4AG2C

Human chymase - fynomer complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
VTLFVALYDYNATRWTDLSFHKGEKFQILDGDSGDWWEARSLTTGETGYIPSNYVAPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMASE
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/de novo protein
total genus 11
structure length 58
sequence length 58
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4ag2C00
5GJVB 1UGVA 1AWOA 3EHQA 2A08A 1WXBA 1NM7A 4A63B 1GFDA 1U06A 1YWPA 3LH5A 2HSPA 1M27C 2LQWA 1JO8A 2OAWA 2FG0A 2LZ6B 1T3LA 4M4ZA 2ED0A 2HEQA 1ZUUA 2CDTA 4KRTA 2W10A 1X2QA 1U5SA 3GBQA 2K9GA 1YN8A 1OEBA 2C0OA 1T3SA 3M0UA 2AKLA 4R0KA 3PE0A 1N5ZA 4F14A 4JZ3A 1BK2A 5IHIA 5L23A 2KR3A 3SEMA 3NPFA 1WA7A 2RNAA 2GGRA 4J9BA 1TUDA 4LE9A 3PVLA 4J9FA 3ULRB 4X1VA 1ZUKA 2YUNA 1W1FA 2ROLA 2JMAA 2O2OA 2IIMA 1X6GA 2LJ1A 1QKXA 2O9SA 1GRIA 4DEXA 2OI3A 2VVKA 1MV3A 2DL5A 2L3SA 2YDLA 2LMJA 5I22A 3TVTA 5FWBA 3UATA 1ZBJA 4ESRA 1U3OA 2CUBA 3VS0A 4RTTA 1K1ZA 3KFVA 1WLPB 2AZSA 2EYXA 3JV3A 2LP5A 3O5ZA 1SSHA 3NHNA 2M0YA 2KEAA 2F2XA 2L3QA 4K11A 1E6HA 2EQIA 1CKAA 2BZYA 1I1JA 1WFWA 2AK5A 2D0NA 2HDAA 2ROTA 1UG1A 3UF4A 1RLPC 2GQIA 1YCSB 2VKNA 1AWXA 1K76A 1QWEA 2B86A 4OMMA 4OMNA 1SEMA 4D8DA 2KXDA 2I0NA 1X2KA 2RQTA 1XOVA 1SHGA 1GBQA 2O88A 1TUCA 2AKKA 1CKBA 2CH4W 1HSQA 4HCKA 1Z9QA 4F16A 1W6XA 2PNIA 2YUOA 3VS7A 2KRSA 4LNPA 4J9EA 2FO0A 4HVWA 2DYBA 2F2WA 2YSQA 1Y57A 1PRLC 4GBQA 4OMOA 1AZGB 3ZL7C 2MIOA 1M8MA 1AD5A 2JM9A 2KGTA 2JXBA 3C0CA 1Y0MA 2JTEA 1PWTA 3SHWA 2G6FX 3M0TA 2DBKA 1E7OA 2D8JA 3TSWA 2EGCA 2M51A 2CT4A 2J6KA 2D8HA 2YUQA 2L0AA 4CC7A 2KNBB 2W0ZA 4OMPA 1MUZA 1HD3A 1K0SA 1UJ0A 1Z9ZA 2O9VA 3RNJA 1BU1A 2GBQA 2BTTA 4IIMA 1OPKA 1SPKA 2MOXA 5IH2A 1V1CA 3I35A 2CREA 1M3AA 2EGEA 2HCKA 2J6OA 4LUDA 1B3QA 4RTYA 2DL8A 1ZX6A 2EYWA 5I11A 4ORZA 2RQWA 2YUPA 4J9GA 1NEGA 2JT4A 2KYBA 2SEMA 4LUEA 3REBB 1J3TA 2FPEA 5EC7A 2SRCA 4CC3A 4CC4B 1AOJA 5HCKA 2KRMA 3H0FA 2JM8A 1JXOA 1UDLA 2FRYA 1PKSA 2X3XD 1NLOC 3VS1A 1K4US 4CC2A 4OMLA 4F17A 1HJDA 1I07A 3EG3A 1ZUYA 3M0PA 1UTIA 2DRKA 3EG2A 3RBBB 5IXFA 3EHRA 1JU5C 1X27A 2NWMA 1B07A 2X3WD 2GNCA 2AZVA 2DX1A 3QWXX 2DF6A 2LJ3A 1UFFA 4DEYA 1K0XA 2V1RA 4Z89A 1WX6A 1QKWA 2QDLA 1A0NB 1SHFA 1UECA 3EGUA 2O31A 4RUGA 3I9QA 4AFZC 3VS4A 2KROA 2LJ0A 2DA9A 3H0HA 1FMKA 2LNHB 4RTXA 5GJWB 3EG1A 2RPNA 1QWFA 3CQTA 4Z88A 1K9AA 1UUEA 2RQVA 1FYNA 4AG1C 2DBMA 1M3CA 2DJQA 2OJ2A 1VA7A 2A28A 3UA7A 4JJCA 3REAB 2DRMA 2CT3A 2KXCA 4E6RA 4Y92A 1PRMC 1GFCA 3FJ5A 2K6DA 1PHTA 3M0SA 1UE9A 1KJWA 1UHCA 2EYZA 1UJYA 2RMOA 3M0QA 2JMCA 3I5SA 3THKA 1RLQC 2EGAA 1MV0B 4HXJA 3VRZA 4QT7A 4GLMA 1T0JA 4ZNXA 4JZ4A 4J9HA 1LCKA 1M30A 2CH4A 1OOTA 2DM1A 4EIKA 4JJBA 1W70A 3NMZC 1X69A 4AFUC 1CSKA 2FEIA 2J06A 1IO6A 1WI7A 2J05A 1GCQC 1I0CA 1PNJA 4RTZA 1JXMA 2K7AA 1RI9A 4WCIA 1E6GA 1YNZA 5FW9A 2CUDA 4RTUA 3QWYA 2KBTA 1SRMA 2KE9A 1KFZA 3VS6A 3UA6A 5FWCA 2PZ1A 2FPDA 2P4RA 4J9IA 1AWJA 3VRYA 1WDXA 2LX7A 2DMOA 3VS3A 2PTKA 2EVRA 1PKTA 2ED1A 3VS2A 2NUZA 1WXUA 1WXTA 2ESWA 3U23A 3R6NA 1G2BA 1G83A 2E5KA 1KSWA 1VYVA 1AWWA 2KT8A 4OMQA 2D1XA 2ECZA 2RQRA 2H8HA 1BBZA 3IQLA 1AVZC 2F2VA 3VS5A 2EW3A 2DILA 4LN2A 4IIOA 2C0TA 2DL7A 2KT1A 3NGPA 2A37A 5ECAA 3TSZA 3A98A 2L2PA 2EBPA 2LQNA 2DVJA 1ABOA 1ZLMA 2V1QA 1H3HA 4J9CA 1SRLA 2XMFA 2GTJA 3H41A 2YT6A 5IXBA 1H8KA 1ABQA 3EG0A 1VYUA 1GL5A 2KRNA 4RTVA 4J9DA 2DNUA 2GTOA 1TG0A 1X6BA 2C0IA 2J7IA 1GBRA 2J6FA 1WYXA 1WIEA 4JJDA 3I5RA 5IHNA 4AFSC 1AEYA 2LCSA 2A36A 1RUWA 1NLPC 1NYGA 2DL3A 1AZEA 2CSIA 2K2MA 2JS2A 1NYFA 1S1NA 2VWFA 4FSSA 2ENMA 2DL4A 1ZSGA 4JPBW 2BZ8A 2FPFA 2MCNA 2JW4A 1EFNA 2K3BA 1H92A 2RN8A 2FRWA 2L3PA 1QLYA 2CSQA 1JQQA 1UHFA 1OV3A 2JS0A 2DLPA 4D8KA 1OPLA 1YP5A 4HVUA 2BZXA 2EYYA 3H0IA 1KIKA 3PVQA 1T0HA 2HBWA 3M0RA 2EPDA 1GCQA 2RQUA 1NG2A 2RF0A 4RTWA 1YWOA 1X43A 1GCPA 1VYTA 4Z8AA 1ARKA 1JEGA 5IHKA 2EKHA 4AG2C 2KYMA 1BB9A 2K79A 1NEBA 2ABLA 1QCFA 2DE0X 4AFQC 4HVVA 1M3BA
chains in the Genus database with same CATH superfamily
1UGVA 1AWOA 3GIBA 3OA6A 1YHQQ 1U06A 5GAN8 3PFSA 1KQSA 2HSPA 1M27C 4BD3A 2LQWA 3DLLA 3M4GA 3KUFA 1D1CA 2WSEE 1VQ6Q 4E47A 1N9RA 2ED0A 3DB4A 5HK0A 4IKFA 1M90C 2K9GA 1YN8A 1T3SA 3M0UA 4R0KA 4M75C 2E64A 3OMCA 5L23A 2PVGB 4C8QB 1NE8A 4J9BA 1TUDA 4ELZC 1TOVA 1BI1A 4R56A 2RB6A 3OS5A 1Y96B 3JAME 4F7UE 2ROLA 2JMAA 2IIMA 2MYSA 1X6GA 1QKXA 2O9SA 1Q81R 1QCOA 2YXYA 2FHDA 1WQ7A 3NTHA 2DL5A 2L3SA 2EQUA 4C5IA 2JZ2A 1M4ZA 1N6AA 1VQPA 3UATA 4ESRA 1QVGS 1TXQA 2CUBA 2EYQA 1K1ZA 2CGHA 4BY6C 2EYXA 4M78A 2DAQA 2M0YA 2DERA 2MAMA 4BDZA 1R77A 5LJ3h 1YITT 3SD4A 1HK9A 3HHTB 2EQIA 2BZYA 4C92E 1GXIE 3CEYA 2AK5A 4PJOF 1IXDA 2HDAA 2HKQB 1P92A 2BKDN 3QBYA 1YCSB 4M7AA 2VKNA 2XG8D 2B86A 4OMNA 3RKYA 1M2VB 3GNFB 1B34B 2E10A 1YIJA 1WHMA 4LXCA 1GBQA 4VUBA 4HCKA 4BUGA 1BKBA 3S3OA 2MPXC 1U1SA 2F5TX 2ZPBB 3VS7A 5GAOl 5L8RE 1Y57A 2FVUA 2E3IA 1TWBA 2KGTA 2JXBA 1BCOA 1Y0MA 2XIDA 4KGZB 3BY7A 1NJIU 1VQ4A 5GANf 2CT4A 2KAFA 1K73U 2L0AA 5FU6C 4FIBA 3EGDA 1Q82R 1K0SA 3V8JA 5LL6S 1UJ0A 1Z9ZA 2O9VA 2LQKA 2XKOC 2GBQA 2VXEA 3LWHA 2QEXT 2MOXA 2LVMA 5KYUA 1Q86R 4RTYA 2DL8A 2OX7A 4ORZA 1ZSZC 4PLLA 1VQLA 4J9GA 1NEGA 1M9SA 1N8RC 4M75B 3RDVA 2M9UA 1YJ9T 1VQNA 1AOJA 4KT0E 2NUTB 3H0FA 1UDLA 3E9GA 1PKSA 2X3XD 1VQPQ 1VQ7T 4CC2A 1VQ9A 4F7UA 3CCRA 5GAOq 3X24B 2YWWA 4M77G 2E4HA 3OB9A 2IVWA 1JU5C 2EAYA 2DF6A 4A4FA 4DA4A 2LJ3A 4HCZA 4DEYA 3QDFA 3CCVA 5CO7A 2HNIA 1KD1U 3V7CA 1UGQB 1M1KR 1SHFA 2O31A 3QPHA 2DXCA 2QAZA 1RAIB 2DA9A 3H0HA 3G6ET 5GAMj 4BY6B 1FMKA 3V8KA 1FMVA 4M7DA 4C5GA 2RQVA 4A4EA 1K9MC 3CCJA 2DBMA 5GMKj 2QXFA 5LJ3g 1C6VX 3PIPA 2A28A 2HD0A 1YIJQ 3JCMW 3REAB 3M59A 3L2ZA 1KQ2A 4BE2A 3FJ5A 1PHTA 1KJWA 2EYZA 1MMGA 2JMCA 3THKA 1RLQC 2OAUA 1PG5B 4BI8B 4QT7A 2XHCA 2NYSA 3G71A 5FROA 3QZ9B 4JZ4A 5LJ5j 1M30A 1Y71A 3OYKA 1W70A 3NMZC 1X69A 4V2SA 3FIFA 2J06A 4XQ3A 3JB9D 1SKUB 1I0CA 3EH2A 2K7AA 1G5VA 4WCIA 1ZBXA 4C0FA 3ZBDA 2CUDA 3TREA 3OYCA 2KBTA 4PJNA 4QQGA 5FWCA 2PZ1A 1YI2T 1UGSB 3OYNA 4J9IA 4HCBA 1B7TA 3BDUA 1Y96A 4XTZA 2PTKA 5C6SA 1PSEA 1YJWT 2M16A 4XU2A 5FU6B 2NUZA 1VQLQ 2OTJT 1WXTA 3CCMT 2O4XA 4DOWA 4LDWA 3QIIA 3INZA 1VQNQ 4C8QD 1G2BA 2E5KA 2KT8A 4OMQA 3RIRA 1BBZA 3IQLA 4B9XA 1VQ9Q 1IRXA 3CCRQ 5J26A 2A37A 2A7YA 2L2PA 3CCLA 1BI3A 4HCCA 1ABOA 1ZLMA 2V1QA 5GANd 1ZSZB 3JCMg 1G3YA 2K5IA 2PVDB 1R8OB 2KRNA 4J9DA 2DNUA 2V8JA 5GANe 1VQMT 3OMGA 3CCVQ 2NLUA 1K8AR 4M77E 2XDDA 2J7IA 1WYXA 1WIEA 4OF1A 3OYIA 1AEYA 2LCSA 1K73C 4JS5A 1NLPC 1NYGA 3OYJA 3CCJQ 1PM3A 4AMCA 4EPCA 4OB2B 2K2MA 1NYFA 2VWFA 2K5FA 3SWNA 3PIOA 4N0AA 1ZSGA 2FPFA 3EG9A 2MCNA 3RUXA 2KVQG 2QEXA 3CXCP 3EFSA 3OBYA 2CSQA 1JQQA 3JRZA 3OW2A 1N27A 1QVGP 1Q81U 5GAN6 8AT1B 2BZXA 2EYYA 2XK0A 3EGXA 2HBWA 1IHWA 4XU3A 1YJNT 3ER0A 4JRKA 1WNLA 2FZCB 3TCJA 2X35A 1GCQA 1NZ9A 3NTIA 4X34A 3CD6A 1FXXA 1I81A 1GCPA 1KQSP 1ARKA 3OQ5A 2DVEA 2HKNA 4IURA 4PJOC 3PT9A 2K57A 4D6WA 3JCMX 4E7KA 2ABLA 2K79A 4MZPA 4BDYA 1MMDA 4FT4A 2YRVA 2CP5A 2PU9B 3ME9A 2RO0A 1M3BA 5GJVB 4OB0B 2A08A 4ZGDB 1NM7A 4BACA 1GFDA 1KD1C 2FL7A 2LT4A 2LQ8A 1VQ5A 5I2MA 3H8ZA 1JO8A 2X51A 1G3WA 3HSBA 1WHGA 3CC7T 2LRQA 3LGFA 2CDTA 4KRTA 2CP2A 3GBQA 4ZTJA 3NFCA 3PE0A 4JLIA 4OB1B 2AHJB 2L3RA 4JZ3A 4F14A 4RCBA 3CCLQ 1VQOA 2LNVA 5GMKe 4FT2A 4M75D 2BE9B 4MZTA 3KXTA 1BIBA 1KK7A 2GGRA 5IN1A 1NPRA 3OW2S 2DD5A 4FM4B 4LE9A 3CC2A 3PVLA 4QVCA 3UWNA 2E65A 4XTYA 3ULRB 2ZGWA 4IUVA 2YUNA 2VYTA 2D6FA 1GRIA 4DEXA 4OGCA 1MV3A 4N4GA 3S6WA 3DB3A 3ZEHA 1QVFP 1ZBJA 2EWNA 2OTLT 5FRNA 4M77A 3OYBA 4M78F 1U3OA 3SDZA 3VS0A 4RTTA 1WLPB 2LP5A 3CCUT 1Q86U 3CCQT 3T9NA 3NHNA 2QEXQ 3MHXA 4JJNK 4F04B 1I1JA 1D1BA 4M7AF 2D0NA 1O75A 3UF4A 1RLPC 2GQIA 5GANh 3JB9G 2MI6A 1K76A 1LJOA 1M5Q1 2NUPA 2E70A 3CD6Q 2I0NA 1XTDA 4WF2A 4IUQA 4DBHA 2PVOB 5KYYA 4DQ2A 3FJPA 1TS9A 1RAHB 1IB8A 4AT1B 2LTOA 2Y90A 3RKXA 2AKKA 3V8LA 4L6V5 4PFZA 3CPWP 1M1KU 3HRSA 4XK8E 2EJ9A 1R0BG 1VQ5Q 2QQAA 4C8QG 2F2WA 4GBQA 5KE3A 4PJOB 1AZGB 3ZL7C 3LLRA 2MIOA 1M8MA 5KYWB 3CPFA 1FWZA 2JM9A 1KQ1A 5CKDA 4O5VA 3C0CA 3SHWA 3BDLA 2ATCB 3M0TA 4E7IA 2DBKA 1E7OA 3LH0A 3I56T 2EGCA 1Y7XA 2KK4A 4LDUA 2JJ9A 2F5KA 3X28B 1D3BA 4CC7A 4HA8A 1IGQA 4OGEA 1MUZA 2VASA 3G4ST 2DYIA 3H9NA 1VQOQ 1VIFA 3OY9A 2XDBA 4IIMA 5IH2A 1EIFA 4PJJA 3CC2Q 2EGEA 3A8OB 3CCEA 3OSSC 1ZX6A 2EYWA 2MWOA 2QQBA 3M53A 2YUPA 1KG1A 2H3JA 2KYBA 1IZ6A 1XQHA 3REBB 1YJNA 3A8GB 4J83A 2R5AA 5EC7A 2SRCA 1UGRB 4CC3A 4CC4B 2EFIA 4F7UF 2QK0A 3VS1A 1NLOC 2QQSA 4F17A 2KMTA 5A0DA 1I07A 3PGGA 2X9HA 5DY9A 1M90R 2HQEA 1RABB 2GNCA 3QWXX 2JN0A 5GMKh 1K0XA 3P8HA 1W4SA 3M58A 3AHUA 1WX6A 3L2VA 1UECA 1Q7YU 3EGUA 3CCST 4AFZC 1SSFA 4M7DF 4A4HA 3JCMQ 1IGUA 5DLQE 2KDSA 1NBEB 2FB7A 4Z88A 3M4YA 1UUEA 4AG1C 3C12A 1VA7A 2DEUA 4JJCA 2VC8A 4PJOE 4E6RA 3UPUA 3CC4T 1PRMC 1RI0A 5GAOp 1K8AU 3L1AA 1UE9A 2EKOA 4FL6A 1UJYA 1MGQA 3M0QA 4J6YA 4RG8A 1XJWB 5A0GA 1WPYA 3C4SA 2QA4T 4EIKA 4AFUC 5GAN5 1VQKT 1IO6A 2PQWA 4C8QE 4M7AD 4RTZA 2C06A 4M75G 2XDPA 1E6GA 1YFNA 4PJMA 1YNZA 2XICA 1SRMA 2KE9A 1TTHB 2V8IA 4XTVA 4FCYA 2FPDA 3OYYA 2P4RA 5KYXA 4LDYA 3WVDB 4E7SA 3CCEQ 2LX7A 2VB6A 3PMTA 1JJ2P 4E7HA 3EH1A 2ED1A 1WXUA 2WACA 2ESWA 1YJNQ 3HRUA 3R6NA 1G83A 4EMGA 1AWWA 2DO3A 4FW1A 2DETA 2RQRA 4ELYC 2F2VA 2EW3A 1W2BP 4IIOA 1UEBA 2DL7A 2CZ1B 1RAGB 3HL8A 3A98A 2LQNA 2DVJA 3LW5E 4J9CA 2I2LA 1F1BB 2GTJA 3H41A 3D7SB 1GL5A 4RTVA 1IHVA 1NPPA 4J6XA 5GAOn 2QI2A 3VUBA 1X6BA 4QVZA 3QG1A 2C0IA 5GAN2 1S72T 1XNIA 4QVDA 2L89A 2K2VA 1ZHIA 5FRMA 3GLXA 5I2SA 3RMQA 2L5QA 1MHNA 2DK3A 5KH6A 4EMKA 1QP3A 1WJSA 3OW2P 4OB3B 5D7UA 2ZPFB 3NTKA 3HTRA 3OBWA 1RAAB 4FSSA 4PJLA 4PKCC 4N4IA 4ANJA 4FYWB 4J5YA 3ASKA 2DL4A 1V76A 2BZ8A 2F1LA 4C92A 3C95A 1YHQT 2JW4A 4B6MA 1EFNA 4WTOB 2A3LA 2LC4A 4XU0A 2H3EB 1KC8U 2WSCE 4M78C 1YP5A 4HVUA 1G3TA 4X9CA 4A53A 5GAMf 1VQ6T 3M0RA 2EPDA 4ZTFA 1C1AA 2RQUA 2RF0A 2CP6A 4RTWA 1YWOA 5LJ3j 4Z8AA 2LCCA 5GAN4 2EKHA 3QUIA 4M7AC 2OTLQ 3MKDA 1G8XA 1FMWA 5FU7C 1K9MR 4M7DD 1BB9A 1OULA 1NEBA 4AFQC 4PJOD 5CQYA 5GAN3 1TH7A 2LDMA 3EHQA 1WXBA 4M75E 4C8QA 1LOJA 5DM7R 3L2UA 4A63B 2E41A 1YWPA 4QQDA 1Q7YC 3LH5A 5LJ5f 3L2WA 5CR2A 2WSFE 2XI9A 5KYNA 3CCSA 1YITA 4HT8A 2CYZB 3G7ZA 3GPLA 5CKBA 3PMIA 4M4ZA 3MP1A 2CP0A 2V26A 2HEQA 1X2QA 1U5SA 2RM4A 4J7FA 2KI7A 1R0CB 1OEBA 3RMSA 1N5ZA 2KR3A 1K8AC 2KQWA 3SEMA 2RHZA 4E2FB 9ATCB 3CC4A 2RNAA 5CIUA 2CP3A 3X26B 4RKUE 2QQ9A 4BI3A 2M02A 4XTUA 1PSFA 4J9FA 3URGA 2ZPEB 4KH0B 2DZ9A 4UC4A 1ZUKA 4DOVA 3A8MB 2O2OA 3JB9H 3VJPA 4C5EA 2QTVA 4C5HA 4Y91A 3JCMJ 2OI3A 5D6WA 3I55T 3BE3A 4M77F 2YDLA 4A4KA 1NJIC 2LMJA 5IAYA 1M2VA 1JB0E 3KFVA 2P4TA 3JCMP 1B34A 3JV3A 3RERA 3O5ZA 1LVKA 4JRQA 2P84A 4FYYB 5GMKl 2HAXA 2KEAA 4LDXA 3HKSA 2F2XA 2L3QA 1ACMB 3KBGA 4K11A 1E6HA 1CKAA 4R55A 3M55A 1WFWA 3TEEA 2ROTA 1UG1A 1C0MA 1TUGB 3JCMf 2QG9B 4BB7A 4M7AG 2DD4A 2GQVA 2DIGA 4PFOA 2DPPB 2B8AA 5KCHA 4KGXB 2KXDA 1X2KA 1YJ9A 2DJZA 3OYAA 1K73R 1XOVA 2COZA 2VV5A 4M78B 4M7DC 3E1SA 1RADB 1UGPB 1VQ7A 3LYIA 2O88A 1TUCA 1OX9A 1Z9QA 5A0LA 3GP8A 4F16A 2PNIA 2KRSA 3J80E 3MEUA 4J9EA 2E1HA 2FO0A 4PFPA 4HVWA 2RI5A 2DYBA 4M7AB 3RESA 2K4YA 1D1AA 1YITQ 3CCSQ 5FU7B 3X20B 1VQPT 2CZ7B 2IG0A 4RG2A 1PWTA 3SFMA 6AT1B 2G6FX 5AYFA 4M75A 5GAMd 2D8JA 4ZN1A 2IPOB 3JCMV 3G6EA 2DKGA 2J6KA 2D8HA 2YUQA 2NUTA 3OSVA 1U1TA 5CQXA 3RKWA 2KNBB 1RAFB 5GAMe 1HD3A 1I4K1 2ZPIB 3RNJA 4BI4A 4NS5A 1KC8C 2BTTA 3MPUB 3CC4Q 3VYGA 1EX4A 1SPKA 4DBQA 4KUIA 1V1CA 2RHUA 4LUDA 1B3QA 4XTWA 4IUTA 5I11A 1KD1R 2JT4A 4LUEA 1J3TA 3M54A 2DIQA 2GCXA 2VXFA 2QA4Q 5LJ5d 2KRMA 4A54A 1YIJT 3PTAA 2ZCFB 1HJDA 5LJ5e 1Q82U 1M1FA 1KHCA 3M0PA 2RJEA 2DRKA 3RBBB 1WHKA 1WHJA 4BE1A 5KYUB 3HP9A 2NWMA 1X27A 2VUBA 3BFMA 1B07A 2O01E 2X3WD 5DLOA 2AZVA 2DXBA 5GMKm 4ZN3A 1UFFA 2V1RA 2CZ6B 4Z89A 1YI2A 1VQ8T 1HYOA 2QDLA 1OX8A 3OYMA 4MDXA 3CMAT 1VQ4T 4RUGA 2X4YA 2QDYB 3VS4A 1LNXA 2KROA 3WVEB 3L2RA 2JNGA 2LNHB 2MF2A 4Q5WA 4RTXA 5GJWB 4E7ZA 2RPNA 1YJWA 1QWFA 2OTJA 3CQTA 3MEAA 2DTHA 4M7DG 1K9AA 3CCMA 1FYNA 1WGSA 1M3CA 4PJOG 2DJQA 1YJ9Q 4QKUA 2FZGB 2VGMA 4M7AE 5CAIA 2DRMA 2CT3A 1YCYA 2KXCA 1VQ7Q 2GF7A 4Y92A 5GMKi 1GFCA 1QP2A 2K6DA 2BE7D 3MO8A 3SWNC 4N0AC 3M0SA 3HFOA 1SF9A 1UHCA 1VQLT 3OYGA 4ATOA 1M2OA 2QQRA 2RJCA 4KUDK 2EGAA 1MV0B 2Z0WA 4XAXB 3VRZA 1VQNT 1S72Q 2DZCA 1VQMA 4J9HA 1LCKA 4M7DB 1WJRA 2Y4YA 2CH4A 1OOTA 4E7LA 1V29B 2QTXA 3CXCA 3I55A 1VQ9T 1CSKA 4EMHA 3DLMA 1OYXA 3VKIA 2HQHA 2FEIA 3G6EQ 1WI7A 2J05A 1GCQC 2DFUA 1JXMA 3JCMd 4PNOA 2V8KA 4X9DA 1RI9A 3QO3A 1OI1A 3EFOB 5FW9A 4FSXA 1OQKA 2VGNA 1KFZA 5J3BA 3VS6A 3JCMe 3CCVT 1ZSZA 3LWIA 1AWJA 3VRYA 3BW1A 2DMOA 3F70A 1Q81C 4J6WA 2X4XA 4MMKA 1PKTA 3VS2A 3GNGA 1TU0B 2HMAA 3OYHA 3CCJT 1RACB 3MJXA 1KSWA 2D1XA 3LX7A 1K9MU 4TVRA 2YRDA 4FW2A 2DILA 2GFUA 4LN2A 4LD9K 4IUPA 2KT1A 3NGPA 2RJFA 3TSZA 2RK2A 5KCOA 2YT6A 3M5AA 1H8KA 2E12A 4MMLA 5GAMh 3G71T 2GTOA 2RHYA 4HT9A 3JB9J 3QJYA 1YI2Q 2J6FA 2O4XB 2XD0A 3EAEA 4JJDA 3RR6A 2RI3A 1OZ2A 1PC0A 1AT1B 3CXCS 5IHNA 4AFSC 4JLGA 1YJWQ 1JRIA 2OTJQ 1G3SA 3ZFJA 1RUWA 5CK9A 3CCMQ 7AT1B 2DL3A 4YTLA 4C92F 1AZEA 2CSIA 3TU4K 1QW1A 2JS2A 2RK1A 1S1NA 3QZ5B 2E6ZA 2BIVA 3CC7A 4MZMA 5IT9E 3MEWA 3E2UA 4M7DE 1WZOA 4M77C 2RN8A 1KQSS 2FRWA 5LJ5h 3JB9F 3J7AF 1QLYA 1QVFA 1UHFA 5GANg 2K5LA 1I5OB 1OPLA 3S3MA 1T0HA 4OVAA 2Y4XA 4M78D 1VQMQ 3SB2A 1PCXA 2HQXA 1NG2A 2MK5A 1X43A 1MNDA 3I55Q 1VYTA 1I8FA 2EQJA 3SWNB 3CCLT 1Q82C 1KHIA 3CMET 1BYMA 4AG2C 4II1A 2KYMA 5GANj 3EG9B 4KH1B 3OYFA 2OTLA 4C8QF 2XU8A 2P0PA 1H3ZA 2HBPA 1RAEB 1Q86C 4LD6A 2EQMA 3FLGA 3M9QA 2RA2A 3EGXB 3CCUA 3CCQA 3A1PA 3E19A 4JDSA 1VQ8A 4LDVA 4E7JA 2OAWA 4PL6A 1DJ7B 2FG0A 3CMAA 2LZ6B 4DBRA 3CPWA 1T3LA 3FEOA 2KY9A 1ZUUA 2COWA 2W10A 1BI2A 4O6JA 2C0OA 1PD1A 2L8DA 4KULA 2AKLA 3OS0A 2P0QA 1BK2A 5IHIA 2M0OA 2CP7A 3NPFA 1WA7A 2ZZDA 3O8VA 1QVFS 5M9OA 1M1KC 3MP8A 1UB4A 2LX9A 3V7SA 2RD1A 3G1JA 3JCMh 4FYVB 4XTXA 4X1VA 3CD6T 1W1FA 1TSFA 2LJ1A 2X4WA 2LCLA 2VVKA 2AIRB 3C94A 4JRIA 5GAMg 4C0ZA 3TVTA 5I22A 5FWBA 1N8RR 3AT1B 1BCMA 3CC7Q 3I56A 1PD0A 2AZSA 4GLKA 4RMOA 2K3XA 1VQ5T 1SSHA 4DBFA 3JCMb 3G4SA 3JSCA 2CKKA 3JCMc 3J81E 1RL2A 3VYHB 1BI0A 2R58A 2FZKB 2EQKA 3HFNA 5CVIA 1AWXA 3CPWS 1QWEA 4PJOA 4OMMA 3VUZA 5KYWA 1SG5A 1SEMA 4M77B 3CBPA 4D8DA 2P0KA 1VUBA 5LJ5g 2ZPHB 1VQOT 4JS4A 4ME7A 1D0XA 1X75C 2RQTA 4MDWA 4Y28E 4C0GA 3A5ZB 3EFOA 4BE0A 1SHGA 5CKFA 3CC2T 2HL5C 5GAOr 2YRCA 1CKBA 2CH4W 1HSQA 3CBOA 3QYHB 2F69A 4C92D 1W6XA 2YUOA 3OS2A 5GAOm 2EJFA 3CCUQ 4LNPA 3CCQQ 3UT1A 3HPWA 2FYKA 1QCNA 1VQ8Q 3OS1A 1U8RA 2YSQA 1PRLC 4OMOA 4L59A 5LJ3f 2NUPB 4M75F 3CMAQ 1VQ4Q 2PUKB 1AD5A 3MCAB 5J39A 2JTEA 2D9TA 4B9WA 3GOXA 1LPLA 4JUVA 3TSWA 4P5NA 2M51A 5KYYB 8ATCB 2W0ZA 3L42A 4OMPA 3H6ZA 4PK4A 2JVVA 1H641 1QQJA 1BU1A 4EDUA 1VIEA 1OPKA 3I35A 2K3YA 3LGLA 2CREA 1M3AA 4GY5A 2HCKA 2J6OA 4NL3A 3CBMA 1ZQ1A 1D09B 2RQWA 2SEMA 1Q7YR 1O9SA 4XU1A 3P8BB 2FPEA 1X01A 1ZA1B 5GAN7 1I5LA 2DXUA 5HCKA 3UDCA 2JM8A 1D3BB 1JXOA 2FRYA 1K4US 2QA4A 1JJ2A 4OMLA 3X25B 4HKEA 2A0FB 3CMEA 1VQKA 3EG3A 1ZUYA 5C0MA 3I56Q 1UTIA 3EG2A 2EJGA 2E5QA 4NOYA 5IXFA 3EHRA 4QQ6A 2BUDA 4ZGJB 3G4SQ 3P8DA 2DX1A 3OYLA 4M78G 2QYZA 2YHTA 1W2BA 1Y07A 3MP6A 2EIFA 4A4GA 2E3HA 1QKWA 4C0DC 1A0NB 1D0YA 2R57A 3I9QA 2LJ0A 2ZAEA 5I21A 3HRTA 2QGFB 4Z02A 2MMPA 3EG1A 2E6NA 4CI0C 4J7IA 2CS7A 1WJQA 5D6YA 5EG2A 4EMKC 1M8VA 2OJ2A 1NJIR 3UA7A 3M57A 4FU6A 3A8HB 1M90U 2JTFA 3FRNA 3CCET 1N9SA 3PNWC 4NL2A 1VOMA 1FX7A 2G3RA 2COYA 4C92C 2RMOA 3G71Q 3I5SA 2RHXA 4HXJA 4GLMA 4J8OA 2YLBA 3QYGB 3JB9I 1T0JA 5FLXE 5HK3A 2M1HA 4ZNXA 3S3NA 2DTOA 3FB9A 3MEVA 2DM1A 4JJBA 1S72A 3QKJA 5KE2A 2RH2A 3OYDA 1JJ2S 2PUOB 4L5GA 1PNJA 3EFRA 5D6XA 3OYEA 2JUFA 4RCCA 4ZGEB 4RTUA 4OMFB 3VV0A 2HL3A 3QWYA 5HY6A 4OP0A 2JOYA 3UA6A 3GF5A 2QASA 1W2BS 1YHQA 1IREB 1WDXA 3VS3A 3FDRA 2DXTA 3VU3C 2DTIA 2EVRA 1HXDA 4C8QC 3R6OA 2MWPA 3M56A 1JBMA 2AT1B 5CCAA 2JTMA 2YLCA 3U23A 1VQ6A 1VYVA 2DEQA 2ECZA 1QMCA 2H8HA 2X4JA 5LJ3d 1AVZC 3VS5A 4QW2A 2C0TA 1YBYA 4FYXB 5ECAA 3CMEQ 1VQKQ 3EGDB 1QVPA 1WQWA 2QGGA 2EBPA 5AT1B 1Q95G 5LJ3e 1H3HA 2CZ0B 5CKEA 5KYXB 4F7UG 2KSSA 1SRLA 2XMFA 5IXBA 1MMAA 1ABQA 3DKMA 3EG0A 1VYUA 3QXEB 1KC8R 1TG0A 1GBRA 2RI2A 1MNEA 4IUUA 2RHIA 2RJDA 4CRIA 3A8LB 5HKCA 1OU8A 1EZZB 3I5RA 3TQ7P 4M78E 2R5MA 4KGVB 2A36A 1WHLA 3Q1JA 4N4HA 2LT1A 3QJ6A 2ENMA 2GFAA 3WXMB 4F7UB 4JPBW 3L2QA 1X6OA 4C92G 4C0DB 2K3BA 1H92A 5CKHA 2L3PA 4KBMB 4M77D 1OV3A 3FC3A 2JS0A 2DLPA 4D8KA 1MMNA 1D0ZA 3H0IA 1KIKA 3PVQA 1AHJB 4EMKB 1ZA2B 3V7RA 1OU9A 5A2QE 1WHHA 3E9FA 2D0QB 3N5BB 1N8RU 3QSUA 1JEGA 5IHKA 2ZPGB 3QHSA 4JRPA 3META 3CCRT 4C92B 1M1GA 1QVGA 2HZYA 2DE0X 1QCFA 4PLIA 3QDRB 4HVVA 1BIAA 1OZ3A 2HSEB
chains in the Genus database with same CATH topology
5GJVB 1UGVA 1AWOA 3EHQA 2A08A 1WXBA 1NM7A 4A63B 1GFDA 1U06A 1YWPA 3LH5A 2HSPA 1M27C 2LQWA 1JO8A 2OAWA 2FG0A 2LZ6B 1T3LA 4M4ZA 2ED0A 2HEQA 1ZUUA 2CDTA 4KRTA 2W10A 1X2QA 1U5SA 3GBQA 2K9GA 1YN8A 1OEBA 2C0OA 1T3SA 3M0UA 2AKLA 4R0KA 3PE0A 1N5ZA 4F14A 4JZ3A 1BK2A 5IHIA 5L23A 2KR3A 3SEMA 3NPFA 1WA7A 2RNAA 2GGRA 4J9BA 1TUDA 4LE9A 3PVLA 4J9FA 3ULRB 4X1VA 1ZUKA 2YUNA 1W1FA 2ROLA 2JMAA 2O2OA 2IIMA 1X6GA 2LJ1A 1QKXA 2O9SA 1GRIA 4DEXA 2OI3A 2VVKA 1MV3A 2DL5A 2L3SA 2YDLA 2LMJA 5I22A 3TVTA 5FWBA 3UATA 1ZBJA 4ESRA 1U3OA 2CUBA 3VS0A 4RTTA 1K1ZA 3KFVA 1WLPB 2AZSA 2EYXA 3JV3A 2LP5A 3O5ZA 1SSHA 3NHNA 2M0YA 2KEAA 2F2XA 2L3QA 4K11A 1E6HA 2EQIA 1CKAA 2BZYA 1I1JA 1WFWA 2AK5A 2D0NA 2HDAA 2ROTA 1UG1A 3UF4A 1RLPC 2GQIA 1YCSB 2VKNA 1AWXA 1K76A 1QWEA 2B86A 4OMMA 4OMNA 1SEMA 4D8DA 2KXDA 2I0NA 1X2KA 2RQTA 1XOVA 1SHGA 1GBQA 2O88A 1TUCA 2AKKA 1CKBA 2CH4W 1HSQA 4HCKA 1Z9QA 4F16A 1W6XA 2PNIA 2YUOA 3VS7A 2KRSA 4LNPA 4J9EA 2FO0A 4HVWA 2DYBA 2F2WA 2YSQA 1Y57A 1PRLC 4GBQA 4OMOA 1AZGB 3ZL7C 2MIOA 1M8MA 1AD5A 2JM9A 2KGTA 2JXBA 3C0CA 1Y0MA 2JTEA 1PWTA 3SHWA 2G6FX 3M0TA 2DBKA 1E7OA 2D8JA 3TSWA 2EGCA 2M51A 2CT4A 2J6KA 2D8HA 2YUQA 2L0AA 4CC7A 2KNBB 2W0ZA 4OMPA 1MUZA 1HD3A 1K0SA 1UJ0A 1Z9ZA 2O9VA 3RNJA 1BU1A 2GBQA 2BTTA 4IIMA 1OPKA 1SPKA 2MOXA 5IH2A 1V1CA 3I35A 2CREA 1M3AA 2EGEA 2HCKA 2J6OA 4LUDA 1B3QA 4RTYA 2DL8A 1ZX6A 2EYWA 5I11A 4ORZA 2RQWA 2YUPA 4J9GA 1NEGA 2JT4A 2KYBA 2SEMA 4LUEA 3REBB 1J3TA 2FPEA 5EC7A 2SRCA 4CC3A 4CC4B 1AOJA 5HCKA 2KRMA 3H0FA 2JM8A 1JXOA 1UDLA 2FRYA 1PKSA 2X3XD 1NLOC 3VS1A 1K4US 4CC2A 4OMLA 4F17A 1HJDA 1I07A 3EG3A 1ZUYA 3M0PA 1UTIA 2DRKA 3EG2A 3RBBB 5IXFA 3EHRA 1JU5C 1X27A 2NWMA 1B07A 2X3WD 2GNCA 2AZVA 2DX1A 3QWXX 2DF6A 2LJ3A 1UFFA 4DEYA 1K0XA 2V1RA 4Z89A 1WX6A 1QKWA 2QDLA 1A0NB 1SHFA 1UECA 3EGUA 2O31A 4RUGA 3I9QA 4AFZC 3VS4A 2KROA 2LJ0A 2DA9A 3H0HA 1FMKA 2LNHB 4RTXA 5GJWB 3EG1A 2RPNA 1QWFA 3CQTA 4Z88A 1K9AA 1UUEA 2RQVA 1FYNA 4AG1C 2DBMA 1M3CA 2DJQA 2OJ2A 1VA7A 2A28A 3UA7A 4JJCA 3REAB 2DRMA 2CT3A 2KXCA 4E6RA 4Y92A 1PRMC 1GFCA 3FJ5A 2K6DA 1PHTA 3M0SA 1UE9A 1KJWA 1UHCA 2EYZA 1UJYA 2RMOA 3M0QA 2JMCA 3I5SA 3THKA 1RLQC 2EGAA 1MV0B 4HXJA 3VRZA 4QT7A 4GLMA 1T0JA 4ZNXA 4JZ4A 4J9HA 1LCKA 1M30A 2CH4A 1OOTA 2DM1A 4EIKA 4JJBA 1W70A 3NMZC 1X69A 4AFUC 1CSKA 2FEIA 2J06A 1IO6A 1WI7A 2J05A 1GCQC 1I0CA 1PNJA 4RTZA 1JXMA 2K7AA 1RI9A 4WCIA 1E6GA 1YNZA 5FW9A 2CUDA 4RTUA 3QWYA 2KBTA 1SRMA 2KE9A 1KFZA 3VS6A 3UA6A 5FWCA 2PZ1A 2FPDA 2P4RA 4J9IA 1AWJA 3VRYA 1WDXA 2LX7A 2DMOA 3VS3A 2PTKA 2EVRA 1PKTA 2ED1A 3VS2A 2NUZA 1WXUA 1WXTA 2ESWA 3U23A 3R6NA 1G2BA 1G83A 2E5KA 1KSWA 1VYVA 1AWWA 2KT8A 4OMQA 2D1XA 2ECZA 2RQRA 2H8HA 1BBZA 3IQLA 1AVZC 2F2VA 3VS5A 2EW3A 2DILA 4LN2A 4IIOA 2C0TA 2DL7A 2KT1A 3NGPA 2A37A 5ECAA 3TSZA 3A98A 2L2PA 2EBPA 2LQNA 2DVJA 1ABOA 1ZLMA 2V1QA 1H3HA 4J9CA 1SRLA 2XMFA 2GTJA 3H41A 2YT6A 5IXBA 1H8KA 1ABQA 3EG0A 1VYUA 1GL5A 2KRNA 4RTVA 4J9DA 2DNUA 2GTOA 1TG0A 1X6BA 2C0IA 2J7IA 1GBRA 2J6FA 1WYXA 1WIEA 4JJDA 3I5RA 5IHNA 4AFSC 1AEYA 2LCSA 2A36A 1RUWA 1NLPC 1NYGA 2DL3A 1AZEA 2CSIA 2K2MA 2JS2A 1NYFA 1S1NA 2VWFA 4FSSA 2ENMA 2DL4A 1ZSGA 4JPBW 2BZ8A 2FPFA 2MCNA 2JW4A 1EFNA 2K3BA 1H92A 2RN8A 2FRWA 2L3PA 1QLYA 2CSQA 1JQQA 1UHFA 1OV3A 2JS0A 2DLPA 4D8KA 1OPLA 1YP5A 4HVUA 2BZXA 2EYYA 3H0IA 1KIKA 3PVQA 1T0HA 2HBWA 3M0RA 2EPDA 1GCQA 2RQUA 1NG2A 2RF0A 4RTWA 1YWOA 1X43A 1GCPA 1VYTA 4Z8AA 1ARKA 1JEGA 5IHKA 2EKHA 4AG2C 2KYMA 1BB9A 2K79A 1NEBA 2ABLA 1QCFA 2DE0X 4AFQC 4HVVA 1M3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GJV B;  1UGV A;  1AWO A;  3EHQ A;  2A08 A;  1WXB A;  1NM7 A;  4A63 B;  1GFD A;  1U06 A;  1YWP A;  3LH5 A;  2HSP A;  1M27 C;  2LQW A;  1JO8 A;  2OAW A;  2FG0 A;  2LZ6 B;  1T3L A;  4M4Z A;  2ED0 A;  2HEQ A;  1ZUU A;  2CDT A;  4KRT A;  2W10 A;  1X2Q A;  1U5S A;  3GBQ A;  2K9G A;  1YN8 A;  1OEB A;  2C0O A;  1T3S A;  3M0U A;  2AKL A;  4R0K A;  3PE0 A;  1N5Z A;  4F14 A;  4JZ3 A;  1BK2 A;  5IHI A;  5L23 A;  2KR3 A;  3SEM A;  3NPF A;  1WA7 A;  2RNA A;  2GGR A;  4J9B A;  1TUD A;  4LE9 A;  3PVL A;  4J9F A;  3ULR B;  4X1V A;  1ZUK A;  2YUN A;  1W1F A;  2ROL A;  2JMA A;  2O2O A;  2IIM A;  1X6G A;  2LJ1 A;  1QKX A;  2O9S A;  1GRI A;  4DEX A;  2OI3 A;  2VVK A;  1MV3 A;  2DL5 A;  2L3S A;  2YDL A;  2LMJ A;  5I22 A;  3TVT A;  5FWB A;  3UAT A;  1ZBJ A;  4ESR A;  1U3O A;  2CUB A;  3VS0 A;  4RTT A;  1K1Z A;  3KFV A;  1WLP B;  2AZS A;  2EYX A;  3JV3 A;  2LP5 A;  3O5Z A;  1SSH A;  3NHN A;  2M0Y A;  2KEA A;  2F2X A;  2L3Q A;  4K11 A;  1E6H A;  2EQI A;  1CKA A;  2BZY A;  1I1J A;  1WFW A;  2AK5 A;  2D0N A;  2HDA A;  2ROT A;  1UG1 A;  3UF4 A;  1RLP C;  2GQI A;  1YCS B;  2VKN A;  1AWX A;  1K76 A;  1QWE A;  2B86 A;  4OMM A;  4OMN A;  1SEM A;  4D8D A;  2KXD A;  2I0N A;  1X2K A;  2RQT A;  1XOV A;  1SHG A;  1GBQ A;  2O88 A;  1TUC A;  2AKK A;  1CKB A;  2CH4 W;  1HSQ A;  4HCK A;  1Z9Q A;  4F16 A;  1W6X A;  2PNI A;  2YUO A;  3VS7 A;  2KRS A;  4LNP A;  4J9E A;  2FO0 A;  4HVW A;  2DYB A;  2F2W A;  2YSQ A;  1Y57 A;  1PRL C;  4GBQ A;  4OMO A;  1AZG B;  3ZL7 C;  2MIO A;  1M8M A;  1AD5 A;  2JM9 A;  2KGT A;  2JXB A;  3C0C A;  1Y0M A;  2JTE A;  1PWT A;  3SHW A;  2G6F X;  3M0T A;  2DBK A;  1E7O A;  2D8J A;  3TSW A;  2EGC A;  2M51 A;  2CT4 A;  2J6K A;  2D8H A;  2YUQ A;  2L0A A;  4CC7 A;  2KNB B;  2W0Z A;  4OMP A;  1MUZ A;  1HD3 A;  1K0S A;  1UJ0 A;  1Z9Z A;  2O9V A;  3RNJ A;  1BU1 A;  2GBQ A;  2BTT A;  4IIM A;  1OPK A;  1SPK A;  2MOX A;  5IH2 A;  1V1C A;  3I35 A;  2CRE A;  1M3A A;  2EGE A;  2HCK A;  2J6O A;  4LUD A;  1B3Q A;  4RTY A;  2DL8 A;  1ZX6 A;  2EYW A;  5I11 A;  4ORZ A;  2RQW A;  2YUP A;  4J9G A;  1NEG A;  2JT4 A;  2KYB A;  2SEM A;  4LUE A;  3REB B;  1J3T A;  2FPE A;  5EC7 A;  2SRC A;  4CC3 A;  4CC4 B;  1AOJ A;  5HCK A;  2KRM A;  3H0F A;  2JM8 A;  1JXO A;  1UDL A;  2FRY A;  1PKS A;  2X3X D;  1NLO C;  3VS1 A;  1K4U S;  4CC2 A;  4OML A;  4F17 A;  1HJD A;  1I07 A;  3EG3 A;  1ZUY A;  3M0P A;  1UTI A;  2DRK A;  3EG2 A;  3RBB B;  5IXF A;  3EHR A;  1JU5 C;  1X27 A;  2NWM A;  1B07 A;  2X3W D;  2GNC A;  2AZV A;  2DX1 A;  3QWX X;  2DF6 A;  2LJ3 A;  1UFF A;  4DEY A;  1K0X A;  2V1R A;  4Z89 A;  1WX6 A;  1QKW A;  2QDL A;  1A0N B;  1SHF A;  1UEC A;  3EGU A;  2O31 A;  4RUG A;  3I9Q A;  4AFZ C;  3VS4 A;  2KRO A;  2LJ0 A;  2DA9 A;  3H0H A;  1FMK A;  2LNH B;  4RTX A;  5GJW B;  3EG1 A;  2RPN A;  1QWF A;  3CQT A;  4Z88 A;  1K9A A;  1UUE A;  2RQV A;  1FYN A;  4AG1 C;  2DBM A;  1M3C A;  2DJQ A;  2OJ2 A;  1VA7 A;  2A28 A;  3UA7 A;  4JJC A;  3REA B;  2DRM A;  2CT3 A;  2KXC A;  4E6R A;  4Y92 A;  1PRM C;  1GFC A;  3FJ5 A;  2K6D A;  1PHT A;  3M0S A;  1UE9 A;  1KJW A;  1UHC A;  2EYZ A;  1UJY A;  2RMO A;  3M0Q A;  2JMC A;  3I5S A;  3THK A;  1RLQ C;  2EGA A;  1MV0 B;  4HXJ A;  3VRZ A;  4QT7 A;  4GLM A;  1T0J A;  4ZNX A;  4JZ4 A;  4J9H A;  1LCK A;  1M30 A;  2CH4 A;  1OOT A;  2DM1 A;  4EIK A;  4JJB A;  1W70 A;  3NMZ C;  1X69 A;  4AFU C;  1CSK A;  2FEI A;  2J06 A;  1IO6 A;  1WI7 A;  2J05 A;  1GCQ C;  1I0C A;  1PNJ A;  4RTZ A;  1JXM A;  2K7A A;  1RI9 A;  4WCI A;  1E6G A;  1YNZ A;  5FW9 A;  2CUD A;  4RTU A;  3QWY A;  2KBT A;  1SRM A;  2KE9 A;  1KFZ A;  3VS6 A;  3UA6 A;  5FWC A;  2PZ1 A;  2FPD A;  2P4R A;  4J9I A;  1AWJ A;  3VRY A;  1WDX A;  2LX7 A;  2DMO A;  3VS3 A;  2PTK A;  2EVR A;  1PKT A;  2ED1 A;  3VS2 A;  2NUZ A;  1WXU A;  1WXT A;  2ESW A;  3U23 A;  3R6N A;  1G2B A;  1G83 A;  2E5K A;  1KSW A;  1VYV A;  1AWW A;  2KT8 A;  4OMQ A;  2D1X A;  2ECZ A;  2RQR A;  2H8H A;  1BBZ A;  3IQL A;  1AVZ C;  2F2V A;  3VS5 A;  2EW3 A;  2DIL A;  4LN2 A;  4IIO A;  2C0T A;  2DL7 A;  2KT1 A;  3NGP A;  2A37 A;  5ECA A;  3TSZ A;  3A98 A;  2L2P A;  2EBP A;  2LQN A;  2DVJ A;  1ABO A;  1ZLM A;  2V1Q A;  1H3H A;  4J9C A;  1SRL A;  2XMF A;  2GTJ A;  3H41 A;  2YT6 A;  5IXB A;  1H8K A;  1ABQ A;  3EG0 A;  1VYU A;  1GL5 A;  2KRN A;  4RTV A;  4J9D A;  2DNU A;  2GTO A;  1TG0 A;  1X6B A;  2C0I A;  2J7I A;  1GBR A;  2J6F A;  1WYX A;  1WIE A;  4JJD A;  3I5R A;  5IHN A;  4AFS C;  1AEY A;  2LCS A;  2A36 A;  1RUW A;  1NLP C;  1NYG A;  2DL3 A;  1AZE A;  2CSI A;  2K2M A;  2JS2 A;  1NYF A;  1S1N A;  2VWF A;  4FSS A;  2ENM A;  2DL4 A;  1ZSG A;  4JPB W;  2BZ8 A;  2FPF A;  2MCN A;  2JW4 A;  1EFN A;  2K3B A;  1H92 A;  2RN8 A;  2FRW A;  2L3P A;  1QLY A;  2CSQ A;  1JQQ A;  1UHF A;  1OV3 A;  2JS0 A;  2DLP A;  4D8K A;  1OPL A;  1YP5 A;  4HVU A;  2BZX A;  2EYY A;  3H0I A;  1KIK A;  3PVQ A;  1T0H A;  2HBW A;  3M0R A;  2EPD A;  1GCQ A;  2RQU A;  1NG2 A;  2RF0 A;  4RTW A;  1YWO A;  1X43 A;  1GCP A;  1VYT A;  4Z8A A;  1ARK A;  1JEG A;  5IHK A;  2EKH A;  4AG2 C;  2KYM A;  1BB9 A;  2K79 A;  1NEB A;  2ABL A;  1QCF A;  2DE0 X;  4AFQ C;  4HVV A;  1M3B A; 
#chains in the Genus database with same CATH topology
 1UGV A;  1AWO A;  3GIB A;  3OA6 A;  1YHQ Q;  1U06 A;  5GAN 8;  3PFS A;  1KQS A;  2HSP A;  1M27 C;  4BD3 A;  2LQW A;  3DLL A;  3M4G A;  3KUF A;  1D1C A;  2WSE E;  1VQ6 Q;  4E47 A;  1N9R A;  2ED0 A;  3DB4 A;  5HK0 A;  4IKF A;  1M90 C;  2K9G A;  1YN8 A;  1T3S A;  3M0U A;  4R0K A;  4M75 C;  2E64 A;  3OMC A;  5L23 A;  2PVG B;  4C8Q B;  1NE8 A;  4J9B A;  1TUD A;  4ELZ C;  1TOV A;  1BI1 A;  4R56 A;  2RB6 A;  3OS5 A;  1Y96 B;  3JAM E;  4F7U E;  2ROL A;  2JMA A;  2IIM A;  2MYS A;  1X6G A;  1QKX A;  2O9S A;  1Q81 R;  1QCO A;  2YXY A;  2FHD A;  1WQ7 A;  3NTH A;  2DL5 A;  2L3S A;  2EQU A;  4C5I A;  2JZ2 A;  1M4Z A;  1N6A A;  1VQP A;  3UAT A;  4ESR A;  1QVG S;  1TXQ A;  2CUB A;  2EYQ A;  1K1Z A;  2CGH A;  4BY6 C;  2EYX A;  4M78 A;  2DAQ A;  2M0Y A;  2DER A;  2MAM A;  4BDZ A;  1R77 A;  5LJ3 h;  1YIT T;  3SD4 A;  1HK9 A;  3HHT B;  2EQI A;  2BZY A;  4C92 E;  1GXI E;  3CEY A;  2AK5 A;  4PJO F;  1IXD A;  2HDA A;  2HKQ B;  1P92 A;  2BKD N;  3QBY A;  1YCS B;  4M7A A;  2VKN A;  2XG8 D;  2B86 A;  4OMN A;  3RKY A;  1M2V B;  3GNF B;  1B34 B;  2E10 A;  1YIJ A;  1WHM A;  4LXC A;  1GBQ A;  4VUB A;  4HCK A;  4BUG A;  1BKB A;  3S3O A;  2MPX C;  1U1S A;  2F5T X;  2ZPB B;  3VS7 A;  5GAO l;  5L8R E;  1Y57 A;  2FVU A;  2E3I A;  1TWB A;  2KGT A;  2JXB A;  1BCO A;  1Y0M A;  2XID A;  4KGZ B;  3BY7 A;  1NJI U;  1VQ4 A;  5GAN f;  2CT4 A;  2KAF A;  1K73 U;  2L0A A;  5FU6 C;  4FIB A;  3EGD A;  1Q82 R;  1K0S A;  3V8J A;  5LL6 S;  1UJ0 A;  1Z9Z A;  2O9V A;  2LQK A;  2XKO C;  2GBQ A;  2VXE A;  3LWH A;  2QEX T;  2MOX A;  2LVM A;  5KYU A;  1Q86 R;  4RTY A;  2DL8 A;  2OX7 A;  4ORZ A;  1ZSZ C;  4PLL A;  1VQL A;  4J9G A;  1NEG A;  1M9S A;  1N8R C;  4M75 B;  3RDV A;  2M9U A;  1YJ9 T;  1VQN A;  1AOJ A;  4KT0 E;  2NUT B;  3H0F A;  1UDL A;  3E9G A;  1PKS A;  2X3X D;  1VQP Q;  1VQ7 T;  4CC2 A;  1VQ9 A;  4F7U A;  3CCR A;  5GAO q;  3X24 B;  2YWW A;  4M77 G;  2E4H A;  3OB9 A;  2IVW A;  1JU5 C;  2EAY A;  2DF6 A;  4A4F A;  4DA4 A;  2LJ3 A;  4HCZ A;  4DEY A;  3QDF A;  3CCV A;  5CO7 A;  2HNI A;  1KD1 U;  3V7C A;  1UGQ B;  1M1K R;  1SHF A;  2O31 A;  3QPH A;  2DXC A;  2QAZ A;  1RAI B;  2DA9 A;  3H0H A;  3G6E T;  5GAM j;  4BY6 B;  1FMK A;  3V8K A;  1FMV A;  4M7D A;  4C5G A;  2RQV A;  4A4E A;  1K9M C;  3CCJ A;  2DBM A;  5GMK j;  2QXF A;  5LJ3 g;  1C6V X;  3PIP A;  2A28 A;  2HD0 A;  1YIJ Q;  3JCM W;  3REA B;  3M59 A;  3L2Z A;  1KQ2 A;  4BE2 A;  3FJ5 A;  1PHT A;  1KJW A;  2EYZ A;  1MMG A;  2JMC A;  3THK A;  1RLQ C;  2OAU A;  1PG5 B;  4BI8 B;  4QT7 A;  2XHC A;  2NYS A;  3G71 A;  5FRO A;  3QZ9 B;  4JZ4 A;  5LJ5 j;  1M30 A;  1Y71 A;  3OYK A;  1W70 A;  3NMZ C;  1X69 A;  4V2S A;  3FIF A;  2J06 A;  4XQ3 A;  3JB9 D;  1SKU B;  1I0C A;  3EH2 A;  2K7A A;  1G5V A;  4WCI A;  1ZBX A;  4C0F A;  3ZBD A;  2CUD A;  3TRE A;  3OYC A;  2KBT A;  4PJN A;  4QQG A;  5FWC A;  2PZ1 A;  1YI2 T;  1UGS B;  3OYN A;  4J9I A;  4HCB A;  1B7T A;  3BDU A;  1Y96 A;  4XTZ A;  2PTK A;  5C6S A;  1PSE A;  1YJW T;  2M16 A;  4XU2 A;  5FU6 B;  2NUZ A;  1VQL Q;  2OTJ T;  1WXT A;  3CCM T;  2O4X A;  4DOW A;  4LDW A;  3QII A;  3INZ A;  1VQN Q;  4C8Q D;  1G2B A;  2E5K A;  2KT8 A;  4OMQ A;  3RIR A;  1BBZ A;  3IQL A;  4B9X A;  1VQ9 Q;  1IRX A;  3CCR Q;  5J26 A;  2A37 A;  2A7Y A;  2L2P A;  3CCL A;  1BI3 A;  4HCC A;  1ABO A;  1ZLM A;  2V1Q A;  5GAN d;  1ZSZ B;  3JCM g;  1G3Y A;  2K5I A;  2PVD B;  1R8O B;  2KRN A;  4J9D A;  2DNU A;  2V8J A;  5GAN e;  1VQM T;  3OMG A;  3CCV Q;  2NLU A;  1K8A R;  4M77 E;  2XDD A;  2J7I A;  1WYX A;  1WIE A;  4OF1 A;  3OYI A;  1AEY A;  2LCS A;  1K73 C;  4JS5 A;  1NLP C;  1NYG A;  3OYJ A;  3CCJ Q;  1PM3 A;  4AMC A;  4EPC A;  4OB2 B;  2K2M A;  1NYF A;  2VWF A;  2K5F A;  3SWN A;  3PIO A;  4N0A A;  1ZSG A;  2FPF A;  3EG9 A;  2MCN A;  3RUX A;  2KVQ G;  2QEX A;  3CXC P;  3EFS A;  3OBY A;  2CSQ A;  1JQQ A;  3JRZ A;  3OW2 A;  1N27 A;  1QVG P;  1Q81 U;  5GAN 6;  8AT1 B;  2BZX A;  2EYY A;  2XK0 A;  3EGX A;  2HBW A;  1IHW A;  4XU3 A;  1YJN T;  3ER0 A;  4JRK A;  1WNL A;  2FZC B;  3TCJ A;  2X35 A;  1GCQ A;  1NZ9 A;  3NTI A;  4X34 A;  3CD6 A;  1FXX A;  1I81 A;  1GCP A;  1KQS P;  1ARK A;  3OQ5 A;  2DVE A;  2HKN A;  4IUR A;  4PJO C;  3PT9 A;  2K57 A;  4D6W A;  3JCM X;  4E7K A;  2ABL A;  2K79 A;  4MZP A;  4BDY A;  1MMD A;  4FT4 A;  2YRV A;  2CP5 A;  2PU9 B;  3ME9 A;  2RO0 A;  1M3B A;  5GJV B;  4OB0 B;  2A08 A;  4ZGD B;  1NM7 A;  4BAC A;  1GFD A;  1KD1 C;  2FL7 A;  2LT4 A;  2LQ8 A;  1VQ5 A;  5I2M A;  3H8Z A;  1JO8 A;  2X51 A;  1G3W A;  3HSB A;  1WHG A;  3CC7 T;  2LRQ A;  3LGF A;  2CDT A;  4KRT A;  2CP2 A;  3GBQ A;  4ZTJ A;  3NFC A;  3PE0 A;  4JLI A;  4OB1 B;  2AHJ B;  2L3R A;  4JZ3 A;  4F14 A;  4RCB A;  3CCL Q;  1VQO A;  2LNV A;  5GMK e;  4FT2 A;  4M75 D;  2BE9 B;  4MZT A;  3KXT A;  1BIB A;  1KK7 A;  2GGR A;  5IN1 A;  1NPR A;  3OW2 S;  2DD5 A;  4FM4 B;  4LE9 A;  3CC2 A;  3PVL A;  4QVC A;  3UWN A;  2E65 A;  4XTY A;  3ULR B;  2ZGW A;  4IUV A;  2YUN A;  2VYT A;  2D6F A;  1GRI A;  4DEX A;  4OGC A;  1MV3 A;  4N4G A;  3S6W A;  3DB3 A;  3ZEH A;  1QVF P;  1ZBJ A;  2EWN A;  2OTL T;  5FRN A;  4M77 A;  3OYB A;  4M78 F;  1U3O A;  3SDZ A;  3VS0 A;  4RTT A;  1WLP B;  2LP5 A;  3CCU T;  1Q86 U;  3CCQ T;  3T9N A;  3NHN A;  2QEX Q;  3MHX A;  4JJN K;  4F04 B;  1I1J A;  1D1B A;  4M7A F;  2D0N A;  1O75 A;  3UF4 A;  1RLP C;  2GQI A;  5GAN h;  3JB9 G;  2MI6 A;  1K76 A;  1LJO A;  1M5Q 1;  2NUP A;  2E70 A;  3CD6 Q;  2I0N A;  1XTD A;  4WF2 A;  4IUQ A;  4DBH A;  2PVO B;  5KYY A;  4DQ2 A;  3FJP A;  1TS9 A;  1RAH B;  1IB8 A;  4AT1 B;  2LTO A;  2Y90 A;  3RKX A;  2AKK A;  3V8L A;  4L6V 5;  4PFZ A;  3CPW P;  1M1K U;  3HRS A;  4XK8 E;  2EJ9 A;  1R0B G;  1VQ5 Q;  2QQA A;  4C8Q G;  2F2W A;  4GBQ A;  5KE3 A;  4PJO B;  1AZG B;  3ZL7 C;  3LLR A;  2MIO A;  1M8M A;  5KYW B;  3CPF A;  1FWZ A;  2JM9 A;  1KQ1 A;  5CKD A;  4O5V A;  3C0C A;  3SHW A;  3BDL A;  2ATC B;  3M0T A;  4E7I A;  2DBK A;  1E7O A;  3LH0 A;  3I56 T;  2EGC A;  1Y7X A;  2KK4 A;  4LDU A;  2JJ9 A;  2F5K A;  3X28 B;  1D3B A;  4CC7 A;  4HA8 A;  1IGQ A;  4OGE A;  1MUZ A;  2VAS A;  3G4S T;  2DYI A;  3H9N A;  1VQO Q;  1VIF A;  3OY9 A;  2XDB A;  4IIM A;  5IH2 A;  1EIF A;  4PJJ A;  3CC2 Q;  2EGE A;  3A8O B;  3CCE A;  3OSS C;  1ZX6 A;  2EYW A;  2MWO A;  2QQB A;  3M53 A;  2YUP A;  1KG1 A;  2H3J A;  2KYB A;  1IZ6 A;  1XQH A;  3REB B;  1YJN A;  3A8G B;  4J83 A;  2R5A A;  5EC7 A;  2SRC A;  1UGR B;  4CC3 A;  4CC4 B;  2EFI A;  4F7U F;  2QK0 A;  3VS1 A;  1NLO C;  2QQS A;  4F17 A;  2KMT A;  5A0D A;  1I07 A;  3PGG A;  2X9H A;  5DY9 A;  1M90 R;  2HQE A;  1RAB B;  2GNC A;  3QWX X;  2JN0 A;  5GMK h;  1K0X A;  3P8H A;  1W4S A;  3M58 A;  3AHU A;  1WX6 A;  3L2V A;  1UEC A;  1Q7Y U;  3EGU A;  3CCS T;  4AFZ C;  1SSF A;  4M7D F;  4A4H A;  3JCM Q;  1IGU A;  5DLQ E;  2KDS A;  1NBE B;  2FB7 A;  4Z88 A;  3M4Y A;  1UUE A;  4AG1 C;  3C12 A;  1VA7 A;  2DEU A;  4JJC A;  2VC8 A;  4PJO E;  4E6R A;  3UPU A;  3CC4 T;  1PRM C;  1RI0 A;  5GAO p;  1K8A U;  3L1A A;  1UE9 A;  2EKO A;  4FL6 A;  1UJY A;  1MGQ A;  3M0Q A;  4J6Y A;  4RG8 A;  1XJW B;  5A0G A;  1WPY A;  3C4S A;  2QA4 T;  4EIK A;  4AFU C;  5GAN 5;  1VQK T;  1IO6 A;  2PQW A;  4C8Q E;  4M7A D;  4RTZ A;  2C06 A;  4M75 G;  2XDP A;  1E6G A;  1YFN A;  4PJM A;  1YNZ A;  2XIC A;  1SRM A;  2KE9 A;  1TTH B;  2V8I A;  4XTV A;  4FCY A;  2FPD A;  3OYY A;  2P4R A;  5KYX A;  4LDY A;  3WVD B;  4E7S A;  3CCE Q;  2LX7 A;  2VB6 A;  3PMT A;  1JJ2 P;  4E7H A;  3EH1 A;  2ED1 A;  1WXU A;  2WAC A;  2ESW A;  1YJN Q;  3HRU A;  3R6N A;  1G83 A;  4EMG A;  1AWW A;  2DO3 A;  4FW1 A;  2DET A;  2RQR A;  4ELY C;  2F2V A;  2EW3 A;  1W2B P;  4IIO A;  1UEB A;  2DL7 A;  2CZ1 B;  1RAG B;  3HL8 A;  3A98 A;  2LQN A;  2DVJ A;  3LW5 E;  4J9C A;  2I2L A;  1F1B B;  2GTJ A;  3H41 A;  3D7S B;  1GL5 A;  4RTV A;  1IHV A;  1NPP A;  4J6X A;  5GAO n;  2QI2 A;  3VUB A;  1X6B A;  4QVZ A;  3QG1 A;  2C0I A;  5GAN 2;  1S72 T;  1XNI A;  4QVD A;  2L89 A;  2K2V A;  1ZHI A;  5FRM A;  3GLX A;  5I2S A;  3RMQ A;  2L5Q A;  1MHN A;  2DK3 A;  5KH6 A;  4EMK A;  1QP3 A;  1WJS A;  3OW2 P;  4OB3 B;  5D7U A;  2ZPF B;  3NTK A;  3HTR A;  3OBW A;  1RAA B;  4FSS A;  4PJL A;  4PKC C;  4N4I A;  4ANJ A;  4FYW B;  4J5Y A;  3ASK A;  2DL4 A;  1V76 A;  2BZ8 A;  2F1L A;  4C92 A;  3C95 A;  1YHQ T;  2JW4 A;  4B6M A;  1EFN A;  4WTO B;  2A3L A;  2LC4 A;  4XU0 A;  2H3E B;  1KC8 U;  2WSC E;  4M78 C;  1YP5 A;  4HVU A;  1G3T A;  4X9C A;  4A53 A;  5GAM f;  1VQ6 T;  3M0R A;  2EPD A;  4ZTF A;  1C1A A;  2RQU A;  2RF0 A;  2CP6 A;  4RTW A;  1YWO A;  5LJ3 j;  4Z8A A;  2LCC A;  5GAN 4;  2EKH A;  3QUI A;  4M7A C;  2OTL Q;  3MKD A;  1G8X A;  1FMW A;  5FU7 C;  1K9M R;  4M7D D;  1BB9 A;  1OUL A;  1NEB A;  4AFQ C;  4PJO D;  5CQY A;  5GAN 3;  1TH7 A;  2LDM A;  3EHQ A;  1WXB A;  4M75 E;  4C8Q A;  1LOJ A;  5DM7 R;  3L2U A;  4A63 B;  2E41 A;  1YWP A;  4QQD A;  1Q7Y C;  3LH5 A;  5LJ5 f;  3L2W A;  5CR2 A;  2WSF E;  2XI9 A;  5KYN A;  3CCS A;  1YIT A;  4HT8 A;  2CYZ B;  3G7Z A;  3GPL A;  5CKB A;  3PMI A;  4M4Z A;  3MP1 A;  2CP0 A;  2V26 A;  2HEQ A;  1X2Q A;  1U5S A;  2RM4 A;  4J7F A;  2KI7 A;  1R0C B;  1OEB A;  3RMS A;  1N5Z A;  2KR3 A;  1K8A C;  2KQW A;  3SEM A;  2RHZ A;  4E2F B;  9ATC B;  3CC4 A;  2RNA A;  5CIU A;  2CP3 A;  3X26 B;  4RKU E;  2QQ9 A;  4BI3 A;  2M02 A;  4XTU A;  1PSF A;  4J9F A;  3URG A;  2ZPE B;  4KH0 B;  2DZ9 A;  4UC4 A;  1ZUK A;  4DOV A;  3A8M B;  2O2O A;  3JB9 H;  3VJP A;  4C5E A;  2QTV A;  4C5H A;  4Y91 A;  3JCM J;  2OI3 A;  5D6W A;  3I55 T;  3BE3 A;  4M77 F;  2YDL A;  4A4K A;  1NJI C;  2LMJ A;  5IAY A;  1M2V A;  1JB0 E;  3KFV A;  2P4T A;  3JCM P;  1B34 A;  3JV3 A;  3RER A;  3O5Z A;  1LVK A;  4JRQ A;  2P84 A;  4FYY B;  5GMK l;  2HAX A;  2KEA A;  4LDX A;  3HKS A;  2F2X A;  2L3Q A;  1ACM B;  3KBG A;  4K11 A;  1E6H A;  1CKA A;  4R55 A;  3M55 A;  1WFW A;  3TEE A;  2ROT A;  1UG1 A;  1C0M A;  1TUG B;  3JCM f;  2QG9 B;  4BB7 A;  4M7A G;  2DD4 A;  2GQV A;  2DIG A;  4PFO A;  2DPP B;  2B8A A;  5KCH A;  4KGX B;  2KXD A;  1X2K A;  1YJ9 A;  2DJZ A;  3OYA A;  1K73 R;  1XOV A;  2COZ A;  2VV5 A;  4M78 B;  4M7D C;  3E1S A;  1RAD B;  1UGP B;  1VQ7 A;  3LYI A;  2O88 A;  1TUC A;  1OX9 A;  1Z9Q A;  5A0L A;  3GP8 A;  4F16 A;  2PNI A;  2KRS A;  3J80 E;  3MEU A;  4J9E A;  2E1H A;  2FO0 A;  4PFP A;  4HVW A;  2RI5 A;  2DYB A;  4M7A B;  3RES A;  2K4Y A;  1D1A A;  1YIT Q;  3CCS Q;  5FU7 B;  3X20 B;  1VQP T;  2CZ7 B;  2IG0 A;  4RG2 A;  1PWT A;  3SFM A;  6AT1 B;  2G6F X;  5AYF A;  4M75 A;  5GAM d;  2D8J A;  4ZN1 A;  2IPO B;  3JCM V;  3G6E A;  2DKG A;  2J6K A;  2D8H A;  2YUQ A;  2NUT A;  3OSV A;  1U1T A;  5CQX A;  3RKW A;  2KNB B;  1RAF B;  5GAM e;  1HD3 A;  1I4K 1;  2ZPI B;  3RNJ A;  4BI4 A;  4NS5 A;  1KC8 C;  2BTT A;  3MPU B;  3CC4 Q;  3VYG A;  1EX4 A;  1SPK A;  4DBQ A;  4KUI A;  1V1C A;  2RHU A;  4LUD A;  1B3Q A;  4XTW A;  4IUT A;  5I11 A;  1KD1 R;  2JT4 A;  4LUE A;  1J3T A;  3M54 A;  2DIQ A;  2GCX A;  2VXF A;  2QA4 Q;  5LJ5 d;  2KRM A;  4A54 A;  1YIJ T;  3PTA A;  2ZCF B;  1HJD A;  5LJ5 e;  1Q82 U;  1M1F A;  1KHC A;  3M0P A;  2RJE A;  2DRK A;  3RBB B;  1WHK A;  1WHJ A;  4BE1 A;  5KYU B;  3HP9 A;  2NWM A;  1X27 A;  2VUB A;  3BFM A;  1B07 A;  2O01 E;  2X3W D;  5DLO A;  2AZV A;  2DXB A;  5GMK m;  4ZN3 A;  1UFF A;  2V1R A;  2CZ6 B;  4Z89 A;  1YI2 A;  1VQ8 T;  1HYO A;  2QDL A;  1OX8 A;  3OYM A;  4MDX A;  3CMA T;  1VQ4 T;  4RUG A;  2X4Y A;  2QDY B;  3VS4 A;  1LNX A;  2KRO A;  3WVE B;  3L2R A;  2JNG A;  2LNH B;  2MF2 A;  4Q5W A;  4RTX A;  5GJW B;  4E7Z A;  2RPN A;  1YJW A;  1QWF A;  2OTJ A;  3CQT A;  3MEA A;  2DTH A;  4M7D G;  1K9A A;  3CCM A;  1FYN A;  1WGS A;  1M3C A;  4PJO G;  2DJQ A;  1YJ9 Q;  4QKU A;  2FZG B;  2VGM A;  4M7A E;  5CAI A;  2DRM A;  2CT3 A;  1YCY A;  2KXC A;  1VQ7 Q;  2GF7 A;  4Y92 A;  5GMK i;  1GFC A;  1QP2 A;  2K6D A;  2BE7 D;  3MO8 A;  3SWN C;  4N0A C;  3M0S A;  3HFO A;  1SF9 A;  1UHC A;  1VQL T;  3OYG A;  4ATO A;  1M2O A;  2QQR A;  2RJC A;  4KUD K;  2EGA A;  1MV0 B;  2Z0W A;  4XAX B;  3VRZ A;  1VQN T;  1S72 Q;  2DZC A;  1VQM A;  4J9H A;  1LCK A;  4M7D B;  1WJR A;  2Y4Y A;  2CH4 A;  1OOT A;  4E7L A;  1V29 B;  2QTX A;  3CXC A;  3I55 A;  1VQ9 T;  1CSK A;  4EMH A;  3DLM A;  1OYX A;  3VKI A;  2HQH A;  2FEI A;  3G6E Q;  1WI7 A;  2J05 A;  1GCQ C;  2DFU A;  1JXM A;  3JCM d;  4PNO A;  2V8K A;  4X9D A;  1RI9 A;  3QO3 A;  1OI1 A;  3EFO B;  5FW9 A;  4FSX A;  1OQK A;  2VGN A;  1KFZ A;  5J3B A;  3VS6 A;  3JCM e;  3CCV T;  1ZSZ A;  3LWI A;  1AWJ A;  3VRY A;  3BW1 A;  2DMO A;  3F70 A;  1Q81 C;  4J6W A;  2X4X A;  4MMK A;  1PKT A;  3VS2 A;  3GNG A;  1TU0 B;  2HMA A;  3OYH A;  3CCJ T;  1RAC B;  3MJX A;  1KSW A;  2D1X A;  3LX7 A;  1K9M U;  4TVR A;  2YRD A;  4FW2 A;  2DIL A;  2GFU A;  4LN2 A;  4LD9 K;  4IUP A;  2KT1 A;  3NGP A;  2RJF A;  3TSZ A;  2RK2 A;  5KCO A;  2YT6 A;  3M5A A;  1H8K A;  2E12 A;  4MML A;  5GAM h;  3G71 T;  2GTO A;  2RHY A;  4HT9 A;  3JB9 J;  3QJY A;  1YI2 Q;  2J6F A;  2O4X B;  2XD0 A;  3EAE A;  4JJD A;  3RR6 A;  2RI3 A;  1OZ2 A;  1PC0 A;  1AT1 B;  3CXC S;  5IHN A;  4AFS C;  4JLG A;  1YJW Q;  1JRI A;  2OTJ Q;  1G3S A;  3ZFJ A;  1RUW A;  5CK9 A;  3CCM Q;  7AT1 B;  2DL3 A;  4YTL A;  4C92 F;  1AZE A;  2CSI A;  3TU4 K;  1QW1 A;  2JS2 A;  2RK1 A;  1S1N A;  3QZ5 B;  2E6Z A;  2BIV A;  3CC7 A;  4MZM A;  5IT9 E;  3MEW A;  3E2U A;  4M7D E;  1WZO A;  4M77 C;  2RN8 A;  1KQS S;  2FRW A;  5LJ5 h;  3JB9 F;  3J7A F;  1QLY A;  1QVF A;  1UHF A;  5GAN g;  2K5L A;  1I5O B;  1OPL A;  3S3M A;  1T0H A;  4OVA A;  2Y4X A;  4M78 D;  1VQM Q;  3SB2 A;  1PCX A;  2HQX A;  1NG2 A;  2MK5 A;  1X43 A;  1MND A;  3I55 Q;  1VYT A;  1I8F A;  2EQJ A;  3SWN B;  3CCL T;  1Q82 C;  1KHI A;  3CME T;  1BYM A;  4AG2 C;  4II1 A;  2KYM A;  5GAN j;  3EG9 B;  4KH1 B;  3OYF A;  2OTL A;  4C8Q F;  2XU8 A;  2P0P A;  1H3Z A;  2HBP A;  1RAE B;  1Q86 C;  4LD6 A;  2EQM A;  3FLG A;  3M9Q A;  2RA2 A;  3EGX B;  3CCU A;  3CCQ A;  3A1P A;  3E19 A;  4JDS A;  1VQ8 A;  4LDV A;  4E7J A;  2OAW A;  4PL6 A;  1DJ7 B;  2FG0 A;  3CMA A;  2LZ6 B;  4DBR A;  3CPW A;  1T3L A;  3FEO A;  2KY9 A;  1ZUU A;  2COW A;  2W10 A;  1BI2 A;  4O6J A;  2C0O A;  1PD1 A;  2L8D A;  4KUL A;  2AKL A;  3OS0 A;  2P0Q A;  1BK2 A;  5IHI A;  2M0O A;  2CP7 A;  3NPF A;  1WA7 A;  2ZZD A;  3O8V A;  1QVF S;  5M9O A;  1M1K C;  3MP8 A;  1UB4 A;  2LX9 A;  3V7S A;  2RD1 A;  3G1J A;  3JCM h;  4FYV B;  4XTX A;  4X1V A;  3CD6 T;  1W1F A;  1TSF A;  2LJ1 A;  2X4W A;  2LCL A;  2VVK A;  2AIR B;  3C94 A;  4JRI A;  5GAM g;  4C0Z A;  3TVT A;  5I22 A;  5FWB A;  1N8R R;  3AT1 B;  1BCM A;  3CC7 Q;  3I56 A;  1PD0 A;  2AZS A;  4GLK A;  4RMO A;  2K3X A;  1VQ5 T;  1SSH A;  4DBF A;  3JCM b;  3G4S A;  3JSC A;  2CKK A;  3JCM c;  3J81 E;  1RL2 A;  3VYH B;  1BI0 A;  2R58 A;  2FZK B;  2EQK A;  3HFN A;  5CVI A;  1AWX A;  3CPW S;  1QWE A;  4PJO A;  4OMM A;  3VUZ A;  5KYW A;  1SG5 A;  1SEM A;  4M77 B;  3CBP A;  4D8D A;  2P0K A;  1VUB A;  5LJ5 g;  2ZPH B;  1VQO T;  4JS4 A;  4ME7 A;  1D0X A;  1X75 C;  2RQT A;  4MDW A;  4Y28 E;  4C0G A;  3A5Z B;  3EFO A;  4BE0 A;  1SHG A;  5CKF A;  3CC2 T;  2HL5 C;  5GAO r;  2YRC A;  1CKB A;  2CH4 W;  1HSQ A;  3CBO A;  3QYH B;  2F69 A;  4C92 D;  1W6X A;  2YUO A;  3OS2 A;  5GAO m;  2EJF A;  3CCU Q;  4LNP A;  3CCQ Q;  3UT1 A;  3HPW A;  2FYK A;  1QCN A;  1VQ8 Q;  3OS1 A;  1U8R A;  2YSQ A;  1PRL C;  4OMO A;  4L59 A;  5LJ3 f;  2NUP B;  4M75 F;  3CMA Q;  1VQ4 Q;  2PUK B;  1AD5 A;  3MCA B;  5J39 A;  2JTE A;  2D9T A;  4B9W A;  3GOX A;  1LPL A;  4JUV A;  3TSW A;  4P5N A;  2M51 A;  5KYY B;  8ATC B;  2W0Z A;  3L42 A;  4OMP A;  3H6Z A;  4PK4 A;  2JVV A;  1H64 1;  1QQJ A;  1BU1 A;  4EDU A;  1VIE A;  1OPK A;  3I35 A;  2K3Y A;  3LGL A;  2CRE A;  1M3A A;  4GY5 A;  2HCK A;  2J6O A;  4NL3 A;  3CBM A;  1ZQ1 A;  1D09 B;  2RQW A;  2SEM A;  1Q7Y R;  1O9S A;  4XU1 A;  3P8B B;  2FPE A;  1X01 A;  1ZA1 B;  5GAN 7;  1I5L A;  2DXU A;  5HCK A;  3UDC A;  2JM8 A;  1D3B B;  1JXO A;  2FRY A;  1K4U S;  2QA4 A;  1JJ2 A;  4OML A;  3X25 B;  4HKE A;  2A0F B;  3CME A;  1VQK A;  3EG3 A;  1ZUY A;  5C0M A;  3I56 Q;  1UTI A;  3EG2 A;  2EJG A;  2E5Q A;  4NOY A;  5IXF A;  3EHR A;  4QQ6 A;  2BUD A;  4ZGJ B;  3G4S Q;  3P8D A;  2DX1 A;  3OYL A;  4M78 G;  2QYZ A;  2YHT A;  1W2B A;  1Y07 A;  3MP6 A;  2EIF A;  4A4G A;  2E3H A;  1QKW A;  4C0D C;  1A0N B;  1D0Y A;  2R57 A;  3I9Q A;  2LJ0 A;  2ZAE A;  5I21 A;  3HRT A;  2QGF B;  4Z02 A;  2MMP A;  3EG1 A;  2E6N A;  4CI0 C;  4J7I A;  2CS7 A;  1WJQ A;  5D6Y A;  5EG2 A;  4EMK C;  1M8V A;  2OJ2 A;  1NJI R;  3UA7 A;  3M57 A;  4FU6 A;  3A8H B;  1M90 U;  2JTF A;  3FRN A;  3CCE T;  1N9S A;  3PNW C;  4NL2 A;  1VOM A;  1FX7 A;  2G3R A;  2COY A;  4C92 C;  2RMO A;  3G71 Q;  3I5S A;  2RHX A;  4HXJ A;  4GLM A;  4J8O A;  2YLB A;  3QYG B;  3JB9 I;  1T0J A;  5FLX E;  5HK3 A;  2M1H A;  4ZNX A;  3S3N A;  2DTO A;  3FB9 A;  3MEV A;  2DM1 A;  4JJB A;  1S72 A;  3QKJ A;  5KE2 A;  2RH2 A;  3OYD A;  1JJ2 S;  2PUO B;  4L5G A;  1PNJ A;  3EFR A;  5D6X A;  3OYE A;  2JUF A;  4RCC A;  4ZGE B;  4RTU A;  4OMF B;  3VV0 A;  2HL3 A;  3QWY A;  5HY6 A;  4OP0 A;  2JOY A;  3UA6 A;  3GF5 A;  2QAS A;  1W2B S;  1YHQ A;  1IRE B;  1WDX A;  3VS3 A;  3FDR A;  2DXT A;  3VU3 C;  2DTI A;  2EVR A;  1HXD A;  4C8Q C;  3R6O A;  2MWP A;  3M56 A;  1JBM A;  2AT1 B;  5CCA A;  2JTM A;  2YLC A;  3U23 A;  1VQ6 A;  1VYV A;  2DEQ A;  2ECZ A;  1QMC A;  2H8H A;  2X4J A;  5LJ3 d;  1AVZ C;  3VS5 A;  4QW2 A;  2C0T A;  1YBY A;  4FYX B;  5ECA A;  3CME Q;  1VQK Q;  3EGD B;  1QVP A;  1WQW A;  2QGG A;  2EBP A;  5AT1 B;  1Q95 G;  5LJ3 e;  1H3H A;  2CZ0 B;  5CKE A;  5KYX B;  4F7U G;  2KSS A;  1SRL A;  2XMF A;  5IXB A;  1MMA A;  1ABQ A;  3DKM A;  3EG0 A;  1VYU A;  3QXE B;  1KC8 R;  1TG0 A;  1GBR A;  2RI2 A;  1MNE A;  4IUU A;  2RHI A;  2RJD A;  4CRI A;  3A8L B;  5HKC A;  1OU8 A;  1EZZ B;  3I5R A;  3TQ7 P;  4M78 E;  2R5M A;  4KGV B;  2A36 A;  1WHL A;  3Q1J A;  4N4H A;  2LT1 A;  3QJ6 A;  2ENM A;  2GFA A;  3WXM B;  4F7U B;  4JPB W;  3L2Q A;  1X6O A;  4C92 G;  4C0D B;  2K3B A;  1H92 A;  5CKH A;  2L3P A;  4KBM B;  4M77 D;  1OV3 A;  3FC3 A;  2JS0 A;  2DLP A;  4D8K A;  1MMN A;  1D0Z A;  3H0I A;  1KIK A;  3PVQ A;  1AHJ B;  4EMK B;  1ZA2 B;  3V7R A;  1OU9 A;  5A2Q E;  1WHH A;  3E9F A;  2D0Q B;  3N5B B;  1N8R U;  3QSU A;  1JEG A;  5IHK A;  2ZPG B;  3QHS A;  4JRP A;  3MET A;  3CCR T;  4C92 B;  1M1G A;  1QVG A;  2HZY A;  2DE0 X;  1QCF A;  4PLI A;  3QDR B;  4HVV A;  1BIA A;  1OZ3 A;  2HSE B; 
#chains in the Genus database with same CATH homology
 5GJV B;  1UGV A;  1AWO A;  3EHQ A;  2A08 A;  1WXB A;  1NM7 A;  4A63 B;  1GFD A;  1U06 A;  1YWP A;  3LH5 A;  2HSP A;  1M27 C;  2LQW A;  1JO8 A;  2OAW A;  2FG0 A;  2LZ6 B;  1T3L A;  4M4Z A;  2ED0 A;  2HEQ A;  1ZUU A;  2CDT A;  4KRT A;  2W10 A;  1X2Q A;  1U5S A;  3GBQ A;  2K9G A;  1YN8 A;  1OEB A;  2C0O A;  1T3S A;  3M0U A;  2AKL A;  4R0K A;  3PE0 A;  1N5Z A;  4F14 A;  4JZ3 A;  1BK2 A;  5IHI A;  5L23 A;  2KR3 A;  3SEM A;  3NPF A;  1WA7 A;  2RNA A;  2GGR A;  4J9B A;  1TUD A;  4LE9 A;  3PVL A;  4J9F A;  3ULR B;  4X1V A;  1ZUK A;  2YUN A;  1W1F A;  2ROL A;  2JMA A;  2O2O A;  2IIM A;  1X6G A;  2LJ1 A;  1QKX A;  2O9S A;  1GRI A;  4DEX A;  2OI3 A;  2VVK A;  1MV3 A;  2DL5 A;  2L3S A;  2YDL A;  2LMJ A;  5I22 A;  3TVT A;  5FWB A;  3UAT A;  1ZBJ A;  4ESR A;  1U3O A;  2CUB A;  3VS0 A;  4RTT A;  1K1Z A;  3KFV A;  1WLP B;  2AZS A;  2EYX A;  3JV3 A;  2LP5 A;  3O5Z A;  1SSH A;  3NHN A;  2M0Y A;  2KEA A;  2F2X A;  2L3Q A;  4K11 A;  1E6H A;  2EQI A;  1CKA A;  2BZY A;  1I1J A;  1WFW A;  2AK5 A;  2D0N A;  2HDA A;  2ROT A;  1UG1 A;  3UF4 A;  1RLP C;  2GQI A;  1YCS B;  2VKN A;  1AWX A;  1K76 A;  1QWE A;  2B86 A;  4OMM A;  4OMN A;  1SEM A;  4D8D A;  2KXD A;  2I0N A;  1X2K A;  2RQT A;  1XOV A;  1SHG A;  1GBQ A;  2O88 A;  1TUC A;  2AKK A;  1CKB A;  2CH4 W;  1HSQ A;  4HCK A;  1Z9Q A;  4F16 A;  1W6X A;  2PNI A;  2YUO A;  3VS7 A;  2KRS A;  4LNP A;  4J9E A;  2FO0 A;  4HVW A;  2DYB A;  2F2W A;  2YSQ A;  1Y57 A;  1PRL C;  4GBQ A;  4OMO A;  1AZG B;  3ZL7 C;  2MIO A;  1M8M A;  1AD5 A;  2JM9 A;  2KGT A;  2JXB A;  3C0C A;  1Y0M A;  2JTE A;  1PWT A;  3SHW A;  2G6F X;  3M0T A;  2DBK A;  1E7O A;  2D8J A;  3TSW A;  2EGC A;  2M51 A;  2CT4 A;  2J6K A;  2D8H A;  2YUQ A;  2L0A A;  4CC7 A;  2KNB B;  2W0Z A;  4OMP A;  1MUZ A;  1HD3 A;  1K0S A;  1UJ0 A;  1Z9Z A;  2O9V A;  3RNJ A;  1BU1 A;  2GBQ A;  2BTT A;  4IIM A;  1OPK A;  1SPK A;  2MOX A;  5IH2 A;  1V1C A;  3I35 A;  2CRE A;  1M3A A;  2EGE A;  2HCK A;  2J6O A;  4LUD A;  1B3Q A;  4RTY A;  2DL8 A;  1ZX6 A;  2EYW A;  5I11 A;  4ORZ A;  2RQW A;  2YUP A;  4J9G A;  1NEG A;  2JT4 A;  2KYB A;  2SEM A;  4LUE A;  3REB B;  1J3T A;  2FPE A;  5EC7 A;  2SRC A;  4CC3 A;  4CC4 B;  1AOJ A;  5HCK A;  2KRM A;  3H0F A;  2JM8 A;  1JXO A;  1UDL A;  2FRY A;  1PKS A;  2X3X D;  1NLO C;  3VS1 A;  1K4U S;  4CC2 A;  4OML A;  4F17 A;  1HJD A;  1I07 A;  3EG3 A;  1ZUY A;  3M0P A;  1UTI A;  2DRK A;  3EG2 A;  3RBB B;  5IXF A;  3EHR A;  1JU5 C;  1X27 A;  2NWM A;  1B07 A;  2X3W D;  2GNC A;  2AZV A;  2DX1 A;  3QWX X;  2DF6 A;  2LJ3 A;  1UFF A;  4DEY A;  1K0X A;  2V1R A;  4Z89 A;  1WX6 A;  1QKW A;  2QDL A;  1A0N B;  1SHF A;  1UEC A;  3EGU A;  2O31 A;  4RUG A;  3I9Q A;  4AFZ C;  3VS4 A;  2KRO A;  2LJ0 A;  2DA9 A;  3H0H A;  1FMK A;  2LNH B;  4RTX A;  5GJW B;  3EG1 A;  2RPN A;  1QWF A;  3CQT A;  4Z88 A;  1K9A A;  1UUE A;  2RQV A;  1FYN A;  4AG1 C;  2DBM A;  1M3C A;  2DJQ A;  2OJ2 A;  1VA7 A;  2A28 A;  3UA7 A;  4JJC A;  3REA B;  2DRM A;  2CT3 A;  2KXC A;  4E6R A;  4Y92 A;  1PRM C;  1GFC A;  3FJ5 A;  2K6D A;  1PHT A;  3M0S A;  1UE9 A;  1KJW A;  1UHC A;  2EYZ A;  1UJY A;  2RMO A;  3M0Q A;  2JMC A;  3I5S A;  3THK A;  1RLQ C;  2EGA A;  1MV0 B;  4HXJ A;  3VRZ A;  4QT7 A;  4GLM A;  1T0J A;  4ZNX A;  4JZ4 A;  4J9H A;  1LCK A;  1M30 A;  2CH4 A;  1OOT A;  2DM1 A;  4EIK A;  4JJB A;  1W70 A;  3NMZ C;  1X69 A;  4AFU C;  1CSK A;  2FEI A;  2J06 A;  1IO6 A;  1WI7 A;  2J05 A;  1GCQ C;  1I0C A;  1PNJ A;  4RTZ A;  1JXM A;  2K7A A;  1RI9 A;  4WCI A;  1E6G A;  1YNZ A;  5FW9 A;  2CUD A;  4RTU A;  3QWY A;  2KBT A;  1SRM A;  2KE9 A;  1KFZ A;  3VS6 A;  3UA6 A;  5FWC A;  2PZ1 A;  2FPD A;  2P4R A;  4J9I A;  1AWJ A;  3VRY A;  1WDX A;  2LX7 A;  2DMO A;  3VS3 A;  2PTK A;  2EVR A;  1PKT A;  2ED1 A;  3VS2 A;  2NUZ A;  1WXU A;  1WXT A;  2ESW A;  3U23 A;  3R6N A;  1G2B A;  1G83 A;  2E5K A;  1KSW A;  1VYV A;  1AWW A;  2KT8 A;  4OMQ A;  2D1X A;  2ECZ A;  2RQR A;  2H8H A;  1BBZ A;  3IQL A;  1AVZ C;  2F2V A;  3VS5 A;  2EW3 A;  2DIL A;  4LN2 A;  4IIO A;  2C0T A;  2DL7 A;  2KT1 A;  3NGP A;  2A37 A;  5ECA A;  3TSZ A;  3A98 A;  2L2P A;  2EBP A;  2LQN A;  2DVJ A;  1ABO A;  1ZLM A;  2V1Q A;  1H3H A;  4J9C A;  1SRL A;  2XMF A;  2GTJ A;  3H41 A;  2YT6 A;  5IXB A;  1H8K A;  1ABQ A;  3EG0 A;  1VYU A;  1GL5 A;  2KRN A;  4RTV A;  4J9D A;  2DNU A;  2GTO A;  1TG0 A;  1X6B A;  2C0I A;  2J7I A;  1GBR A;  2J6F A;  1WYX A;  1WIE A;  4JJD A;  3I5R A;  5IHN A;  4AFS C;  1AEY A;  2LCS A;  2A36 A;  1RUW A;  1NLP C;  1NYG A;  2DL3 A;  1AZE A;  2CSI A;  2K2M A;  2JS2 A;  1NYF A;  1S1N A;  2VWF A;  4FSS A;  2ENM A;  2DL4 A;  1ZSG A;  4JPB W;  2BZ8 A;  2FPF A;  2MCN A;  2JW4 A;  1EFN A;  2K3B A;  1H92 A;  2RN8 A;  2FRW A;  2L3P A;  1QLY A;  2CSQ A;  1JQQ A;  1UHF A;  1OV3 A;  2JS0 A;  2DLP A;  4D8K A;  1OPL A;  1YP5 A;  4HVU A;  2BZX A;  2EYY A;  3H0I A;  1KIK A;  3PVQ A;  1T0H A;  2HBW A;  3M0R A;  2EPD A;  1GCQ A;  2RQU A;  1NG2 A;  2RF0 A;  4RTW A;  1YWO A;  1X43 A;  1GCP A;  1VYT A;  4Z8A A;  1ARK A;  1JEG A;  5IHK A;  2EKH A;  4AG2 C;  2KYM A;  1BB9 A;  2K79 A;  1NEB A;  2ABL A;  1QCF A;  2DE0 X;  4AFQ C;  4HVV A;  1M3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...