ZA1 B;  2YRC A;  3RNJ A;  2DRM A;  4ZTF A;  3EFR A;  4FYV B;  1ARK A;  2PZ1 A;  2E1H A;  2LQK A;  3A8H B;  3S3O A;  1OZ3 A;  2P4R A;  1BI1 A;  4M7D D;  2K2M A;  4C92 F;  1QP3 A;  1WFW A;  2GTJ A;  5KE2 A;  2RHZ A;  4M75 A;  1ABO A;  2L3R A;  4QVC A;  1X27 A;  1KIK A;  2D6F A;  5KYX B;  3VV0 A;  3VUB A;  1AZE A;  1PNJ A;  2ATC B;  1AHJ B;  1UTI A;  1YJW T;  3MKD A;  3C12 A;  2V8K A;  3L42 A;  3OYJ A;  1E7O A;  2E10 A;  4M77 D;  1M90 U;  1UGR B;  2QQS A;  1VQ6 T;  2RHX A;  1M4Z A;  4PKC C;  1O75 A;  4CC2 A;  2DET A;  1UJ0 A;  4PFP A;  1UHC A;  2EJG A;  2GNC A;  3I56 A;  3REB B;  2GFU A;  2VWF A;  2K2V A;  1NEB A;  2K3Y A;  1VQO T;  1NZ9 A;  4C92 B;  1R0C B;  4QVD A;  2CSQ A;  4A4E A;  3FRN A;  4HA8 A;  3AHU A;  1VQ5 T;  2LJ1 A;  1VQL A;  1YJN T;  2HKQ B;  2RO0 A;  5C6S A;  3CCE T;  2KT8 A;  3H0F A;  1VQ4 A;  5I11 A;  2K3X A;  4C5E A;  3I56 Q;  2CZ7 B;  4J6X A;  5KYW A;  3P8H A;  2RN8 A;  1HD3 A;  4ATO A;  5KYY B;  3CCR A;  4KBM B;  3OYD A;  3EGD A;  2RD1 A;  3VYG A;  4IUP A;  4HVU A;  2DJQ A;  1IB8 A;  3OYM A;  3NTI A;  1VQL Q;  4RKU E;  2KRS A;  1N8R C;  2FYK A;  4PLI A;  4BI4 A;  1VQ4 Q;  1ZUK A;  3FDR A;  1NYG A;  4C5H A;  4B9W A;  4KUD K;  2MWP A;  1W4S A;  3CCR Q;  2HL5 C;  2P4T A;  4M78 C;  1BI2 A;  2O31 A;  3RMS A;  1KHI A;  4LD9 K;  2C0I A;  2K6D A;  1M90 R;  2K5I A;  4C8Q F;  1FYN A;  2W0Z A;  1P92 A;  4N4G A;  2HQX A;  4M78 E;  4Z8A A;  1GFC A;  1VQK T;  1C0M A;  3PGG A;  2QTX A;  2EQK A;  1PSE A;  4Y28 E;  3CCL T;  5FU7 B;  2M9U A;  2NUT A;  2HQE A;  1VQ7 T;  2JN0 A;  2VVK A;  4X9D A;  3I5R A;  1VIE A;  2JVV A;  1JXM A;  2EFI A;  1KJW A;  3LLR A;  1WYX A;  3HTR A;  3M4G A;  3LGL A;  1N8R U;  2VAS A;  2K5F A;  3X20 B;  4C8Q B;  4F7U E;  5GAN 6;  3JCM c;  3OYF A;  3FLG A;  2OTJ A;  1G3S A;  3PVL A;  1RI0 A;  1NPP A;  1CKB A;  3CMA A;  3QKJ A;  2ZPG B;  2FPF A;  1R77 A;  1M1K C;  5DLQ E;  3H0I A;  4D8D A;  5C0M A;  1LPL A;  4BUG A;  4M75 G;  4CC4 B;  3BW1 A;  1AWX A;  2OTJ Q;  4XAX B;  4ZN3 A;  4QVZ A;  3RDV A;  3CMA Q;  2LQ8 A;  2Y4X A;  3JCM e;  2EWN A;  3DKM A;  3E19 A;  1D1A A;  4F04 B;  2LTO A;  2KGT A;  4OP0 A;  2L5Q A;  2X4X A;  3EG1 A;  1G83 A;  5CKH A;  3OSV A;  7AT1 B;  2D8H A;  5LJ3 f;  1N27 A;  2EQJ A;  2DIL A;  1X01 A;  3CC2 T;  4C0G A;  3CCJ T;  1V29 B;  3LGF A;  1I1J A;  1IXD A;  4OGC A;  4RUG A;  4PJO A;  3E2U A;  1RI9 A;  1X2K A;  3H8Z A;  3G6E A;  2JMA A;  4WCI A;  4RMO A;  4DA4 A;  5GMK h;  1ZUU A;  1M1K U;  4E6R A;  2HBP A;  1N8R R;  3PFS A;  2O9S A;  4BI8 B;  2DL4 A;  2YHT A;  3ER0 A;  1YIJ T;  3CME A;  3M0P A;  1I5L A;  4E7H A;  1WX6 A;  2ECZ A;  1XOV A;  1D3B B;  3MPU B;  1H64 1;  3QII A;  5GAM f;  2XKO C;  3OS0 A;  8AT1 B;  3MP1 A;  4EMK A;  2NWM A;  1X6G A;  2A08 A;  1PD1 A;  3G6E Q;  5GAM d;  3TRE A;  3EFS A;  4IIM A;  3QZ9 B;  2EJF A;  4C92 D;  3NTK A;  5EG2 A;  1JRI A;  3CME Q;  2KVQ G;  4ZGE B;  2DF6 A;  3TQ7 P;  3PTA A;  2GBQ A;  2BKD N;  5LJ3 g;  3OA6 A;  4XTW A;  4KT0 E;  4OMO A;  5AT1 B;  5KE3 A;  3GNG A;  4VUB A;  1PRM C;  1VQL T;  2J05 A;  3FEO A;  3HSB A;  2YDL A;  5GAN d;  2QAS A;  2LCS A;  5L8R E;  4R56 A;  3TEE A;  2NUP B;  1ACM B;  1VQ4 T;  2ZPF B;  1I5O B;  1SSF A;  4RG2 A;  1MMN A;  5LJ3 h;  2JNG A;  2XHC A;  1ZBX A;  3EG9 A;  2JJ9 A;  3QDF A;  4PNO A;  4LDX A;  1TUC A;  2IPO B;  1LNX A;  2YRD A;  5KCH A;  5HK3 A;  1M1K R;  1TS9 A;  3QZ5 B;  1XTD A;  2LT1 A;  1YNZ A;  4XQ3 A;  2EGC A;  1KD1 U;  1GBQ A;  1NYF A;  2BUD A;  1GCQ A;  2E3I A;  4NS5 A;  2DZ9 A;  4LXC A;  3HFN A;  2EQM A;  2DL7 A;  1LVK A;  1G3Y A;  2QYZ A;  4A4K A;  2KI7 A;  4RCB A;  2E5K A;  3MEA A;  1SPK A;  2YUO A;  1YJW A;  2X4W A;  2V1R A;  2RQU A;  2DEQ A;  5IXF A;  5GAM h;  4J9F A;  1M5Q 1;  2EYQ A;  1VQ6 A;  2KRN A;  2NYS A;  3PIP A;  4FW1 A;  2KT1 A;  2NUP A;  2ROT A;  1K0S A;  2LCC A;  1WJR A;  2CT4 A;  2DTH A;  4MMK A;  1RAG B;  1QP2 A;  2CZ1 B;  3M0S A;  4XTY A;  1VQO A;  1WXB A;  2VYT A;  4M7A D;  1UEB A;  5FU7 C;  3M56 A;  3H41 A;  1WHM A;  1VQ8 A;  3I5S A;  3OS2 A;  5GAO r;  1VQ5 A;  3T9N A;  2AHJ B;  2K57 A;  1YJW Q;  2CZ0 B;  3VS7 A;  4RTU A;  1KSW A;  1YJN A;  2DIG A;  4XU0 A;  3L2Z A;  1JBM A;  1VQ6 Q;  3JB9 H;  4OMN A;  3CCE A;  2VB6 A;  2QA4 A;  2QDY B;  2YXY A;  1U8R A;  1PHT A;  4JRK A;  5A2Q E;  1KQ2 A;  4C8Q C;  2D8J A;  1D09 B;  4RTY A;  4E47 A;  1M2V A;  1T0J A;  2O4X A;  4C5G A;  1VQO Q;  4PJO G;  4ME7 A;  4QW2 A;  1VQ8 Q;  3C95 A;  2MI6 A;  2QQB A;  3HRS A;  1VQ5 Q;  2OI3 A;  3VS4 A;  2VC8 A;  1KD1 R;  1HXD A;  4A63 B;  2DAQ A;  2L8D A;  3SD4 A;  4C8Q E;  5I21 A;  3JAM E;  1K4U S;  3X26 B;  3G7Z A;  4JS5 A;  2ZCF B;  1YJN Q;  2B86 A;  2YUP A;  4AG1 C;  3JCM Q;  2E12 A;  3BDL A;  3CCE Q;  2HL3 A;  2FRW A;  2QA4 Q;  1X69 A;  2F5T X;  1V76 A;  1KHC A;  3QJY A;  1Q82 C;  3GF5 A;  2JTM A;  2MOX A;  1Y96 B;  3OW2 P;  2COY A;  1M9S A;  4LDW A;  5GAN 3;  4EMK C;  2LNV A;  3VRZ A;  4EDU A;  3GLX A;  2ZPE B;  4NOY A;  1H3H A;  1VQK A;  4M77 A;  2J7I A;  4BDY A;  1WHG A;  1H92 A;  4X9C A;  1N9S A;  2LJ3 A;  3CCL A;  4J9H A;  1QWE A;  2E6N A;  4D6W A;  1UB4 A;  1MUZ A;  1QVF A;  2JUF A;  2QGG A;  1WQ7 A;  1R0B G;  2L3Q A;  1X43 A;  1VQ7 A;  1ZA2 B;  1OEB A;  4M75 F;  1W2B P;  3G6E T;  2WSF E;  3EHR A;  3EG2 A;  1SKU B;  1U1T A;  4FU6 A;  1RUW A;  4N0A A;  3NMZ C;  3DLL A;  3J7A F;  4BE0 A;  4II1 A;  1VQK Q;  4JRP A;  1F1B B;  5ECA A;  5IH2 A;  1WPY A;  3O5Z A;  1AZG B;  5J26 A;  4HCC A;  3CCL Q;  2L89 A;  1Q82 U;  2SRC A;  3PMI A;  4HCB A;  2CDT A;  2LX7 A;  2DKG A;  3L2R A;  2E5Q A;  5CCA A;  3M57 A;  1VQ7 Q;  4CC3 A;  2A7Y A;  4KH0 B;  2XID A;  1K1Z A;  5GAO n;  2XDB A;  2RQT A;  3CBP A;  1Y7X A;  2QI2 A;  2X35 A;  4CI0 C;  1OZ2 A;  2M0O A;  4AFS C;  3WVD B;  1GCQ C;  1UGV A;  2RHY A;  4M75 B;  5I22 A;  1LOJ A;  2ED1 A;  3OW2 S;  3PVQ A;  2CYZ B;  5LJ5 f;  4ZGD B;  3DB4 A;  4YTL A;  1BB9 A;  5LJ5 d;  2JT4 A;  2DPP B;  2KQW A;  2X3W D;  3ZL7 C;  1KK7 A;  1EIF A;  1KQS A;  5FWC A;  2MK5 A;  1JEG A;  2DM1 A;  4JJN K;  3JCM V;  5IN1 A;  1TSF A;  2IG0 A;  3CBO A;  3CC2 A;  1BI0 A;  3OBW A;  4FYW B;  3ZBD A;  3V8L A;  2DBK A;  3CCJ A;  2DXU A;  3JB9 G;  2Y90 A;  1JO8 A;  2R57 A;  3NTH A;  1W2B S;  4MDX A;  1GBR A;  3MET A;  4ORZ A;  4IUQ A;  2CS7 A;  2RHI A;  2VXF A;  1LCK A;  3CPW A;  5HCK A;  2JZ2 A;  4E7J A;  2M02 A;  1YIJ A;  1Y57 A;  3GOX A;  3CC2 Q;  1Q82 R;  5KYN A;  3RIR A;  1WXU A;  1B07 A;  3EG3 A;  1OOT A;  1RLP C;  2EGA A;  3CCJ Q;  1EZZ B;  1M2O A;  5KYW B;  2YUQ A;  1M1G A;  3G1J A;  3EGD B;  3F70 A;  3HL8 A;  5IHN A;  1E6H A;  1D0Y A;  2DA9 A;  2MIO A;  2PNI A;  2RJF A;  2Z0W A;  1YIJ Q;  3VYH B;  1WIE A;  1ZSG A;  3MP8 A;  3CXC A;  2FL7 A;  2RMO A;  2QDL A;  1RAI B;  1ZUY A;  4LE9 A;  2XMF A;  2KYB A;  5L23 A;  4FT4 A;  1VQ8 T;  4HT9 A;  5LJ5 h;  1K9M C;  1BK2 A;  1SHF A;  2ED0 A;  2LNH B;  1W70 A;  2NLU A;  2RHU A;  1JJ2 A;  5GMK j;  4NL3 A;  2L2P A;  4BE1 A;  2QA4 T;  2MCN A;  3A1P A;  2DER A;  1G5V A;  3PT9 A;  5FWB A;  4J9D A;  4R55 A;  4A4F A;  2VV5 A;  2JS2 A;  3M9Q A;  3QDR B;  2HSE B;  3UAT A;  4PK4 A;  3QYH B;  1QCN A;  2EBP A;  2NUT B;  1YFN A;  1GCP A;  2RM4 A;  3I55 A;  4O5V A;  3QG1 A;  1NE8 A;  1SHG A;  1PWT A;  5HKC A;  2LT4 A;  3DB3 A;  3CCM T;  4M78 D;  4N0A C;  1FMV A;  4BY6 B;  1OYX A;  4ZNX A;  1VYU A;  4GLK A;  1X6B A;  4IUU A;  4DOW A;  1Q81 U;  3RER A;  1BI3 A;  3KXT A;  3I55 Q;  4A4H A;  4FCY A;  1ZSZ A;  2EGE A;  2PVD B;  5CKB A;  1K9M U;  1T0H A;  2RK2 A;  2CSI A;  2EYZ A;  1I0C A;  3JCM W;  1BU1 A;  4PJO F;  2JW4 A;  1AWJ A;  2DXT A;  3UA6 A;  3TCJ A;  5GAO p;  1YCS B;  2DXC A;  3HPW A;  2OTL A;  2KDS A;  3A8G B;  1OI1 A;  1PD0 A;  1V1C A;  3VU3 C;  3M0U A;  5LJ3 j;  3U23 A;  2RQW A;  2LX9 A;  1SEM A;  2YT6 A;  3SWN A;  3V7S A;  2HQH A;  3OYY A;  4DEX A;  2EIF A;  3CCV T;  4XU2 A;  2OTL Q;  1MMD A;  4OML A;  2AK5 A;  4JPB W;  4PJO B;  3ULR B;  2KE9 A;  2DL5 A;  9ATC B;  2DD4 A;  4LNP A;  4PL6 A;  1JU5 C;  4E7S A;  4J83 A;  5CKD A;  3M54 A;  4JLG A;  1GXI E;  1MNE A;  5GAM j;  3OS5 A;  4RTW A;  4DBQ A;  4NL2 A;  1ZBJ A;  3NHN A;  4M75 C;  2VKN A;  1QVG A;  2MPX C;  5LJ3 e;  5I2M A;  2XD0 A;  4DBH A;  1K9M R;  4EMK B;  2ZPI B;  1VQM T;  2V8I A;  3MHX A;  2HD0 A;  3FIF A;  2EQU A;  2BIV A;  4M75 E;  2XK0 A;  4J9E A;  2X51 A;  3SFM A;  1VQP T;  1HSQ A;  1K76 A;  2HZY A;  4OMP A;  1QW1 A;  3VS6 A;  5CQY A;  3NGP A;  4BDZ A;  3X28 B;  3JB9 J;  4K11 A;  4MML A;  1DJ7 B;  3WXM B;  5IT9 E;  3URG A;  4M7A A;  3KUF A;  3TVT A;  3WVE B;  3EH2 A;  1RAD B;  2C0O A;  2RI5 A;  3JCM J;  1RAC B;  5IXB A;  2RF0 A;  3JCM f;  1WI7 A;  3M4Y A;  3KFV A;  4OF1 A;  4L5G A;  5GAN 5;  2DL8 A;  3JCM d;  2CKK A;  2DFU A;  1IZ6 A;  2HKN A;  1VQN T;  1OX8 A;  1WJS A;  3EG9 B;  2FVU A;  5A0D A;  3CBM A;  3RMQ A;  2E3H A;  5J39 A;  2FG0 A;  3RES A;  2AZV A;  3MEU A;  1GL5 A;  1KD1 C;  1U06 A;  4PJL A;  1I4K 1;  3JB9 F;  1WJQ A;  2YRV A;  3GP8 A;  1YWP A;  2BZX A;  2PUO B;  3REA B;  1NLO C;  1IGU A;  3HP9 A;  1ZQ1 A;  1C1A A;  3NFC A;  1D0Z A;  2EVR A;  4CRI A;  1GFD A;  2LDM A;  1WHH A;  2FZK B;  4OB0 B;  1WZO A;  5DY9 A;  1JB0 E;  2D1X A;  1NPR A;  5HY6 A;  4LD6 A;  5GAN f;  2XG8 D;  1T3L A;  3ZEH A;  2LVM A;  4RTZ A;  1YN8 A;  2RB6 A;  4OB3 B;  2KRM A;  2XDD A;  1JQQ A;  4KGX B;  2C06 A;  5CK9 A;  1YWO A;  2ZGW A;  4RCC A;  3E9G A;  4RTV A;  1AOJ A;  2NUZ A;  2KYM A;  1MMG A;  3A8L B;  3H9N A;  3G71 T;  4FIB A;  3CCQ T;  3I55 T;  2PU9 B;  3M55 A;  3MP6 A;  3J80 E;  1QWF A;  3CC7 Q;  2ZAE A;  2SEM A;  3VS1 A;  2RH2 A;  2EPD A;  2OAU A;  3PE0 A;  5GAM g;  3OYI A;  2MMP A;  3OQ5 A;  1WGS A;  2QXF A;  4J9G A;  3LWH A;  3JCM h;  4BY6 C;  1BYM A;  4EIK A;  1UGP B;  3OYE A;  1M2V B;  2DTO A;  2O4X B;  1M3A A;  1WDX A;  2EYX A;  4IIO A;  2AIR B;  2EAY A;  4M77 F;  1Q95 G;  3CCS T;  4RG8 A;  2PUK B;  4DEY A;  2HNI A;  4A54 A;  2K5L A;  1AWO A;  1YJ9 T;  1FMK A;  4GBQ A;  3MCA B;  5GAN g;  3OMC A;  5J3B A;  3JCM P;  4E2F B;  2OTL T;  3CD6 T;  2A36 A;  4PFO A;  2CH4 A;  2F69 A;  5FRM A;  5FW9 A;  4QT7 A;  1QVP A;  3CCU T;  2E64 A;  2O01 E;  5KYU B;  3E9F A;  4QQD A;  4C8Q D;  2KR3 A;  2K7A A;  3L2W A;  1EX4 A;  1XNI A;  1NM7 A;  5GAN h;  4GY5 A;  4M77 B;  4KH1 B;  1FXX A;  2DEU A;  1TG0 A;  1KQ1 A;  5KCO A;  1CSK A;  1PC0 A;  3OS1 A;  1X75 C;  1MMA A;  1I81 A;  3SEM A;  4M7A G;  1FMW A;  4L59 A;  4AMC A;  1HJD A;  4C0Z A;  4PJO C;  3G4S T;  4GLM A;  3RKY A;  2BZ8 A;  2Y4Y A;  2V1Q A;  2EYY A;  4KRT A;  1BCM A;  3VS2 A;  2M16 A;  2LP5 A;  2KXD A;  3CCM A;  4FM4 B;  4OGE A;  3CC4 T;  3SHW A;  4Z89 A;  2RK1 A;  1U3O A;  2W10 A;  4PJO E;  4M7D A;  4OVA A;  1RLQ C;  4BAC A;  2RI2 A;  4KUL A;  4QQ6 A;  1M30 A;  1TU0 B;  2R5M A;  5M9O A;  1UGS B;  1M27 C;  3S6W A;  4BE2 A;  1TH7 A;  4DOV A;  2J6K A;  2M1H A;  1BIA A;  5KYU A;  1ZHI A;  1I8F A;  2QTV A;  4ELY C;  4ESR A;  1QVF P;  4A4G A;  1BCO A;  5LJ5 j;  3CCM Q;  2ZPB B;  2KRO A;  1QKW A;  4IUV A;  4C0D B;  2J6F A;  2COW A;  2EQI A;  1YHQ T;  4KGV B;  5CKE A;  2DYI A;  1AD5 A;  2WAC A;  4B9X A;  2LMJ A;  2C0T A;  4OB2 B;  3QSU A;  4F14 A;  1Q86 C;  2RJE A;  3HHT B;  3GIB A;  5FU6 C;  1UDL A;  5CKF A;  4IKF A;  2RPN A;  2A0F B;  4Y91 A;  5GAO l;  3INZ A;  2R58 A;  1UEC A;  3CCV A;  2KSS A;  1N5Z A;  2DX1 A;  2JTF A;  2H3E B;  2GCX A;  4FYX B;  3A8O B;  4J6Y A;  1J3T A;  3PNW C;  4JLI A;  5CVI A;  4PJJ A;  1OQK A;  2CUB A;  3TU4 K;  2KNB B;  3VS3 A;  1KQS P;  2QQA A;  4OMF B;  3CCV Q;  4HCZ A;  4M78 A;  1W1F A;  5FRN A;  3C0C A;  5IHK A;  1QCO A;  1D1B A;  3V7R A;  1B34 A;  2XI9 A;  1O9S A;  3P8B B;  2A28 A;  3CQT A;  2XU8 A;  1OUL A;  1VQM A;  2OX7 A;  2CGH A;  4J9B A;  1Q86 U;  1QVF S;  3UPU A;  1H3Z A;  3SB2 A;  2FPE A;  4F17 A;  2GTO A;  3CC7 T;  3BY7 A;  1VQP A;  1PCX A;  2A37 A;  2HSP A;  3M0T A;  1B3Q A;  2I2L A;  2XIC A;  3CPW P;  1X2Q A;  4QKU A;  4HVW A;  4FW2 A;  1YIT T;  4C0F A;  2F2V A;  3A5Z B;  2CP6 A;  4F7U A;  2OJ2 A;  3QBY A;  3Q1J A;  2AZS A;  5GJV B;  4P5N A;  3R6N A;  1VQM Q;  2CP5 A;  1YI2 T;  4N4H A;  2K79 A;  2YLB A;  5GAN 8;  2F5K A;  1AWW A;  2M0Y A;  5DM7 R;  1IRX A;  1C6V X;  1VQP Q;  3QYG B;  3EAE A;  1BBZ A;  2XDP A;  4AFU C;  5GMK m;  2CP2 A;  3OYB A;  1YCY A;  1G3W A;  1VQN A;  2QEX T;  3M0R A;  4IUR A;  2QQR A;  1N9R A;  2MYS A;  5GMK l;  2K4Y A;  3CXC P;  1UE9 A;  4LDU A;  3NPF A;  4LUD A;  3EFO A;  2YLC A;  2DMO A;  4XTZ A;  5LJ5 g;  3EG0 A;  4ZGJ B;  1NEG A;  1KC8 C;  3OB9 A;  2ENM A;  1KQS S;  1M8V A;  4M7D G;  2F2W A;  4ELZ C;  2FZC B;  3QWX X;  2MF2 A;  4M7D C;  1NG2 A;  3EGX B;  4EPC A;  1Q81 C;  1VQN Q;  4RTX A;  1JJ2 P;  4J5Y A;  4PJN A;  1QCF A;  1Q86 R;  1EFN A;  2KEA A;  2HAX A;  2HDA A;  4WTO B;  2LZ6 B;  4ZTJ A;  2B8A A;  1IRE B;  2RQV A;  2BTT A;  1WHJ A;  4M7D E;  4KGZ B;  2MAM A;  4HXJ A;  1ZSZ B;  2CP7 A;  2E4H A;  5GMK i;  1WA7 A;  4M77 G;  3CPW S;  2RI3 A;  3OYA A;  1UHF A;  2P84 A;  1WHK A;  4M77 C;  3UA7 A;  1FWZ A;  1MND A;  1VQ9 T;  5CIU A;  1N6A A;  4D8K A;  2DBM A;  2DVE A;  4XTU A;  3G71 A;  3V8J A;  2FO0 A;  4BB7 A;  2J6O A;  3CCQ A;  4M77 E;  3V8K A;  2L3P A;  4JJB A;  3PMT A;  2E41 A;  1VYV A;  4JRQ A;  2LC4 A;  2IVW A;  3P8D A;  3S3M A;  3SWN B;  1YP5 A;  2DXB A;  4MDW A;  1WQW A;  2D9T A;  1PKT A;  1BKB A;  5GAN 2;  1KC8 U;  2GF7 A;  5D6X A;  5KYX A;  3EGX A;  2OAW A;  2KY9 A;  1TOV A;  1T3S A;  2ABL A;  4C5I A;  2DE0 X;  4XK8 E;  3CXC S;  3M58 A;  1MV0 B;  2E65 A;  4J6W A;  2CH4 W;  3G71 Q;  1PG5 B;  1Q7Y C;  3LH0 A;  1WLP B;  4Z02 A;  3CCS A;  3M0Q A;  4EMH A;  3CCQ Q;  3J81 E;  2DL3 A;  1VOM A;  2VXE A;  4MZM A;  1YJ9 A;  2CP3 A;  5GMK e;  1I07 A;  3OYL A;  3A98 A;  3N5B B;  4C0D C;  2JS0 A;  4M78 G;  4M7A F;  3FJ5 A;  1JJ2 S;  3ZFJ A;  5GJW B;  4C92 A;  2L3S A;  2EKO A;  2DO3 A;  2JMC A;  2GQV A;  3CD6 A;  2PVO B;  3GNF B;  1BIB A;  3CCU A;  1HK9 A;  1PM3 A;  4Q5W A;  3RKW A;  3FC3 A;  1M3C A;  4E7Z A;  3CCS Q;  1RAH B;  1QLY A;  3LH5 A;  3QPH A;  2DZC A;  1YJ9 Q;  2KAF A;  3R6O A;  1KFZ A;  4F16 A;  2GGR A;  4OB1 B;  1Y71 A;  3IQL A;  2GFA A;  5KYY A;  4XTV A;  4PJM A;  3RBB B;  2DJZ A;  4F7U G;  1PKS A;  1MHN A;  3CD6 Q;  1LJO A;  3OYH A;  3G4S A;  3CCU Q;  4M7A B;  1QVG P;  3C94 A;  2DLP A;  1Q7Y U;  1NJI C;  1G2B A;  5A0L A;  4M75 D;  1KC8 R;  1Z9Z A;  4CC7 A;  3CC4 A;  1XJW B;  2YWW A;  3LX7 A;  2COZ A;  3L1A A;  3LYI A;  1Q81 R;  1TXQ A;  1OPK A;  1PSF A;  2BE9 B;  3LWI A;  3AT1 B;  2EW3 A;  1S72 T;  2PTK A;  3ASK A;  5HK0 A;  4DBR A;  1K9A A;  3MEW A;  3G4S Q;  3EH1 A;  2O88 A;  1AVZ C;  1NLP C;  2FHD A;  4AFQ C;  3CC4 Q;  3X24 B;  3JSC A;  1WXT A;  3QXE B;  1YHQ A;  2QAZ A;  1GRI A;  3EGU A;  5GAN j;  3MO8 A;  1SF9 A;  3M59 A;  4A53 A;  4J7F A;  5I2S A;  2RNA A;  4LUE A;  5GAO q;  1M1F A;  5FU6 B;  1VA7 A;  1OU8 A;  3OYC A;  1CKA A;  2X9H A;  1NJI U;  2H8H A;  3H0H A;  1UG1 A;  2H3J A;  4BI3 A;  4C8Q A;  5D6W A;  5GAM e;  4UC4 A;  1YHQ Q;  1U1S A;  5LJ3 d;  3QWY A;  2LRQ A;  2VGN A;  3OYG A;  4O6J A;  4AFZ C;  1IHV A;  2ZPH B;  4JRI A;  2EYW A;  4OMQ A;  1Q7Y R;  2QGF B;  1QVG S;  2CT3 A;  4J8O A;  2FEI A;  4IUT A;  2BE7 D;  4AT1 B;  5D6Y A;  2X3X D;  3QJ6 A;  4ZN1 A;  2LCL A;  5CO7 A;  4N4I A;  2G6F X;  2D0N A;  1TUD A;  4X1V A;  1ZLM A;  5GAN e;  4FSS A;  2K9G A;  2ROL A;  2JM8 A;  1QMC A;  1B7T A;  2CZ6 B;  2V26 A;  2HEQ A;  1JXO A;  2O9V A;  2JXB A;  2AT1 B;  1XQH A;  1G8X A;  2YSQ A;  1IHW A;  2RJC A;  2HMA A;  3OYK A;  3CC7 A;  4J7I A;  2D0Q B;  2PQW A;  1SG5 A;  1ZSZ C;  2E70 A;  4V2S A;  1AT1 B;  1K8A C;  4JJD A;  3I56 T;  4L6V 5;  4J9I A;  3THK A;  3FJP A;  4C92 G;  8ATC B;  3CEY A;  2DNU A;  2AKL A;  3OSS C;  1YIT A;  4C92 C;  1D0X A;  1ZX6 A;  2J06 A;  3JCM g;  3UF4 A;  4JDS A;  2BZY A;  2K3B A;  4FL6 A;  2FRY A;  2GQI A;  4DBF A;  4E7L A;  4HKE A;  1YI2 A;  1NJI R;  4M7D F;  1OU9 A;  3BE3 A;  1MV3 A;  4C92 E;  2FZG B;  4Y92 A;  3UT1 A;  3VUZ A;  3SWN C;  4Z88 A;  2JOY A;  2O2O A;  3HKS A;  1D3B A;  2VUB A;  3ME9 A;  2RQR A;  1QKX A;  3X25 B;  3CCR T;  2QEX A;  1YIT Q;  1M8M A;  2KBT A;  4JJC A;  3OY9 A;  3L2Q A;  4R0K A;  2PVG B;  1UGQ B;  3A8M B;  1YI2 Q;  2E6Z A;  2FPD A;  4XU1 A;  1W6X A;  3VRY A; 
#chains in the Genus database with same CATH homology
 1OV3 A;  2CRE A;  2L2P A;  2MCN A;  2KGT A;  3TSZ A;  4RTT A;  5FWB A;  4J9D A;  1J3T A;  3EG1 A;  1G83 A;  2JS2 A;  1VYT A;  3UAT A;  2CUB A;  2D8H A;  2KNB B;  4J9C A;  3VS3 A;  1UFF A;  2DIL A;  2EBP A;  1GCP A;  1SHG A;  1W1F A;  2EKH A;  1PWT A;  3C0C A;  5IHK A;  1I1J A;  4RUG A;  1UJY A;  4LN2 A;  2A28 A;  3CQT A;  1RI9 A;  1X2K A;  2JMA A;  4WCI A;  4ZNX A;  1VYU A;  4J9B A;  1ZUU A;  2IIM A;  4E6R A;  1X6B A;  2FPE A;  4F17 A;  2GTO A;  5EC7 A;  2O9S A;  2DL4 A;  3VRY A;  2A37 A;  2HSP A;  3M0T A;  1M3B A;  3M0P A;  1B3Q A;  1WX6 A;  1X2Q A;  2ECZ A;  1XOV A;  1UUE A;  1E6G A;  4HVW A;  2EGE A;  1AEY A;  1T0H A;  2CSI A;  2EYZ A;  1I0C A;  2F2V A;  1ABQ A;  1BU1 A;  2JM9 A;  2OJ2 A;  2JW4 A;  1AWJ A;  3UA6 A;  2AZS A;  5GJV B;  2NWM A;  3R6N A;  1X6G A;  1YCS B;  2A08 A;  2L0A A;  2K79 A;  3GBQ A;  1AWW A;  4IIM A;  2M0Y A;  2JTE A;  4JZ3 A;  1V1C A;  2LJ0 A;  1BBZ A;  4AFU C;  1K0X A;  3M0U A;  1U5S A;  3U23 A;  2RQW A;  4HCK A;  2DF6 A;  2F2X A;  1SEM A;  2GBQ A;  2YT6 A;  3M0R A;  1SRL A;  4DEX A;  2ESW A;  1UE9 A;  4OMO A;  1PRM C;  2J05 A;  2M51 A;  3NPF A;  4LUD A;  3TSW A;  2YDL A;  2DMO A;  4OML A;  3EG0 A;  2LCS A;  2AK5 A;  1NEG A;  2LQN A;  4JPB W;  2ENM A;  2YUN A;  3ULR B;  2F2W A;  2KE9 A;  2DL5 A;  3QWX X;  4LNP A;  1NG2 A;  2DVJ A;  1JU5 C;  4RTX A;  1TUC A;  1QCF A;  2KXC A;  1EFN A;  2KEA A;  4RTW A;  3VS0 A;  2HDA A;  2LZ6 B;  1ZBJ A;  2RQV A;  1YNZ A;  2BTT A;  3NHN A;  2VKN A;  4HXJ A;  2EGC A;  1GBQ A;  1NYF A;  1WA7 A;  1GCQ A;  1UHF A;  2LQW A;  2DL7 A;  3EHQ A;  3UA7 A;  1H8K A;  4J9E A;  1PRL C;  4D8K A;  1HSQ A;  1K76 A;  2DBM A;  4OMP A;  3VS6 A;  2E5K A;  3NGP A;  1SPK A;  2FO0 A;  2YUO A;  1A0N B;  2V1R A;  2J6O A;  2RQU A;  5IXF A;  2L3P A;  4JJB A;  4J9F A;  1IO6 A;  1VYV A;  2KRN A;  4K11 A;  4M4Z A;  2KT1 A;  2ROT A;  1K0S A;  3I35 A;  1YP5 A;  1PKT A;  3TVT A;  2CT4 A;  2DRK A;  2C0O A;  4OMM A;  4JZ4 A;  2OAW A;  3M0S A;  1WXB A;  2DYB A;  1T3S A;  5IXB A;  2ABL A;  2RF0 A;  2DE0 X;  3H41 A;  1WI7 A;  3JV3 A;  3KFV A;  3I5S A;  1MV0 B;  1S1N A;  2DL8 A;  5IHI A;  2CH4 W;  2CUD A;  1WLP B;  1SSH A;  4HVV A;  3M0Q A;  2I0N A;  3VS7 A;  4RTU A;  4AG2 C;  2DL3 A;  1KSW A;  1SRM A;  3I9Q A;  3VS5 A;  1Y0M A;  4OMN A;  1I07 A;  3A98 A;  1PHT A;  1Z9Q A;  2FG0 A;  2JS0 A;  3FJ5 A;  2AZV A;  2D8J A;  4RTY A;  5GJW B;  1T0J A;  1GL5 A;  2HCK A;  2L3S A;  1U06 A;  2HBW A;  1OPL A;  2JMC A;  1YWP A;  2BZX A;  3REA B;  2AKK A;  1NLO C;  2OI3 A;  3VS4 A;  4A63 B;  1M3C A;  1K4U S;  2EVR A;  1GFD A;  1QLY A;  3LH5 A;  2B86 A;  2YUP A;  3RNJ A;  2DRM A;  2D1X A;  4AG1 C;  2FRW A;  1X69 A;  1ARK A;  2PZ1 A;  2GGR A;  4F16 A;  1KFZ A;  3IQL A;  1T3L A;  3RBB B;  2P4R A;  2K2M A;  2MOX A;  4RTZ A;  1YN8 A;  1PKS A;  1WFW A;  2GTJ A;  2KRM A;  1ABO A;  3VRZ A;  1JQQ A;  1KIK A;  1X27 A;  2DLP A;  1YWO A;  1G2B A;  1AZE A;  1Z9Z A;  1PNJ A;  4RTV A;  4CC7 A;  1AOJ A;  1H3H A;  2NUZ A;  2KYM A;  1UTI A;  2J7I A;  1H92 A;  1E7O A;  2LJ3 A;  1QWF A;  4J9H A;  1QWE A;  1OPK A;  2SEM A;  3VS1 A;  2EPD A;  2EW3 A;  3PE0 A;  4CC2 A;  1MUZ A;  1UJ0 A;  2PTK A;  1UHC A;  2GNC A;  1K9A A;  4J9G A;  2L3Q A;  1X43 A;  2O88 A;  1OEB A;  3REB B;  1AVZ C;  2VWF A;  3EG2 A;  3EHR A;  4EIK A;  1NEB A;  1NLP C;  1RUW A;  1M3A A;  1WDX A;  4AFQ C;  3NMZ C;  2CSQ A;  2EYX A;  4IIO A;  1WXT A;  2LJ1 A;  5ECA A;  5IH2 A;  3O5Z A;  1AZG B;  1GRI A;  3EGU A;  2SRC A;  4DEY A;  2CDT A;  2LX7 A;  1AWO A;  2KT8 A;  3H0F A;  5I11 A;  1FMK A;  2RNA A;  4GBQ A;  4LUE A;  4CC3 A;  2RN8 A;  1VA7 A;  1K1Z A;  1HD3 A;  2RQT A;  1CKA A;  2A36 A;  2H8H A;  3H0H A;  1UG1 A;  2CH4 A;  4HVU A;  5FW9 A;  4QT7 A;  2DJQ A;  4AFS C;  3QWY A;  1GCQ C;  1UGV A;  5I22 A;  4AFZ C;  2ED1 A;  2KRS A;  3PVQ A;  2KR3 A;  2K7A A;  1NM7 A;  2EYW A;  4OMQ A;  1BB9 A;  1ZUK A;  2CT3 A;  2JT4 A;  2FEI A;  1NYG A;  2X3W D;  3ZL7 C;  1TG0 A;  1CSK A;  5FWC A;  1JEG A;  2X3X D;  2DM1 A;  3SEM A;  2O31 A;  2C0I A;  2K6D A;  1HJD A;  2G6F X;  2D0N A;  1FYN A;  1TUD A;  4X1V A;  1ZLM A;  2W0Z A;  4GLM A;  2DBK A;  2BZ8 A;  2V1Q A;  2EYY A;  4FSS A;  4KRT A;  1JO8 A;  2K9G A;  3VS2 A;  2ROL A;  2LP5 A;  2KXD A;  2JM8 A;  4Z8A A;  3SHW A;  4Z89 A;  1GFC A;  1U3O A;  2W10 A;  1GBR A;  2HEQ A;  1JXO A;  2O9V A;  4ORZ A;  1RLQ C;  2JXB A;  1M30 A;  1LCK A;  2YSQ A;  5HCK A;  1M27 C;  1Y57 A;  4JJD A;  2J6K A;  4J9I A;  3THK A;  1WXU A;  1B07 A;  3EG3 A;  2VVK A;  1OOT A;  3I5R A;  1RLP C;  2EGA A;  2DNU A;  4ESR A;  2AKL A;  2YUQ A;  1JXM A;  1ZX6 A;  1KJW A;  2J06 A;  3UF4 A;  2KRO A;  1WYX A;  1QKW A;  2BZY A;  2K3B A;  2J6F A;  2EQI A;  2FRY A;  2GQI A;  1AD5 A;  5IHN A;  1E6H A;  2PNI A;  2DA9 A;  2MIO A;  3PVL A;  2LMJ A;  2C0T A;  1MV3 A;  1CKB A;  4Y92 A;  4F14 A;  2FPF A;  1WIE A;  4Z88 A;  1ZSG A;  2O2O A;  2RQR A;  1QKX A;  1UDL A;  3H0I A;  4D8D A;  2RMO A;  2QDL A;  2RPN A;  1M8M A;  2KBT A;  4JJC A;  1ZUY A;  4LE9 A;  2XMF A;  2KYB A;  4R0K A;  5L23 A;  4CC4 B;  1UEC A;  1BK2 A;  2FPD A;  1AWX A;  1SHF A;  2ED0 A;  2LNH B;  1W70 A;  1W6X A;  1N5Z A;  2DX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...