4AG2C

Human chymase - fynomer complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
VTLFVALYDYNATRWTDLSFHKGEKFQILDGDSGDWWEARSLTTGETGYIPSNYVAPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/de novo protein
molecule keywords CHYMASE
total genus 11
structure length 58
sequence length 58
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4ag2C00
3M0UA 1GBRA 3M0RA 2QDLA 3EG2A 2DA9A 1WYXA 1WX6A 4CC7A 2L0AA 3VS4A 1NM7A 2ED0A 1I07A 2KXCA 3SEMA 2LJ3A 3RNJA 5GJVB 4CC2A 1NLOC 3VS7A 3LH5A 1BBZA 3VS5A 2L3QA 3UA7A 5IHIA 1ABOA 4GBQA 4FSSA 2AZVA 3NMZC 3EG0A 2LCSA 1ZUYA 2DVJA 2DILA 4ESRA 5I22A 2F2XA 2OI3A 4AFUC 1H92A 1X27A 4M4ZA 2C0TA 2J6KA 4IIOA 1K0XA 2K6DA 1B07A 5IXBA 4DEXA 2SRCA 2GTOA 3H0HA 1VYTA 2LQWA 2DL5A 3EHRA 1LCKA 4RTTA 1S1NA 3REBB 4Y92A 2O9SA 2FPEA 2KBTA 3UATA 2D8JA 4RTXA 2JMAA 3NGPA 3GBQA 2KROA 2DLPA 1J3TA 1UJ0A 2EVRA 1WA7A 2FG0A 1E6HA 1JXOA 4A63B 2O9VA 1ZUUA 2EPDA 1WFWA 2L3PA 5GJWB 2J6FA 2KNBB 3QWXX 2OAWA 1VYVA 2H8HA 3TSWA 1PRLC 4HCKA 3C0CA 1TUDA 2CREA 3VRYA 2GQIA 2OJ2A 2EGEA 2YDLA 3IQLA 5IH2A 4ZNXA 1HSQA 2RNAA 1OPKA 2M51A 1W70A 2RQVA 4OMMA 1TUCA 1NEBA 2FO0A 2NWMA 1RUWA 1UHCA 2K7AA 1E6GA 1HJDA 1WDXA 1PHTA 4JZ3A 1JEGA 2CT4A 5ECAA 2CDTA 2DE0X 2JS2A 2PZ1A 2YUPA 1AD5A 1AWOA 2JMCA 2BZYA 2GTJA 2KR3A 2DL8A 1GBQA 3QWYA 2KYMA 2W0ZA 4D8DA 1NYGA 3I5SA 3ZL7C 4CC3A 1AZEA 1KIKA 3JV3A 2KEAA 2X3XD 2VWFA 1U3OA 1BU1A 2MIOA 2LP5A 3KFVA 4LUEA 2CT3A 2C0IA 1BB9A 1EFNA 2J06A 2DBKA 2ED1A 1HD3A 2HBWA 4AG1C 1ZLMA 2DMOA 2KT1A 1NEGA 2L3SA 2K79A 2YUQA 2E5KA 2EYWA 3EHQA 4RTVA 2JM8A 3THKA 1GL5A 1ZBJA 1YN8A 1UG1A 5I11A 1YWOA 2CUDA 4JJCA 1RLPC 1UUEA 2IIMA 1K9AA 2MCNA 2DL3A 4KRTA 2ENMA 1T0HA 1RLQC 2KT8A 2AZSA 3VRZA 1UGVA 1YCSB 4Z8AA 4JJDA 2A28A 4K11A 1WLPB 2ROTA 3EG1A 2J6OA 1QCFA 5L23A 1JXMA 2K9GA 4JZ4A 2HCKA 1X6BA 1NYFA 2KRSA 4HXJA 3I5RA 1UHFA 4Z89A 3VS2A 1U06A 1PRMC 3TVTA 1KSWA 3H0IA 4EIKA 4F16A 2KXDA 1E7OA 1MUZA 2EYYA 4HVUA 2O31A 2M0YA 3U23A 2J7IA 1H3HA 1GCQC 1WXTA 1SHFA 3RBBB 1UTIA 1GCPA 4JPBW 1G83A 2LJ0A 4OMPA 1T0JA 2EKHA 2DJQA 2PTKA 2FEIA 4J9HA 3EG3A 1W1FA 3M0TA 2A37A 2K3BA 1OEBA 1QLYA 2D1XA 1CKAA 2K2MA 2ABLA 2YSQA 1OOTA 1AWWA 1K4US 2V1RA 4ORZA 1M27C 4RTUA 3R6NA 4J9DA 1AEYA 2JXBA 1SHGA 2JT4A 1OV3A 2RQTA 1UFFA 2D0NA 2AKKA 2FPDA 2FRYA 4RTZA 3EGUA 4LNPA 2EYXA 4OMOA 4HVWA 1AVZC 2NUZA 2CH4A 5EC7A 1XOVA 1WXBA 2DF6A 2CSQA 1A0NB 1AZGB 3PVLA 1W6XA 2JW4A 4LN2A 1B3QA 1NLPC 3VS0A 4QT7A 2DM1A 3REAB 3VS1A 2YUOA 1Y57A 3PE0A 2AKLA 2DBMA 1ZX6A 2A36A 2RQUA 4E6RA 1JQQA 2KRMA 2DYBA 2KGTA 4LE9A 2XMFA 1GFCA 3UF4A 1X6GA 5FWBA 4CC4B 3ULRB 2FRWA 2RN8A 1M3AA 1VA7A 3I9QA 2G6FX 3H0FA 1SPKA 2DL7A 3M0PA 2RQRA 1G2BA 1X43A 4DEYA 1TG0A 3M0SA 2V1QA 1V1CA 4J9CA 2JTEA 2ESWA 2X3WD 3O5ZA 1KFZA 2A08A 4RTYA 4F17A 1T3SA 4R0KA 1GRIA 1SSHA 3SHWA 2B86A 1ARKA 1Y0MA 2W10A 4J9FA 1PNJA 4AG2C 1K76A 2DRKA 2J05A 2KYBA 2BTTA 2EYZA 4OMNA 4D8KA 2I0NA 2P4RA 5IHNA 1FYNA 1JO8A 2EQIA 2CH4W 4WCIA 1VYUA 4AFZC 2LZ6B 1KJWA 4GLMA 1M3BA 2LMJA 1K0SA 1M8MA 1SRMA 2L2PA 4IIMA 4F14A 1YP5A 1MV3A 1QWFA 2VVKA 2ROLA 2CSIA 1Z9QA 2LX7A 2PNIA 4JJBA 1SRLA 4RUGA 1PKSA 2D8HA 1WIEA 1AWJA 3CQTA 5IHKA 2F2VA 2LJ1A 1ZSGA 2CUBA 3FJ5A 3UA6A 1QKXA 2LNHB 2GBQA 3H41A 2HEQA 3TSZA 2O88A 1CSKA 4OMQA 2FPFA 5HCKA 2ECZA 2DX1A 2HSPA 4AFSC 1SEMA 1ABQA 1U5SA 3VS6A 1BK2A 4OMLA 2C0OA 3PVQA 2YT6A 2AK5A 3A98A 1UJYA 1UDLA 1OPLA 1Z9ZA 2YUNA 5IXFA 2EGAA 1I0CA 4RTWA 1ZUKA 1PWTA 1IO6A 2LQNA 1MV0B 2RF0A 1WI7A 2GGRA 1T3LA 2RMOA 1UECA 2BZXA 3I35A 5FWCA 4Z88A 4J9EA 2EW3A 2RQWA 4J9BA 1N5ZA 1I1JA 2GNCA 1RI9A 1X2KA 1AWXA 4AFQC 1FMKA 1CKBA 2DL4A 1GFDA 1X69A 4J9GA 1JU5C 2DRMA 1WXUA 2VKNA 4X1VA 2KRNA 4LUDA 3NHNA 1M3CA 2EGCA 1UE9A 1H8KA 1PKTA 2JS0A 1GCQA 2HDAA 1X2QA 2MOXA 4J9IA 5FW9A 2DNUA 1NG2A 4HVVA 1QWEA 2F2WA 2O2OA 2JM9A 2RPNA 3VS3A 1QKWA 2KE9A 2SEMA 1YWPA 1K1ZA 3NPFA 1AOJA 3M0QA 2EBPA 1M30A 2BZ8A 1YNZA
chains in the Genus database with same CATH superfamily
3M0RA 4EMGA 3EG2A 1WYXA 3VS4A 5IN1A 3HSBA 1NM7A 1RADB 2KXCA 4NS5A 3S3NA 1BI3A 4CC2A 4LDYA 2OTLQ 1NLOC 1UEBA 3CD6Q 1V76A 1X75C 3UA7A 2IVWA 3G6ET 4GBQA 3CC2A 4A53A 4X34A 4N4HA 3META 4ESRA 4BI4A 4C8QA 5I22A 4ZTJA 4MDXA 2OI3A 5C6SA 1SKUB 1X27A 4MMKA 4F7UF 1JJ2A 2J6KA 1K0XA 3TCJA 4C5HA 3MJXA 4R56A 5I2MA 5J39A 2F5KA 1VYTA 3TEEA 4PFOA 1LCKA 1I5OB 4RTTA 1S1NA 4XK8E 2FPEA 4EMKC 2D8JA 3CPFA 4RTXA 3BFMA 3GBQA 4IUTA 2VB6A 3S6WA 1S72Q 1Y07A 2QEXQ 1E6HA 4A63B 1WFWA 2QTVA 2J6FA 3QWXX 2KY9A 1VYVA 3PIOA 2P84A 1RABB 2HMAA 4HT9A 2V8IA 2CREA 5KE3A 2EGEA 4OGEA 4A4EA 2MMPA 3CC4T 1OPKA 2RNAA 1B34B 2RQVA 3X26B 4KGVB 1K8AC 1K9MU 1NEBA 2FO0A 2NWMA 1WGSA 1Q81C 3CEYA 1FXXA 2RA2A 2V26A 4DBFA 3QKJA 1HJDA 1K73R 3AT1B 1WDXA 2HKQB 4JZ3A 3VYGA 2EIFA 1JEGA 5ECAA 1G3TA 1YJNA 2JS2A 5GMKl 3FLGA 2YUPA 1AD5A 3CCUA 4YTLA 2GTJA 3LGLA 3CCRQ 1C0MA 2DL8A 2KYMA 4ANJA 2MAMA 4QQGA 3E9GA 3ZL7C 1VQ7T 1JJ2P 1KG1A 3OQ5A 4EPCA 2KEAA 3HFNA 3G4SQ 2X3XD 1VQ5T 3HL8A 4M78D 2HL3A 4O5VA 4TVRA 4LUEA 2C06A 3EFSA 1WHKA 5LJ5d 1HD3A 3VYHB 3I56Q 4II1A 2HBWA 4J7IA 4AG1C 4RCCA 4EDUA 2AHJB 2XIDA 4PJOA 2DMOA 2KT1A 4M7DB 1NEGA 1Q81R 1JB0E 2LNVA 1XTDA 1K8AR 1BCMA 1O75A 3CCJA 3EHQA 3THKA 1D09B 2VGNA 4XTVA 3CC7T 3PMIA 2OTJQ 4A4FA 1QVGA 3CXCS 2K4YA 4C8QB 1K9AA 2H3JA 5GAN8 5D6YA 1NPRA 1M1KU 4BI8B 2RI5A 2AZSA 1UGVA 4M78C 1ACMB 4FM4B 2LX9A 4FYYB 2A28A 3GNFB 4K11A 1WLPB 3EG1A 1Q86U 1XNIA 1VQNT 1X6BA 2A0FB 3CCEA 2A3LA 3FRNA 2BE9B 1UHFA 1U06A 1PRMC 4C92E 3H0IA 4EIKA 1E7OA 4HVUA 2BUDA 2R5AA 5CIUA 1G8XA 1RAGB 2O31A 1QMCA 2J7IA 5CKDA 2DXUA 3S3MA 1Q95G 2NUTB 4XTUA 3PMTA 4JPBW 3CXCA 2K3XA 3GP8A 1WHGA 1WJSA 1N8RU 5CR2A 4J9HA 3RKXA 5GAN3 3EG3A 4MMLA 4JLIA 1MMNA 4M7AC 4M7AF 3M53A 1OEBA 2D1XA 2LCLA 3SB2A 4M77F 3CMET 5KYNA 2YSQA 3EGDA 2V1RA 4N0AC 4RTUA 4J9DA 2JT4A 1D3BB 3PIPA 2RQTA 1UFFA 4M7DF 2D0NA 2AKKA 2FPDA 2FRYA 2JUFA 4RTZA 3EGUA 4M75B 2EYXA 3QO3A 3OBYA 5GAOl 5D7UA 4C8QG 4RG8A 1WXBA 4EMKA 1K9MC 3DB3A 4XAXB 3D7SB 4XU2A 3I56A 1Q7YC 2DKGA 1PD0A 4QT7A 2EJ9A 1MMGA 3CCQA 1KHCA 2CP0A 5KYUB 2MF2A 4E7KA 1G3WA 5LJ3f 5KYYA 2DXCA 3URGA 3RUXA 4J7FA 5KYWA 2XMFA 3JCMV 1MMDA 1TTHB 3G1JA 1QP3A 4QW2A 4Q5WA 1YI2Q 1YJ9T 1SPKA 2B8AA 1KHIA 3M0PA 2RQRA 1X43A 4L6V5 4C8QE 5GAN5 1C1AA 3M4GA 1IGUA 1YIJQ 4J9CA 5C0MA 2JTEA 2JJ9A 3J7AF 3JCMb 2A08A 3FC3A 3A1PA 1U1SA 3GOXA 3HFOA 4A4HA 5KYWB 2XI9A 3OMCA 4J9FA 4AG2C 2J05A 2RJEA 2BTTA 3HRTA 3CMEA 3LX7A 4WCIA 2MK5A 1Q81U 1RI0A 3CCUQ 4BE2A 1TSFA 4IIMA 1YP5A 4HCCA 2CP3A 1K73C 4E7IA 4Z02A 2ROLA 2CSIA 5GMKi 5GANe 2DXBA 2LX7A 4JJBA 1VQMA 4ZGEB 2GCXA 1WIEA 1AWJA 3INZA 1M1GA 2F2VA 3CBPA 3WVEB 4PJMA 2K3YA 3J81E 1VQPQ 5GAMh 3FJ5A 4C8QF 3UA6A 1YBYA 3H41A 1M90C 3TSZA 1CSKA 4OMQA 5HCKA 2HZYA 1U5SA 9ATCB 4E7LA 2FZGB 2DJZA 1Q7YU 1K9MR 4OMLA 3PVQA 3QIIA 3A98A 4F7UB 1UDLA 1VQNA 3L2UA 1OPLA 2X35A 4N4GA 4RTWA 1ZUKA 2RF0A 1VQKQ 2CP2A 2RMOA 2BZXA 4QQDA 4A54A 1YJ9A 2ZAEA 3WVDB 3QSUA 1N5ZA 1RI9A 2F5TX 2WACA 1YIJA 1IHVA 4C0DB 1ZA1B 4M77E 1JU5C 2DRMA 1YITT 4X1VA 4OB1B 1M1KC 4AMCA 1YHQT 1H8KA 5GANd 1PKTA 2JS0A 3QXEB 1PSEA 3G4SA 2K5IA 3CMAT 5GAOp 3JCMg 1BKBA 2E70A 2F2WA 2O2OA 2R58A 3QHSA 4RCBA 4E7ZA 3I55Q 2SEMA 3Q1JA 3NPFA 1AOJA 3M0QA 2EBPA 2YLBA 3JB9J 3G71Q 2D6FA 2DYIA 4RMOA 2ED0A 4PJOC 1JRIA 3RNJA 1VQMT 5GANf 3BW1A 1VQ8T 2K2VA 2PUOB 3L2VA 3JSCA 5M9OA 5J3BA 2DFUA 3VS7A 4NOYA 1Q82U 3LH5A 4E2FB 2DK3A 2GFAA 3V7CA 4FSSA 3MP8A 2CGHA 3EG0A 2XU8A 2O01E 4DBQA 1VQLT 1V29B 2QEXA 1H92A 5CQYA 4DQ2A 4FCYA 4IIOA 1B07A 5IXBA 4DEXA 3H0HA 5GANh 1FWZA 2DL5A 3M55A 4XTWA 3UATA 3NGPA 2XDPA 1J3TA 1NJIR 4ELYC 2FG0A 1JXOA 1TWBA 4MDWA 1HXDA 2QA4T 1RAAB 3CCET 2IG0A 3V7RA 4O6JA 5DLQE 1PRLC 4HCKA 3VRYA 2OJ2A 2YDLA 4ZNXA 2DZ9A 4F04B 2EQJA 2XDBA 4HA8A 1M90R 1YJWA 2FZCB 4PJOD 1TUCA 3TREA 2K7AA 4KGZB 2DIQA 1RAIB 2DZCA 3E1SA 3HKSA 4GLKA 1RAHB 2PZ1A 4ME7A 2QQRA 2JMCA 5D6WA 1DJ7B 1I81A 1N27A 3JCMX 1PC0A 2AT1B 1UB4A 1NJIC 3EFRA 1VQLQ 4DBHA 2OX7A 2OAUA 1AZEA 1BU1A 1FMWA 5A2QE 1BB9A 1EFNA 3EGXA 1U1TA 1TU0B 4BY6B 2LTOA 3LGFA 2ED1A 2L3RA 3HP9A 3P8HA 4M75G 1VQMQ 8AT1B 2P4TA 2NUPA 3OYEA 3MEWA 5DLOA 2L3SA 2PVDB 1B34A 2R57A 4IUPA 1YN8A 1YWOA 4JJCA 1Y7XA 1UUEA 3OW2S 1T0HA 5CK9A 4M7AG 3EGXB 3VRZA 5GANj 4FU6A 3NTKA 2QTXA 2E41A 3FJPA 4BE0A 4LDXA 2J6OA 1QCFA 2K9GA 3UT1A 2HCKA 4M78G 1NYFA 2ZPHB 3CMAA 4C5GA 4CRIA 4HXJA 1IZ6A 1HYOA 1Q82C 1KC8R 2MI6A 3M54A 2LT1A 1KSWA 2HL5C 1UGRB 4J6XA 4XTZA 3CMEQ 2XK0A 2KXDA 2EYYA 2XG8D 1N8RR 2JZ2A 2M0YA 3U23A 1VQLA 1O9SA 4N4IA 1VQKT 1KQSA 1P92A 1Q82R 1SHFA 3T9NA 2HQEA 1W4SA 2KVQG 4M78F 3FB9A 2YRVA 3NFCA 3UDCA 1NPPA 2ZPGB 1R0CB 2EFIA 1TOVA 2RHIA 2Y4XA 2DJQA 3JRZA 4X9CA 1W1FA 2A37A 2DO3A 5GAMe 2XICA 1OZ2A 1M1FA 4PFPA 2QGFB 3G71A 1WJRA 5FROA 4ZN3A 2DXTA 3QYGB 3R6NA 2RHUA 1PSFA 1BI1A 1SHGA 3OYKA 1QVGP 5GAMj 5FLXE 1OQKA 2HSEB 4HVWA 2DETA 1AVZC 1Y96B 7AT1B 1VQ9Q 4KBMB 5EC7A 2DF6A 4MZPA 2XHCA 1A0NB 3PVLA 2JW4A 4LN2A 3OYLA 1X01A 1B3QA 3C12A 3CCVA 3VS0A 4E7SA 4N0AA 5KYXA 3L2ZA 2YUOA 4HCBA 4CI0C 3RERA 2AKLA 3HRUA 2DBMA 1ZX6A 3A8LB 3DB4A 2A36A 1BIAA 2AIRB 2KRMA 1XQHA 2KGTA 1WQWA 3V7SA 5FWBA 4CC4B 4PFZA 2D9TA 1ZHIA 2X51A 2KMTA 1YI2T 3I9QA 2LVMA 1QVPA 2DL7A 3RMSA 1VQ5Q 3G4ST 5GMKm 1TG0A 4C92B 4XTYA 5CKEA 2ESWA 2X3WD 1F1BB 4PJOE 3PTAA 2DVEA 2PVOB 1T3SA 1N9RA 2FHDA 1KQSS 2W10A 1PNJA 2X4XA 3KXTA 2DRKA 3OYJA 2EYZA 3E19A 1FYNA 2EQIA 1WZOA 2OTJA 1VQ9T 4AFZC 1KJWA 2VUBA 1KC8C 4GLMA 2LMJA 3CC4Q 4LXCA 1M8MA 1QVFP 2E10A 2L2PA 4F14A 1MV3A 3QDRB 2BIVA 1D3BA 1QWFA 1N8RC 1I5LA 3GIBA 1VQ8A 1Z9QA 4NL3A 2HKNA 1SRLA 1M2OA 3BE3A 4FSXA 4C8QD 4ATOA 2A7YA 2D8HA 4LDUA 3CCEQ 4C5IA 2QA4Q 3VUZA 2LJ1A 4BDYA 1RACB 1ZSGA 3JCMe 2CUBA 3OS2A 2LNHB 1ZSZC 2G3RA 4KULA 2O88A 1LVKA 2ECZA 3M57A 4AFSC 1SEMA 1ABQA 3VS6A 2F69A 4BACA 2ZCFB 3EFOB 5LL6S 2YT6A 2AK5A 1UJYA 1WHLA 2YUNA 2EGAA 4KT0E 3ASKA 4M7AA 2GGRA 3HHTB 5FWCA 3HTRA 4BY6C 2CP6A 4FL6A 2EW3A 4PLIA 2GNCA 1X2KA 4AFQC 1CKBA 4XQ3A 1G3SA 4LUDA 3CD6T 2DD4A 4RKUE 3X20B 3JCMQ 1VQ4A 1W2BS 1VUBA 1VQNQ 1VQ8Q 3LYIA 1GCQA 2MOXA 5FW9A 4HVVA 2JM9A 2RPNA 3VS3A 2KE9A 5KH6A 3SD4A 3DLLA 1M30A 2E12A 1S72A 1W2BA 4QKUA 2OTJT 1JJ2S 5DY9A 5FRNA 3GLXA 1UGSB 3P8DA 5GAOn 1QP2A 2DA9A 2FL7A 3OSSC 1WX6A 4CC7A 5GAMd 2L0AA 3O8VA 3SEMA 3J80E 5AT1B 5GJVB 3I56T 1EIFA 1YHQQ 1D0ZA 4C92F 1BBZA 3VS5A 2XD0A 2L3QA 5IHIA 2AZVA 3NMZC 1Q86R 1YI2A 2LCSA 1ZUYA 2H3EB 4QVZA 2YRCA 2DVJA 5HKCA 4R55A 2F2XA 1M4ZA 3MCAB 2DPPB 1TUGB 4M75A 4AFUC 4Y28E 4GY5A 4M4ZA 3JB9F 4EMHA 3SFMA 8ATCB 2EQKA 2GTOA 2EWNA 2QQBA 2M1HA 2LQWA 3EHRA 2XKOC 2QAZA 4FT4A 2QDYB 2KBTA 1OI1A 4JS5A 2JMAA 5FRMA 2KROA 2DLPA 4JRPA 3CC2Q 5L8RE 1UJ0A 5KCOA 1VQPT 1WA7A 2YWWA 2COZA 2EPDA 4M7DC 4HCZA 2FB7A 2K5LA 2KNBB 2DIGA 2OAWA 2CP5A 4L59A 2H8HA 3TSWA 1OX9A 5GAN4 4M7DG 3QBYA 1ZA2B 5CO7A 2RHZA 5IH2A 1YJWQ 3OYNA 2KSSA 1HSQA 3JCMW 2QEXT 2LQKA 3VUBA 1S72T 1UHCA 2RB6A 1E6GA 2QI2A 1VQ9A 1PHTA 1BIBA 2VGMA 2CT4A 3SWNC 2CDTA 2EAYA 4A4KA 2VXEA 3M5AA 4JLGA 1AWOA 2BZYA 1D1CA 3SWNB 2KR3A 2HBPA 1QVGS 1GBQA 2RJFA 1ZSZB 2LT4A 1NYGA 2DEQA 1YIJT 2YHTA 2VYTA 4CC3A 1GXIE 1MMAA 3JV3A 4KUDK 1PM3A 3H9NA 5HK0A 2VWFA 4C92C 1Q7YR 5FU7C 4M75D 1YJ9Q 3G6EQ 2LP5A 1K8AU 2CT3A 2C0IA 4M77B 3S3OA 1ZLMA 3C94A 3L42A 5A0GA 2LQ8A 2VV5A 1U8RA 3N5BB 2E5KA 1M1KR 2JM8A 3JB9I 3G71T 4QQ6A 1EZZB 4C92A 3CCMQ 1RLPC 4C0ZA 5GAMf 2IIMA 2MCNA 2KDSA 2CZ7B 2DTOA 2QK0A 2DL3A 3I55T 2ENMA 2KT8A 3CMAQ 1YCSB 2HQXA 4Z8AA 2LCCA 3KUFA 1PG5B 2ROTA 2RHYA 4JS4A 5CVIA 1JXMA 1YCYA 4BDZA 4XU1A 2M0OA 5CAIA 1YITQ 3RIRA 1NBEB 4WF2A 3VS2A 4M77G 2NLUA 2V8JA 3EH2A 1Y96A 2WSFE 1ZBXA 3PNWC 1RAEB 4C5EA 4FYWB 5A0LA 3NTHA 5D6XA 4M7DE 2P0KA 4PK4A 1WXTA 2YRDA 3RBBB 1GCPA 1I8FA 3M4YA 2PVGB 4PLLA 1T0JA 2X9HA 3M0TA 4PL6A 2CP7A 3MEUA 4J5YA 2K3BA 1QLYA 1CKAA 4Y91A 3ZBDA 2K2MA 4J6WA 3CC4A 4OVAA 3JCMc 1N9SA 1OZ3A 1M5Q1 2OTLA 1VQ7A 3RMQA 2NUPB 3QYHB 3OYGA 1Y71A 5DM7R 1NJIU 3A8OB 4C92D 1KQ1A 1BCOA 3CCUT 3OB9A 4XU0A 2CH4A 3VJPA 1VOMA 3G7ZA 3V8KA 1XOVA 2CSQA 4BI3A 4PJJA 1W6XA 4MZTA 1TS9A 4HKEA 2PU9B 1NLPC 2O4XB 2M16A 3PT9A 2V8KA 3VS1A 4WTOB 2QASA 1LNXA 1Y57A 3EFOA 4M78E 2QQSA 1VQ6A 3JB9G 4E6RA 1JQQA 5LJ5h 4LE9A 4VUBA 1GFCA 1MNDA 2E3IA 2E3HA 1FMVA 2NYSA 3UF4A 3CCQT 3ULRB 4ZGDB 2FRWA 4M7AE 3CXCP 1PCXA 2G6FX 3H0FA 3QUIA 4J8OA 1MHNA 2CZ0B 3CCJT 4DEYA 1RAFB 4V2SA 1RL2A 3M0SA 4ZN1A 1IXDA 1V1CA 3MPUB 3LWIA 4EMKB 2RJDA 3QG1A 5LJ5e 4RTYA 2QGGA 2F1LA 2CYZB 5IAYA 5LJ3g 2M9UA 3V8LA 4E7HA 1SSHA 4OP0A 1Y0MA 4IURA 4IUVA 2KYBA 3UWNA 4OMNA 3CCLQ 1ZSZA 4RG2A 2JVVA 4KGXB 3OYIA 4FIBA 5IHNA 1JO8A 3QJ6A 3RKYA 2CH4W 1VYUA 2LZ6B 1K0SA 2E64A 3A8HB 3OBWA 3CPWS 3V8JA 2IPOB 2EKOA 3X24B 5GMKj 4C0DC 2I2LA 5LJ3h 2VVKA 4KUIA 2LDMA 1OULA 3E9FA 2PNIA 4OF1A 1PKSA 2EQMA 1NZ9A 3CQTA 5IHKA 3QZ9B 2DAQA 3EG9A 5GMKe 2DTIA 3JCMd 3OYMA 3CCSQ 1KQSP 4C8QC 2KI7A 4LDWA 4B9WA 2HEQA 1QVFA 1YJNQ 2HSPA 2DX1A 1QW1A 5LJ3e 1QCNA 1FX7A 3RKWA 3MEVA 4M77D 5IXFA 2QA4A 1IRXA 1K73U 2LQNA 3JCMh 1WI7A 1QVFS 3CPWP 3M59A 1T3LA 3M9QA 3I35A 4Z88A 3EG9B 4ELZC 2HNIA 5HK3A 4J9EA 4J9BA 3QZ5B 2MWPA 3M58A 4E7JA 3H6ZA 1FMKA 2DL4A 1X69A 2ZPEB 2DD5A 1WXUA 2KRNA 2YLCA 3NHNA 4LDVA 1M90U 4DOVA 2OTLT 2EGCA 3CCRA 5IT9E 3DLMA 4MZMA 1VQ6Q 4M78B 2HDAA 1X2QA 4J9IA 4HT8A 2DNUA 1EX4A 1NG2A 4PKCC 3CPWA 5AYFA 4FYVB 3CCVT 4X9DA 1QKWA 1R0BG 1K1ZA 4IUUA 2BZ8A 1VQPA 3CC7Q 3OYYA 3JAME 3SDZA 3FEOA 2RJCA 2KAFA 3M0UA 1GBRA 2QDLA 2CZ6B 3CCVQ 3WXMB 2GF7A 3LLRA 1I07A 2PUKB 1M2VA 1VIFA 3X25B 2LJ3A 4AT1B 4OGCA 4D6WA 3C4SA 2BE7D 4C92G 3X28B 1H641 1ABOA 1OU8A 3QJYA 2FZKB 1VQ7Q 2DILA 2EJGA 1KD1U 1VQ4Q 1G5VA 4FYXB 1WHHA 2YXYA 3CCRT 2VC8A 4PJOB 2ZZDA 2C0TA 2KK4A 2K6DA 1D1BA 2ZPBB 2P0PA 2SRCA 3HRSA 4P5NA 3L2WA 3I55A 1IGQA 3REBB 5GAOm 4JRKA 4Y92A 1VQKA 2O9SA 3OYDA 3MO8A 2EYQA 4DA4A 1VQOQ 4OMFB 2QXFA 4DBRA 2EVRA 2DEUA 2O9VA 1ZUUA 1AT1B 5GJWB 2L3PA 1BI2A 3MEAA 4M77A 1WHJA 4QVDA 3QPHA 1I4K1 3C0CA 5FU6C 1TUDA 3RR6A 4DOWA 2GQIA 5LJ5g 3IQLA 3L2QA 2ZGWA 2M51A 1W70A 4E47A 4OMMA 3ZFJA 3VV0A 5I21A 1VQOT 4NL2A 1SSFA 1RUWA 4J6YA 3M56A 4PJLA 2QYZA 2E5QA 3JCMf 3F70A 4OB3B 3UPUA 2DE0X 2DTHA 4J83A 6AT1B 2RK1A 4M78A 1WPYA 4XTXA 3JCMJ 2M02A 1TXQA 2JN0A 2X4YA 1UGQB 4JRIA 4QVCA 3QWYA 3ER0A 2W0ZA 2Z0WA 1R8OB 3HPWA 4D8DA 3I5SA 3L2RA 2FVUA 1KIKA 2RI3A 2O4XA 3G6EA 3AHUA 3OA6A 1U3OA 2LC4A 1LJOA 2MIOA 3OY9A 3KFVA 3FDRA 2HD0A 1AHJB 1OYXA 2J06A 5FU6B 2X4JA 2DBKA 4M75E 1M2VB 4ZTFA 2MYSA 2VASA 4C0FA 2ZPIB 3MP1A 2E4HA 2RHXA 2JOYA 3H8ZA 3RESA 2K79A 2YUQA 5HY6A 2HAXA 2EYWA 2RI2A 4RTVA 1GL5A 1KK7A 1ZBJA 1UG1A 4PJOF 5I11A 2CUDA 1D0XA 2MPXC 1OU9A 4KRTA 1RLQC 2R5MA 4JDSA 2VXFA 3GF5A 2E1HA 5LJ3j 3EGDB 4JJDA 3BY7A 1VQ6T 3MHXA 1Q86C 5L23A 4JZ4A 4M75F 5GAOr 1OX8A 3R6OA 1D1AA 1MGQA 2KRSA 3PGGA 3EH1A 2QQ9A 1HK9A 3I5RA 4Z89A 2DERA 5CKBA 5I2SA 2K57A 2JTMA 4M7DD 3TVTA 3OS0A 2E6ZA 4F16A 4B9XA 3DKMA 1MUZA 2E6NA 1H3HA 1KD1C 1LOJA 1QCOA 1GCQC 1UTIA 4LD6A 3KBGA 4XU3A 1G83A 3OYHA 2GQVA 4B6MA 2LJ0A 4F7UE 4OMPA 1LPLA 2QQAA 3GNGA 2Y4YA 5A0DA 1KD1R 2Y90A 2EKHA 1YJNT 1YITA 2PTKA 2FEIA 3QDFA 4IUQA 3CCST 3OSVA 3A8GB 1IB8A 3CC7A 1IREB 4OB2B 2ABLA 2KQWA 1OOTA 1AWWA 1K4US 1BI0A 4ORZA 1M27C 1AEYA 1W2BP 2JXBA 3PFSA 3A8MB 4M7AD 3JB9H 1OV3A 1IHWA 3LWHA 5LJ5f 4IKFA 5GAOq 4BD3A 4LNPA 4OMOA 3TQ7P 1BYMA 3OYFA 3E2UA 3OYBA 2GFUA 2ZPFB 4KH0B 2RM4A 2E65A 2NUZA 3CBMA 4M7AB 3CCLT 1X6OA 4L5GA 3C95A 5J26A 1AZGB 1R77A 3OYCA 4FW1A 3ZEHA 2EJFA 2HQHA 3OS5A 4ZGJB 1M8VA 2JNGA 2DM1A 3REAB 3PE0A 5GAN7 3RDVA 3OW2A 2RQUA 3GPLA 2JTFA 2DYBA 5KE2A 5CCAA 1UGPB 4PNOA 3CD6A 1QQJA 1X6GA 3CCJQ 2RN8A 1M3AA 1VA7A 2EQUA 4C0GA 1VQOA 3OS1A 5EG2A 4M77C 5CKHA 5KYYB 2CKKA 3CCQQ 1G2BA 1VIEA 4KH1B 1SF9A 2V1QA 1D0YA 3OYAA 5CQXA 3JCMP 1C6VX 3O5ZA 3VKIA 3BDLA 1KFZA 4F17A 4R0KA 1B7TA 1GRIA 4PJOG 1WHMA 1SG5A 3A5ZB 4F7UA 3SHWA 2B86A 1ARKA 2L8DA 5KYXB 2RH2A 3MP6A 1K76A 2COWA 2RD1A 1XJWB 3JB9D 4D8KA 1PD1A 2I0NA 2P4RA 1WNLA 3CCMA 1M9SA 3OW2P 3VU3C 3SWNA 1M3BA 5KYUA 3LW5E 1SRMA 2BKDN 1YJWT 2PQWA 2LRQA 2L5QA 2L89A 2XDDA 4RUGA 2RK2A 4A4GA 2X4WA 2CZ1B 5FU7B 5GANg 3CC2T 2FYKA 4PJNA 3NTIA 1QKXA 2GBQA 5LJ3d 4M7DA 5CKFA 2FPFA 5GAN6 3BDUA 1ZQ1A 1YHQA 5GAN2 1KC8U 5LJ5j 4LD9K 1BK2A 2C0OA 1KQ2A 4F7UG 2COYA 4FW2A 1WQ7A 1Z9ZA 3EAEA 1I0CA 4OB0B 1PWTA 1IO6A 3CBOA 5GAMg 1MV0B 5GMKh 2WSEE 1UECA 3TU4K 1VQ5A 1VQ4T 2WSCE 2RQWA 2MWOA 3MKDA 2K5FA 5KCHA 1I1JA 4BUGA 4BE1A 4M75C 3LH0A 1AWXA 1JBMA 3P8BB 2ATCB 2D0QB 3L1AA 1GFDA 4J9GA 4UC4A 2VKNA 3FIFA 2P0QA 4FT2A 1YFNA 2RO0A 1M3CA 4JUVA 1UE9A 1WJQA 1G3YA 3OMGA 1NE8A 1QWEA 1TH7A 2CS7A 1N6AA 2QG9B 4JJNK 1YWPA 3ME9A 3CCSA 3CCMT 1MNEA 1H3ZA 2NUTA 3CCLA 4BB7A 1YNZA 4JRQA
chains in the Genus database with same CATH topology
3M0UA 1GBRA 3M0RA 2QDLA 3EG2A 2DA9A 1WYXA 1WX6A 4CC7A 2L0AA 3VS4A 1NM7A 2ED0A 1I07A 2KXCA 3SEMA 2LJ3A 3RNJA 5GJVB 4CC2A 1NLOC 3VS7A 3LH5A 1BBZA 3VS5A 2L3QA 3UA7A 5IHIA 1ABOA 4GBQA 4FSSA 2AZVA 3NMZC 3EG0A 2LCSA 1ZUYA 2DVJA 2DILA 4ESRA 5I22A 2F2XA 2OI3A 4AFUC 1H92A 1X27A 4M4ZA 2C0TA 2J6KA 4IIOA 1K0XA 2K6DA 1B07A 5IXBA 4DEXA 2SRCA 2GTOA 3H0HA 1VYTA 2LQWA 2DL5A 3EHRA 1LCKA 4RTTA 1S1NA 3REBB 4Y92A 2O9SA 2FPEA 2KBTA 3UATA 2D8JA 4RTXA 2JMAA 3NGPA 3GBQA 2KROA 2DLPA 1J3TA 1UJ0A 2EVRA 1WA7A 2FG0A 1E6HA 1JXOA 4A63B 2O9VA 1ZUUA 2EPDA 1WFWA 2L3PA 5GJWB 2J6FA 2KNBB 3QWXX 2OAWA 1VYVA 2H8HA 3TSWA 1PRLC 4HCKA 3C0CA 1TUDA 2CREA 3VRYA 2GQIA 2OJ2A 2EGEA 2YDLA 3IQLA 5IH2A 4ZNXA 1HSQA 2RNAA 1OPKA 2M51A 1W70A 2RQVA 4OMMA 1TUCA 1NEBA 2FO0A 2NWMA 1RUWA 1UHCA 2K7AA 1E6GA 1HJDA 1WDXA 1PHTA 4JZ3A 1JEGA 2CT4A 5ECAA 2CDTA 2DE0X 2JS2A 2PZ1A 2YUPA 1AD5A 1AWOA 2JMCA 2BZYA 2GTJA 2KR3A 2DL8A 1GBQA 3QWYA 2KYMA 2W0ZA 4D8DA 1NYGA 3I5SA 3ZL7C 4CC3A 1AZEA 1KIKA 3JV3A 2KEAA 2X3XD 2VWFA 1U3OA 1BU1A 2MIOA 2LP5A 3KFVA 4LUEA 2CT3A 2C0IA 1BB9A 1EFNA 2J06A 2DBKA 2ED1A 1HD3A 2HBWA 4AG1C 1ZLMA 2DMOA 2KT1A 1NEGA 2L3SA 2K79A 2YUQA 2E5KA 2EYWA 3EHQA 4RTVA 2JM8A 3THKA 1GL5A 1ZBJA 1YN8A 1UG1A 5I11A 1YWOA 2CUDA 4JJCA 1RLPC 1UUEA 2IIMA 1K9AA 2MCNA 2DL3A 4KRTA 2ENMA 1T0HA 1RLQC 2KT8A 2AZSA 3VRZA 1UGVA 1YCSB 4Z8AA 4JJDA 2A28A 4K11A 1WLPB 2ROTA 3EG1A 2J6OA 1QCFA 5L23A 1JXMA 2K9GA 4JZ4A 2HCKA 1X6BA 1NYFA 2KRSA 4HXJA 3I5RA 1UHFA 4Z89A 3VS2A 1U06A 1PRMC 3TVTA 1KSWA 3H0IA 4EIKA 4F16A 2KXDA 1E7OA 1MUZA 2EYYA 4HVUA 2O31A 2M0YA 3U23A 2J7IA 1H3HA 1GCQC 1WXTA 1SHFA 3RBBB 1UTIA 1GCPA 4JPBW 1G83A 2LJ0A 4OMPA 1T0JA 2EKHA 2DJQA 2PTKA 2FEIA 4J9HA 3EG3A 1W1FA 3M0TA 2A37A 2K3BA 1OEBA 1QLYA 2D1XA 1CKAA 2K2MA 2ABLA 2YSQA 1OOTA 1AWWA 1K4US 2V1RA 4ORZA 1M27C 4RTUA 3R6NA 4J9DA 1AEYA 2JXBA 1SHGA 2JT4A 1OV3A 2RQTA 1UFFA 2D0NA 2AKKA 2FPDA 2FRYA 4RTZA 3EGUA 4LNPA 2EYXA 4OMOA 4HVWA 1AVZC 2NUZA 2CH4A 5EC7A 1XOVA 1WXBA 2DF6A 2CSQA 1A0NB 1AZGB 3PVLA 1W6XA 2JW4A 4LN2A 1B3QA 1NLPC 3VS0A 4QT7A 2DM1A 3REAB 3VS1A 2YUOA 1Y57A 3PE0A 2AKLA 2DBMA 1ZX6A 2A36A 2RQUA 4E6RA 1JQQA 2KRMA 2DYBA 2KGTA 4LE9A 2XMFA 1GFCA 3UF4A 1X6GA 5FWBA 4CC4B 3ULRB 2FRWA 2RN8A 1M3AA 1VA7A 3I9QA 2G6FX 3H0FA 1SPKA 2DL7A 3M0PA 2RQRA 1G2BA 1X43A 4DEYA 1TG0A 3M0SA 2V1QA 1V1CA 4J9CA 2JTEA 2ESWA 2X3WD 3O5ZA 1KFZA 2A08A 4RTYA 4F17A 1T3SA 4R0KA 1GRIA 1SSHA 3SHWA 2B86A 1ARKA 1Y0MA 2W10A 4J9FA 1PNJA 4AG2C 1K76A 2DRKA 2J05A 2KYBA 2BTTA 2EYZA 4OMNA 4D8KA 2I0NA 2P4RA 5IHNA 1FYNA 1JO8A 2EQIA 2CH4W 4WCIA 1VYUA 4AFZC 2LZ6B 1KJWA 4GLMA 1M3BA 2LMJA 1K0SA 1M8MA 1SRMA 2L2PA 4IIMA 4F14A 1YP5A 1MV3A 1QWFA 2VVKA 2ROLA 2CSIA 1Z9QA 2LX7A 2PNIA 4JJBA 1SRLA 4RUGA 1PKSA 2D8HA 1WIEA 1AWJA 3CQTA 5IHKA 2F2VA 2LJ1A 1ZSGA 2CUBA 3FJ5A 3UA6A 1QKXA 2LNHB 2GBQA 3H41A 2HEQA 3TSZA 2O88A 1CSKA 4OMQA 2FPFA 5HCKA 2ECZA 2DX1A 2HSPA 4AFSC 1SEMA 1ABQA 1U5SA 3VS6A 1BK2A 4OMLA 2C0OA 3PVQA 2YT6A 2AK5A 3A98A 1UJYA 1UDLA 1OPLA 1Z9ZA 2YUNA 5IXFA 2EGAA 1I0CA 4RTWA 1ZUKA 1PWTA 1IO6A 2LQNA 1MV0B 2RF0A 1WI7A 2GGRA 1T3LA 2RMOA 1UECA 2BZXA 3I35A 5FWCA 4Z88A 4J9EA 2EW3A 2RQWA 4J9BA 1N5ZA 1I1JA 2GNCA 1RI9A 1X2KA 1AWXA 4AFQC 1FMKA 1CKBA 2DL4A 1GFDA 1X69A 4J9GA 1JU5C 2DRMA 1WXUA 2VKNA 4X1VA 2KRNA 4LUDA 3NHNA 1M3CA 2EGCA 1UE9A 1H8KA 1PKTA 2JS0A 1GCQA 2HDAA 1X2QA 2MOXA 4J9IA 5FW9A 2DNUA 1NG2A 4HVVA 1QWEA 2F2WA 2O2OA 2JM9A 2RPNA 3VS3A 1QKWA 2KE9A 2SEMA 1YWPA 1K1ZA 3NPFA 1AOJA 3M0QA 2EBPA 1M30A 2BZ8A 1YNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0U A;  1GBR A;  3M0R A;  2QDL A;  3EG2 A;  2DA9 A;  1WYX A;  1WX6 A;  4CC7 A;  2L0A A;  3VS4 A;  1NM7 A;  2ED0 A;  1I07 A;  2KXC A;  3SEM A;  2LJ3 A;  3RNJ A;  5GJV B;  4CC2 A;  1NLO C;  3VS7 A;  3LH5 A;  1BBZ A;  3VS5 A;  2L3Q A;  3UA7 A;  5IHI A;  1ABO A;  4GBQ A;  4FSS A;  2AZV A;  3NMZ C;  3EG0 A;  2LCS A;  1ZUY A;  2DVJ A;  2DIL A;  4ESR A;  5I22 A;  2F2X A;  2OI3 A;  4AFU C;  1H92 A;  1X27 A;  4M4Z A;  2C0T A;  2J6K A;  4IIO A;  1K0X A;  2K6D A;  1B07 A;  5IXB A;  4DEX A;  2SRC A;  2GTO A;  3H0H A;  1VYT A;  2LQW A;  2DL5 A;  3EHR A;  1LCK A;  4RTT A;  1S1N A;  3REB B;  4Y92 A;  2O9S A;  2FPE A;  2KBT A;  3UAT A;  2D8J A;  4RTX A;  2JMA A;  3NGP A;  3GBQ A;  2KRO A;  2DLP A;  1J3T A;  1UJ0 A;  2EVR A;  1WA7 A;  2FG0 A;  1E6H A;  1JXO A;  4A63 B;  2O9V A;  1ZUU A;  2EPD A;  1WFW A;  2L3P A;  5GJW B;  2J6F A;  2KNB B;  3QWX X;  2OAW A;  1VYV A;  2H8H A;  3TSW A;  1PRL C;  4HCK A;  3C0C A;  1TUD A;  2CRE A;  3VRY A;  2GQI A;  2OJ2 A;  2EGE A;  2YDL A;  3IQL A;  5IH2 A;  4ZNX A;  1HSQ A;  2RNA A;  1OPK A;  2M51 A;  1W70 A;  2RQV A;  4OMM A;  1TUC A;  1NEB A;  2FO0 A;  2NWM A;  1RUW A;  1UHC A;  2K7A A;  1E6G A;  1HJD A;  1WDX A;  1PHT A;  4JZ3 A;  1JEG A;  2CT4 A;  5ECA A;  2CDT A;  2DE0 X;  2JS2 A;  2PZ1 A;  2YUP A;  1AD5 A;  1AWO A;  2JMC A;  2BZY A;  2GTJ A;  2KR3 A;  2DL8 A;  1GBQ A;  3QWY A;  2KYM A;  2W0Z A;  4D8D A;  1NYG A;  3I5S A;  3ZL7 C;  4CC3 A;  1AZE A;  1KIK A;  3JV3 A;  2KEA A;  2X3X D;  2VWF A;  1U3O A;  1BU1 A;  2MIO A;  2LP5 A;  3KFV A;  4LUE A;  2CT3 A;  2C0I A;  1BB9 A;  1EFN A;  2J06 A;  2DBK A;  2ED1 A;  1HD3 A;  2HBW A;  4AG1 C;  1ZLM A;  2DMO A;  2KT1 A;  1NEG A;  2L3S A;  2K79 A;  2YUQ A;  2E5K A;  2EYW A;  3EHQ A;  4RTV A;  2JM8 A;  3THK A;  1GL5 A;  1ZBJ A;  1YN8 A;  1UG1 A;  5I11 A;  1YWO A;  2CUD A;  4JJC A;  1RLP C;  1UUE A;  2IIM A;  1K9A A;  2MCN A;  2DL3 A;  4KRT A;  2ENM A;  1T0H A;  1RLQ C;  2KT8 A;  2AZS A;  3VRZ A;  1UGV A;  1YCS B;  4Z8A A;  4JJD A;  2A28 A;  4K11 A;  1WLP B;  2ROT A;  3EG1 A;  2J6O A;  1QCF A;  5L23 A;  1JXM A;  2K9G A;  4JZ4 A;  2HCK A;  1X6B A;  1NYF A;  2KRS A;  4HXJ A;  3I5R A;  1UHF A;  4Z89 A;  3VS2 A;  1U06 A;  1PRM C;  3TVT A;  1KSW A;  3H0I A;  4EIK A;  4F16 A;  2KXD A;  1E7O A;  1MUZ A;  2EYY A;  4HVU A;  2O31 A;  2M0Y A;  3U23 A;  2J7I A;  1H3H A;  1GCQ C;  1WXT A;  1SHF A;  3RBB B;  1UTI A;  1GCP A;  4JPB W;  1G83 A;  2LJ0 A;  4OMP A;  1T0J A;  2EKH A;  2DJQ A;  2PTK A;  2FEI A;  4J9H A;  3EG3 A;  1W1F A;  3M0T A;  2A37 A;  2K3B A;  1OEB A;  1QLY A;  2D1X A;  1CKA A;  2K2M A;  2ABL A;  2YSQ A;  1OOT A;  1AWW A;  1K4U S;  2V1R A;  4ORZ A;  1M27 C;  4RTU A;  3R6N A;  4J9D A;  1AEY A;  2JXB A;  1SHG A;  2JT4 A;  1OV3 A;  2RQT A;  1UFF A;  2D0N A;  2AKK A;  2FPD A;  2FRY A;  4RTZ A;  3EGU A;  4LNP A;  2EYX A;  4OMO A;  4HVW A;  1AVZ C;  2NUZ A;  2CH4 A;  5EC7 A;  1XOV A;  1WXB A;  2DF6 A;  2CSQ A;  1A0N B;  1AZG B;  3PVL A;  1W6X A;  2JW4 A;  4LN2 A;  1B3Q A;  1NLP C;  3VS0 A;  4QT7 A;  2DM1 A;  3REA B;  3VS1 A;  2YUO A;  1Y57 A;  3PE0 A;  2AKL A;  2DBM A;  1ZX6 A;  2A36 A;  2RQU A;  4E6R A;  1JQQ A;  2KRM A;  2DYB A;  2KGT A;  4LE9 A;  2XMF A;  1GFC A;  3UF4 A;  1X6G A;  5FWB A;  4CC4 B;  3ULR B;  2FRW A;  2RN8 A;  1M3A A;  1VA7 A;  3I9Q A;  2G6F X;  3H0F A;  1SPK A;  2DL7 A;  3M0P A;  2RQR A;  1G2B A;  1X43 A;  4DEY A;  1TG0 A;  3M0S A;  2V1Q A;  1V1C A;  4J9C A;  2JTE A;  2ESW A;  2X3W D;  3O5Z A;  1KFZ A;  2A08 A;  4RTY A;  4F17 A;  1T3S A;  4R0K A;  1GRI A;  1SSH A;  3SHW A;  2B86 A;  1ARK A;  1Y0M A;  2W10 A;  4J9F A;  1PNJ A;  4AG2 C;  1K76 A;  2DRK A;  2J05 A;  2KYB A;  2BTT A;  2EYZ A;  4OMN A;  4D8K A;  2I0N A;  2P4R A;  5IHN A;  1FYN A;  1JO8 A;  2EQI A;  2CH4 W;  4WCI A;  1VYU A;  4AFZ C;  2LZ6 B;  1KJW A;  4GLM A;  1M3B A;  2LMJ A;  1K0S A;  1M8M A;  1SRM A;  2L2P A;  4IIM A;  4F14 A;  1YP5 A;  1MV3 A;  1QWF A;  2VVK A;  2ROL A;  2CSI A;  1Z9Q A;  2LX7 A;  2PNI A;  4JJB A;  1SRL A;  4RUG A;  1PKS A;  2D8H A;  1WIE A;  1AWJ A;  3CQT A;  5IHK A;  2F2V A;  2LJ1 A;  1ZSG A;  2CUB A;  3FJ5 A;  3UA6 A;  1QKX A;  2LNH B;  2GBQ A;  3H41 A;  2HEQ A;  3TSZ A;  2O88 A;  1CSK A;  4OMQ A;  2FPF A;  5HCK A;  2ECZ A;  2DX1 A;  2HSP A;  4AFS C;  1SEM A;  1ABQ A;  1U5S A;  3VS6 A;  1BK2 A;  4OML A;  2C0O A;  3PVQ A;  2YT6 A;  2AK5 A;  3A98 A;  1UJY A;  1UDL A;  1OPL A;  1Z9Z A;  2YUN A;  5IXF A;  2EGA A;  1I0C A;  4RTW A;  1ZUK A;  1PWT A;  1IO6 A;  2LQN A;  1MV0 B;  2RF0 A;  1WI7 A;  2GGR A;  1T3L A;  2RMO A;  1UEC A;  2BZX A;  3I35 A;  5FWC A;  4Z88 A;  4J9E A;  2EW3 A;  2RQW A;  4J9B A;  1N5Z A;  1I1J A;  2GNC A;  1RI9 A;  1X2K A;  1AWX A;  4AFQ C;  1FMK A;  1CKB A;  2DL4 A;  1GFD A;  1X69 A;  4J9G A;  1JU5 C;  2DRM A;  1WXU A;  2VKN A;  4X1V A;  2KRN A;  4LUD A;  3NHN A;  1M3C A;  2EGC A;  1UE9 A;  1H8K A;  1PKT A;  2JS0 A;  1GCQ A;  2HDA A;  1X2Q A;  2MOX A;  4J9I A;  5FW9 A;  2DNU A;  1NG2 A;  4HVV A;  1QWE A;  2F2W A;  2O2O A;  2JM9 A;  2RPN A;  3VS3 A;  1QKW A;  2KE9 A;  2SEM A;  1YWP A;  1K1Z A;  3NPF A;  1AOJ A;  3M0Q A;  2EBP A;  1M30 A;  2BZ8 A;  1YNZ A; 
#chains in the Genus database with same CATH topology
 3M0R A;  4EMG A;  3EG2 A;  1WYX A;  3VS4 A;  5IN1 A;  3HSB A;  1NM7 A;  1RAD B;  2KXC A;  4NS5 A;  3S3N A;  1BI3 A;  4CC2 A;  4LDY A;  2OTL Q;  1NLO C;  1UEB A;  3CD6 Q;  1V76 A;  1X75 C;  3UA7 A;  2IVW A;  3G6E T;  4GBQ A;  3CC2 A;  4A53 A;  4X34 A;  4N4H A;  3MET A;  4ESR A;  4BI4 A;  4C8Q A;  5I22 A;  4ZTJ A;  4MDX A;  2OI3 A;  5C6S A;  1SKU B;  1X27 A;  4MMK A;  4F7U F;  1JJ2 A;  2J6K A;  1K0X A;  3TCJ A;  4C5H A;  3MJX A;  4R56 A;  5I2M A;  5J39 A;  2F5K A;  1VYT A;  3TEE A;  4PFO A;  1LCK A;  1I5O B;  4RTT A;  1S1N A;  4XK8 E;  2FPE A;  4EMK C;  2D8J A;  3CPF A;  4RTX A;  3BFM A;  3GBQ A;  4IUT A;  2VB6 A;  3S6W A;  1S72 Q;  1Y07 A;  2QEX Q;  1E6H A;  4A63 B;  1WFW A;  2QTV A;  2J6F A;  3QWX X;  2KY9 A;  1VYV A;  3PIO A;  2P84 A;  1RAB B;  2HMA A;  4HT9 A;  2V8I A;  2CRE A;  5KE3 A;  2EGE A;  4OGE A;  4A4E A;  2MMP A;  3CC4 T;  1OPK A;  2RNA A;  1B34 B;  2RQV A;  3X26 B;  4KGV B;  1K8A C;  1K9M U;  1NEB A;  2FO0 A;  2NWM A;  1WGS A;  1Q81 C;  3CEY A;  1FXX A;  2RA2 A;  2V26 A;  4DBF A;  3QKJ A;  1HJD A;  1K73 R;  3AT1 B;  1WDX A;  2HKQ B;  4JZ3 A;  3VYG A;  2EIF A;  1JEG A;  5ECA A;  1G3T A;  1YJN A;  2JS2 A;  5GMK l;  3FLG A;  2YUP A;  1AD5 A;  3CCU A;  4YTL A;  2GTJ A;  3LGL A;  3CCR Q;  1C0M A;  2DL8 A;  2KYM A;  4ANJ A;  2MAM A;  4QQG A;  3E9G A;  3ZL7 C;  1VQ7 T;  1JJ2 P;  1KG1 A;  3OQ5 A;  4EPC A;  2KEA A;  3HFN A;  3G4S Q;  2X3X D;  1VQ5 T;  3HL8 A;  4M78 D;  2HL3 A;  4O5V A;  4TVR A;  4LUE A;  2C06 A;  3EFS A;  1WHK A;  5LJ5 d;  1HD3 A;  3VYH B;  3I56 Q;  4II1 A;  2HBW A;  4J7I A;  4AG1 C;  4RCC A;  4EDU A;  2AHJ B;  2XID A;  4PJO A;  2DMO A;  2KT1 A;  4M7D B;  1NEG A;  1Q81 R;  1JB0 E;  2LNV A;  1XTD A;  1K8A R;  1BCM A;  1O75 A;  3CCJ A;  3EHQ A;  3THK A;  1D09 B;  2VGN A;  4XTV A;  3CC7 T;  3PMI A;  2OTJ Q;  4A4F A;  1QVG A;  3CXC S;  2K4Y A;  4C8Q B;  1K9A A;  2H3J A;  5GAN 8;  5D6Y A;  1NPR A;  1M1K U;  4BI8 B;  2RI5 A;  2AZS A;  1UGV A;  4M78 C;  1ACM B;  4FM4 B;  2LX9 A;  4FYY B;  2A28 A;  3GNF B;  4K11 A;  1WLP B;  3EG1 A;  1Q86 U;  1XNI A;  1VQN T;  1X6B A;  2A0F B;  3CCE A;  2A3L A;  3FRN A;  2BE9 B;  1UHF A;  1U06 A;  1PRM C;  4C92 E;  3H0I A;  4EIK A;  1E7O A;  4HVU A;  2BUD A;  2R5A A;  5CIU A;  1G8X A;  1RAG B;  2O31 A;  1QMC A;  2J7I A;  5CKD A;  2DXU A;  3S3M A;  1Q95 G;  2NUT B;  4XTU A;  3PMT A;  4JPB W;  3CXC A;  2K3X A;  3GP8 A;  1WHG A;  1WJS A;  1N8R U;  5CR2 A;  4J9H A;  3RKX A;  5GAN 3;  3EG3 A;  4MML A;  4JLI A;  1MMN A;  4M7A C;  4M7A F;  3M53 A;  1OEB A;  2D1X A;  2LCL A;  3SB2 A;  4M77 F;  3CME T;  5KYN A;  2YSQ A;  3EGD A;  2V1R A;  4N0A C;  4RTU A;  4J9D A;  2JT4 A;  1D3B B;  3PIP A;  2RQT A;  1UFF A;  4M7D F;  2D0N A;  2AKK A;  2FPD A;  2FRY A;  2JUF A;  4RTZ A;  3EGU A;  4M75 B;  2EYX A;  3QO3 A;  3OBY A;  5GAO l;  5D7U A;  4C8Q G;  4RG8 A;  1WXB A;  4EMK A;  1K9M C;  3DB3 A;  4XAX B;  3D7S B;  4XU2 A;  3I56 A;  1Q7Y C;  2DKG A;  1PD0 A;  4QT7 A;  2EJ9 A;  1MMG A;  3CCQ A;  1KHC A;  2CP0 A;  5KYU B;  2MF2 A;  4E7K A;  1G3W A;  5LJ3 f;  5KYY A;  2DXC A;  3URG A;  3RUX A;  4J7F A;  5KYW A;  2XMF A;  3JCM V;  1MMD A;  1TTH B;  3G1J A;  1QP3 A;  4QW2 A;  4Q5W A;  1YI2 Q;  1YJ9 T;  1SPK A;  2B8A A;  1KHI A;  3M0P A;  2RQR A;  1X43 A;  4L6V 5;  4C8Q E;  5GAN 5;  1C1A A;  3M4G A;  1IGU A;  1YIJ Q;  4J9C A;  5C0M A;  2JTE A;  2JJ9 A;  3J7A F;  3JCM b;  2A08 A;  3FC3 A;  3A1P A;  1U1S A;  3GOX A;  3HFO A;  4A4H A;  5KYW B;  2XI9 A;  3OMC A;  4J9F A;  4AG2 C;  2J05 A;  2RJE A;  2BTT A;  3HRT A;  3CME A;  3LX7 A;  4WCI A;  2MK5 A;  1Q81 U;  1RI0 A;  3CCU Q;  4BE2 A;  1TSF A;  4IIM A;  1YP5 A;  4HCC A;  2CP3 A;  1K73 C;  4E7I A;  4Z02 A;  2ROL A;  2CSI A;  5GMK i;  5GAN e;  2DXB A;  2LX7 A;  4JJB A;  1VQM A;  4ZGE B;  2GCX A;  1WIE A;  1AWJ A;  3INZ A;  1M1G A;  2F2V A;  3CBP A;  3WVE B;  4PJM A;  2K3Y A;  3J81 E;  1VQP Q;  5GAM h;  3FJ5 A;  4C8Q F;  3UA6 A;  1YBY A;  3H41 A;  1M90 C;  3TSZ A;  1CSK A;  4OMQ A;  5HCK A;  2HZY A;  1U5S A;  9ATC B;  4E7L A;  2FZG B;  2DJZ A;  1Q7Y U;  1K9M R;  4OML A;  3PVQ A;  3QII A;  3A98 A;  4F7U B;  1UDL A;  1VQN A;  3L2U A;  1OPL A;  2X35 A;  4N4G A;  4RTW A;  1ZUK A;  2RF0 A;  1VQK Q;  2CP2 A;  2RMO A;  2BZX A;  4QQD A;  4A54 A;  1YJ9 A;  2ZAE A;  3WVD B;  3QSU A;  1N5Z A;  1RI9 A;  2F5T X;  2WAC A;  1YIJ A;  1IHV A;  4C0D B;  1ZA1 B;  4M77 E;  1JU5 C;  2DRM A;  1YIT T;  4X1V A;  4OB1 B;  1M1K C;  4AMC A;  1YHQ T;  1H8K A;  5GAN d;  1PKT A;  2JS0 A;  3QXE B;  1PSE A;  3G4S A;  2K5I A;  3CMA T;  5GAO p;  3JCM g;  1BKB A;  2E70 A;  2F2W A;  2O2O A;  2R58 A;  3QHS A;  4RCB A;  4E7Z A;  3I55 Q;  2SEM A;  3Q1J A;  3NPF A;  1AOJ A;  3M0Q A;  2EBP A;  2YLB A;  3JB9 J;  3G71 Q;  2D6F A;  2DYI A;  4RMO A;  2ED0 A;  4PJO C;  1JRI A;  3RNJ A;  1VQM T;  5GAN f;  3BW1 A;  1VQ8 T;  2K2V A;  2PUO B;  3L2V A;  3JSC A;  5M9O A;  5J3B A;  2DFU A;  3VS7 A;  4NOY A;  1Q82 U;  3LH5 A;  4E2F B;  2DK3 A;  2GFA A;  3V7C A;  4FSS A;  3MP8 A;  2CGH A;  3EG0 A;  2XU8 A;  2O01 E;  4DBQ A;  1VQL T;  1V29 B;  2QEX A;  1H92 A;  5CQY A;  4DQ2 A;  4FCY A;  4IIO A;  1B07 A;  5IXB A;  4DEX A;  3H0H A;  5GAN h;  1FWZ A;  2DL5 A;  3M55 A;  4XTW A;  3UAT A;  3NGP A;  2XDP A;  1J3T A;  1NJI R;  4ELY C;  2FG0 A;  1JXO A;  1TWB A;  4MDW A;  1HXD A;  2QA4 T;  1RAA B;  3CCE T;  2IG0 A;  3V7R A;  4O6J A;  5DLQ E;  1PRL C;  4HCK A;  3VRY A;  2OJ2 A;  2YDL A;  4ZNX A;  2DZ9 A;  4F04 B;  2EQJ A;  2XDB A;  4HA8 A;  1M90 R;  1YJW A;  2FZC B;  4PJO D;  1TUC A;  3TRE A;  2K7A A;  4KGZ B;  2DIQ A;  1RAI B;  2DZC A;  3E1S A;  3HKS A;  4GLK A;  1RAH B;  2PZ1 A;  4ME7 A;  2QQR A;  2JMC A;  5D6W A;  1DJ7 B;  1I81 A;  1N27 A;  3JCM X;  1PC0 A;  2AT1 B;  1UB4 A;  1NJI C;  3EFR A;  1VQL Q;  4DBH A;  2OX7 A;  2OAU A;  1AZE A;  1BU1 A;  1FMW A;  5A2Q E;  1BB9 A;  1EFN A;  3EGX A;  1U1T A;  1TU0 B;  4BY6 B;  2LTO A;  3LGF A;  2ED1 A;  2L3R A;  3HP9 A;  3P8H A;  4M75 G;  1VQM Q;  8AT1 B;  2P4T A;  2NUP A;  3OYE A;  3MEW A;  5DLO A;  2L3S A;  2PVD B;  1B34 A;  2R57 A;  4IUP A;  1YN8 A;  1YWO A;  4JJC A;  1Y7X A;  1UUE A;  3OW2 S;  1T0H A;  5CK9 A;  4M7A G;  3EGX B;  3VRZ A;  5GAN j;  4FU6 A;  3NTK A;  2QTX A;  2E41 A;  3FJP A;  4BE0 A;  4LDX A;  2J6O A;  1QCF A;  2K9G A;  3UT1 A;  2HCK A;  4M78 G;  1NYF A;  2ZPH B;  3CMA A;  4C5G A;  4CRI A;  4HXJ A;  1IZ6 A;  1HYO A;  1Q82 C;  1KC8 R;  2MI6 A;  3M54 A;  2LT1 A;  1KSW A;  2HL5 C;  1UGR B;  4J6X A;  4XTZ A;  3CME Q;  2XK0 A;  2KXD A;  2EYY A;  2XG8 D;  1N8R R;  2JZ2 A;  2M0Y A;  3U23 A;  1VQL A;  1O9S A;  4N4I A;  1VQK T;  1KQS A;  1P92 A;  1Q82 R;  1SHF A;  3T9N A;  2HQE A;  1W4S A;  2KVQ G;  4M78 F;  3FB9 A;  2YRV A;  3NFC A;  3UDC A;  1NPP A;  2ZPG B;  1R0C B;  2EFI A;  1TOV A;  2RHI A;  2Y4X A;  2DJQ A;  3JRZ A;  4X9C A;  1W1F A;  2A37 A;  2DO3 A;  5GAM e;  2XIC A;  1OZ2 A;  1M1F A;  4PFP A;  2QGF B;  3G71 A;  1WJR A;  5FRO A;  4ZN3 A;  2DXT A;  3QYG B;  3R6N A;  2RHU A;  1PSF A;  1BI1 A;  1SHG A;  3OYK A;  1QVG P;  5GAM j;  5FLX E;  1OQK A;  2HSE B;  4HVW A;  2DET A;  1AVZ C;  1Y96 B;  7AT1 B;  1VQ9 Q;  4KBM B;  5EC7 A;  2DF6 A;  4MZP A;  2XHC A;  1A0N B;  3PVL A;  2JW4 A;  4LN2 A;  3OYL A;  1X01 A;  1B3Q A;  3C12 A;  3CCV A;  3VS0 A;  4E7S A;  4N0A A;  5KYX A;  3L2Z A;  2YUO A;  4HCB A;  4CI0 C;  3RER A;  2AKL A;  3HRU A;  2DBM A;  1ZX6 A;  3A8L B;  3DB4 A;  2A36 A;  1BIA A;  2AIR B;  2KRM A;  1XQH A;  2KGT A;  1WQW A;  3V7S A;  5FWB A;  4CC4 B;  4PFZ A;  2D9T A;  1ZHI A;  2X51 A;  2KMT A;  1YI2 T;  3I9Q A;  2LVM A;  1QVP A;  2DL7 A;  3RMS A;  1VQ5 Q;  3G4S T;  5GMK m;  1TG0 A;  4C92 B;  4XTY A;  5CKE A;  2ESW A;  2X3W D;  1F1B B;  4PJO E;  3PTA A;  2DVE A;  2PVO B;  1T3S A;  1N9R A;  2FHD A;  1KQS S;  2W10 A;  1PNJ A;  2X4X A;  3KXT A;  2DRK A;  3OYJ A;  2EYZ A;  3E19 A;  1FYN A;  2EQI A;  1WZO A;  2OTJ A;  1VQ9 T;  4AFZ C;  1KJW A;  2VUB A;  1KC8 C;  4GLM A;  2LMJ A;  3CC4 Q;  4LXC A;  1M8M A;  1QVF P;  2E10 A;  2L2P A;  4F14 A;  1MV3 A;  3QDR B;  2BIV A;  1D3B A;  1QWF A;  1N8R C;  1I5L A;  3GIB A;  1VQ8 A;  1Z9Q A;  4NL3 A;  2HKN A;  1SRL A;  1M2O A;  3BE3 A;  4FSX A;  4C8Q D;  4ATO A;  2A7Y A;  2D8H A;  4LDU A;  3CCE Q;  4C5I A;  2QA4 Q;  3VUZ A;  2LJ1 A;  4BDY A;  1RAC B;  1ZSG A;  3JCM e;  2CUB A;  3OS2 A;  2LNH B;  1ZSZ C;  2G3R A;  4KUL A;  2O88 A;  1LVK A;  2ECZ A;  3M57 A;  4AFS C;  1SEM A;  1ABQ A;  3VS6 A;  2F69 A;  4BAC A;  2ZCF B;  3EFO B;  5LL6 S;  2YT6 A;  2AK5 A;  1UJY A;  1WHL A;  2YUN A;  2EGA A;  4KT0 E;  3ASK A;  4M7A A;  2GGR A;  3HHT B;  5FWC A;  3HTR A;  4BY6 C;  2CP6 A;  4FL6 A;  2EW3 A;  4PLI A;  2GNC A;  1X2K A;  4AFQ C;  1CKB A;  4XQ3 A;  1G3S A;  4LUD A;  3CD6 T;  2DD4 A;  4RKU E;  3X20 B;  3JCM Q;  1VQ4 A;  1W2B S;  1VUB A;  1VQN Q;  1VQ8 Q;  3LYI A;  1GCQ A;  2MOX A;  5FW9 A;  4HVV A;  2JM9 A;  2RPN A;  3VS3 A;  2KE9 A;  5KH6 A;  3SD4 A;  3DLL A;  1M30 A;  2E12 A;  1S72 A;  1W2B A;  4QKU A;  2OTJ T;  1JJ2 S;  5DY9 A;  5FRN A;  3GLX A;  1UGS B;  3P8D A;  5GAO n;  1QP2 A;  2DA9 A;  2FL7 A;  3OSS C;  1WX6 A;  4CC7 A;  5GAM d;  2L0A A;  3O8V A;  3SEM A;  3J80 E;  5AT1 B;  5GJV B;  3I56 T;  1EIF A;  1YHQ Q;  1D0Z A;  4C92 F;  1BBZ A;  3VS5 A;  2XD0 A;  2L3Q A;  5IHI A;  2AZV A;  3NMZ C;  1Q86 R;  1YI2 A;  2LCS A;  1ZUY A;  2H3E B;  4QVZ A;  2YRC A;  2DVJ A;  5HKC A;  4R55 A;  2F2X A;  1M4Z A;  3MCA B;  2DPP B;  1TUG B;  4M75 A;  4AFU C;  4Y28 E;  4GY5 A;  4M4Z A;  3JB9 F;  4EMH A;  3SFM A;  8ATC B;  2EQK A;  2GTO A;  2EWN A;  2QQB A;  2M1H A;  2LQW A;  3EHR A;  2XKO C;  2QAZ A;  4FT4 A;  2QDY B;  2KBT A;  1OI1 A;  4JS5 A;  2JMA A;  5FRM A;  2KRO A;  2DLP A;  4JRP A;  3CC2 Q;  5L8R E;  1UJ0 A;  5KCO A;  1VQP T;  1WA7 A;  2YWW A;  2COZ A;  2EPD A;  4M7D C;  4HCZ A;  2FB7 A;  2K5L A;  2KNB B;  2DIG A;  2OAW A;  2CP5 A;  4L59 A;  2H8H A;  3TSW A;  1OX9 A;  5GAN 4;  4M7D G;  3QBY A;  1ZA2 B;  5CO7 A;  2RHZ A;  5IH2 A;  1YJW Q;  3OYN A;  2KSS A;  1HSQ A;  3JCM W;  2QEX T;  2LQK A;  3VUB A;  1S72 T;  1UHC A;  2RB6 A;  1E6G A;  2QI2 A;  1VQ9 A;  1PHT A;  1BIB A;  2VGM A;  2CT4 A;  3SWN C;  2CDT A;  2EAY A;  4A4K A;  2VXE A;  3M5A A;  4JLG A;  1AWO A;  2BZY A;  1D1C A;  3SWN B;  2KR3 A;  2HBP A;  1QVG S;  1GBQ A;  2RJF A;  1ZSZ B;  2LT4 A;  1NYG A;  2DEQ A;  1YIJ T;  2YHT A;  2VYT A;  4CC3 A;  1GXI E;  1MMA A;  3JV3 A;  4KUD K;  1PM3 A;  3H9N A;  5HK0 A;  2VWF A;  4C92 C;  1Q7Y R;  5FU7 C;  4M75 D;  1YJ9 Q;  3G6E Q;  2LP5 A;  1K8A U;  2CT3 A;  2C0I A;  4M77 B;  3S3O A;  1ZLM A;  3C94 A;  3L42 A;  5A0G A;  2LQ8 A;  2VV5 A;  1U8R A;  3N5B B;  2E5K A;  1M1K R;  2JM8 A;  3JB9 I;  3G71 T;  4QQ6 A;  1EZZ B;  4C92 A;  3CCM Q;  1RLP C;  4C0Z A;  5GAM f;  2IIM A;  2MCN A;  2KDS A;  2CZ7 B;  2DTO A;  2QK0 A;  2DL3 A;  3I55 T;  2ENM A;  2KT8 A;  3CMA Q;  1YCS B;  2HQX A;  4Z8A A;  2LCC A;  3KUF A;  1PG5 B;  2ROT A;  2RHY A;  4JS4 A;  5CVI A;  1JXM A;  1YCY A;  4BDZ A;  4XU1 A;  2M0O A;  5CAI A;  1YIT Q;  3RIR A;  1NBE B;  4WF2 A;  3VS2 A;  4M77 G;  2NLU A;  2V8J A;  3EH2 A;  1Y96 A;  2WSF E;  1ZBX A;  3PNW C;  1RAE B;  4C5E A;  4FYW B;  5A0L A;  3NTH A;  5D6X A;  4M7D E;  2P0K A;  4PK4 A;  1WXT A;  2YRD A;  3RBB B;  1GCP A;  1I8F A;  3M4Y A;  2PVG B;  4PLL A;  1T0J A;  2X9H A;  3M0T A;  4PL6 A;  2CP7 A;  3MEU A;  4J5Y A;  2K3B A;  1QLY A;  1CKA A;  4Y91 A;  3ZBD A;  2K2M A;  4J6W A;  3CC4 A;  4OVA A;  3JCM c;  1N9S A;  1OZ3 A;  1M5Q 1;  2OTL A;  1VQ7 A;  3RMQ A;  2NUP B;  3QYH B;  3OYG A;  1Y71 A;  5DM7 R;  1NJI U;  3A8O B;  4C92 D;  1KQ1 A;  1BCO A;  3CCU T;  3OB9 A;  4XU0 A;  2CH4 A;  3VJP A;  1VOM A;  3G7Z A;  3V8K A;  1XOV A;  2CSQ A;  4BI3 A;  4PJJ A;  1W6X A;  4MZT A;  1TS9 A;  4HKE A;  2PU9 B;  1NLP C;  2O4X B;  2M16 A;  3PT9 A;  2V8K A;  3VS1 A;  4WTO B;  2QAS A;  1LNX A;  1Y57 A;  3EFO A;  4M78 E;  2QQS A;  1VQ6 A;  3JB9 G;  4E6R A;  1JQQ A;  5LJ5 h;  4LE9 A;  4VUB A;  1GFC A;  1MND A;  2E3I A;  2E3H A;  1FMV A;  2NYS A;  3UF4 A;  3CCQ T;  3ULR B;  4ZGD B;  2FRW A;  4M7A E;  3CXC P;  1PCX A;  2G6F X;  3H0F A;  3QUI A;  4J8O A;  1MHN A;  2CZ0 B;  3CCJ T;  4DEY A;  1RAF B;  4V2S A;  1RL2 A;  3M0S A;  4ZN1 A;  1IXD A;  1V1C A;  3MPU B;  3LWI A;  4EMK B;  2RJD A;  3QG1 A;  5LJ5 e;  4RTY A;  2QGG A;  2F1L A;  2CYZ B;  5IAY A;  5LJ3 g;  2M9U A;  3V8L A;  4E7H A;  1SSH A;  4OP0 A;  1Y0M A;  4IUR A;  4IUV A;  2KYB A;  3UWN A;  4OMN A;  3CCL Q;  1ZSZ A;  4RG2 A;  2JVV A;  4KGX B;  3OYI A;  4FIB A;  5IHN A;  1JO8 A;  3QJ6 A;  3RKY A;  2CH4 W;  1VYU A;  2LZ6 B;  1K0S A;  2E64 A;  3A8H B;  3OBW A;  3CPW S;  3V8J A;  2IPO B;  2EKO A;  3X24 B;  5GMK j;  4C0D C;  2I2L A;  5LJ3 h;  2VVK A;  4KUI A;  2LDM A;  1OUL A;  3E9F A;  2PNI A;  4OF1 A;  1PKS A;  2EQM A;  1NZ9 A;  3CQT A;  5IHK A;  3QZ9 B;  2DAQ A;  3EG9 A;  5GMK e;  2DTI A;  3JCM d;  3OYM A;  3CCS Q;  1KQS P;  4C8Q C;  2KI7 A;  4LDW A;  4B9W A;  2HEQ A;  1QVF A;  1YJN Q;  2HSP A;  2DX1 A;  1QW1 A;  5LJ3 e;  1QCN A;  1FX7 A;  3RKW A;  3MEV A;  4M77 D;  5IXF A;  2QA4 A;  1IRX A;  1K73 U;  2LQN A;  3JCM h;  1WI7 A;  1QVF S;  3CPW P;  3M59 A;  1T3L A;  3M9Q A;  3I35 A;  4Z88 A;  3EG9 B;  4ELZ C;  2HNI A;  5HK3 A;  4J9E A;  4J9B A;  3QZ5 B;  2MWP A;  3M58 A;  4E7J A;  3H6Z A;  1FMK A;  2DL4 A;  1X69 A;  2ZPE B;  2DD5 A;  1WXU A;  2KRN A;  2YLC A;  3NHN A;  4LDV A;  1M90 U;  4DOV A;  2OTL T;  2EGC A;  3CCR A;  5IT9 E;  3DLM A;  4MZM A;  1VQ6 Q;  4M78 B;  2HDA A;  1X2Q A;  4J9I A;  4HT8 A;  2DNU A;  1EX4 A;  1NG2 A;  4PKC C;  3CPW A;  5AYF A;  4FYV B;  3CCV T;  4X9D A;  1QKW A;  1R0B G;  1K1Z A;  4IUU A;  2BZ8 A;  1VQP A;  3CC7 Q;  3OYY A;  3JAM E;  3SDZ A;  3FEO A;  2RJC A;  2KAF A;  3M0U A;  1GBR A;  2QDL A;  2CZ6 B;  3CCV Q;  3WXM B;  2GF7 A;  3LLR A;  1I07 A;  2PUK B;  1M2V A;  1VIF A;  3X25 B;  2LJ3 A;  4AT1 B;  4OGC A;  4D6W A;  3C4S A;  2BE7 D;  4C92 G;  3X28 B;  1H64 1;  1ABO A;  1OU8 A;  3QJY A;  2FZK B;  1VQ7 Q;  2DIL A;  2EJG A;  1KD1 U;  1VQ4 Q;  1G5V A;  4FYX B;  1WHH A;  2YXY A;  3CCR T;  2VC8 A;  4PJO B;  2ZZD A;  2C0T A;  2KK4 A;  2K6D A;  1D1B A;  2ZPB B;  2P0P A;  2SRC A;  3HRS A;  4P5N A;  3L2W A;  3I55 A;  1IGQ A;  3REB B;  5GAO m;  4JRK A;  4Y92 A;  1VQK A;  2O9S A;  3OYD A;  3MO8 A;  2EYQ A;  4DA4 A;  1VQO Q;  4OMF B;  2QXF A;  4DBR A;  2EVR A;  2DEU A;  2O9V A;  1ZUU A;  1AT1 B;  5GJW B;  2L3P A;  1BI2 A;  3MEA A;  4M77 A;  1WHJ A;  4QVD A;  3QPH A;  1I4K 1;  3C0C A;  5FU6 C;  1TUD A;  3RR6 A;  4DOW A;  2GQI A;  5LJ5 g;  3IQL A;  3L2Q A;  2ZGW A;  2M51 A;  1W70 A;  4E47 A;  4OMM A;  3ZFJ A;  3VV0 A;  5I21 A;  1VQO T;  4NL2 A;  1SSF A;  1RUW A;  4J6Y A;  3M56 A;  4PJL A;  2QYZ A;  2E5Q A;  3JCM f;  3F70 A;  4OB3 B;  3UPU A;  2DE0 X;  2DTH A;  4J83 A;  6AT1 B;  2RK1 A;  4M78 A;  1WPY A;  4XTX A;  3JCM J;  2M02 A;  1TXQ A;  2JN0 A;  2X4Y A;  1UGQ B;  4JRI A;  4QVC A;  3QWY A;  3ER0 A;  2W0Z A;  2Z0W A;  1R8O B;  3HPW A;  4D8D A;  3I5S A;  3L2R A;  2FVU A;  1KIK A;  2RI3 A;  2O4X A;  3G6E A;  3AHU A;  3OA6 A;  1U3O A;  2LC4 A;  1LJO A;  2MIO A;  3OY9 A;  3KFV A;  3FDR A;  2HD0 A;  1AHJ B;  1OYX A;  2J06 A;  5FU6 B;  2X4J A;  2DBK A;  4M75 E;  1M2V B;  4ZTF A;  2MYS A;  2VAS A;  4C0F A;  2ZPI B;  3MP1 A;  2E4H A;  2RHX A;  2JOY A;  3H8Z A;  3RES A;  2K79 A;  2YUQ A;  5HY6 A;  2HAX A;  2EYW A;  2RI2 A;  4RTV A;  1GL5 A;  1KK7 A;  1ZBJ A;  1UG1 A;  4PJO F;  5I11 A;  2CUD A;  1D0X A;  2MPX C;  1OU9 A;  4KRT A;  1RLQ C;  2R5M A;  4JDS A;  2VXF A;  3GF5 A;  2E1H A;  5LJ3 j;  3EGD B;  4JJD A;  3BY7 A;  1VQ6 T;  3MHX A;  1Q86 C;  5L23 A;  4JZ4 A;  4M75 F;  5GAO r;  1OX8 A;  3R6O A;  1D1A A;  1MGQ A;  2KRS A;  3PGG A;  3EH1 A;  2QQ9 A;  1HK9 A;  3I5R A;  4Z89 A;  2DER A;  5CKB A;  5I2S A;  2K57 A;  2JTM A;  4M7D D;  3TVT A;  3OS0 A;  2E6Z A;  4F16 A;  4B9X A;  3DKM A;  1MUZ A;  2E6N A;  1H3H A;  1KD1 C;  1LOJ A;  1QCO A;  1GCQ C;  1UTI A;  4LD6 A;  3KBG A;  4XU3 A;  1G83 A;  3OYH A;  2GQV A;  4B6M A;  2LJ0 A;  4F7U E;  4OMP A;  1LPL A;  2QQA A;  3GNG A;  2Y4Y A;  5A0D A;  1KD1 R;  2Y90 A;  2EKH A;  1YJN T;  1YIT A;  2PTK A;  2FEI A;  3QDF A;  4IUQ A;  3CCS T;  3OSV A;  3A8G B;  1IB8 A;  3CC7 A;  1IRE B;  4OB2 B;  2ABL A;  2KQW A;  1OOT A;  1AWW A;  1K4U S;  1BI0 A;  4ORZ A;  1M27 C;  1AEY A;  1W2B P;  2JXB A;  3PFS A;  3A8M B;  4M7A D;  3JB9 H;  1OV3 A;  1IHW A;  3LWH A;  5LJ5 f;  4IKF A;  5GAO q;  4BD3 A;  4LNP A;  4OMO A;  3TQ7 P;  1BYM A;  3OYF A;  3E2U A;  3OYB A;  2GFU A;  2ZPF B;  4KH0 B;  2RM4 A;  2E65 A;  2NUZ A;  3CBM A;  4M7A B;  3CCL T;  1X6O A;  4L5G A;  3C95 A;  5J26 A;  1AZG B;  1R77 A;  3OYC A;  4FW1 A;  3ZEH A;  2EJF A;  2HQH A;  3OS5 A;  4ZGJ B;  1M8V A;  2JNG A;  2DM1 A;  3REA B;  3PE0 A;  5GAN 7;  3RDV A;  3OW2 A;  2RQU A;  3GPL A;  2JTF A;  2DYB A;  5KE2 A;  5CCA A;  1UGP B;  4PNO A;  3CD6 A;  1QQJ A;  1X6G A;  3CCJ Q;  2RN8 A;  1M3A A;  1VA7 A;  2EQU A;  4C0G A;  1VQO A;  3OS1 A;  5EG2 A;  4M77 C;  5CKH A;  5KYY B;  2CKK A;  3CCQ Q;  1G2B A;  1VIE A;  4KH1 B;  1SF9 A;  2V1Q A;  1D0Y A;  3OYA A;  5CQX A;  3JCM P;  1C6V X;  3O5Z A;  3VKI A;  3BDL A;  1KFZ A;  4F17 A;  4R0K A;  1B7T A;  1GRI A;  4PJO G;  1WHM A;  1SG5 A;  3A5Z B;  4F7U A;  3SHW A;  2B86 A;  1ARK A;  2L8D A;  5KYX B;  2RH2 A;  3MP6 A;  1K76 A;  2COW A;  2RD1 A;  1XJW B;  3JB9 D;  4D8K A;  1PD1 A;  2I0N A;  2P4R A;  1WNL A;  3CCM A;  1M9S A;  3OW2 P;  3VU3 C;  3SWN A;  1M3B A;  5KYU A;  3LW5 E;  1SRM A;  2BKD N;  1YJW T;  2PQW A;  2LRQ A;  2L5Q A;  2L89 A;  2XDD A;  4RUG A;  2RK2 A;  4A4G A;  2X4W A;  2CZ1 B;  5FU7 B;  5GAN g;  3CC2 T;  2FYK A;  4PJN A;  3NTI A;  1QKX A;  2GBQ A;  5LJ3 d;  4M7D A;  5CKF A;  2FPF A;  5GAN 6;  3BDU A;  1ZQ1 A;  1YHQ A;  5GAN 2;  1KC8 U;  5LJ5 j;  4LD9 K;  1BK2 A;  2C0O A;  1KQ2 A;  4F7U G;  2COY A;  4FW2 A;  1WQ7 A;  1Z9Z A;  3EAE A;  1I0C A;  4OB0 B;  1PWT A;  1IO6 A;  3CBO A;  5GAM g;  1MV0 B;  5GMK h;  2WSE E;  1UEC A;  3TU4 K;  1VQ5 A;  1VQ4 T;  2WSC E;  2RQW A;  2MWO A;  3MKD A;  2K5F A;  5KCH A;  1I1J A;  4BUG A;  4BE1 A;  4M75 C;  3LH0 A;  1AWX A;  1JBM A;  3P8B B;  2ATC B;  2D0Q B;  3L1A A;  1GFD A;  4J9G A;  4UC4 A;  2VKN A;  3FIF A;  2P0Q A;  4FT2 A;  1YFN A;  2RO0 A;  1M3C A;  4JUV A;  1UE9 A;  1WJQ A;  1G3Y A;  3OMG A;  1NE8 A;  1QWE A;  1TH7 A;  2CS7 A;  1N6A A;  2QG9 B;  4JJN K;  1YWP A;  3ME9 A;  3CCS A;  3CCM T;  1MNE A;  1H3Z A;  2NUT A;  3CCL A;  4BB7 A;  1YNZ A;  4JRQ A; 
#chains in the Genus database with same CATH homology
 3M0U A;  1GBR A;  3M0R A;  2QDL A;  3EG2 A;  2DA9 A;  1WYX A;  1WX6 A;  4CC7 A;  2L0A A;  3VS4 A;  1NM7 A;  2ED0 A;  1I07 A;  2KXC A;  3SEM A;  2LJ3 A;  3RNJ A;  5GJV B;  4CC2 A;  1NLO C;  3VS7 A;  3LH5 A;  1BBZ A;  3VS5 A;  2L3Q A;  3UA7 A;  5IHI A;  1ABO A;  4GBQ A;  4FSS A;  2AZV A;  3NMZ C;  3EG0 A;  2LCS A;  1ZUY A;  2DVJ A;  2DIL A;  4ESR A;  5I22 A;  2F2X A;  2OI3 A;  4AFU C;  1H92 A;  1X27 A;  4M4Z A;  2C0T A;  2J6K A;  4IIO A;  1K0X A;  2K6D A;  1B07 A;  5IXB A;  4DEX A;  2SRC A;  2GTO A;  3H0H A;  1VYT A;  2LQW A;  2DL5 A;  3EHR A;  1LCK A;  4RTT A;  1S1N A;  3REB B;  4Y92 A;  2O9S A;  2FPE A;  2KBT A;  3UAT A;  2D8J A;  4RTX A;  2JMA A;  3NGP A;  3GBQ A;  2KRO A;  2DLP A;  1J3T A;  1UJ0 A;  2EVR A;  1WA7 A;  2FG0 A;  1E6H A;  1JXO A;  4A63 B;  2O9V A;  1ZUU A;  2EPD A;  1WFW A;  2L3P A;  5GJW B;  2J6F A;  2KNB B;  3QWX X;  2OAW A;  1VYV A;  2H8H A;  3TSW A;  1PRL C;  4HCK A;  3C0C A;  1TUD A;  2CRE A;  3VRY A;  2GQI A;  2OJ2 A;  2EGE A;  2YDL A;  3IQL A;  5IH2 A;  4ZNX A;  1HSQ A;  2RNA A;  1OPK A;  2M51 A;  1W70 A;  2RQV A;  4OMM A;  1TUC A;  1NEB A;  2FO0 A;  2NWM A;  1RUW A;  1UHC A;  2K7A A;  1E6G A;  1HJD A;  1WDX A;  1PHT A;  4JZ3 A;  1JEG A;  2CT4 A;  5ECA A;  2CDT A;  2DE0 X;  2JS2 A;  2PZ1 A;  2YUP A;  1AD5 A;  1AWO A;  2JMC A;  2BZY A;  2GTJ A;  2KR3 A;  2DL8 A;  1GBQ A;  3QWY A;  2KYM A;  2W0Z A;  4D8D A;  1NYG A;  3I5S A;  3ZL7 C;  4CC3 A;  1AZE A;  1KIK A;  3JV3 A;  2KEA A;  2X3X D;  2VWF A;  1U3O A;  1BU1 A;  2MIO A;  2LP5 A;  3KFV A;  4LUE A;  2CT3 A;  2C0I A;  1BB9 A;  1EFN A;  2J06 A;  2DBK A;  2ED1 A;  1HD3 A;  2HBW A;  4AG1 C;  1ZLM A;  2DMO A;  2KT1 A;  1NEG A;  2L3S A;  2K79 A;  2YUQ A;  2E5K A;  2EYW A;  3EHQ A;  4RTV A;  2JM8 A;  3THK A;  1GL5 A;  1ZBJ A;  1YN8 A;  1UG1 A;  5I11 A;  1YWO A;  2CUD A;  4JJC A;  1RLP C;  1UUE A;  2IIM A;  1K9A A;  2MCN A;  2DL3 A;  4KRT A;  2ENM A;  1T0H A;  1RLQ C;  2KT8 A;  2AZS A;  3VRZ A;  1UGV A;  1YCS B;  4Z8A A;  4JJD A;  2A28 A;  4K11 A;  1WLP B;  2ROT A;  3EG1 A;  2J6O A;  1QCF A;  5L23 A;  1JXM A;  2K9G A;  4JZ4 A;  2HCK A;  1X6B A;  1NYF A;  2KRS A;  4HXJ A;  3I5R A;  1UHF A;  4Z89 A;  3VS2 A;  1U06 A;  1PRM C;  3TVT A;  1KSW A;  3H0I A;  4EIK A;  4F16 A;  2KXD A;  1E7O A;  1MUZ A;  2EYY A;  4HVU A;  2O31 A;  2M0Y A;  3U23 A;  2J7I A;  1H3H A;  1GCQ C;  1WXT A;  1SHF A;  3RBB B;  1UTI A;  1GCP A;  4JPB W;  1G83 A;  2LJ0 A;  4OMP A;  1T0J A;  2EKH A;  2DJQ A;  2PTK A;  2FEI A;  4J9H A;  3EG3 A;  1W1F A;  3M0T A;  2A37 A;  2K3B A;  1OEB A;  1QLY A;  2D1X A;  1CKA A;  2K2M A;  2ABL A;  2YSQ A;  1OOT A;  1AWW A;  1K4U S;  2V1R A;  4ORZ A;  1M27 C;  4RTU A;  3R6N A;  4J9D A;  1AEY A;  2JXB A;  1SHG A;  2JT4 A;  1OV3 A;  2RQT A;  1UFF A;  2D0N A;  2AKK A;  2FPD A;  2FRY A;  4RTZ A;  3EGU A;  4LNP A;  2EYX A;  4OMO A;  4HVW A;  1AVZ C;  2NUZ A;  2CH4 A;  5EC7 A;  1XOV A;  1WXB A;  2DF6 A;  2CSQ A;  1A0N B;  1AZG B;  3PVL A;  1W6X A;  2JW4 A;  4LN2 A;  1B3Q A;  1NLP C;  3VS0 A;  4QT7 A;  2DM1 A;  3REA B;  3VS1 A;  2YUO A;  1Y57 A;  3PE0 A;  2AKL A;  2DBM A;  1ZX6 A;  2A36 A;  2RQU A;  4E6R A;  1JQQ A;  2KRM A;  2DYB A;  2KGT A;  4LE9 A;  2XMF A;  1GFC A;  3UF4 A;  1X6G A;  5FWB A;  4CC4 B;  3ULR B;  2FRW A;  2RN8 A;  1M3A A;  1VA7 A;  3I9Q A;  2G6F X;  3H0F A;  1SPK A;  2DL7 A;  3M0P A;  2RQR A;  1G2B A;  1X43 A;  4DEY A;  1TG0 A;  3M0S A;  2V1Q A;  1V1C A;  4J9C A;  2JTE A;  2ESW A;  2X3W D;  3O5Z A;  1KFZ A;  2A08 A;  4RTY A;  4F17 A;  1T3S A;  4R0K A;  1GRI A;  1SSH A;  3SHW A;  2B86 A;  1ARK A;  1Y0M A;  2W10 A;  4J9F A;  1PNJ A;  4AG2 C;  1K76 A;  2DRK A;  2J05 A;  2KYB A;  2BTT A;  2EYZ A;  4OMN A;  4D8K A;  2I0N A;  2P4R A;  5IHN A;  1FYN A;  1JO8 A;  2EQI A;  2CH4 W;  4WCI A;  1VYU A;  4AFZ C;  2LZ6 B;  1KJW A;  4GLM A;  1M3B A;  2LMJ A;  1K0S A;  1M8M A;  1SRM A;  2L2P A;  4IIM A;  4F14 A;  1YP5 A;  1MV3 A;  1QWF A;  2VVK A;  2ROL A;  2CSI A;  1Z9Q A;  2LX7 A;  2PNI A;  4JJB A;  1SRL A;  4RUG A;  1PKS A;  2D8H A;  1WIE A;  1AWJ A;  3CQT A;  5IHK A;  2F2V A;  2LJ1 A;  1ZSG A;  2CUB A;  3FJ5 A;  3UA6 A;  1QKX A;  2LNH B;  2GBQ A;  3H41 A;  2HEQ A;  3TSZ A;  2O88 A;  1CSK A;  4OMQ A;  2FPF A;  5HCK A;  2ECZ A;  2DX1 A;  2HSP A;  4AFS C;  1SEM A;  1ABQ A;  1U5S A;  3VS6 A;  1BK2 A;  4OML A;  2C0O A;  3PVQ A;  2YT6 A;  2AK5 A;  3A98 A;  1UJY A;  1UDL A;  1OPL A;  1Z9Z A;  2YUN A;  5IXF A;  2EGA A;  1I0C A;  4RTW A;  1ZUK A;  1PWT A;  1IO6 A;  2LQN A;  1MV0 B;  2RF0 A;  1WI7 A;  2GGR A;  1T3L A;  2RMO A;  1UEC A;  2BZX A;  3I35 A;  5FWC A;  4Z88 A;  4J9E A;  2EW3 A;  2RQW A;  4J9B A;  1N5Z A;  1I1J A;  2GNC A;  1RI9 A;  1X2K A;  1AWX A;  4AFQ C;  1FMK A;  1CKB A;  2DL4 A;  1GFD A;  1X69 A;  4J9G A;  1JU5 C;  2DRM A;  1WXU A;  2VKN A;  4X1V A;  2KRN A;  4LUD A;  3NHN A;  1M3C A;  2EGC A;  1UE9 A;  1H8K A;  1PKT A;  2JS0 A;  1GCQ A;  2HDA A;  1X2Q A;  2MOX A;  4J9I A;  5FW9 A;  2DNU A;  1NG2 A;  4HVV A;  1QWE A;  2F2W A;  2O2O A;  2JM9 A;  2RPN A;  3VS3 A;  1QKW A;  2KE9 A;  2SEM A;  1YWP A;  1K1Z A;  3NPF A;  1AOJ A;  3M0Q A;  2EBP A;  1M30 A;  2BZ8 A;  1YNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...