4AG1C

Human chymase - fynomer complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
VTLFVALYDYNATRWTDLSFHKGEKFQILEFGPGDWWEARSLTTGETGYIPSNYVAPVDSIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
molecule keywords CHYMASE
molecule tags Hydrolase/de novo protein
source organism Homo sapiens
total genus 12
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2012-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4ag1C00
2EGEA 1SPKA 1YP5A 2CSQA 2V1QA 2EYWA 4JZ4A 1ZUUA 2ED0A 2M0YA 3NHNA 1NYFA 3M0SA 4CC4B 3VS3A 1VYTA 1AZGB 1HD3A 1WFWA 2D1XA 2K7AA 2JW4A 4HVVA 1GBRA 1UHCA 5IXFA 1WDXA 1GFCA 1S1NA 1ZUYA 1OOTA 2KXCA 1EFNA 3UF4A 2EGAA 4LUEA 2KYMA 5L23A 3REAB 4F17A 1NEBA 4E6RA 1RLQC 2IIMA 5IHIA 2EQIA 2DVJA 1UG1A 3M0QA 4CC3A 2YT6A 2FEIA 2KROA 4FSSA 4RTVA 2KXDA 4JJCA 4RTTA 2VVKA 5HCKA 4DEXA 2MIOA 2C0OA 1UJYA 4LN2A 2DBKA 1BU1A 1UJ0A 1SHFA 2JM8A 4WCIA 1LCKA 4GLMA 4AFZC 2EBPA 2K3BA 1AVZC 2ROLA 3JV3A 1KFZA 1G2BA 2MOXA 2DMOA 2ECZA 1SEMA 2FPEA 2ABLA 2O2OA 2DLPA 2C0TA 2KBTA 3FJ5A 1GCQA 2CUBA 1K4US 4F16A 2L3QA 1SSHA 1CSKA 1J3TA 2K9GA 1WXTA 1AD5A 1M30A 2LQWA 3RNJA 2J06A 1BK2A 1K1ZA 5EC7A 4AFQC 2HBWA 4RTUA 1ABOA 2YUOA 3ULRB 4JZ3A 4F14A 1X43A 1NYGA 1VYUA 1YWPA 1AEYA 2RQRA 1ZBJA 4J9BA 1PKTA 4Z89A 1UFFA 1ZLMA 2KT8A 1Z9QA 1GRIA 4JJDA 2GBQA 1FMKA 2JS0A 2RQVA 4J9IA 2AZVA 1WYXA 1WX6A 2DE0X 1WXBA 4QT7A 1OPLA 4D8DA 2W10A 4CC2A 3VS7A 2D8JA 1ABQA 2EPDA 3UA6A 1QLYA 3REBB 4AG2C 4M4ZA 4GBQA 1NG2A 1PKSA 1TG0A 2EYZA 3EG1A 1T0JA 1U3OA 2JMAA 4DEYA 1MV0B 2EYYA 2B86A 1NLOC 2CUDA 3M0UA 1VYVA 3THKA 2DL7A 1K76A 5FW9A 2PTKA 2V1RA 1HSQA 3M0PA 1JEGA 4HXJA 1OPKA 3H41A 4X1VA 2XMFA 1M27C 1PNJA 2CT4A 2K79A 2LJ3A 2J7IA 3QWXX 2F2XA 4ZNXA 3NGPA 4OMMA 2J6FA 2KRNA 4J9FA 1SRMA 2H8HA 3TSZA 4J9CA 2KR3A 4JJBA 4ESRA 2CDTA 2KEAA 2C0IA 1M3AA 1W6XA 1GCQC 2BZ8A 1VA7A 3H0IA 1HJDA 5FWCA 2EYXA 1WLPB 4JPBW 2I0NA 2DL4A 1UE9A 1T0HA 1AZEA 1RLPC 2JM9A 3EG2A 1JXOA 2L3SA 2SEMA 1WA7A 1Z9ZA 5GJVB 1B3QA 2O9VA 2F2WA 4HVWA 3EHRA 5I22A 2NUZA 2JMCA 1JXMA 2AKKA 4OMNA 2RQUA 2O88A 1WXUA 1T3LA 2O31A 1QWEA 1WI7A 2KRSA 2X3WD 2LJ1A 2DL3A 2L2PA 1QCFA 4CC7A 2D0NA 4OMQA 1GBQA 4EIKA 1RUWA 3M0TA 2KRMA 1K0SA 1YCSB 2E5KA 1OV3A 1B07A 1E6HA 1H8KA 1BB9A 2DNUA 4AFUC 3C0CA 4AG1C 2J6KA 2AKLA 1X2KA 1ZX6A 5I11A 2FRYA 3TSWA 2FG0A 2LCSA 2GQIA 1TUCA 2CREA 5IH2A 3KFVA 3NPFA 2K6DA 3EHQA 4HVUA 3VS0A 2J05A 4Z88A 3I5RA 2L0AA 2QDLA 2DJQA 1I0CA 2EVRA 2RPNA 4IIOA 1AWOA 2DBMA 1AWXA 3SHWA 1Y0MA 3CQTA 4RUGA 2PNIA 1UHFA 1QWFA 1UDLA 1PRMC 2ED1A 2ESWA 2OAWA 4K11A 4J9EA 3A98A 1I1JA 1M8MA 4A63B 2HEQA 2LZ6B 2AZSA 1A0NB 1V1CA 4ORZA 1YWOA 2GTJA 1W1FA 3I9QA 2J6OA 1OEBA 2AK5A 2BZYA 3QWYA 2FRWA 2KE9A 1GFDA 3UATA 1NM7A 1E6GA 2CT3A 1BBZA 1ZSGA 3PE0A 1YN8A 2FO0A 2P4RA 2RQTA 4Y92A 1UECA 4J9HA 2EGCA 3VRYA 3VS5A 1PWTA 2LX7A 1ZUKA 2PZ1A 2MCNA 1U5SA 2LQNA 1CKAA 1JO8A 4Z8AA 1N5ZA 2VWFA 1X6GA 1QKXA 3LH5A 2RN8A 1GCPA 4LUDA 2RMOA 2YDLA 4HCKA 1IO6A 2DM1A 3SEMA 4OMOA 5IHKA 5IXBA 1Y57A 3I35A 1E7OA 2KNBB 2FPDA 1K9AA 4D8KA 1T3SA 2OI3A 2YUNA 2GGRA 1ARKA 1H3HA 1TUDA 2JXBA 1WIEA 2GNCA 4IIMA 2LJ0A 1UTIA 3EGUA 2RF0A 2EW3A 5IHNA 3U23A 2EKHA 4RTXA 1KJWA 1AOJA 2M51A 1SHGA 3ZL7C 3EG0A 3VRZA 3PVQA 1K0XA 1I07A 2K2MA 1FYNA 1MUZA 1MV3A 1JQQA 1PRLC 2DL5A 3R6NA 4AFSC 2ENMA 1X2QA 2YSQA 2X3XD 1JU5C 1XOVA 1AWJA 1M3CA 1U06A 2GTOA 5ECAA 2DRMA 2DF6A 2VKNA 1NEGA 1UGVA 2HCKA 3IQLA 4J9DA 1G83A 2D8HA 2LMJA 2DL8A 3H0FA 1CKBA 2DRKA 3PVLA 2BTTA 3M0RA 1UUEA 4LNPA 4RTWA 3EG3A 3I5SA 2BZXA 2DX1A 2F2VA 4OMLA 3GBQA 2RQWA 1W70A 4R0KA 3VS6A 2NWMA 1NLPC 4OMPA 1KIKA 1RI9A 2DA9A 2O9SA 2YUPA 3UA7A 2JS2A 2G6FX 3RBBB 2KT1A 2ROTA 1YNZA 2W0ZA 3H0HA 1AWWA 2A28A 1KSWA 1QKWA 4LE9A 2OJ2A 1H92A 2HDAA 3VS1A 3VS2A 2CH4A 2HSPA 2FPFA 2KYBA 1SRLA 2LNHB 1GL5A 5FWBA 2A36A 2JTEA 2LP5A 5GJWB 2RNAA 3VS4A 1X6BA 2JT4A 1X69A 3NMZC 2L3PA 4RTZA 4RTYA 2DYBA 4J9GA 1X27A 3TVTA 2A37A 2KGTA 3O5ZA 4KRTA 2CSIA 1M3BA 2CH4W 1PHTA 2A08A 2DILA 2SRCA 2YUQA
chains in the Genus database with same CATH superfamily
2QQAA 4IURA 2ED0A 2VXEA 2DJZA 2RHUA 3S3OA 4MZMA 1MHNA 4HKEA 3X24B 1D3BA 3PGGA 1R8OB 1WFWA 3ZFJA 1WHMA 1QCNA 5LJ3d 1UHCA 3JB9H 1WDXA 3E9GA 3CCSA 5I21A 4L6V5 4B9XA 3KXTA 1RAFB 1YJWT 1D3BB 1M90U 2D6FA 3OYAA 2E3IA 2EGAA 1B7TA 4LUEA 2MF2A 5L23A 3REAB 2R5MA 4F17A 1YI2A 2JZ2A 1VQKT 5IHIA 3JCMg 2OTLQ 2K4YA 4E7SA 6AT1B 2MIOA 2C0OA 4F7UF 3BY7A 4GY5A 1UJYA 1QQJA 2ZPBB 3EG9A 4A4EA 2DBKA 4WF2A 1BU1A 1SHFA 2JM8A 3PNWC 5FRNA 1YHQT 4GLMA 2C06A 4BUGA 1RADB 2EBPA 2RM4A 2P0QA 2QA4T 2K3BA 4BI8B 3EG9B 2ROLA 3UDCA 2MOXA 3J80E 4PLIA 4MMLA 1M2OA 2DMOA 1VQ5Q 1SEMA 2F5TX 3GP8A 2DLPA 3AHUA 2COZA 4F7UB 5GMKi 1K4US 4F16A 1CSKA 1WXTA 2HL5C 1ZBXA 1RACB 2DD5A 5DLQE 3RNJA 5LJ3g 2J06A 1ZA1B 2E12A 1R77A 2YUOA 3OW2S 1MMAA 2NYSA 2M1HA 4F14A 1W2BA 3DLMA 1PCXA 3MP6A 3RR6A 1VQLA 1ZBJA 9ATCB 1H3ZA 3GF5A 2M0OA 4PJOE 1YFNA 3QJYA 4C0GA 4HCZA 1ZLMA 2YRDA 4LD6A 1WJSA 4LDUA 1Z9QA 1GRIA 4JJDA 2HNIA 5CO7A 3QDRB 4J9IA 4R56A 3TU4K 1WX6A 3RMSA 4QT7A 2L5QA 1DJ7B 1OPLA 4D8DA 1D1CA 3MO8A 4CC2A 3VS7A 1QLYA 2X9HA 4AG2C 4M4ZA 4GBQA 4Y28E 3EG1A 2Z0WA 1IZ6A 4BY6C 4DEYA 4M78F 1TSFA 2E64A 2DL7A 5KE3A 2WSCE 2PTKA 4AMCA 2FVUA 2EYQA 3M4YA 2RJEA 2NUPA 3CCJQ 1D09B 1KC8U 4FYVB 2J7IA 1K73R 5CK9A 5GAN3 4P5NA 4ZNXA 4C0DB 4RG2A 1QMCA 2EAYA 2KY9A 4QVZA 4HA8A 3QHSA 5GANh 2KEAA 4M78B 3JCMe 1RAHB 3KBGA 1M3AA 3PTAA 4XAXB 2ZPIB 1Y7XA 5GANj 2E1HA 2EQJA 2KI7A 1HJDA 2D9TA 2I0NA 2DVEA 3C94A 4BD3A 1JJ2S 2JM9A 5KYWA 2E3HA 2SEMA 1N9SA 1WA7A 2E70A 1VQ4Q 2G3RA 5GJVB 4ELZC 5GAOl 4BE0A 3OYDA 3CC4Q 3CCLT 2O9VA 3A8MB 4HVWA 2GCXA 2QASA 1TUGB 2V8KA 3EHRA 4C92G 2A3LA 5KYWB 3CMEA 1KQ1A 4L59A 4ZGDB 3V8LA 2O88A 1QVGS 1C1AA 4XU0A 4M77F 5FRMA 4MDWA 4CC7A 4PJLA 3E19A 1GBQA 4C5EA 2XDDA 1WHJA 1RUWA 2X4WA 2KRMA 4JUVA 5CKFA 1K0SA 1YCSB 2E5KA 5CIUA 5LJ3e 1KD1C 3JCMV 4EDUA 4XTVA 3PT9A 2ZAEA 3C0CA 3INZA 1IHWA 4C8QG 5I11A 3CCEA 4R55A 3TSWA 2DIQA 1TUCA 3PMTA 3TQ7P 3OYEA 2K6DA 1X75C 4FCYA 2OAUA 4M77B 2DJQA 3OS0A 2EVRA 2RK2A 3LW5E 4E47A 1M1KR 5GAN5 1AWXA 1Y0MA 2ATCB 2HD0A 4MZTA 3HKSA 1KQSP 4BE2A 5IN1A 4M7AC 5D6YA 2DIGA 4J9EA 3V7SA 1LPLA 5KYUB 1YITT 2NLUA 4FIBA 2QGGA 1V1CA 4N4IA 4ORZA 4J7IA 3VYHB 1NJIU 3H6ZA 3G6ET 1YWOA 1VQNT 3I9QA 3ASKA 4FM4B 4M7DE 4V2SA 4M75G 2JJ9A 2FRWA 4PFOA 5D7UA 1NM7A 1SKUB 2CT3A 1BBZA 2P4RA 1FWZA 5LL6S 4J9HA 2EGCA 1F1BB 4EMKB 2HQXA 1VQ7Q 1QP3A 1G3YA 2LX7A 2PZ1A 4N0AA 1U5SA 1K9MR 4Z8AA 4BDZA 4NS5A 3CCMA 3OYLA 4HCKA 1NPRA 3I56T 4M7AE 2X35A 2KNBB 3RERA 2BE7D 1K9AA 1VQMT 1T3SA 3PFSA 1Q82R 2GGRA 1ARKA 1H3HA 4A53A 2GNCA 1RAEB 2VXFA 3F70A 4J7FA 3URGA 2QG9B 3HRUA 3UPUA 2FZCB 3U23A 4C5HA 3J81E 1KJWA 3META 1D0ZA 3EG0A 1WHLA 4XU2A 4E2FB 2QTVA 5GAN4 5CKBA 2VC8A 2RH2A 2RHYA 4NOYA 3A8OB 1K0XA 1I07A 3LLRA 4FYYB 4BI3A 1FYNA 3LWHA 3LX7A 3SD4A 2MWOA 4PLLA 3QIIA 1YIJA 3HPWA 1YJNT 3CCST 4J83A 4M77D 2K3XA 2YSQA 1Q81R 4DOVA 2V8IA 1XOVA 4C92F 5GAOq 2ZGWA 1I5OB 2GQVA 2QGFB 1UGSB 2LMJA 2DL8A 1BYMA 2EJFA 2HL3A 1K8AC 5LJ5h 4TVRA 1UUEA 5A0LA 2XDBA 4C92A 3PIPA 1M90R 3I5SA 2BZXA 3EFOB 3GBQA 1X6OA 4JRQA 5GMKl 3CMAT 2NWMA 5HK0A 2M9UA 3NTIA 2DA9A 3CCRQ 3E2UA 2O9SA 3FDRA 3UA7A 3OBYA 2RA2A 5C0MA 2PVDB 2G6FX 2WSFE 2KT1A 1I8FA 1TH7A 3MJXA 2VYTA 3CCVA 2CZ6B 2LRQA 4C8QA 2DZ9A 2D0QB 3OW2P 4KGVB 4XTUA 1H92A 2HDAA 1KQ2A 3CCQQ 4C8QE 2QQRA 5DLOA 3S3NA 2QAZA 2KYBA 3OYJA 2OTJQ 1SRLA 5LJ3f 1GL5A 1HYOA 2KK4A 2LP5A 3X20B 2RNAA 3VS4A 1W2BS 1RAGB 2JT4A 4XTYA 4OB1B 2L89A 2ZCFB 1FMWA 1EIFA 3JCMQ 3QYHB 4PK4A 2A37A 3O5ZA 4KRTA 2CSIA 4M75F 1M3BA 1VQLT 2WACA 3RIRA 4HCCA 4KGXB 2MPXC 2EGEA 3LH0A 1O9SA 2CSQA 3QKJA 4JZ4A 2M0YA 3NHNA 1NYFA 1IB8A 1BI0A 4M75A 2HQEA 2OTLA 5KYYA 3L1AA 3OYKA 2K7AA 3S3MA 1AT1B 5IXFA 3JCMh 2EFIA 1YJWQ 2MMPA 2RK1A 1S1NA 4ZTFA 4M75B 1EFNA 5J26A 2CP6A 1VQKQ 2E41A 1NEBA 4F7UG 1D0YA 2MI6A 3CC2Q 2QEXQ 2KXDA 5HCKA 3G71T 1VQ5A 2HZYA 4LN2A 4C92D 4AT1B 1YHQQ 2LTOA 2P4TA 1OX8A 4WCIA 1LCKA 3DLLA 1JJ2P 2DTOA 3P8BB 1XQHA 4NL3A 2QA4Q 2AIRB 1Y96A 3DKMA 2CP0A 1G2BA 4J8OA 3D7SB 2ECZA 1PG5B 4E7IA 4EMGA 1IGUA 1GCQA 2CUBA 4LXCA 1G3SA 1QVGP 2GF7A 3SWNA 3EFSA 1J3TA 1U8RA 4DBRA 3I55T 1M30A 2P84A 5D6XA 5A0GA 1BK2A 4AFQC 5I2SA 1VUBA 3MPUB 3SWNB 2JOYA 3X25B 5GMKe 1TU0B 1Y71A 1VYUA 2YLBA 5IAYA 3HFOA 4VUBA 4PJNA 3CXCA 4J9BA 1PKTA 3Q1JA 3RUXA 1Q7YC 3BDUA 3SB2A 5KE2A 2M16A 2DEUA 5KCHA 2VGMA 2LC4A 3M5AA 3OYHA 2JS0A 2RQVA 1IHVA 2AZVA 1WHGA 1OX9A 5A0DA 2VB6A 3CCET 2W10A 4PNOA 2CZ0B 4M78G 4M75D 2RHZA 3CCJA 3MEWA 1I81A 4ANJA 1IGQA 2OX7A 5GAMj 1U3OA 2EYYA 1QW1A 1NLOC 1VQPT 4XTXA 4XU3A 1XNIA 2KAFA 3THKA 3MEAA 3CCUQ 1Q81U 4EMHA 1B34B 1OZ3A 2E4HA 1YJ9Q 1P92A 2DPPB 2DXUA 3OS5A 3OA6A 2PQWA 2XMFA 3HP9A 1M27C 3BW1A 1TWBA 2AT1B 1X01A 2CT4A 2LJ3A 3QWXX 1BI2A 3GNFB 1KC8C 3NGPA 1VQ4A 2J6FA 4J9FA 1SRMA 2H8HA 3RDVA 2CP5A 3TSZA 4J9CA 2KR3A 1WQ7A 4ESRA 4RCCA 1ZA2B 2DXTA 1YCYA 1VA7A 2RI5A 1G5VA 3OYIA 1V76A 2EYXA 3H8ZA 1NJIR 1JRIA 2V26A 3KUFA 2DL4A 4OB3B 3OYNA 3CCLQ 2YWWA 3EGXA 3VKIA 2DTHA 5CCAA 4PJOC 2F2WA 3CCMT 4M77G 4PFPA 4F7UA 1OULA 1JXMA 2LT1A 3NTKA 3EGXB 1WXUA 1N8RC 1WI7A 3CD6T 4IUQA 2L2PA 1QCFA 3QZ9B 2EJ9A 1ZSZC 4IUUA 3M0TA 4OF1A 2RJCA 1OV3A 2ZPGB 3M59A 2DFUA 4AFUC 2VGNA 4AG1C 4ELYC 2BIVA 5GAMd 3MP8A 1C0MA 2CREA 3LGFA 3MKDA 5IH2A 3NPFA 3EHQA 3VS0A 3QUIA 2JTFA 2L0AA 3OMCA 2COWA 3CC7T 1I0CA 2HKNA 2CS7A 4C5GA 4IIOA 3VU3C 2DBMA 4ZTJA 4OGCA 4JRKA 2IPOB 1N9RA 1EZZB 3FB9A 1UDLA 1PRMC 2ED1A 2YLCA 2RHIA 2OAWA 1YITQ 3A98A 1VOMA 4A63B 2HEQA 1KG1A 1VQ7A 1N6AA 2QI2A 1VQNQ 1A0NB 3QBYA 1BI3A 3M9QA 2J6OA 2AK5A 4PJOB 3JB9I 4C0ZA 2MWPA 2BZYA 3L2RA 3UATA 2DXCA 3HL8A 3N5BB 1E6GA 1ZSGA 2ZZDA 1W2BP 4Y92A 2EWNA 4F04B 4M78A 3OS1A 2MCNA 2LQNA 1JO8A 1QKXA 3LH5A 2RN8A 5GAMg 2LVMA 5AT1B 2YDLA 3T9NA 1WJQA 3SEMA 4OMOA 2HKQB 3VYGA 5IHKA 1Y57A 5IXBA 1VQMQ 3I35A 3JCMX 2YUNA 4JRIA 3QO3A 4KH0B 5GAN7 4BACA 5IT9E 2EKHA 1LNXA 4QKUA 1PC0A 1SF9A 1RI0A 2E6NA 1AOJA 1SHGA 2HMAA 3ZL7C 4KGZB 2OTLT 1JQQA 1YJNQ 1ACMB 1ZQ1A 2VV5A 4A4KA 4B9WA 1X2QA 1JU5C 1NBEB 3EH1A 2GTOA 2DRMA 2DF6A 2VKNA 4ZN3A 1UGVA 1G83A 4BY6B 1FX7A 3CCRA 3H0FA 2DRKA 3G7ZA 2O01E 3PVLA 4M7DC 4XU1A 4LNPA 4M77A 3GPLA 3CMAQ 2COYA 2GFUA 2RQWA 4M77E 1W70A 1VQ9Q 5HY6A 1NLPC 3JCMb 3CCQA 1MMDA 1HXDA 3DB4A 2OTJA 4JDSA 2YUPA 3GIBA 2DEQA 2PVGB 3GNGA 2A0FB 1NE8A 5KYUA 4N0AC 1YNZA 2W0ZA 1OI1A 1Y07A 1AWWA 1K73C 2RHXA 4KULA 3AT1B 3P8DA 3OSVA 1MGQA 2PVOB 3FC3A 3VS2A 4PJMA 2HSPA 5CKEA 1FMVA 3S6WA 3VV0A 4M78D 3QXEB 2LNHB 5GANd 5FWBA 5FU7C 5GJWB 4WTOB 4M7DF 4EMKA 3MEUA 4FL6A 4OGEA 2DERA 3NMZC 4ZGEB 3CXCS 2DYBA 2K3YA 5J3BA 4J9GA 1C6VX 1Q95G 2QQBA 3TVTA 1VQOQ 1WQWA 2P0PA 2FZKB 2XG8D 1MNEA 2A08A 1YJWA 3FRNA 4FW1A 3JAME 1VQ8T 1SPKA 2DK3A 1YP5A 5GAMe 3EGDB 2EYWA 3M56A 1VQKA 4IUVA 5L8RE 1Q86R 4CC4B 4M7DB 1AZGB 2CKKA 3G4SQ 4FSXA 4OB2B 3CC2A 4M7AF 2QEXA 2JW4A 4HVVA 1UB4A 3UWNA 1GFCA 1VQ6T 1ZUYA 1YHQA 1G3TA 4E7JA 4DBQA 3HTRA 2QA4A 2V8JA 4E6RA 8ATCB 5KCOA 1RLQC 2EQIA 2DVJA 4OMFB 3M0QA 4CC3A 3CPWA 4A4FA 5M9OA 3G71Q 2YT6A 2FEIA 4FSSA 4RTVA 4RTTA 3RESA 4JJCA 2VVKA 4DEXA 4N4GA 2QXFA 4M7AB 5GANg 1M1KC 1UJ0A 1UEBA 3JB9G 2H3JA 2RJFA 4AFZC 4C8QC 2BUDA 2EJGA 2K5IA 2DD4A 3EFOA 1YI2T 2Y4XA 1PSEA 1QVFA 2F69A 4E7HA 2VUBA 4LDYA 1BIBA 3M57A 5LJ5j 2LQKA 5HKCA 2ABLA 2O2OA 1M1GA 4GLKA 3G1JA 4C92E 2B8AA 4JS4A 1OU9A 1KD1U 3X28B 5KYXA 2L3QA 1SG5A 3I55Q 1SSHA 4IUTA 2K9GA 2KMTA 3L42A 1AD5A 3MP1A 2DETA 2IG0A 2JTMA 1K1ZA 5EC7A 2HBWA 3ULRB 5KYXB 1YBYA 1K9MC 3M58A 1IXDA 1AEYA 3CBOA 2XU8A 3GOXA 4E7KA 1UFFA 3HHTB 1PM3A 1MMGA 2GBQA 1KHIA 1Q82C 3CCUA 1S72Q 1YJ9A 1U1SA 7AT1B 2EPDA 3UA6A 3REBB 4FW2A 3RKXA 1NG2A 1PKSA 4D6WA 2EYZA 3HSBA 4MMKA 4KH1B 1VQPQ 1MV0B 2B86A 3C12A 2CUDA 3M0UA 1VYVA 1QCOA 5FW9A 2H3EB 2V1RA 4B6MA 1EX4A 1Q81C 3QJ6A 3M0PA 1JEGA 3H41A 4J6YA 4X1VA 4M75E 2WSEE 3PMIA 2K79A 1D1BA 3OYMA 4OMMA 2CYZB 3CCLA 2KRNA 5HK3A 1M90C 3A5ZB 4DBHA 3OB9A 1WPYA 1W6XA 2L8DA 1GCQC 1NZ9A 3H0IA 3OYBA 1WLPB 5GANe 2QDYB 4JLIA 4DQ2A 1UE9A 1RLPC 3VUZA 2R58A 3EG2A 2L3SA 2RJDA 1Z9ZA 5GAMf 4PKCC 1B3QA 2NUZA 5KH6A 1ZHIA 2AKKA 3JB9F 4OB0B 2RQUA 1G8XA 3CD6Q 2O31A 1QWEA 5CQYA 2KRSA 2LCLA 5LJ3h 1HK9A 2X3WD 2DL3A 5KYNA 2D0NA 5LJ3j 3FLGA 2QQSA 5CAIA 1K8AU 3OYFA 1E6HA 1H8KA 1KHCA 3TEEA 1UGPB 4JRPA 5AYFA 3CMET 1ZX6A 4PJOG 2FRYA 4DBFA 2MK5A 4HVUA 4ME7A 1BKBA 2DYIA 1M2VB 1Q86U 3CC7Q 4Z88A 5LJ5g 1YITA 3CBMA 3I5RA 2QDLA 3SFMA 2DO3A 1VQNA 3ER0A 2RPNA 3CCRT 5GAOn 2EQUA 3CQTA 2LNVA 4QVCA 5J39A 1UHFA 1XTDA 3JCMc 3C95A 4BI4A 1BCMA 1M8MA 2CP2A 2LZ6B 1B34A 1MMNA 2AZSA 2OTJT 3L2ZA 3BDLA 1OEBA 1AHJB 3RKWA 3M55A 1TTHB 2KE9A 1GFDA 5EG2A 1JBMA 2X4XA 1YN8A 2RQTA 1UECA 4C5IA 1VQMA 2LX9A 3MCAB 3CXCP 3VRYA 3J7AF 3VS5A 3BFMA 3FJPA 4FT2A 1PWTA 1ZUKA 4OVAA 4KBMB 2E5QA 2VWFA 3WVDB 4LUDA 3CC4A 3E9FA 3GLXA 2RMOA 1I4K1 3DB3A 4QVDA 3V8KA 2FPDA 4D8KA 1YJNA 4BE1A 1IRXA 2XDPA 1TUDA 2JXBA 4IIMA 2FL7A 3WXMB 2LJ0A 1UTIA 3EGUA 4J6XA 2RF0A 2EW3A 5I2MA 5IHNA 4RTXA 2M51A 3LWIA 2HQHA 2YHTA 3JB9D 4MDXA 2K2MA 1MV3A 3CC2T 2RO0A 2QEXT 4F7UE 3R6NA 4AFSC 2ENMA 3CMAA 2X3XD 2IVWA 3M54A 1U06A 4Y91A 5ECAA 1VQ9A 3CPWS 4J9DA 4QW2A 2KQWA 2D8HA 1V29B 5GAOr 4RCBA 4UC4A 2I2LA 5CQXA 4RTWA 3EG3A 5GANf 4PFZA 2MYSA 4OMLA 3OYCA 1YIJT 3OQ5A 2QTXA 5LJ5e 4R0KA 3PIOA 3VS6A 4XTWA 4C0DC 1QVFS 1WZOA 4OMPA 2CZ7B 1KIKA 4PJOF 2RB6A 4M78C 2JS2A 3QYGB 3EAEA 3OMGA 4NL2A 3H0HA 1QKWA 4LE9A 3A1PA 2YXYA 4PJOA 3BE3A 2EQKA 4M7DG 1VIFA 1VQOA 1Q7YU 5GAN6 2CH4A 1LVKA 2FPFA 4ATOA 3G6EQ 4ZN1A 1OYXA 2JTEA 1NJIC 1LOJA 1X69A 1GXIE 1KD1R 4RTYA 1ZSZA 3G4SA 3O8VA 3CCVT 1IREB 3JCMW 4PL6A 1PHTA 2QYZA 1VQ8Q 2DILA 2SRCA 3QG1A 2XIDA 2YUQA 4M78E 1ZSZB 2V1QA 4M7AG 1ZUUA 1UGRB 1M9SA 3M0SA 3VS3A 2R57A 3I56Q 3CCUT 1VYTA 2K5LA 4HCBA 1HD3A 1YJ9T 3OY9A 2D1XA 3G71A 1BCOA 3JCMJ 1GBRA 1VQ6Q 5GAN2 4LDXA 3TCJA 4M77C 1OOTA 2KXCA 2Y90A 1D1AA 3UF4A 1N27A 2NUPB 1D0XA 2DKGA 2KYMA 2X4YA 2JVVA 3LYIA 2IIMA 2EIFA 1UG1A 2AHJB 2KROA 3QSUA 5DM7R 3CCSQ 2DAQA 2ZPHB 5D6WA 1R0BG 4XTZA 4YTLA 2K5FA 3JSCA 4XK8E 2DXBA 2NUTA 4QQ6A 1YI2Q 1QVPA 3I55A 1AVZC 1VIEA 5FU6C 5FROA 3JV3A 1N8RU 1KFZA 2P0KA 1RAAB 1KQSA 2NUTB 2FPEA 4EMKC 2LCCA 1VQ5T 2C0TA 2KBTA 3FJ5A 4PJOD 2JUFA 4X9DA 2DZCA 3CPFA 5GMKh 2LQWA 2RI3A 1TOVA 1G3WA 3MEVA 4RTUA 5GMKj 1ABOA 1OQKA 5CVIA 1S72A 4JZ3A 2E65A 3HRSA 1X43A 1NYGA 1TXQA 4II1A 1YWPA 1RL2A 2KSSA 2RQRA 1FXXA 3QPHA 3L2QA 4KT0E 2RD1A 4Z89A 1VQPA 2KT8A 3X26B 1SSFA 1FMKA 3LGLA 5GAOm 1WYXA 2DE0X 1WXBA 3OYYA 2KVQG 2GFAA 3FIFA 3EGDA 2D8JA 1ABQA 5LJ5f 1K8AR 1W4SA 1VQLQ 1TG0A 4C0FA 4M7DA 1NPPA 1T0JA 4Z02A 2JMAA 3HRTA 3RKYA 3JRZA 1WHHA 4PJJA 2X51A 2LT4A 2XICA 3MHXA 1K76A 5FU6B 1HSQA 4QQDA 3P8HA 3OBWA 4HXJA 1OPKA 2O4XA 3JCMP 3UT1A 1PNJA 4BB7A 3CCJT 2F2XA 4C92C 1R0CB 1RABB 2K57A 5CKDA 2O4XB 4JJBA 2CDTA 2C0IA 4M7AA 2BZ8A 4DOWA 5FWCA 2EQMA 4JPBW 4KUIA 3CD6A 2HBPA 1T0HA 1AZEA 3A8LB 1JXOA 1TS9A 4CRIA 2PUKB 3E1SA 1VQ4T 4Q5WA 3CC4T 5FU7B 4XQ3A 4DA4A 1H641 5I22A 2JMCA 2RI2A 4E7LA 4FT4A 2LQ8A 4OMNA 1OZ2A 1T3LA 4RG8A 2LJ1A 4E7ZA 2XI9A 3OW2A 3CC7A 4OMQA 4EIKA 4FYXB 4LD9K 3JCMf 1WHKA 1M1FA 1B07A 4BDYA 1BB9A 3CPWP 3CMEQ 2DNUA 8AT1B 2JN0A 2J6KA 2AKLA 1X2KA 2CP3A 3V7CA 2FG0A 2LCSA 3HFNA 2GQIA 4HT8A 1PSFA 3KFVA 2QK0A 2BE9B 2J05A 2XKOC 4IUPA 2FZGB 4M75C 2X4JA 1PD0A 4C92B 4C8QF 1VQ9T 1Q86C 2E6ZA 3A8GB 1BIAA 3ME9A 1LJOA 2LDMA 4M7DD 1AWOA 1QVFP 3SHWA 3CBPA 2HAXA 4RUGA 1K73U 2PNIA 3CCEQ 1QWFA 2ESWA 3R6OA 4QQGA 4LDVA 3OSSC 4K11A 4O6JA 1I1JA 4A54A 1BI1A 3JB9J 2XHCA 2JNGA 2QQ9A 2GTJA 1W1FA 4C8QB 1XJWB 2PU9B 2CZ1B 3QWYA 2BKDN 1KK7A 4EPCA 1JB0E 5C6SA 3PE0A 2FO0A 3VJPA 4M7AD 1I5LA 1M8VA 4LDWA 1VQOT 5GAN8 5FLXE 1VQ7T 2HSEB 1JJ2A 5GMKm 1CKAA 1N5ZA 1X6GA 2YRCA 1GCPA 5LJ5d 1Q7YR 1IO6A 2PUOB 2DM1A 3ZBDA 3L2VA 4JJNK 3SWNC 3G4ST 1E7OA 3L2WA 2R5AA 2OI3A 1WNLA 3CEYA 1O75A 1WIEA 5GAOp 2YRVA 5KYYB 3ZEHA 1PD1A 1QVGA 1QP2A 3NTHA 3CCMQ 4A4GA 4RMOA 4J5YA 3SDZA 4X9CA 3VRZA 3PVQA 1MUZA 4J6WA 1M1KU 1RAIB 5A2QE 4JLGA 5CKHA 1PRLC 2CGHA 2DL5A 2ZPFB 2L3RA 1AWJA 1M3CA 4OP0A 4A4HA 3A8HB 5CR2A 1NEGA 2HCKA 3IQLA 2EKOA 3QDFA 2FB7A 2KDSA 1CKBA 2M02A 3V8JA 3FEOA 1KC8R 1M2VA 2BTTA 3M0RA 1U1TA 3QZ5B 4O5VA 2F1LA 4HT9A 3V7RA 1YIJQ 2FHDA 2DX1A 2F2VA 3OYGA 1Y96B 2MAMA 1M5Q1 3EH2A 4JS5A 2K2VA 4C8QD 4N4HA 4FU6A 2XK0A 3OS2A 1RI9A 2A7YA 3WVEB 3G6EA 4X34A 1KQSS 1WGSA 3M4GA 4MZPA 3RBBB 2ROTA 3C4SA 2CP7A 2A28A 3EFRA 1K9MU 1KSWA 2OJ2A 2F5KA 3JCMd 2FYKA 1WJRA 3VS1A 4KUDK 2Y4YA 1N8RR 3L2UA 3CCQT 1VQ8A 2ZPEB 3VUBA 3M53A 4ZGJB 4FYWB 1Q82U 2A36A 1M4ZA 1X6BA 2DTIA 3H9NA 2L3PA 3I56A 2XD0A 4RTZA 3CCVQ 1S72T 4RKUE 4L5GA 1X27A 2VASA 5GAMh 3TREA 5DY9A 2KGTA 2CH4W 3NFCA 1VQ6A 4IKFA 2E10A 1MNDA 4CI0C 1OU8A 3RMQA 1UGQB
chains in the Genus database with same CATH topology
2EGEA 1SPKA 1YP5A 2CSQA 2V1QA 2EYWA 4JZ4A 1ZUUA 2ED0A 2M0YA 3NHNA 1NYFA 3M0SA 4CC4B 3VS3A 1VYTA 1AZGB 1HD3A 1WFWA 2D1XA 2K7AA 2JW4A 4HVVA 1GBRA 1UHCA 5IXFA 1WDXA 1GFCA 1S1NA 1ZUYA 1OOTA 2KXCA 1EFNA 3UF4A 2EGAA 4LUEA 2KYMA 5L23A 3REAB 4F17A 1NEBA 4E6RA 1RLQC 2IIMA 5IHIA 2EQIA 2DVJA 1UG1A 3M0QA 4CC3A 2YT6A 2FEIA 2KROA 4FSSA 4RTVA 2KXDA 4JJCA 4RTTA 2VVKA 5HCKA 4DEXA 2MIOA 2C0OA 1UJYA 4LN2A 2DBKA 1BU1A 1UJ0A 1SHFA 2JM8A 4WCIA 1LCKA 4GLMA 4AFZC 2EBPA 2K3BA 1AVZC 2ROLA 3JV3A 1KFZA 1G2BA 2MOXA 2DMOA 2ECZA 1SEMA 2FPEA 2ABLA 2O2OA 2DLPA 2C0TA 2KBTA 3FJ5A 1GCQA 2CUBA 1K4US 4F16A 2L3QA 1SSHA 1CSKA 1J3TA 2K9GA 1WXTA 1AD5A 1M30A 2LQWA 3RNJA 2J06A 1BK2A 1K1ZA 5EC7A 4AFQC 2HBWA 4RTUA 1ABOA 2YUOA 3ULRB 4JZ3A 4F14A 1X43A 1NYGA 1VYUA 1YWPA 1AEYA 2RQRA 1ZBJA 4J9BA 1PKTA 4Z89A 1UFFA 1ZLMA 2KT8A 1Z9QA 1GRIA 4JJDA 2GBQA 1FMKA 2JS0A 2RQVA 4J9IA 2AZVA 1WYXA 1WX6A 2DE0X 1WXBA 4QT7A 1OPLA 4D8DA 2W10A 4CC2A 3VS7A 2D8JA 1ABQA 2EPDA 3UA6A 1QLYA 3REBB 4AG2C 4M4ZA 4GBQA 1NG2A 1PKSA 1TG0A 2EYZA 3EG1A 1T0JA 1U3OA 2JMAA 4DEYA 1MV0B 2EYYA 2B86A 1NLOC 2CUDA 3M0UA 1VYVA 3THKA 2DL7A 1K76A 5FW9A 2PTKA 2V1RA 1HSQA 3M0PA 1JEGA 4HXJA 1OPKA 3H41A 4X1VA 2XMFA 1M27C 1PNJA 2CT4A 2K79A 2LJ3A 2J7IA 3QWXX 2F2XA 4ZNXA 3NGPA 4OMMA 2J6FA 2KRNA 4J9FA 1SRMA 2H8HA 3TSZA 4J9CA 2KR3A 4JJBA 4ESRA 2CDTA 2KEAA 2C0IA 1M3AA 1W6XA 1GCQC 2BZ8A 1VA7A 3H0IA 1HJDA 5FWCA 2EYXA 1WLPB 4JPBW 2I0NA 2DL4A 1UE9A 1T0HA 1AZEA 1RLPC 2JM9A 3EG2A 1JXOA 2L3SA 2SEMA 1WA7A 1Z9ZA 5GJVB 1B3QA 2O9VA 2F2WA 4HVWA 3EHRA 5I22A 2NUZA 2JMCA 1JXMA 2AKKA 4OMNA 2RQUA 2O88A 1WXUA 1T3LA 2O31A 1QWEA 1WI7A 2KRSA 2X3WD 2LJ1A 2DL3A 2L2PA 1QCFA 4CC7A 2D0NA 4OMQA 1GBQA 4EIKA 1RUWA 3M0TA 2KRMA 1K0SA 1YCSB 2E5KA 1OV3A 1B07A 1E6HA 1H8KA 1BB9A 2DNUA 4AFUC 3C0CA 4AG1C 2J6KA 2AKLA 1X2KA 1ZX6A 5I11A 2FRYA 3TSWA 2FG0A 2LCSA 2GQIA 1TUCA 2CREA 5IH2A 3KFVA 3NPFA 2K6DA 3EHQA 4HVUA 3VS0A 2J05A 4Z88A 3I5RA 2L0AA 2QDLA 2DJQA 1I0CA 2EVRA 2RPNA 4IIOA 1AWOA 2DBMA 1AWXA 3SHWA 1Y0MA 3CQTA 4RUGA 2PNIA 1UHFA 1QWFA 1UDLA 1PRMC 2ED1A 2ESWA 2OAWA 4K11A 4J9EA 3A98A 1I1JA 1M8MA 4A63B 2HEQA 2LZ6B 2AZSA 1A0NB 1V1CA 4ORZA 1YWOA 2GTJA 1W1FA 3I9QA 2J6OA 1OEBA 2AK5A 2BZYA 3QWYA 2FRWA 2KE9A 1GFDA 3UATA 1NM7A 1E6GA 2CT3A 1BBZA 1ZSGA 3PE0A 1YN8A 2FO0A 2P4RA 2RQTA 4Y92A 1UECA 4J9HA 2EGCA 3VRYA 3VS5A 1PWTA 2LX7A 1ZUKA 2PZ1A 2MCNA 1U5SA 2LQNA 1CKAA 1JO8A 4Z8AA 1N5ZA 2VWFA 1X6GA 1QKXA 3LH5A 2RN8A 1GCPA 4LUDA 2RMOA 2YDLA 4HCKA 1IO6A 2DM1A 3SEMA 4OMOA 5IHKA 5IXBA 1Y57A 3I35A 1E7OA 2KNBB 2FPDA 1K9AA 4D8KA 1T3SA 2OI3A 2YUNA 2GGRA 1ARKA 1H3HA 1TUDA 2JXBA 1WIEA 2GNCA 4IIMA 2LJ0A 1UTIA 3EGUA 2RF0A 2EW3A 5IHNA 3U23A 2EKHA 4RTXA 1KJWA 1AOJA 2M51A 1SHGA 3ZL7C 3EG0A 3VRZA 3PVQA 1K0XA 1I07A 2K2MA 1FYNA 1MUZA 1MV3A 1JQQA 1PRLC 2DL5A 3R6NA 4AFSC 2ENMA 1X2QA 2YSQA 2X3XD 1JU5C 1XOVA 1AWJA 1M3CA 1U06A 2GTOA 5ECAA 2DRMA 2DF6A 2VKNA 1NEGA 1UGVA 2HCKA 3IQLA 4J9DA 1G83A 2D8HA 2LMJA 2DL8A 3H0FA 1CKBA 2DRKA 3PVLA 2BTTA 3M0RA 1UUEA 4LNPA 4RTWA 3EG3A 3I5SA 2BZXA 2DX1A 2F2VA 4OMLA 3GBQA 2RQWA 1W70A 4R0KA 3VS6A 2NWMA 1NLPC 4OMPA 1KIKA 1RI9A 2DA9A 2O9SA 2YUPA 3UA7A 2JS2A 2G6FX 3RBBB 2KT1A 2ROTA 1YNZA 2W0ZA 3H0HA 1AWWA 2A28A 1KSWA 1QKWA 4LE9A 2OJ2A 1H92A 2HDAA 3VS1A 3VS2A 2CH4A 2HSPA 2FPFA 2KYBA 1SRLA 2LNHB 1GL5A 5FWBA 2A36A 2JTEA 2LP5A 5GJWB 2RNAA 3VS4A 1X6BA 2JT4A 1X69A 3NMZC 2L3PA 4RTZA 4RTYA 2DYBA 4J9GA 1X27A 3TVTA 2A37A 2KGTA 3O5ZA 4KRTA 2CSIA 1M3BA 2CH4W 1PHTA 2A08A 2DILA 2SRCA 2YUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EGE A;  1SPK A;  1YP5 A;  2CSQ A;  2V1Q A;  2EYW A;  4JZ4 A;  1ZUU A;  2ED0 A;  2M0Y A;  3NHN A;  1NYF A;  3M0S A;  4CC4 B;  3VS3 A;  1VYT A;  1AZG B;  1HD3 A;  1WFW A;  2D1X A;  2K7A A;  2JW4 A;  4HVV A;  1GBR A;  1UHC A;  5IXF A;  1WDX A;  1GFC A;  1S1N A;  1ZUY A;  1OOT A;  2KXC A;  1EFN A;  3UF4 A;  2EGA A;  4LUE A;  2KYM A;  5L23 A;  3REA B;  4F17 A;  1NEB A;  4E6R A;  1RLQ C;  2IIM A;  5IHI A;  2EQI A;  2DVJ A;  1UG1 A;  3M0Q A;  4CC3 A;  2YT6 A;  2FEI A;  2KRO A;  4FSS A;  4RTV A;  2KXD A;  4JJC A;  4RTT A;  2VVK A;  5HCK A;  4DEX A;  2MIO A;  2C0O A;  1UJY A;  4LN2 A;  2DBK A;  1BU1 A;  1UJ0 A;  1SHF A;  2JM8 A;  4WCI A;  1LCK A;  4GLM A;  4AFZ C;  2EBP A;  2K3B A;  1AVZ C;  2ROL A;  3JV3 A;  1KFZ A;  1G2B A;  2MOX A;  2DMO A;  2ECZ A;  1SEM A;  2FPE A;  2ABL A;  2O2O A;  2DLP A;  2C0T A;  2KBT A;  3FJ5 A;  1GCQ A;  2CUB A;  1K4U S;  4F16 A;  2L3Q A;  1SSH A;  1CSK A;  1J3T A;  2K9G A;  1WXT A;  1AD5 A;  1M30 A;  2LQW A;  3RNJ A;  2J06 A;  1BK2 A;  1K1Z A;  5EC7 A;  4AFQ C;  2HBW A;  4RTU A;  1ABO A;  2YUO A;  3ULR B;  4JZ3 A;  4F14 A;  1X43 A;  1NYG A;  1VYU A;  1YWP A;  1AEY A;  2RQR A;  1ZBJ A;  4J9B A;  1PKT A;  4Z89 A;  1UFF A;  1ZLM A;  2KT8 A;  1Z9Q A;  1GRI A;  4JJD A;  2GBQ A;  1FMK A;  2JS0 A;  2RQV A;  4J9I A;  2AZV A;  1WYX A;  1WX6 A;  2DE0 X;  1WXB A;  4QT7 A;  1OPL A;  4D8D A;  2W10 A;  4CC2 A;  3VS7 A;  2D8J A;  1ABQ A;  2EPD A;  3UA6 A;  1QLY A;  3REB B;  4AG2 C;  4M4Z A;  4GBQ A;  1NG2 A;  1PKS A;  1TG0 A;  2EYZ A;  3EG1 A;  1T0J A;  1U3O A;  2JMA A;  4DEY A;  1MV0 B;  2EYY A;  2B86 A;  1NLO C;  2CUD A;  3M0U A;  1VYV A;  3THK A;  2DL7 A;  1K76 A;  5FW9 A;  2PTK A;  2V1R A;  1HSQ A;  3M0P A;  1JEG A;  4HXJ A;  1OPK A;  3H41 A;  4X1V A;  2XMF A;  1M27 C;  1PNJ A;  2CT4 A;  2K79 A;  2LJ3 A;  2J7I A;  3QWX X;  2F2X A;  4ZNX A;  3NGP A;  4OMM A;  2J6F A;  2KRN A;  4J9F A;  1SRM A;  2H8H A;  3TSZ A;  4J9C A;  2KR3 A;  4JJB A;  4ESR A;  2CDT A;  2KEA A;  2C0I A;  1M3A A;  1W6X A;  1GCQ C;  2BZ8 A;  1VA7 A;  3H0I A;  1HJD A;  5FWC A;  2EYX A;  1WLP B;  4JPB W;  2I0N A;  2DL4 A;  1UE9 A;  1T0H A;  1AZE A;  1RLP C;  2JM9 A;  3EG2 A;  1JXO A;  2L3S A;  2SEM A;  1WA7 A;  1Z9Z A;  5GJV B;  1B3Q A;  2O9V A;  2F2W A;  4HVW A;  3EHR A;  5I22 A;  2NUZ A;  2JMC A;  1JXM A;  2AKK A;  4OMN A;  2RQU A;  2O88 A;  1WXU A;  1T3L A;  2O31 A;  1QWE A;  1WI7 A;  2KRS A;  2X3W D;  2LJ1 A;  2DL3 A;  2L2P A;  1QCF A;  4CC7 A;  2D0N A;  4OMQ A;  1GBQ A;  4EIK A;  1RUW A;  3M0T A;  2KRM A;  1K0S A;  1YCS B;  2E5K A;  1OV3 A;  1B07 A;  1E6H A;  1H8K A;  1BB9 A;  2DNU A;  4AFU C;  3C0C A;  4AG1 C;  2J6K A;  2AKL A;  1X2K A;  1ZX6 A;  5I11 A;  2FRY A;  3TSW A;  2FG0 A;  2LCS A;  2GQI A;  1TUC A;  2CRE A;  5IH2 A;  3KFV A;  3NPF A;  2K6D A;  3EHQ A;  4HVU A;  3VS0 A;  2J05 A;  4Z88 A;  3I5R A;  2L0A A;  2QDL A;  2DJQ A;  1I0C A;  2EVR A;  2RPN A;  4IIO A;  1AWO A;  2DBM A;  1AWX A;  3SHW A;  1Y0M A;  3CQT A;  4RUG A;  2PNI A;  1UHF A;  1QWF A;  1UDL A;  1PRM C;  2ED1 A;  2ESW A;  2OAW A;  4K11 A;  4J9E A;  3A98 A;  1I1J A;  1M8M A;  4A63 B;  2HEQ A;  2LZ6 B;  2AZS A;  1A0N B;  1V1C A;  4ORZ A;  1YWO A;  2GTJ A;  1W1F A;  3I9Q A;  2J6O A;  1OEB A;  2AK5 A;  2BZY A;  3QWY A;  2FRW A;  2KE9 A;  1GFD A;  3UAT A;  1NM7 A;  1E6G A;  2CT3 A;  1BBZ A;  1ZSG A;  3PE0 A;  1YN8 A;  2FO0 A;  2P4R A;  2RQT A;  4Y92 A;  1UEC A;  4J9H A;  2EGC A;  3VRY A;  3VS5 A;  1PWT A;  2LX7 A;  1ZUK A;  2PZ1 A;  2MCN A;  1U5S A;  2LQN A;  1CKA A;  1JO8 A;  4Z8A A;  1N5Z A;  2VWF A;  1X6G A;  1QKX A;  3LH5 A;  2RN8 A;  1GCP A;  4LUD A;  2RMO A;  2YDL A;  4HCK A;  1IO6 A;  2DM1 A;  3SEM A;  4OMO A;  5IHK A;  5IXB A;  1Y57 A;  3I35 A;  1E7O A;  2KNB B;  2FPD A;  1K9A A;  4D8K A;  1T3S A;  2OI3 A;  2YUN A;  2GGR A;  1ARK A;  1H3H A;  1TUD A;  2JXB A;  1WIE A;  2GNC A;  4IIM A;  2LJ0 A;  1UTI A;  3EGU A;  2RF0 A;  2EW3 A;  5IHN A;  3U23 A;  2EKH A;  4RTX A;  1KJW A;  1AOJ A;  2M51 A;  1SHG A;  3ZL7 C;  3EG0 A;  3VRZ A;  3PVQ A;  1K0X A;  1I07 A;  2K2M A;  1FYN A;  1MUZ A;  1MV3 A;  1JQQ A;  1PRL C;  2DL5 A;  3R6N A;  4AFS C;  2ENM A;  1X2Q A;  2YSQ A;  2X3X D;  1JU5 C;  1XOV A;  1AWJ A;  1M3C A;  1U06 A;  2GTO A;  5ECA A;  2DRM A;  2DF6 A;  2VKN A;  1NEG A;  1UGV A;  2HCK A;  3IQL A;  4J9D A;  1G83 A;  2D8H A;  2LMJ A;  2DL8 A;  3H0F A;  1CKB A;  2DRK A;  3PVL A;  2BTT A;  3M0R A;  1UUE A;  4LNP A;  4RTW A;  3EG3 A;  3I5S A;  2BZX A;  2DX1 A;  2F2V A;  4OML A;  3GBQ A;  2RQW A;  1W70 A;  4R0K A;  3VS6 A;  2NWM A;  1NLP C;  4OMP A;  1KIK A;  1RI9 A;  2DA9 A;  2O9S A;  2YUP A;  3UA7 A;  2JS2 A;  2G6F X;  3RBB B;  2KT1 A;  2ROT A;  1YNZ A;  2W0Z A;  3H0H A;  1AWW A;  2A28 A;  1KSW A;  1QKW A;  4LE9 A;  2OJ2 A;  1H92 A;  2HDA A;  3VS1 A;  3VS2 A;  2CH4 A;  2HSP A;  2FPF A;  2KYB A;  1SRL A;  2LNH B;  1GL5 A;  5FWB A;  2A36 A;  2JTE A;  2LP5 A;  5GJW B;  2RNA A;  3VS4 A;  1X6B A;  2JT4 A;  1X69 A;  3NMZ C;  2L3P A;  4RTZ A;  4RTY A;  2DYB A;  4J9G A;  1X27 A;  3TVT A;  2A37 A;  2KGT A;  3O5Z A;  4KRT A;  2CSI A;  1M3B A;  2CH4 W;  1PHT A;  2A08 A;  2DIL A;  2SRC A;  2YUQ A; 
#chains in the Genus database with same CATH topology
 2QQA A;  4IUR A;  2ED0 A;  2VXE A;  2DJZ A;  2RHU A;  3S3O A;  4MZM A;  1MHN A;  4HKE A;  3X24 B;  1D3B A;  3PGG A;  1R8O B;  1WFW A;  3ZFJ A;  1WHM A;  1QCN A;  5LJ3 d;  1UHC A;  3JB9 H;  1WDX A;  3E9G A;  3CCS A;  5I21 A;  4L6V 5;  4B9X A;  3KXT A;  1RAF B;  1YJW T;  1D3B B;  1M90 U;  2D6F A;  3OYA A;  2E3I A;  2EGA A;  1B7T A;  4LUE A;  2MF2 A;  5L23 A;  3REA B;  2R5M A;  4F17 A;  1YI2 A;  2JZ2 A;  1VQK T;  5IHI A;  3JCM g;  2OTL Q;  2K4Y A;  4E7S A;  6AT1 B;  2MIO A;  2C0O A;  4F7U F;  3BY7 A;  4GY5 A;  1UJY A;  1QQJ A;  2ZPB B;  3EG9 A;  4A4E A;  2DBK A;  4WF2 A;  1BU1 A;  1SHF A;  2JM8 A;  3PNW C;  5FRN A;  1YHQ T;  4GLM A;  2C06 A;  4BUG A;  1RAD B;  2EBP A;  2RM4 A;  2P0Q A;  2QA4 T;  2K3B A;  4BI8 B;  3EG9 B;  2ROL A;  3UDC A;  2MOX A;  3J80 E;  4PLI A;  4MML A;  1M2O A;  2DMO A;  1VQ5 Q;  1SEM A;  2F5T X;  3GP8 A;  2DLP A;  3AHU A;  2COZ A;  4F7U B;  5GMK i;  1K4U S;  4F16 A;  1CSK A;  1WXT A;  2HL5 C;  1ZBX A;  1RAC B;  2DD5 A;  5DLQ E;  3RNJ A;  5LJ3 g;  2J06 A;  1ZA1 B;  2E12 A;  1R77 A;  2YUO A;  3OW2 S;  1MMA A;  2NYS A;  2M1H A;  4F14 A;  1W2B A;  3DLM A;  1PCX A;  3MP6 A;  3RR6 A;  1VQL A;  1ZBJ A;  9ATC B;  1H3Z A;  3GF5 A;  2M0O A;  4PJO E;  1YFN A;  3QJY A;  4C0G A;  4HCZ A;  1ZLM A;  2YRD A;  4LD6 A;  1WJS A;  4LDU A;  1Z9Q A;  1GRI A;  4JJD A;  2HNI A;  5CO7 A;  3QDR B;  4J9I A;  4R56 A;  3TU4 K;  1WX6 A;  3RMS A;  4QT7 A;  2L5Q A;  1DJ7 B;  1OPL A;  4D8D A;  1D1C A;  3MO8 A;  4CC2 A;  3VS7 A;  1QLY A;  2X9H A;  4AG2 C;  4M4Z A;  4GBQ A;  4Y28 E;  3EG1 A;  2Z0W A;  1IZ6 A;  4BY6 C;  4DEY A;  4M78 F;  1TSF A;  2E64 A;  2DL7 A;  5KE3 A;  2WSC E;  2PTK A;  4AMC A;  2FVU A;  2EYQ A;  3M4Y A;  2RJE A;  2NUP A;  3CCJ Q;  1D09 B;  1KC8 U;  4FYV B;  2J7I A;  1K73 R;  5CK9 A;  5GAN 3;  4P5N A;  4ZNX A;  4C0D B;  4RG2 A;  1QMC A;  2EAY A;  2KY9 A;  4QVZ A;  4HA8 A;  3QHS A;  5GAN h;  2KEA A;  4M78 B;  3JCM e;  1RAH B;  3KBG A;  1M3A A;  3PTA A;  4XAX B;  2ZPI B;  1Y7X A;  5GAN j;  2E1H A;  2EQJ A;  2KI7 A;  1HJD A;  2D9T A;  2I0N A;  2DVE A;  3C94 A;  4BD3 A;  1JJ2 S;  2JM9 A;  5KYW A;  2E3H A;  2SEM A;  1N9S A;  1WA7 A;  2E70 A;  1VQ4 Q;  2G3R A;  5GJV B;  4ELZ C;  5GAO l;  4BE0 A;  3OYD A;  3CC4 Q;  3CCL T;  2O9V A;  3A8M B;  4HVW A;  2GCX A;  2QAS A;  1TUG B;  2V8K A;  3EHR A;  4C92 G;  2A3L A;  5KYW B;  3CME A;  1KQ1 A;  4L59 A;  4ZGD B;  3V8L A;  2O88 A;  1QVG S;  1C1A A;  4XU0 A;  4M77 F;  5FRM A;  4MDW A;  4CC7 A;  4PJL A;  3E19 A;  1GBQ A;  4C5E A;  2XDD A;  1WHJ A;  1RUW A;  2X4W A;  2KRM A;  4JUV A;  5CKF A;  1K0S A;  1YCS B;  2E5K A;  5CIU A;  5LJ3 e;  1KD1 C;  3JCM V;  4EDU A;  4XTV A;  3PT9 A;  2ZAE A;  3C0C A;  3INZ A;  1IHW A;  4C8Q G;  5I11 A;  3CCE A;  4R55 A;  3TSW A;  2DIQ A;  1TUC A;  3PMT A;  3TQ7 P;  3OYE A;  2K6D A;  1X75 C;  4FCY A;  2OAU A;  4M77 B;  2DJQ A;  3OS0 A;  2EVR A;  2RK2 A;  3LW5 E;  4E47 A;  1M1K R;  5GAN 5;  1AWX A;  1Y0M A;  2ATC B;  2HD0 A;  4MZT A;  3HKS A;  1KQS P;  4BE2 A;  5IN1 A;  4M7A C;  5D6Y A;  2DIG A;  4J9E A;  3V7S A;  1LPL A;  5KYU B;  1YIT T;  2NLU A;  4FIB A;  2QGG A;  1V1C A;  4N4I A;  4ORZ A;  4J7I A;  3VYH B;  1NJI U;  3H6Z A;  3G6E T;  1YWO A;  1VQN T;  3I9Q A;  3ASK A;  4FM4 B;  4M7D E;  4V2S A;  4M75 G;  2JJ9 A;  2FRW A;  4PFO A;  5D7U A;  1NM7 A;  1SKU B;  2CT3 A;  1BBZ A;  2P4R A;  1FWZ A;  5LL6 S;  4J9H A;  2EGC A;  1F1B B;  4EMK B;  2HQX A;  1VQ7 Q;  1QP3 A;  1G3Y A;  2LX7 A;  2PZ1 A;  4N0A A;  1U5S A;  1K9M R;  4Z8A A;  4BDZ A;  4NS5 A;  3CCM A;  3OYL A;  4HCK A;  1NPR A;  3I56 T;  4M7A E;  2X35 A;  2KNB B;  3RER A;  2BE7 D;  1K9A A;  1VQM T;  1T3S A;  3PFS A;  1Q82 R;  2GGR A;  1ARK A;  1H3H A;  4A53 A;  2GNC A;  1RAE B;  2VXF A;  3F70 A;  4J7F A;  3URG A;  2QG9 B;  3HRU A;  3UPU A;  2FZC B;  3U23 A;  4C5H A;  3J81 E;  1KJW A;  3MET A;  1D0Z A;  3EG0 A;  1WHL A;  4XU2 A;  4E2F B;  2QTV A;  5GAN 4;  5CKB A;  2VC8 A;  2RH2 A;  2RHY A;  4NOY A;  3A8O B;  1K0X A;  1I07 A;  3LLR A;  4FYY B;  4BI3 A;  1FYN A;  3LWH A;  3LX7 A;  3SD4 A;  2MWO A;  4PLL A;  3QII A;  1YIJ A;  3HPW A;  1YJN T;  3CCS T;  4J83 A;  4M77 D;  2K3X A;  2YSQ A;  1Q81 R;  4DOV A;  2V8I A;  1XOV A;  4C92 F;  5GAO q;  2ZGW A;  1I5O B;  2GQV A;  2QGF B;  1UGS B;  2LMJ A;  2DL8 A;  1BYM A;  2EJF A;  2HL3 A;  1K8A C;  5LJ5 h;  4TVR A;  1UUE A;  5A0L A;  2XDB A;  4C92 A;  3PIP A;  1M90 R;  3I5S A;  2BZX A;  3EFO B;  3GBQ A;  1X6O A;  4JRQ A;  5GMK l;  3CMA T;  2NWM A;  5HK0 A;  2M9U A;  3NTI A;  2DA9 A;  3CCR Q;  3E2U A;  2O9S A;  3FDR A;  3UA7 A;  3OBY A;  2RA2 A;  5C0M A;  2PVD B;  2G6F X;  2WSF E;  2KT1 A;  1I8F A;  1TH7 A;  3MJX A;  2VYT A;  3CCV A;  2CZ6 B;  2LRQ A;  4C8Q A;  2DZ9 A;  2D0Q B;  3OW2 P;  4KGV B;  4XTU A;  1H92 A;  2HDA A;  1KQ2 A;  3CCQ Q;  4C8Q E;  2QQR A;  5DLO A;  3S3N A;  2QAZ A;  2KYB A;  3OYJ A;  2OTJ Q;  1SRL A;  5LJ3 f;  1GL5 A;  1HYO A;  2KK4 A;  2LP5 A;  3X20 B;  2RNA A;  3VS4 A;  1W2B S;  1RAG B;  2JT4 A;  4XTY A;  4OB1 B;  2L89 A;  2ZCF B;  1FMW A;  1EIF A;  3JCM Q;  3QYH B;  4PK4 A;  2A37 A;  3O5Z A;  4KRT A;  2CSI A;  4M75 F;  1M3B A;  1VQL T;  2WAC A;  3RIR A;  4HCC A;  4KGX B;  2MPX C;  2EGE A;  3LH0 A;  1O9S A;  2CSQ A;  3QKJ A;  4JZ4 A;  2M0Y A;  3NHN A;  1NYF A;  1IB8 A;  1BI0 A;  4M75 A;  2HQE A;  2OTL A;  5KYY A;  3L1A A;  3OYK A;  2K7A A;  3S3M A;  1AT1 B;  5IXF A;  3JCM h;  2EFI A;  1YJW Q;  2MMP A;  2RK1 A;  1S1N A;  4ZTF A;  4M75 B;  1EFN A;  5J26 A;  2CP6 A;  1VQK Q;  2E41 A;  1NEB A;  4F7U G;  1D0Y A;  2MI6 A;  3CC2 Q;  2QEX Q;  2KXD A;  5HCK A;  3G71 T;  1VQ5 A;  2HZY A;  4LN2 A;  4C92 D;  4AT1 B;  1YHQ Q;  2LTO A;  2P4T A;  1OX8 A;  4WCI A;  1LCK A;  3DLL A;  1JJ2 P;  2DTO A;  3P8B B;  1XQH A;  4NL3 A;  2QA4 Q;  2AIR B;  1Y96 A;  3DKM A;  2CP0 A;  1G2B A;  4J8O A;  3D7S B;  2ECZ A;  1PG5 B;  4E7I A;  4EMG A;  1IGU A;  1GCQ A;  2CUB A;  4LXC A;  1G3S A;  1QVG P;  2GF7 A;  3SWN A;  3EFS A;  1J3T A;  1U8R A;  4DBR A;  3I55 T;  1M30 A;  2P84 A;  5D6X A;  5A0G A;  1BK2 A;  4AFQ C;  5I2S A;  1VUB A;  3MPU B;  3SWN B;  2JOY A;  3X25 B;  5GMK e;  1TU0 B;  1Y71 A;  1VYU A;  2YLB A;  5IAY A;  3HFO A;  4VUB A;  4PJN A;  3CXC A;  4J9B A;  1PKT A;  3Q1J A;  3RUX A;  1Q7Y C;  3BDU A;  3SB2 A;  5KE2 A;  2M16 A;  2DEU A;  5KCH A;  2VGM A;  2LC4 A;  3M5A A;  3OYH A;  2JS0 A;  2RQV A;  1IHV A;  2AZV A;  1WHG A;  1OX9 A;  5A0D A;  2VB6 A;  3CCE T;  2W10 A;  4PNO A;  2CZ0 B;  4M78 G;  4M75 D;  2RHZ A;  3CCJ A;  3MEW A;  1I81 A;  4ANJ A;  1IGQ A;  2OX7 A;  5GAM j;  1U3O A;  2EYY A;  1QW1 A;  1NLO C;  1VQP T;  4XTX A;  4XU3 A;  1XNI A;  2KAF A;  3THK A;  3MEA A;  3CCU Q;  1Q81 U;  4EMH A;  1B34 B;  1OZ3 A;  2E4H A;  1YJ9 Q;  1P92 A;  2DPP B;  2DXU A;  3OS5 A;  3OA6 A;  2PQW A;  2XMF A;  3HP9 A;  1M27 C;  3BW1 A;  1TWB A;  2AT1 B;  1X01 A;  2CT4 A;  2LJ3 A;  3QWX X;  1BI2 A;  3GNF B;  1KC8 C;  3NGP A;  1VQ4 A;  2J6F A;  4J9F A;  1SRM A;  2H8H A;  3RDV A;  2CP5 A;  3TSZ A;  4J9C A;  2KR3 A;  1WQ7 A;  4ESR A;  4RCC A;  1ZA2 B;  2DXT A;  1YCY A;  1VA7 A;  2RI5 A;  1G5V A;  3OYI A;  1V76 A;  2EYX A;  3H8Z A;  1NJI R;  1JRI A;  2V26 A;  3KUF A;  2DL4 A;  4OB3 B;  3OYN A;  3CCL Q;  2YWW A;  3EGX A;  3VKI A;  2DTH A;  5CCA A;  4PJO C;  2F2W A;  3CCM T;  4M77 G;  4PFP A;  4F7U A;  1OUL A;  1JXM A;  2LT1 A;  3NTK A;  3EGX B;  1WXU A;  1N8R C;  1WI7 A;  3CD6 T;  4IUQ A;  2L2P A;  1QCF A;  3QZ9 B;  2EJ9 A;  1ZSZ C;  4IUU A;  3M0T A;  4OF1 A;  2RJC A;  1OV3 A;  2ZPG B;  3M59 A;  2DFU A;  4AFU C;  2VGN A;  4AG1 C;  4ELY C;  2BIV A;  5GAM d;  3MP8 A;  1C0M A;  2CRE A;  3LGF A;  3MKD A;  5IH2 A;  3NPF A;  3EHQ A;  3VS0 A;  3QUI A;  2JTF A;  2L0A A;  3OMC A;  2COW A;  3CC7 T;  1I0C A;  2HKN A;  2CS7 A;  4C5G A;  4IIO A;  3VU3 C;  2DBM A;  4ZTJ A;  4OGC A;  4JRK A;  2IPO B;  1N9R A;  1EZZ B;  3FB9 A;  1UDL A;  1PRM C;  2ED1 A;  2YLC A;  2RHI A;  2OAW A;  1YIT Q;  3A98 A;  1VOM A;  4A63 B;  2HEQ A;  1KG1 A;  1VQ7 A;  1N6A A;  2QI2 A;  1VQN Q;  1A0N B;  3QBY A;  1BI3 A;  3M9Q A;  2J6O A;  2AK5 A;  4PJO B;  3JB9 I;  4C0Z A;  2MWP A;  2BZY A;  3L2R A;  3UAT A;  2DXC A;  3HL8 A;  3N5B B;  1E6G A;  1ZSG A;  2ZZD A;  1W2B P;  4Y92 A;  2EWN A;  4F04 B;  4M78 A;  3OS1 A;  2MCN A;  2LQN A;  1JO8 A;  1QKX A;  3LH5 A;  2RN8 A;  5GAM g;  2LVM A;  5AT1 B;  2YDL A;  3T9N A;  1WJQ A;  3SEM A;  4OMO A;  2HKQ B;  3VYG A;  5IHK A;  1Y57 A;  5IXB A;  1VQM Q;  3I35 A;  3JCM X;  2YUN A;  4JRI A;  3QO3 A;  4KH0 B;  5GAN 7;  4BAC A;  5IT9 E;  2EKH A;  1LNX A;  4QKU A;  1PC0 A;  1SF9 A;  1RI0 A;  2E6N A;  1AOJ A;  1SHG A;  2HMA A;  3ZL7 C;  4KGZ B;  2OTL T;  1JQQ A;  1YJN Q;  1ACM B;  1ZQ1 A;  2VV5 A;  4A4K A;  4B9W A;  1X2Q A;  1JU5 C;  1NBE B;  3EH1 A;  2GTO A;  2DRM A;  2DF6 A;  2VKN A;  4ZN3 A;  1UGV A;  1G83 A;  4BY6 B;  1FX7 A;  3CCR A;  3H0F A;  2DRK A;  3G7Z A;  2O01 E;  3PVL A;  4M7D C;  4XU1 A;  4LNP A;  4M77 A;  3GPL A;  3CMA Q;  2COY A;  2GFU A;  2RQW A;  4M77 E;  1W70 A;  1VQ9 Q;  5HY6 A;  1NLP C;  3JCM b;  3CCQ A;  1MMD A;  1HXD A;  3DB4 A;  2OTJ A;  4JDS A;  2YUP A;  3GIB A;  2DEQ A;  2PVG B;  3GNG A;  2A0F B;  1NE8 A;  5KYU A;  4N0A C;  1YNZ A;  2W0Z A;  1OI1 A;  1Y07 A;  1AWW A;  1K73 C;  2RHX A;  4KUL A;  3AT1 B;  3P8D A;  3OSV A;  1MGQ A;  2PVO B;  3FC3 A;  3VS2 A;  4PJM A;  2HSP A;  5CKE A;  1FMV A;  3S6W A;  3VV0 A;  4M78 D;  3QXE B;  2LNH B;  5GAN d;  5FWB A;  5FU7 C;  5GJW B;  4WTO B;  4M7D F;  4EMK A;  3MEU A;  4FL6 A;  4OGE A;  2DER A;  3NMZ C;  4ZGE B;  3CXC S;  2DYB A;  2K3Y A;  5J3B A;  4J9G A;  1C6V X;  1Q95 G;  2QQB A;  3TVT A;  1VQO Q;  1WQW A;  2P0P A;  2FZK B;  2XG8 D;  1MNE A;  2A08 A;  1YJW A;  3FRN A;  4FW1 A;  3JAM E;  1VQ8 T;  1SPK A;  2DK3 A;  1YP5 A;  5GAM e;  3EGD B;  2EYW A;  3M56 A;  1VQK A;  4IUV A;  5L8R E;  1Q86 R;  4CC4 B;  4M7D B;  1AZG B;  2CKK A;  3G4S Q;  4FSX A;  4OB2 B;  3CC2 A;  4M7A F;  2QEX A;  2JW4 A;  4HVV A;  1UB4 A;  3UWN A;  1GFC A;  1VQ6 T;  1ZUY A;  1YHQ A;  1G3T A;  4E7J A;  4DBQ A;  3HTR A;  2QA4 A;  2V8J A;  4E6R A;  8ATC B;  5KCO A;  1RLQ C;  2EQI A;  2DVJ A;  4OMF B;  3M0Q A;  4CC3 A;  3CPW A;  4A4F A;  5M9O A;  3G71 Q;  2YT6 A;  2FEI A;  4FSS A;  4RTV A;  4RTT A;  3RES A;  4JJC A;  2VVK A;  4DEX A;  4N4G A;  2QXF A;  4M7A B;  5GAN g;  1M1K C;  1UJ0 A;  1UEB A;  3JB9 G;  2H3J A;  2RJF A;  4AFZ C;  4C8Q C;  2BUD A;  2EJG A;  2K5I A;  2DD4 A;  3EFO A;  1YI2 T;  2Y4X A;  1PSE A;  1QVF A;  2F69 A;  4E7H A;  2VUB A;  4LDY A;  1BIB A;  3M57 A;  5LJ5 j;  2LQK A;  5HKC A;  2ABL A;  2O2O A;  1M1G A;  4GLK A;  3G1J A;  4C92 E;  2B8A A;  4JS4 A;  1OU9 A;  1KD1 U;  3X28 B;  5KYX A;  2L3Q A;  1SG5 A;  3I55 Q;  1SSH A;  4IUT A;  2K9G A;  2KMT A;  3L42 A;  1AD5 A;  3MP1 A;  2DET A;  2IG0 A;  2JTM A;  1K1Z A;  5EC7 A;  2HBW A;  3ULR B;  5KYX B;  1YBY A;  1K9M C;  3M58 A;  1IXD A;  1AEY A;  3CBO A;  2XU8 A;  3GOX A;  4E7K A;  1UFF A;  3HHT B;  1PM3 A;  1MMG A;  2GBQ A;  1KHI A;  1Q82 C;  3CCU A;  1S72 Q;  1YJ9 A;  1U1S A;  7AT1 B;  2EPD A;  3UA6 A;  3REB B;  4FW2 A;  3RKX A;  1NG2 A;  1PKS A;  4D6W A;  2EYZ A;  3HSB A;  4MMK A;  4KH1 B;  1VQP Q;  1MV0 B;  2B86 A;  3C12 A;  2CUD A;  3M0U A;  1VYV A;  1QCO A;  5FW9 A;  2H3E B;  2V1R A;  4B6M A;  1EX4 A;  1Q81 C;  3QJ6 A;  3M0P A;  1JEG A;  3H41 A;  4J6Y A;  4X1V A;  4M75 E;  2WSE E;  3PMI A;  2K79 A;  1D1B A;  3OYM A;  4OMM A;  2CYZ B;  3CCL A;  2KRN A;  5HK3 A;  1M90 C;  3A5Z B;  4DBH A;  3OB9 A;  1WPY A;  1W6X A;  2L8D A;  1GCQ C;  1NZ9 A;  3H0I A;  3OYB A;  1WLP B;  5GAN e;  2QDY B;  4JLI A;  4DQ2 A;  1UE9 A;  1RLP C;  3VUZ A;  2R58 A;  3EG2 A;  2L3S A;  2RJD A;  1Z9Z A;  5GAM f;  4PKC C;  1B3Q A;  2NUZ A;  5KH6 A;  1ZHI A;  2AKK A;  3JB9 F;  4OB0 B;  2RQU A;  1G8X A;  3CD6 Q;  2O31 A;  1QWE A;  5CQY A;  2KRS A;  2LCL A;  5LJ3 h;  1HK9 A;  2X3W D;  2DL3 A;  5KYN A;  2D0N A;  5LJ3 j;  3FLG A;  2QQS A;  5CAI A;  1K8A U;  3OYF A;  1E6H A;  1H8K A;  1KHC A;  3TEE A;  1UGP B;  4JRP A;  5AYF A;  3CME T;  1ZX6 A;  4PJO G;  2FRY A;  4DBF A;  2MK5 A;  4HVU A;  4ME7 A;  1BKB A;  2DYI A;  1M2V B;  1Q86 U;  3CC7 Q;  4Z88 A;  5LJ5 g;  1YIT A;  3CBM A;  3I5R A;  2QDL A;  3SFM A;  2DO3 A;  1VQN A;  3ER0 A;  2RPN A;  3CCR T;  5GAO n;  2EQU A;  3CQT A;  2LNV A;  4QVC A;  5J39 A;  1UHF A;  1XTD A;  3JCM c;  3C95 A;  4BI4 A;  1BCM A;  1M8M A;  2CP2 A;  2LZ6 B;  1B34 A;  1MMN A;  2AZS A;  2OTJ T;  3L2Z A;  3BDL A;  1OEB A;  1AHJ B;  3RKW A;  3M55 A;  1TTH B;  2KE9 A;  1GFD A;  5EG2 A;  1JBM A;  2X4X A;  1YN8 A;  2RQT A;  1UEC A;  4C5I A;  1VQM A;  2LX9 A;  3MCA B;  3CXC P;  3VRY A;  3J7A F;  3VS5 A;  3BFM A;  3FJP A;  4FT2 A;  1PWT A;  1ZUK A;  4OVA A;  4KBM B;  2E5Q A;  2VWF A;  3WVD B;  4LUD A;  3CC4 A;  3E9F A;  3GLX A;  2RMO A;  1I4K 1;  3DB3 A;  4QVD A;  3V8K A;  2FPD A;  4D8K A;  1YJN A;  4BE1 A;  1IRX A;  2XDP A;  1TUD A;  2JXB A;  4IIM A;  2FL7 A;  3WXM B;  2LJ0 A;  1UTI A;  3EGU A;  4J6X A;  2RF0 A;  2EW3 A;  5I2M A;  5IHN A;  4RTX A;  2M51 A;  3LWI A;  2HQH A;  2YHT A;  3JB9 D;  4MDX A;  2K2M A;  1MV3 A;  3CC2 T;  2RO0 A;  2QEX T;  4F7U E;  3R6N A;  4AFS C;  2ENM A;  3CMA A;  2X3X D;  2IVW A;  3M54 A;  1U06 A;  4Y91 A;  5ECA A;  1VQ9 A;  3CPW S;  4J9D A;  4QW2 A;  2KQW A;  2D8H A;  1V29 B;  5GAO r;  4RCB A;  4UC4 A;  2I2L A;  5CQX A;  4RTW A;  3EG3 A;  5GAN f;  4PFZ A;  2MYS A;  4OML A;  3OYC A;  1YIJ T;  3OQ5 A;  2QTX A;  5LJ5 e;  4R0K A;  3PIO A;  3VS6 A;  4XTW A;  4C0D C;  1QVF S;  1WZO A;  4OMP A;  2CZ7 B;  1KIK A;  4PJO F;  2RB6 A;  4M78 C;  2JS2 A;  3QYG B;  3EAE A;  3OMG A;  4NL2 A;  3H0H A;  1QKW A;  4LE9 A;  3A1P A;  2YXY A;  4PJO A;  3BE3 A;  2EQK A;  4M7D G;  1VIF A;  1VQO A;  1Q7Y U;  5GAN 6;  2CH4 A;  1LVK A;  2FPF A;  4ATO A;  3G6E Q;  4ZN1 A;  1OYX A;  2JTE A;  1NJI C;  1LOJ A;  1X69 A;  1GXI E;  1KD1 R;  4RTY A;  1ZSZ A;  3G4S A;  3O8V A;  3CCV T;  1IRE B;  3JCM W;  4PL6 A;  1PHT A;  2QYZ A;  1VQ8 Q;  2DIL A;  2SRC A;  3QG1 A;  2XID A;  2YUQ A;  4M78 E;  1ZSZ B;  2V1Q A;  4M7A G;  1ZUU A;  1UGR B;  1M9S A;  3M0S A;  3VS3 A;  2R57 A;  3I56 Q;  3CCU T;  1VYT A;  2K5L A;  4HCB A;  1HD3 A;  1YJ9 T;  3OY9 A;  2D1X A;  3G71 A;  1BCO A;  3JCM J;  1GBR A;  1VQ6 Q;  5GAN 2;  4LDX A;  3TCJ A;  4M77 C;  1OOT A;  2KXC A;  2Y90 A;  1D1A A;  3UF4 A;  1N27 A;  2NUP B;  1D0X A;  2DKG A;  2KYM A;  2X4Y A;  2JVV A;  3LYI A;  2IIM A;  2EIF A;  1UG1 A;  2AHJ B;  2KRO A;  3QSU A;  5DM7 R;  3CCS Q;  2DAQ A;  2ZPH B;  5D6W A;  1R0B G;  4XTZ A;  4YTL A;  2K5F A;  3JSC A;  4XK8 E;  2DXB A;  2NUT A;  4QQ6 A;  1YI2 Q;  1QVP A;  3I55 A;  1AVZ C;  1VIE A;  5FU6 C;  5FRO A;  3JV3 A;  1N8R U;  1KFZ A;  2P0K A;  1RAA B;  1KQS A;  2NUT B;  2FPE A;  4EMK C;  2LCC A;  1VQ5 T;  2C0T A;  2KBT A;  3FJ5 A;  4PJO D;  2JUF A;  4X9D A;  2DZC A;  3CPF A;  5GMK h;  2LQW A;  2RI3 A;  1TOV A;  1G3W A;  3MEV A;  4RTU A;  5GMK j;  1ABO A;  1OQK A;  5CVI A;  1S72 A;  4JZ3 A;  2E65 A;  3HRS A;  1X43 A;  1NYG A;  1TXQ A;  4II1 A;  1YWP A;  1RL2 A;  2KSS A;  2RQR A;  1FXX A;  3QPH A;  3L2Q A;  4KT0 E;  2RD1 A;  4Z89 A;  1VQP A;  2KT8 A;  3X26 B;  1SSF A;  1FMK A;  3LGL A;  5GAO m;  1WYX A;  2DE0 X;  1WXB A;  3OYY A;  2KVQ G;  2GFA A;  3FIF A;  3EGD A;  2D8J A;  1ABQ A;  5LJ5 f;  1K8A R;  1W4S A;  1VQL Q;  1TG0 A;  4C0F A;  4M7D A;  1NPP A;  1T0J A;  4Z02 A;  2JMA A;  3HRT A;  3RKY A;  3JRZ A;  1WHH A;  4PJJ A;  2X51 A;  2LT4 A;  2XIC A;  3MHX A;  1K76 A;  5FU6 B;  1HSQ A;  4QQD A;  3P8H A;  3OBW A;  4HXJ A;  1OPK A;  2O4X A;  3JCM P;  3UT1 A;  1PNJ A;  4BB7 A;  3CCJ T;  2F2X A;  4C92 C;  1R0C B;  1RAB B;  2K57 A;  5CKD A;  2O4X B;  4JJB A;  2CDT A;  2C0I A;  4M7A A;  2BZ8 A;  4DOW A;  5FWC A;  2EQM A;  4JPB W;  4KUI A;  3CD6 A;  2HBP A;  1T0H A;  1AZE A;  3A8L B;  1JXO A;  1TS9 A;  4CRI A;  2PUK B;  3E1S A;  1VQ4 T;  4Q5W A;  3CC4 T;  5FU7 B;  4XQ3 A;  4DA4 A;  1H64 1;  5I22 A;  2JMC A;  2RI2 A;  4E7L A;  4FT4 A;  2LQ8 A;  4OMN A;  1OZ2 A;  1T3L A;  4RG8 A;  2LJ1 A;  4E7Z A;  2XI9 A;  3OW2 A;  3CC7 A;  4OMQ A;  4EIK A;  4FYX B;  4LD9 K;  3JCM f;  1WHK A;  1M1F A;  1B07 A;  4BDY A;  1BB9 A;  3CPW P;  3CME Q;  2DNU A;  8AT1 B;  2JN0 A;  2J6K A;  2AKL A;  1X2K A;  2CP3 A;  3V7C A;  2FG0 A;  2LCS A;  3HFN A;  2GQI A;  4HT8 A;  1PSF A;  3KFV A;  2QK0 A;  2BE9 B;  2J05 A;  2XKO C;  4IUP A;  2FZG B;  4M75 C;  2X4J A;  1PD0 A;  4C92 B;  4C8Q F;  1VQ9 T;  1Q86 C;  2E6Z A;  3A8G B;  1BIA A;  3ME9 A;  1LJO A;  2LDM A;  4M7D D;  1AWO A;  1QVF P;  3SHW A;  3CBP A;  2HAX A;  4RUG A;  1K73 U;  2PNI A;  3CCE Q;  1QWF A;  2ESW A;  3R6O A;  4QQG A;  4LDV A;  3OSS C;  4K11 A;  4O6J A;  1I1J A;  4A54 A;  1BI1 A;  3JB9 J;  2XHC A;  2JNG A;  2QQ9 A;  2GTJ A;  1W1F A;  4C8Q B;  1XJW B;  2PU9 B;  2CZ1 B;  3QWY A;  2BKD N;  1KK7 A;  4EPC A;  1JB0 E;  5C6S A;  3PE0 A;  2FO0 A;  3VJP A;  4M7A D;  1I5L A;  1M8V A;  4LDW A;  1VQO T;  5GAN 8;  5FLX E;  1VQ7 T;  2HSE B;  1JJ2 A;  5GMK m;  1CKA A;  1N5Z A;  1X6G A;  2YRC A;  1GCP A;  5LJ5 d;  1Q7Y R;  1IO6 A;  2PUO B;  2DM1 A;  3ZBD A;  3L2V A;  4JJN K;  3SWN C;  3G4S T;  1E7O A;  3L2W A;  2R5A A;  2OI3 A;  1WNL A;  3CEY A;  1O75 A;  1WIE A;  5GAO p;  2YRV A;  5KYY B;  3ZEH A;  1PD1 A;  1QVG A;  1QP2 A;  3NTH A;  3CCM Q;  4A4G A;  4RMO A;  4J5Y A;  3SDZ A;  4X9C A;  3VRZ A;  3PVQ A;  1MUZ A;  4J6W A;  1M1K U;  1RAI B;  5A2Q E;  4JLG A;  5CKH A;  1PRL C;  2CGH A;  2DL5 A;  2ZPF B;  2L3R A;  1AWJ A;  1M3C A;  4OP0 A;  4A4H A;  3A8H B;  5CR2 A;  1NEG A;  2HCK A;  3IQL A;  2EKO A;  3QDF A;  2FB7 A;  2KDS A;  1CKB A;  2M02 A;  3V8J A;  3FEO A;  1KC8 R;  1M2V A;  2BTT A;  3M0R A;  1U1T A;  3QZ5 B;  4O5V A;  2F1L A;  4HT9 A;  3V7R A;  1YIJ Q;  2FHD A;  2DX1 A;  2F2V A;  3OYG A;  1Y96 B;  2MAM A;  1M5Q 1;  3EH2 A;  4JS5 A;  2K2V A;  4C8Q D;  4N4H A;  4FU6 A;  2XK0 A;  3OS2 A;  1RI9 A;  2A7Y A;  3WVE B;  3G6E A;  4X34 A;  1KQS S;  1WGS A;  3M4G A;  4MZP A;  3RBB B;  2ROT A;  3C4S A;  2CP7 A;  2A28 A;  3EFR A;  1K9M U;  1KSW A;  2OJ2 A;  2F5K A;  3JCM d;  2FYK A;  1WJR A;  3VS1 A;  4KUD K;  2Y4Y A;  1N8R R;  3L2U A;  3CCQ T;  1VQ8 A;  2ZPE B;  3VUB A;  3M53 A;  4ZGJ B;  4FYW B;  1Q82 U;  2A36 A;  1M4Z A;  1X6B A;  2DTI A;  3H9N A;  2L3P A;  3I56 A;  2XD0 A;  4RTZ A;  3CCV Q;  1S72 T;  4RKU E;  4L5G A;  1X27 A;  2VAS A;  5GAM h;  3TRE A;  5DY9 A;  2KGT A;  2CH4 W;  3NFC A;  1VQ6 A;  4IKF A;  2E10 A;  1MND A;  4CI0 C;  1OU8 A;  3RMQ A;  1UGQ B; 
#chains in the Genus database with same CATH homology
 2EGE A;  1SPK A;  1YP5 A;  2CSQ A;  2V1Q A;  2EYW A;  4JZ4 A;  1ZUU A;  2ED0 A;  2M0Y A;  3NHN A;  1NYF A;  3M0S A;  4CC4 B;  3VS3 A;  1VYT A;  1AZG B;  1HD3 A;  1WFW A;  2D1X A;  2K7A A;  2JW4 A;  4HVV A;  1GBR A;  1UHC A;  5IXF A;  1WDX A;  1GFC A;  1S1N A;  1ZUY A;  1OOT A;  2KXC A;  1EFN A;  3UF4 A;  2EGA A;  4LUE A;  2KYM A;  5L23 A;  3REA B;  4F17 A;  1NEB A;  4E6R A;  1RLQ C;  2IIM A;  5IHI A;  2EQI A;  2DVJ A;  1UG1 A;  3M0Q A;  4CC3 A;  2YT6 A;  2FEI A;  2KRO A;  4FSS A;  4RTV A;  2KXD A;  4JJC A;  4RTT A;  2VVK A;  5HCK A;  4DEX A;  2MIO A;  2C0O A;  1UJY A;  4LN2 A;  2DBK A;  1BU1 A;  1UJ0 A;  1SHF A;  2JM8 A;  4WCI A;  1LCK A;  4GLM A;  4AFZ C;  2EBP A;  2K3B A;  1AVZ C;  2ROL A;  3JV3 A;  1KFZ A;  1G2B A;  2MOX A;  2DMO A;  2ECZ A;  1SEM A;  2FPE A;  2ABL A;  2O2O A;  2DLP A;  2C0T A;  2KBT A;  3FJ5 A;  1GCQ A;  2CUB A;  1K4U S;  4F16 A;  2L3Q A;  1SSH A;  1CSK A;  1J3T A;  2K9G A;  1WXT A;  1AD5 A;  1M30 A;  2LQW A;  3RNJ A;  2J06 A;  1BK2 A;  1K1Z A;  5EC7 A;  4AFQ C;  2HBW A;  4RTU A;  1ABO A;  2YUO A;  3ULR B;  4JZ3 A;  4F14 A;  1X43 A;  1NYG A;  1VYU A;  1YWP A;  1AEY A;  2RQR A;  1ZBJ A;  4J9B A;  1PKT A;  4Z89 A;  1UFF A;  1ZLM A;  2KT8 A;  1Z9Q A;  1GRI A;  4JJD A;  2GBQ A;  1FMK A;  2JS0 A;  2RQV A;  4J9I A;  2AZV A;  1WYX A;  1WX6 A;  2DE0 X;  1WXB A;  4QT7 A;  1OPL A;  4D8D A;  2W10 A;  4CC2 A;  3VS7 A;  2D8J A;  1ABQ A;  2EPD A;  3UA6 A;  1QLY A;  3REB B;  4AG2 C;  4M4Z A;  4GBQ A;  1NG2 A;  1PKS A;  1TG0 A;  2EYZ A;  3EG1 A;  1T0J A;  1U3O A;  2JMA A;  4DEY A;  1MV0 B;  2EYY A;  2B86 A;  1NLO C;  2CUD A;  3M0U A;  1VYV A;  3THK A;  2DL7 A;  1K76 A;  5FW9 A;  2PTK A;  2V1R A;  1HSQ A;  3M0P A;  1JEG A;  4HXJ A;  1OPK A;  3H41 A;  4X1V A;  2XMF A;  1M27 C;  1PNJ A;  2CT4 A;  2K79 A;  2LJ3 A;  2J7I A;  3QWX X;  2F2X A;  4ZNX A;  3NGP A;  4OMM A;  2J6F A;  2KRN A;  4J9F A;  1SRM A;  2H8H A;  3TSZ A;  4J9C A;  2KR3 A;  4JJB A;  4ESR A;  2CDT A;  2KEA A;  2C0I A;  1M3A A;  1W6X A;  1GCQ C;  2BZ8 A;  1VA7 A;  3H0I A;  1HJD A;  5FWC A;  2EYX A;  1WLP B;  4JPB W;  2I0N A;  2DL4 A;  1UE9 A;  1T0H A;  1AZE A;  1RLP C;  2JM9 A;  3EG2 A;  1JXO A;  2L3S A;  2SEM A;  1WA7 A;  1Z9Z A;  5GJV B;  1B3Q A;  2O9V A;  2F2W A;  4HVW A;  3EHR A;  5I22 A;  2NUZ A;  2JMC A;  1JXM A;  2AKK A;  4OMN A;  2RQU A;  2O88 A;  1WXU A;  1T3L A;  2O31 A;  1QWE A;  1WI7 A;  2KRS A;  2X3W D;  2LJ1 A;  2DL3 A;  2L2P A;  1QCF A;  4CC7 A;  2D0N A;  4OMQ A;  1GBQ A;  4EIK A;  1RUW A;  3M0T A;  2KRM A;  1K0S A;  1YCS B;  2E5K A;  1OV3 A;  1B07 A;  1E6H A;  1H8K A;  1BB9 A;  2DNU A;  4AFU C;  3C0C A;  4AG1 C;  2J6K A;  2AKL A;  1X2K A;  1ZX6 A;  5I11 A;  2FRY A;  3TSW A;  2FG0 A;  2LCS A;  2GQI A;  1TUC A;  2CRE A;  5IH2 A;  3KFV A;  3NPF A;  2K6D A;  3EHQ A;  4HVU A;  3VS0 A;  2J05 A;  4Z88 A;  3I5R A;  2L0A A;  2QDL A;  2DJQ A;  1I0C A;  2EVR A;  2RPN A;  4IIO A;  1AWO A;  2DBM A;  1AWX A;  3SHW A;  1Y0M A;  3CQT A;  4RUG A;  2PNI A;  1UHF A;  1QWF A;  1UDL A;  1PRM C;  2ED1 A;  2ESW A;  2OAW A;  4K11 A;  4J9E A;  3A98 A;  1I1J A;  1M8M A;  4A63 B;  2HEQ A;  2LZ6 B;  2AZS A;  1A0N B;  1V1C A;  4ORZ A;  1YWO A;  2GTJ A;  1W1F A;  3I9Q A;  2J6O A;  1OEB A;  2AK5 A;  2BZY A;  3QWY A;  2FRW A;  2KE9 A;  1GFD A;  3UAT A;  1NM7 A;  1E6G A;  2CT3 A;  1BBZ A;  1ZSG A;  3PE0 A;  1YN8 A;  2FO0 A;  2P4R A;  2RQT A;  4Y92 A;  1UEC A;  4J9H A;  2EGC A;  3VRY A;  3VS5 A;  1PWT A;  2LX7 A;  1ZUK A;  2PZ1 A;  2MCN A;  1U5S A;  2LQN A;  1CKA A;  1JO8 A;  4Z8A A;  1N5Z A;  2VWF A;  1X6G A;  1QKX A;  3LH5 A;  2RN8 A;  1GCP A;  4LUD A;  2RMO A;  2YDL A;  4HCK A;  1IO6 A;  2DM1 A;  3SEM A;  4OMO A;  5IHK A;  5IXB A;  1Y57 A;  3I35 A;  1E7O A;  2KNB B;  2FPD A;  1K9A A;  4D8K A;  1T3S A;  2OI3 A;  2YUN A;  2GGR A;  1ARK A;  1H3H A;  1TUD A;  2JXB A;  1WIE A;  2GNC A;  4IIM A;  2LJ0 A;  1UTI A;  3EGU A;  2RF0 A;  2EW3 A;  5IHN A;  3U23 A;  2EKH A;  4RTX A;  1KJW A;  1AOJ A;  2M51 A;  1SHG A;  3ZL7 C;  3EG0 A;  3VRZ A;  3PVQ A;  1K0X A;  1I07 A;  2K2M A;  1FYN A;  1MUZ A;  1MV3 A;  1JQQ A;  1PRL C;  2DL5 A;  3R6N A;  4AFS C;  2ENM A;  1X2Q A;  2YSQ A;  2X3X D;  1JU5 C;  1XOV A;  1AWJ A;  1M3C A;  1U06 A;  2GTO A;  5ECA A;  2DRM A;  2DF6 A;  2VKN A;  1NEG A;  1UGV A;  2HCK A;  3IQL A;  4J9D A;  1G83 A;  2D8H A;  2LMJ A;  2DL8 A;  3H0F A;  1CKB A;  2DRK A;  3PVL A;  2BTT A;  3M0R A;  1UUE A;  4LNP A;  4RTW A;  3EG3 A;  3I5S A;  2BZX A;  2DX1 A;  2F2V A;  4OML A;  3GBQ A;  2RQW A;  1W70 A;  4R0K A;  3VS6 A;  2NWM A;  1NLP C;  4OMP A;  1KIK A;  1RI9 A;  2DA9 A;  2O9S A;  2YUP A;  3UA7 A;  2JS2 A;  2G6F X;  3RBB B;  2KT1 A;  2ROT A;  1YNZ A;  2W0Z A;  3H0H A;  1AWW A;  2A28 A;  1KSW A;  1QKW A;  4LE9 A;  2OJ2 A;  1H92 A;  2HDA A;  3VS1 A;  3VS2 A;  2CH4 A;  2HSP A;  2FPF A;  2KYB A;  1SRL A;  2LNH B;  1GL5 A;  5FWB A;  2A36 A;  2JTE A;  2LP5 A;  5GJW B;  2RNA A;  3VS4 A;  1X6B A;  2JT4 A;  1X69 A;  3NMZ C;  2L3P A;  4RTZ A;  4RTY A;  2DYB A;  4J9G A;  1X27 A;  3TVT A;  2A37 A;  2KGT A;  3O5Z A;  4KRT A;  2CSI A;  1M3B A;  2CH4 W;  1PHT A;  2A08 A;  2DIL A;  2SRC A;  2YUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...