4AG4L

Crystal structure of a ddr1-fab complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
210
structure length
210
Chain Sequence
DIQLTQSPALMSASPGEKVTMTCSASSSVTFMYWYQQKPRSSPKPWIYLTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSNPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPITHELIAL DISCOIDIN DOMAIN-CONTAINING RECEPTOR 1
publication title Structure of the Discoidin Domain Receptor 1 Extracellular Region Bound to an Inhibitory Fab Fragment Reveals Features Important for Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/transferase
total genus 49
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2012-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ag4L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ag4L01
2IEPA 2XNAA 3LKSB 1C16B 1FNEA 4WW2F 5CHNB 5J1TC 1P7HL 3RKPA 1YEKL 4BUGA 5CUSL 2AVGA 1QRNB 2Z92A 4BQBA 3O3AA 3RIAK 3U36A 2O5YH 4KDTC 3ZDZE 3NACH 3UPAA 4Q9RH 5HDQL 2ADJB 4ODTH 5GJSH 1KEMH 3U0PB 2GQHA 2CIKA 1BQLL 4I0PA 5DS8A 4FQCL 5JW5B 1HEZB 2BMKB 2F19L 3LOWA 3NFNB 2X4PB 1U8KB 2R23B 4KTEL 4KKCD 4KUCF 3Q3GB 4G8GB 4ONFH 5GZNC 5EOTB 5GGSB 1HCVA 2N56A 3DJ9A 3KPOB 1X5ZA 5ID0A 4XPAL 3P4NA 5D7IE 4RNRA 1WBXA 5H37G 5JO5B 1QSED 2QADD 1BBDH 2DBLH 3T3PF 1JTTA 4IOFC 4LHJB 4YXKL 1B0RA 4YBQD 4NO0B 3NPSB 1YPZE 1T03H 1MFCL 4ZO6A 4LFHG 3H3KA 3NIGE 2BNQA 4G8IB 4GW4A 2CGRH 1K4CB 3QEUA 3VRIB 1FGVL 2HT4C 3PGCB 4OBRA 3TBVA 3I75A 1VDGA 5GGTL 2BHYA 4KROD 5I8KH 2R4SL 5JMRA 4ONOA 5SWSA 1BZ7A 5IB1A 4LLWA 4UDUA 2BERA 1JUFB 3TFKC 3N0PB 3D69B 2VXQH 4AEFA 3PWJB 3S96B 4FQ2H 3NABH 2Z4QB 4RWYH 5TE4H 5JQ6H 1IKNA 3BEWB 3MRMA 1BHGA 2VLKA 3C60B 2YBRB 1LK2A 4G6AC 1NMAL 2ICWB 3QZWG 2APXA 2R69H 5IK3A 1HNFA 3BT2H 3CPLB 4HCRA 4IIQA 1RUAH 1ZVYA 3EJYD 1MUJB 5CD3B 5B3NA 1QSFD 5IB4A 5ALCL 2HJKA 5C2UB 5I1LB 4OKDA 5DSCB 3IFOB 1MH5A 2JJSC 3MBED 4HMDA 3GSQA 5KN5A 4XBEL 4LMQI 3OGCB 2WUCL 3T08A 1H8SA 1UWGH 3B5GA 4HKXA 5DEGA 4ZD3L 3VA6A 4HFWB 2OI9B 2VDOL 4HUWA 4OLYH 4DTGH 3KJ4C 5EU4A 4KUZH 3EHBC 4LQFH 3I2CL 4EI5D 2R4RL 3OZ9H 4X8JA 4YHZL 2JJTA 3QI9D 4XMKH 1KLUB 4PJIE 4P5KB 3KXFD 4PRPD 3WFDL 1FAIL 3QCTL 4L8CA 5CILH 4YDLC 2CO7B 3PABB 2EH8L 3QUXC 3RWJB 4ZPVA 2EDFA 2OYPA 5CJ8A 4B7IA 4LSQH 1QLRA 2A83B 4HGWB 4QRSA 1MCPL 2CUHA 3OF6D 3SDXA 1ZVSA 4YIQA 3GMOB 2YWZA 1AGCA 4NZJA 4JO3L 5INCA 1NAMB 1J5OL 2KQMA 4WNQB 4YQXH 1EO7A 4PFEA 3LKRB 2P4AB 2YN5A 3HRZB 1JPGB 1MWAL 3BWUC 1U36A 1KTDB 3I6GB 3CNKA 5MHSD 2CLRA 1ZOXA 4NJ9L 2XWTA 1AXSB 4K7FB 4WUUB 3MFFA 2EYTB 4NBXB 5J9PB 2DQHL 3W11C 4AM0A 4RRPG 2FX8H 3QJHA 1EK3A 3BPLC 4APQB 4AYFA 1RUKH 1T04B 2OXGA 4FZEL 1IC4H 3PUCA 4QO1A 5BRZE 4W4OC 3VFUA 4PJGA 1FSKC 3IFNL 2JCCA 5D70H 3DX8B 2FGZA 4WJ5B 4NKQB 2ITDB 1MHPH 4KRMB 3TPUA 2AK4B 3F62A 2JB6B 4JKPL 4RFOL 3JWDC 5IMOA 2B2XH 3JWDH 5IHUH 5E8DH 5JW4R 1GVIA 4O2FA 4HJJL 3T4AA 4X6EA 2EZ0D 2ZUVA 4GAJL 3WJJA 3SDCA 4L29A 1QBAA 1WIOA 5DI8B 4PRHB 5EO0A 1MCIA 2Y07H 4DEPC 3NIFE 4ZFFB 5FB8A 4JFFE 1MJUL 4KXZH 5E99H 4LKCA 4Z7VE 4ZXBD 5BJTA 5C0CB 5C09E 4CU6A 4WO4C 5J7CC 4LCWA 5CZXC 1UXWA 3OKKB 2F5BH 2W65A 1JHLL 1S9XA 4J6RH 2QLVB 1VFUA 2CDFA 4BYHA 4X7FC 5EB9A 1G0YR 3D2UA 2AJXH 3SKNA 3H8NA 4EQ2A 4PRIE 2EDXA 3KR3H 5CEZD 2PXYA 3G6AB 4DAGL 2GCYA 1CK0L 3D0LB 3QCUL 5JPMB 1X5XA 2LU4A 5HXMA 4FS0A 5C9JA 3GSOB 2IBBA 4DGVL 1T5WB 3GBML 3WFZA 3W9EA 1FZKA 1NFIB 4R4ND 4KK9D 4I1NB 1WEJH 2J8OA 1NC2B 2DJUA 5DJ8B 3O3BA 2MWCA 4PJ7A 4RX4D 1NGWA 5F9DC 1G1CA 1JNJA 1ZA3A 4PBXA 1A7PL 2FL5B 3N50A 2UZIL 1WFNA 4WI7A 3EOBA 5ADPL 2B1HH 2YPVH 1O7VA 2P49B 4JFYA 2DLTA 3GSNA 3IDJA 1KB5A 3LEVL 3RL2B 1FFNB 4KVCL 4Z78A 5JIHA 3AS3A 1YEKH 3UJJL 4XWGL 2WSKA 3I50L 3RY5A 1PFCA 3R0MA 2ZCKL 2NNAB 4F9PC 1RZIB 1BQLH 2DD8H 1P4LB 3D39E 4NQXA 4F33B 3DYPA 5EU7C 5HYEA 4FQCH 3AREB 4GRLD 2WK2A 2F19H 3OKYA 4L8DA 2RBLA 1S78D 2VDKL 5DRZA 3UBXI 4Z76A 3ARGA 4U6HA 3HE6D 4FOMA 3O0RL 4JB9H 1D5BA 5IB5A 3VGAB 1FL6B 4ZFZA 4KDWA 5BW7C 2GYSA 1DCLA 3BHBB 4NJAL 4Y4KB 1VHPA 3FQXB 1O0VA 4YXLL 2AXHA 2DWEB 2X4UB 3K80A 1WCQA 4LDLB 1G7PA 4ELMB 4GUPB 3T77B 1JMXA 4LAJH 5DURB 1MFCH 4MDJA 3TYFB 3MJ9H 2B0SL 3UDWC 2W38A 3ZKSD 5BZDA 2OMNA 5BV7L 3SGKC 3RZCA 3Q6GL 5L88L 1FC1A 4BH7B 3TVMB 1YN7A 5GGTH 2JK5B 4ONHB 2WINA 5D5MA 5JPNA 1UQSA 2D03L 1JZ8A 4XGZB 2OTWB 2I26N 3KPTA 4HGKC 2QHLA 4MA1B 2E7BA 4X4YB 4BH8A 2LAAA 5E5MA 3RNKA 1J1PL 2F53E 5HY9A 4P59H 1SJEB 1WZKA 1GXEA 4QRRB 1T1WA 3R1GL 5F7NC 5TFSH 1DUZA 2D31A 4OZGA 5DK0B 4KJYA 1DE4A 4IRSD 3GI9L 5EOCJ 4GKZA 1N4XH 4JY5L 3ULSA 1TVBA 4PIRF 4ELMF 4P57A 1QR1A 2ZUQB 2GW5A 5ALCH 5DEZA 2P5EE 2PO6B 5ESAA 1DBJL 2DKSA 2E6QA 3ZDYF 1T0NB 5B8CC 1S7UA 2QSCL 1G7HB 5TDPB 3I6LE 3QBTB 4JLRA 2APBA 1ZMYA 3VW3H 4LOUC 2VDOH 1X5HA 3C8DA 3ARDD 4O2EB 2BXZA 3MR9A 1L9NA 4OSUL 4LNVA 5CMAA 5HYJA 1DDHA 3MRBB 5ECJE 4TOYH 3NTCL 2K3TA 5ISZD 1QHOA 4NC1E 5CGMA 2DICA 1U8NB 3DX7A 1FAIH 5FUCE 1UWEL 3EYSH 4NKDA 4TQEH 3ZT5A 1CICC 3IYLW 2P5WA 3PP4H 5DJ0B 3RL1B 2KKQA 4YHNB 3TT1H 2RFXB 4NO0D 1NBZA 4MGXA 4ZTPH 5DUMH 5IW3A 8FABA 1HZHL 5ANMA 4HAFA 4J12A 5DD0H 2NW3B 4JO3H 4QXGH 2WWMD 1J5OH 5I1KL 1IRAY 3D48R 1SBSH 2V2WA 4I48A 3O6LH 3BMVA 2V17H 3RY6C 2Y1VA 1F00I 4KI5F 5DMGC 2YPLA 4JN1H 3GSUB 1RUML 4JRXE 4D0DA 4XCEA 2VXUL 4OLUH 1X5KA 4OZIA 1I85A 3PJSA 4LEOB 1J7VR 4QTIL 3V0WH 3BFOA 1OSZA 1TZIB 4CVXA 2QSVA 3G6JA 3EO1B 2XI9A 2O61B 4ZAKC 4CJ0A 3IRPX 5CINL 4FZEH 3ZKXB 1ZV5A 2VABB 3QUKA 2PW2B 2QR0A 3MA9L 4PJ5D 5IW1A 2DTML 3IAPA 5K33A 4HUXB 3GHBH 1LDSA 5ID1B 1CN4A 2UYLB 4OM0L 3KDMB 4DZ8A 5T3ZH 2GEEA 4JKPH 3D9AL 1PKOA 4M93C 3V6OA 1PKQA 4X4XA 3SDAA 3V95A 5ITBH 3RWFA 2NY1C 3QQ9D 3SE8L 1T7VA 1XZ0B 5TH2B 5KAQF 3GM8A 3N1QC 2FYYB 4QRUB 1QLFA 1X5FA 3BN9C 1CQKA 1BZ9B 2DM4A 5DJCB 3B2VH 4GAJH 3SEPA 3VWJA 1HHHB 3B5HA 5DJXA 4WV1C 3QIWA 2BK8A 1AH1A 3MRCA 3BPCB 3T0ED 4X7TA 3TJHD 4JVUA 3LEYL 4Q0XH 5MEOA 3WJLC 2F58H 1R3LA 1LO5B 4YGVB 2BVYA 5LQBL 1D5ZB 3Q6FA 1B3JA 5DK2A 4M43H 2OLDA 2GJ6B 1JPFB 5IIEB 4Q97A 1GGYA 1R24A 3PL6A 4LLMB 5F88B 4TVPL 1IVLA 1U8HB 4H5SA 3U2SB 2E7MA 4K8RH 4LF3B 4F37F 4M7JH 3FFCA 3BAEL 4J4PC 5D93C 2WLZA 1YMMB 3L3KA 2HH0L 2MSPA 3HG1B 4NRZB 5CEZL 3ZYJA 1NLBL 5FYKU 5CAYB 3FB7B 4WUUD 4DGVH 3B43A 4M7ZB 4U2YA 4FXLA 2FX9H 3LSOA 1I1FA 2CD0A 4LRNL 1TLKA 5J3HD 4HFUL 2NXZD 4OAWB 5HGHA 2A6KB 2D3VA 4UV4L 4APQD 4LLYB 5F9OL 5FYKE 4N1HB 3BKMH 4OM1L 3MLZH 3ESVF 1A2YA 2A6JB 1MIEL 2FIKB 3QUMH 1VFBB 4AENA 4WI2A 4NC0B 4Y5XB 3UZQA 2R39A 5IJVB 5J6GA 5IJKC 3N1FC 2DQDL 5D1QD 1P84K 1AQKH 2D7OA 3S35L 5J6HA 1TITA 2BVEA 3H42L 2WV3A 5D7LA 1MHCA 2PYEA 3LS4L 1M7IB 4NSKB 2Y72A 4PTTB 4F2MB 1CLOL 3K2UH 1KIQB 1NSNH 1ND0A 5IB2B 4QXWA 2H1PL 4JZNA 3UYOD 4QGYA 4YHKH 2VC2L 1XR8A 3CSYB 4HXBL 5I16A 4IS6A 1J0KA 5D7IB 1OVZA 2LE9A 4F7CA 5IQ9B 3CAFA 1QNZH 1ZTXL 4KDTA 1YPZB 5TGBA 3QIUD 4MD0B 3O0RH 5C0CD 1OGTA 5C0JB 4NJAH 4KKCC 4JQVC 4H20L 2AJYH 3MV11 4R4FH 3RWGA 1KIPA 3R8BB 5EO9A 3UBXB 4U1SA 5IMMA 2VZTA 4GRWE 3RZWA 4JQXC 4MAYD 5CIPA 2QADC 5D9SB 5BV7C 2B0SH 4YBQC 4RZCA 1WITA 3FQTA 4XZUA 4JY4A 2E7HA 4R2GB 4OT1L 3DHJA 3IF1B 3QIBD 4PJXF 4MD5B 2I25N 4JRYD 3NZHL 4JFHD 3CK0L 5EZJA 4KROC 1K5NA 3KNBA 3QNXA 4JFDA 1I9EA 3H0TB 2RB8A 1INDL 1Q9WB 3GIVB 2Y5EA 2PCPB 5MENB 4HIXL 2H8PB 4DK6A 2DQTL 1JL8A 5E24E 3JV6B 4X6CB 3BW9A 4V2CB 3KHQA 4MDIA 5ERWA 1NFDA 4D9RD 3HC3H 4EN3D 4H1LG 2O93L 2Z91A 4I4WB 1LDPH 2FHFA 3FN0L 3S37L 3BEVB 4XNMB 3BWAB 4KPHL 4HS3A 1NMCB 2J8HA 4PR5B 2X1OA 2YKLL 2MFNA 2X4RA 1RUQL 3MBEC 3LS5H 5FA4B 2YZ8A 3KVQA 4Z7NF 5EWIH 4NM4H 4NT6B 1NGYA 3SE9H 3ARED 4R0LC 3KPRA 2H6PA 3PGFL 5C0GB 5C0FB 3WUWA 2NY2D 3VD3A 3NTCH 4HUVA 1LNUA 2JJSA 1ZVHA 2E9BA 4XRCB 4EI5C 5FECA 4X0KA 5BS0A 3OXSB 1I3GH 3QI9C 4X6CF 4Y4KD 3DX9A 2BJML 5F6HJ 1MCEA 3HAEA 5EZLA 1LO3L 4M7KH 2G2RA 4L4TA 3P4OA 4CAGA 4O00A 1EFXA 3QXVA 2CKBB 5IMLA 1BEYL 4PGBA 5CP7A 1S9KC 1PY9A 3LMJL 4G8EA 5I74C 4DVBB 5D2LA 4ZOCA 4BZ2L 1Z3GH 3HFML 4OJFL 4J23A 5DVKA 3EYFB 3MRQA 3QUXA 1IM9D 5CWSA 2HKFL 1AGEA 4XVTL 1JE6A 1QD0A 3EDEA 4RAUB 3SDXE 1IT9L 3VXTB 5BRZB 2IFGA 1V7ML 1WCBA 2DQIL 3UPRA 1FVEA 1S9WA 1JPTL 3GSXB 4LIQE 4B41A 5C0DB 4QRRD 1EUUA 3QFDA 5EPMB 2HFFA 4NQSB 4A6YL 2EDQA 4K3JL 4MHHI 3TWCH 1R3JB 1TPXC 5CINH 1YEFH 3BKCH 3MA9H 3S4SA 2H41A 4Q58C 4D0BB 3EYOB 3UC0H 2B1AL 5E1AA 3IXAB 2PO6D 3IXTA 3MLVL 1XF2B 1AY1H 5HVGB 2XFXA 4MJ5B 3KWWB 3SE8H 5F9WB 4C83A 3CFEB 3ROOA 3VFVB 2VZSA 2WBWB 1A7RH 4W4OA 2NPLX 2X4NA 4KI5D 5KJRH 3VFGH 3AUVA 2R0KH 1ETZB 5GS2D 3TIEA 4TPRH 3ZT6A 2EZ0C 5IEHB 3MOBH 1GL4B 2VN7A 4TSCL 5E9DD 1S5IL 3NFPA 3V6ZA 3U0WH 1A14L 1KJ3H 4O5LL 1YEDA 1NL0L 4PRIB 1CD0A 5LQBH 2CMRH 4PJEE 4ZXBC 2WZPD 3DVGB 2CRMA 5FA3B 5BCAA 5IT2L 4PV9B 4CU8A 12E8H 5DQ9A 3OG4B 4CDGC 3EO9L 3VXNA 4JREB 1B0GA 2JF1A 1NGPH 3BQUB 2P8PB 3ARVA 4YUEH 3VD4A 4QEGA 4LCWE 3ARYA 4N0FB 3TLRA 3BAEH 4JAMB 2FR4A 1DL7H 1TZHA 4WCYL 2OM5A 5E8NA 2FO4A 1HILB 4PGDA 3SQBA 5CEZH 1HWGB 4XH2A 1Z9LA 1FPTL 5KSVB 3ELAT 3RAJL 4HXAL 1ZKAA 5DWUL 5C8JA 4LRNH 1GC1L 4HHAA 3CDYA 1DQLL 4HFUH 4GS7C 4PLKC 3KPSA 4R4NC 4KK9C 3JVGA 3FQNA 1G6RB 3ZTJG 4I0CC 3VCLB 5F9OH 1BQHG 3MOAH 4L5FH 3TNNB 1JPST 3E3QE 1MIEH 1ED3B 1YZZA 5C0AB 5IW6B 3S34L 2FECI 4X99B 4PJ7E 3D39B 2X2YA 4XVJH 2BVPB 2WWKT 3GJFH 1MCSA 4NQDB 3PHSA 1UC6A 1KYOJ 3IDXL 1JWUB 3EOYG 1T1XB 4RFNC 1S7QB 1CLOH 3KLAA 4YFLI 4UV7H 3M17A 1MJ8L 4JPIA 4WTZA 4U33A 3SPVA 1FL3B 5DHXB 1SVZA 4XBPB 4KGJA 1U2HA 3D6GA 3L3GA 2JELL 2K7PA 4GRLC 1MCQA 1G7JB 1ZTXH 3BH8A 4E9LA 1S78C 1JGUH 4NPYB 4U1KA 1JMZA 4F9PA 3FO2A 3GO1H 1K8DB 3HE6C 5IHBA 4I5BA 1MF2L 2IAMB 2BHZA 4X5XB 1HHIA 4KHXL 5HHOB 1F4AA 5LWYH 1AGFA 3SE3C 5T3XE 5IROA 5MEPA 1HH9A 3RUGA 1Q0XH 5JNYB 4HV8B 4N0YH 2D9QB 1IAOA 4JFEE 3X11B 4OIIL 2A1WL 1DBKL 1KIUA 1U92B 2F53B 1F6AA 3QG6B 5BW7A 1ZS8A 3EO0A 4MWFA 4I77H 4WFHD 4MJ6B 3KYNB 3MNZB 1QFUL 3HG1D 3I84A 2IH3B 4X80H 1JIBA 5EFIA 3THMH 5I73B 3WEXA 4JE4B 5C7XL 5KANI 5E2UL 4ZNEE 5HI3D 4RIRA 2ICEA 3DYOA 5ALBL 5CEYA 3UDWA 3OR6A 2FEDD 5TDNA 1G7LB 1GPOL 3S6CA 3SGKA 5GGTA 2P5EB 4LPTA 4HIXH 2R1WA 2I9TA 4U0QB 5GS0L 2DAVA 1HYSD 1FZJA 3QHFH 4JDZB 4RGMC 2ZOKA 1G9ML 1YQVL 4X7SH 4D0CA 4IRSC 1BX2B 4Z5RB 2E8ZA 3FCTB 5T1MA 2X6MA 1P4IL 3O6FB 5B3JE 4U1LA 1KG0B 4OZ4A 5KSAB 1Z9MA 4A2MA 3VGHA 4HK3N 2YKLH 3T1FA 2ATKB 2XRAH 1BGXL 2FLBT 4Y5YB 3V0AC 4DGIH 1BFVL 1HSAB 4PJBA 1IBGL 2ADFL 1CFTB 1UT9A 1UH2A 4G8FB 4O58L 4UAOC 5F7MC 1NBYB 1CFSA 3LN9A 1D5XA 2IADB 5J0BA 3PGFH 4NN6B 3ARDC 1MCRA 5LGHL 4LAQL 2J8UB 4G3YL 5B8CA 5JDJA 2XY1A 1MQ8A 5IBUG 3GMQB 4OLXH 3PWLA 2LTQB 1MPAH 3RI5K 1UVQB 3LN5B 3MNVB 1KN2L 1I1AB 1G84A 1LO3H 1CXKA 2E7CA 4HKZA 3RVWD 2ZKHH 5DF0A 3LY6A 5F71A 1CG9B 3W5NA 4K3HA 4JGJA 4HJ0D 4JRXB 3F7YA 2A73A 3TBYB 1VEMA 3HUJF 4DWHA 2DQEL 3U4EA 5EBLA 2CIIA 2YUZA 4KQ4H 4U0RC 2KBGA 1NJ9B 4BZ2H 3I6KB 3HFMH 4TUOA 2PW1B 2WWMC 4LHUA 4GLRI 1CICA 1IFHL 1T0MA 1KNOB 3OX8B 4N0UA 4O9HH 4DGYH 3BZFB 3F58H 4WWID 4OD1H 1BM3L 2ZCHL 2YS4A 3NCYS 5F7FA 2E9JA 1S3KH 2J8UF 4J3WA 1K8IB 2GSGB 2W0KA 3AFLA 4NQVA 5EG6C 1ULVA 2HLFD 1MWAA 5EC1A 3KS0J 3ES6B 15C8H 1MFDH 4LK4A 3RY6A 3VH8G 1CFVL 3CXDH 2PTTB 4FXKB 1H3TA 1NCNA 3BKYH 5EU6E 3HMWL 2V7NA 3STZA 5IOPA 4GBXB 1LP9E 2QSTA 3MLVH 4N0CD 3NCJH 1BLNB 4LEXL 5EBWB 3VFNA 1F97A 5K9OA 5HPOA 3QQ9C 1KCVL 3EUUA 1YY8B 2R8SL 2VKXA 3U7WH 2ZNXA 2VYRE 2VQTA 1PKQE 5DXWA 4AL8H 4UB0H 1Q0YL 4Z77B 4TSCH 2AXFB 5DMJB 3IU3A 5KAQG 3J7HA 3S88L 3FB6B 1A14H 1WIUA 2VAAA 4K07A 2N4IA 3O6ML 1ORQA 4KWUA 3T0EC 3TJHC 3C08H 2DTSA 3O2DH 4HKJB 3AY4C 4HWZB 1MCWM 1WC7A 4OB5L 1QBBA 4JHWH 3EFDL 4OQTL 4X5WB 4F8QA 4IJ3B 4RISL 4YX2L 4PGEB 4WV1A 4DN3L 2DI7A 4PB9H 5ICYB 3QRFM 3K81A 4KU1A 3RWDA 3WJLA 1NC4A 1AKJD 1RJLA 3DXAE 5CP3H 3LV3B 3WFHA 3SKJH 2AEWA 1NAMH 1CQYA 3O2WH 1G7IA 5JHLL 4PYGA 3EFFA 5BRZD 4PRDA 1CS6A 4G9DA 5TDOB 2FEEI 4O2CB 1GC1C 3LQZA 5JORB 2BNUB 4HXAH 4JKMA 4OLWH 4X5LA 1A64A 4JPWL 1S7WA 3NPZB 1DQLH 4C54A 5FF6A 4J4PA 5J3HC 4G43A 3PQYB 1EXUB 2NXZC 3H9SA 4P4KD 5F9JA 1PZ5B 2FLRT 3L95A 4APQC 5GRYA 3ZSTA 2F54B 2VZ3A 5I76A 3JTSA 4XXDA 4UTAL 2XNAB 1FNEB 4LP5A 1K3IA 3SGEI 1FYTA 2Z92B 1Q9KA 3LEXA 3O3AB 5IHZA 3U36B 4HX1A 5DFWH 4Y4FD 1RZKC 4JFFD 4NGHL 1EHNA 5D1QC 3MRIA 3U9UA 1TQBB 3UTTA 1RZKH 2CIKB 4I0PB 4KMLB 2ZUWA 5DS8B 1MJ8H 5GS3A 2XZQH 5C09D 1FYHB 4MB5A 5KG9A 3DUSA 3N1GC 5BVPL 3BN3B 5IJKA 1XF4A 2JELH 3G04A 4XAKE 4GRWB 3RHWK 1P2CA 3ULUF 1XF1A 3OPZL 4PRID 4ODSL 1N8ZA 1YQ2A 1DQJA 5ID0B 3P4NB 5HYSA 4F80A 3QIUC 4LSPH 4RNRB 1MF2H 1YN6A 2XN9A 1WBXB 2XQBH 2HVKA 3G6DL 4PY8I 4P2OD 4MA8L 1MIML 4ODXA 2KZ1B 1B0RB 4PRAA 3BUTA 4W6YB 2CUMA 3QR2A 2BNQB 4GW4B 3IAQA 1S7VA 3QCVH 1SYVA 3STLA 1DBKH 4MAYC 3QEUB 1A21A 3TBVB 3I75B 4KHTL 1N0XL 3K3QA 1LMKA 2X41A 5SWSB 1BZ7B 1L0XA 4LLWB 3HTLX 5IB1B 4UDUB 5HYIA 3KPPA 2GITA 5C7XH 2X89A 3QIBC 4JQXA 4JHZA 4YFLF 2Y06L 4EIZC 1A7NH 3KYAA 3VDBA 3E8UH 4OFYD 2MPAL 3MRMB 3FT4A 1MFEL 2VLKB 5GS0C 1LK2B 2C9AA 3QQ3A 5IK3B 4JM4L 3PXHA 1G9MC 3L1OH 5CZVH 4IIQB 4DN4L 3U30C 4JFDE 3KYKH 1FJ1A 3D39D 1UZ8A 5IB4B 4EN3C 1FIEA 1P4IH 2G5BA 2HJKB 4OZHA 5DUPL 2HJFA 3VU2A 3WDHA 4S1SL 2X1WL 1MH5B 2NW2A 3GSQB 5KN5B 5J56B 3HS0A 3BP5A 1ZEAL 4HKXB 5DEGB 1ITBB 1BFVH 1CIUA 4HUWB 2VZ1A 5FYLL 1MOEA 5EU4B 5D2NE 3FQRA 2X4TA 5GIRA 4X8JB 3AREC 1QBLL 5LGHH 4JKWA 4JFOA 1E6JL 3GUTA 4OF8A 3X13A 4XMPL 3IB4A 4OF6A 3MNWA 4L8CB 2NY2C 3MV9E 3MBEA 4ZPVB 1ZGLM 3BESR 2FRGP 4FMKA 2QQLH 1KN2H 1QLRB 4JHAL 5J1SC 4Y4KC 3C2SA 2VIRA 4QRSB 3GI8L 2DLGA 3SDXB 3JXAA 5BS0E 1ZVSB 4JY6A 4YIQB 1AGCB 5DFVD 1ES0A 2DS4A 5INCB 1IGYA 4EI5A 2F53D 3OB0H 5IB3A 4GG6A 4P0DA 3QI9A 4Z7UA 4L4TE 2DIAA 1G0XA 3KXFA 4MSWA 4PRPA 4YPJA 1YUHA 1I75A 1OOAA 4NP4H 2VDML 1IFHH 3MRJA 2CLRB 4QTHA 1IL1A 2XWTB 5CZKA 3VRLF 43CAB 3BRDA 5GRVL 1DBAL 3MFFB 1BM3H 2ZCHH 4AM0B 4RGOL 3TP4A 3LRHA 2UZXB 3QJHB 1CF8H 1EA9C 5KW9H 3OF6A 2P5ED 3GIZH 1U93A 3V5KA 1GGUA 1H9VA 5KVEL 1JNNH 3VFUB 1ZWIA 4PJGB 1K2DA 2JCCB 1GZPA 3I6LD 5ACMA 5DR5L 1OTTD 5EH1A 3REVA 3SDXF 3TPUB 4TNWF 3MXVL 3HMWH 4U6XA 2ZUQC 5IMOB 4F7PA 4TULH 4BZ1H 1FNAA 1EPFA 1ZHNA 2PYFA 2XZCH 2PO6C 1T1YA 4O2FB 3WKMH 4ODBD 3T4AB 1CVSC 2DJ4A 4X6EB 2I5YH 2OZ4H 4P3CL 4LSRL 2AJVL 4GRMA 3IS0X 1W0WA 3H9HA 2ZPKL 4OFDA 3SDCB 4L29B 4FP8H 3K74B 3IDNA 4LBEA 5FB8B 5EO0B 3CMOH 1JN6A 2EDDA 5JIIA 4LKCB 1X5YA 4OF3A 3S88H 5J1AA 5GS2H 5BJTB 4EBQL 5K9KA 3WIIL 1MJJA 4UTBL 3O6MH 1FCGA 4PJGF 4S11A 4LCUA 4LCWB 1UXWB 2NY6D 1I1AD 2JCCF 5IVXE 4ODVH 2W65B 3DI3B 1S9XB 1DBML 4KVNL 4OB5H 1YECH 2CDFB 3EFDH 4OFPA 4OQTH 5D7SL 1W2KT 4JRXD 3D2UB 1AJ7L 3QWQB 3SKNB 4DN3H 3FONA 3TH4T 4OUOA 4YEFA 2YOCA 3V4UL 2PXYB 1QBMH 4NHCH 4WDIA 3W81A 2GCYB 3WFCL 1G9NC 3WIFA 1P7QB 1F3DH 4ZOEA 4ZXBA 3RWEA 1G9NH 3SN6N 4NCC1 1U8QA 3JWOH 5JHLH 5C9JB 2AKRA 4LVHC 1J86A 2AAVA 1JRHL 3W9EB 1FZKB 3ZE2E 4PJHA 1PZUB 3O3BB 4PJ7B 4JPWH 4OCRL 3P0VL 1NGWB 1X6NA 4JHBA 1ZA3B 2DMKA 5FGRA 3Q5TA 2D7NA 3EOBB 2CH8A 1LO2L 2PKDA 4XP1L 1ZHLA 3L7FA 4JFYB 3GSNB 4MA3A 5FV1L 3IDJB 1KB5B 1RIHH 1VEOA 1UM4L 2AJUL 2Q8BL 4Z78B 1CGUA 4GBXD 4QOKA 1OSPL 3OKLB 4XI5D 4NDMA 1OPGL 3NOIA 5FO9A 4RX4A 3WS3A 5LCVL 3ULVL 5IESH 5GGUA 4N5ED 1T80A 4NQXB 4AEHH 3QHTC 4ZFGL 1FRGH 4NQTA 4L8DB 1MSPA 5DRZB 1Y6KR 5TF1H 5FOBA 4YHYC 4Z76B 3ARGB 4U6HB 1D5BB 5IB5B 4ZFZB 3S98A 2EO1A 3OPZH 5E5UB 4ODSH 4FTVE 3ZTNL 3N1PC 1MVFA 3TZVD 3G6DH 4J2XA 1G7PB 1MIMH 3QEQE 4MDJB 1OAZL 3VI4E 4GRLA 1H3PH 2XG4A 4WFGE 5BZDB 1BWMA 3RI5F 5I1GL 3PF2A 5GJTH 3RZCB 1XGQA 3QUYD 4LNRA 3U9PH 3ARUA 2IALA 1DTUA 1YN7B 4P2QE 2WINB 5D5MB 5JPNB 1UQSB 4KHTH 3RWHA 4P5MA 5FYKD 1WICA 3SE3A 4N8CL 4BH8B 7CGTA 2DOCA 5E5MB 3RNKB 3U6RA 1WFUA 5EORL 5HY9B 5HHNA 3P11H 1MI5E 1T1WB 2Y06H 5HI3C 2EC9T 2DQGH 1I9IH 2ILLA 1DUZB 1MFEH 2D31B 4OZGB 5DJ2A 2FEDC 4KJYB 1DE4B 5FCSH 4JM4H 3VXSE 4GKZB 1CDCA 1DANU 3V8OA 3S97C 2Y6SD 3CU7A 1TVBB 4P57B 3MRLA 3RVVD 5K59F 1QR1B 1HYSC 1JGLL 1E0OB 2Q20A 3B6SA 3BSZL 4NZTL 1CXHA 4GMSL 1CFNA 5ESAB 4FQXD 1DLFL 1Z0NA 1K6QH 1S7UB 3KHOA 1Y0LA 5D5MF 5E08L 2XPGA 4JLRB 4XPFL 1MCLA 3MLUL 4BSVA 3MUY1 1P6FA 4R90L 4IRSA 3F7RA 4JN2A 3MR9B 4XXCC 3HNSH 3DRQA 4AH2A 1Y18A 5CMAB 4XX1E 5HYJB 4AEIL 1UCBH 1DDHB 2YPKA 4V1DA 1QBLH 2R56L 4XMPH 4PJBE 4Y4HC 3DX7B 4OZGF 2DLFL 1GCFA 4NKDB 2NYYD 1P69B 3EGSA 2ZG2A 3BRFA 2VQ1A 2MJWA 1KN4H 2P5WB 4JHAH 2VN4A 3D0VA 3ZE0E 2EO9A 1NBZB 3GI8H 2WANA 2J88L 3ARRA 5EU3A 8FABB 3ARDA 3DECA 4OFVA 5ANMB 5B21A 4QKXB 2ZJSH 1ACZA 5DO2D 5ISZA 2V2WB 4I48B 5EU5A 2Q7NA 1KC5L 3MUHL 5DT1L 1N6UA 2YPLB 1NGXA 3T4YA 2EIEA 4D0DB 2VDMH 5HVFB 4XCEB 3VGBA 1I8IA 5KVDH 4OZIB 2GK2A 4EEEA 2UWEE 1JWSA 3PJSB 1S7TA 4OCMC 1NKRA 4RGOH 4BK5A 4P2RA 1OSZB 4LCIL 4CVXB 3G6JB 5E2WL 4HS8L 1MVUA 2BSED 3QUKB 4N0UE 2QR0B 1AC6A 5JR1H 5IW1B 2HLFC 2AQ2A 1U95A 3RU8L 5DR5H 2HFEA 4DZ8B 1ORSA 5I1HL 4A6YA 2CRZA 1PKQB 4X4XB 3QXAA 1MNUL 3SDAB 3RWFB 1CXLA 2XZAH 1NMCC 4HWNA 2RIKA 3AXLA 4OGXL 4N0CC 1QLFB 3OAYK 2CLVA 2Q3AA 1TQCC 2WP3T 3VWJB 4OZIF 4KK8D 5HDBF 2BY3A 4OBSA 4Z6AT 4PJ5A 5DJXB 5AWNH 3N9GL 3QIWB 3DI2B 3MRCB 4X7TB 1BPVA 4KXZI 3G6JF 3C5JA 5MEOB 3E6FA 1R3LB 2LQRA 1KCRL 2WWKO 3PV6A 4P5TD 4XNZC 3Q6FB 4OCWH 2H26A 3WIIH 3GBNL 5DK2B 1NBQA 4J3XA 1BFTA 1H3GA 1AI1H 2Z0BA 3DSNA 5MERA 4G6KL 3MQIA 1L7IL 1ADQL 3PL6B 4RAHA 1AJ7H 4BK4A 3BDYL 4H5SB 1D6VL 4XX1G 3V4UH 1IC7H 2D0HA 1J1OL 3FFCB 3O2DA 3WFCH 3T0EA 3L3KB 4FQLH 1JNLL 3KGRA 1ZE3C 1KYOK 3AY4A 3L9RA 1H5BC 1N7MH 5I8CA 3SCMD 4EOWH 1ROWA 4WTWA 3D3VE 1IAIL 3W39A 3LSOB 4K3DL 4L3EE 1I1FB 3ECBA 4LP4A 5HGHB 5J12B 1HOCA 4OCRH 1EHLL 3DBXA 5AG9A 1CTOA 4FQ1H 3SJVA 4YHOH 4JFQA 1WWWX 4P4KC 1LO2H 2AK1H 2CUIA 1EX0A 2PN5A 3TJEH 5J6GB 5T5FL 4YBHA 2Q8BH 2EDBA 5J6HB 1OSPH 3G5VA 4XCCH 2X1PA 5D7LB 1MHCB 2PYEB 5TJWK 2GTZA 3PP3K 4XPGH 2FX7L 5DVOA 1N5AA 4JO1H 1MLCA 1CDBA 1QPXA 4Y4FC 4M6AA 1ND0B 4JZNB 5F9WC 1FYTE 2BY0A 4OCSL 4Z8FH 1FP5A 1XR8B 2IPTH 3SDCD 5I16B 4IS6B 4JO4L 2IGFL 4GMTH 4PJDE 4F7CB 3UTTE 4JG0H 3V8CA 2A74A 4MMXC 3DETD 3EZJB 5D1QA 5TGBB 1XGYL 3QO1A 5CJQH 1OGTB 3CSBA 4LCWD 5F1SA 1CWVA 1KIPB 4Y5VA 3RWGB 3ZTNH 3EZ8A 1G7MA 3QXUA 1NCAH 4MXVE 1JGVH 5EO9B 4M48H 1KCKA 4JQIL 4U1SB 5IMMB 2P1YA 1C5DA 5CIPB 4P2OC 3Q5OA 5LG1A 5GRJL 4RZCB 5I1GH 1KJ2H 3FQTB 5F7LB 5GGRY 3VFSA 4XZUB 2XN9E 1P7QD 1II4E 4JY4B 2VXSL 3QIUA 1I9RH 3BD5A 4S1QL 4K7PL 5EZJB 3ZL4L 1K5NB 3KNBB 3QNXB 4N8CH 4XT1C 4JFDB 3TIDA 5DTFA 3TYGH 3IU4L 1WAAE 5J06A 1MFAL 4MAYA 4GKOA 4M5YH 2DB8A 4FQIL 5TQ0L 4H0GA 3BW9B 3MCLL 3IAGC 5ERWB 4MDIB 1NFDB 2G60H 5DMIL 1MCDA 1JFQH 3WIHH 4U05A 1NAKL 1G6RH 2Z91B 4WU7A 4FFYL 3QIBA 4NN5B 4JRYA 1MAMH 4H88H 4HS3B 2DL9A 5EZOL 5F7HA 4GMSH 2G5RA 2VLME 5JXAH 1IGML 2X4RB 3K4AA 3A6CH 5C0EA 5DUBA 2NY7L 3MLUH 1FNGA 2BVOA 4NFBA 4OZHE 1BD2E 1NGYB 3X12A 1DFBL 3KPRB 2H6PB 1HHGA 4G42A 3RGVC 4EN3A 5L7XH 4UILL 2KL6A 3MLXL 4AEIH 3WUWB 4HUVB 1LNUB 2VWEE 5T3XD 2R56H 5FECB 4X0KB 5BS0B 3HMXH 3LQAL 3WFEL 5GRUH 1OHQA 1WVZA 2A2QT 3DROA 5D96C 4JFED 5B39A 1NEZG 3VA2C 1NFDF 3HAEB 2GUOA 5EZLB 2G2RB 2YD4A 4L4TB 3KJ4B 3P4OB 1EFXB 4UT7L 4XMLL 4B53A 3ARBD 5IMLB 3FL7A 4NQUA 3G5YA 4WUKH 4PGBB 1QP1A 5CJXC 5CP7B 4HC1L 4G8EB 5D2LB 3RZCD 5EA0H 5SX4I 3CCHA 5A2IH 4G6ML 3MJ8A 5DFVC 3MRQB 2XXMB 3QUXB 5CWSB 4K23H 1AGEB 4ZUUA 1A5FH 3QNZA 4RBPK 1D5IH 3FT3A 1WCBB 5I8OL 2EDTA 5M95B 5HBBA 3UPRB 4GG6E 5DJ6A 1FVEB 1S9WB 2EKJA 4Z7UE 4YE4H 3QFDB 2HFFB 4LCIH 3CVHL 3JV4A 2C7UB 3S4SB 3I3BA 3MLPA 1IM9A 1E6OL 2C3XA 3ZE1E 2JK5A 5HHME 4R7NA 1N2RA 3RU8H 3WO4C 3VFRA 2A6DA 3WL9A 5TE6H 3PHQA 5F1NA 4CVUA 2MHAA 5E1AB 4Y88A 1OTTC 4XAWH 2J4WL 3IXTB 1E4XL 4NWUH 5I1HH 5D2LF 3BPLB 2XFXB 2Z8SA 1Q72L 1SJEA 4C83B 4QRRA 3ROOB 1OAYL 2VITA 4RGNE 4YNYA 2X4NB 1BBJA 5IFHL 4NC1C 3OJ2C 3ZHDA 3TIEB 2O5XL 3CJJA 1FNHA 1HYRC 3V79C 3NFPB 4U49A 1CXEA 3V6ZB 1NCCL 4QNPF 3MRFA 2VL4A 1T21A 1YEDB 4NN6C 3PE9A 1C1EH 5D6CA 1R5IA 2RGSA 1HKFA 1CLYL 5EN2A 3HC0A 5DQ9B 5L8LB 1AHWC 4OV5A 5AZEL 3VXNB 4DEPB 2NY6C 1I1AC 1B0GB 2MQCA 4YLQT 1LILA 4XP6H 1U58A 4L3AA 1ZLUK 5E2JA 3BDYH 5BMFL 2NCMA 5E9DA 4GQPH 2FR4B 1FFPA 1RURH 1TZHB 2VDRL 1NCBH 5FYJE 4AG4H 5E8NB 2FO4B 3BKJH 4C55A 4PGDB 1JNLH 2YHGA 4OQTA 4XH2B 4J3OC 4LIQL 1CDJA 4DVRH 5JUEL 5DEFA 2NY5L 2V7HA 5DD5H 1A6UL 5C8JB 4ODWA 4HHAB 5L6YL 2EXWD 3MO1A 4KKAD 4MZ3A 5E2VL 5EU6D 3KPSB 5F7EL 3FQNB 3TT3H 1EBPA 4WHCA 1LE5B 1LGVA 1FBIL 3B2UD 5FHBH 1G1YA 4LSVH 2IC2A 4TVPE 2IANA 4PJHE 3IETA 3ET9F 4NKIH 4WEBL 3HE7D 5T5FH 1T22A 1QQDA 1CE1L 4K9EL 4YHLL 1P4BL 3I85A 2FHCA 2AABL 4XI5C 4GBXC 1K3ZA 3KLAB 5KOMC 2LV4A 1UA6H 1SY6L 3M17B 5KS9A 1QVOA 3VWJD 3ILPA 4JPIB 4QOKE 5A2FA 1KJVA 4ODHL 3SPVB 1ZANH 4C4KT 3MJ6A 5EZIL 3L3GB 1A3RH 2NLJA 3MLYL 3U4BL 5I1DA 1FIGL 2J6EL 3BH8B 4N9GA 4MMZC 1UADC 4U1KB 3EDKA 4GXVH 3FO2B 5C6PB 3WNPA 2HT2C 4I5BB 3WXVH 4AEEA 2IWGA 3O81A 1HHIB 5TH2A 5IF0A 1MHHA 1AGFB 4U6VH 3RA7H 5MEPB 5HGAA 1HH9B 1TMCB 3RUGB 1OM3H 3TZVC 3RFZC 4Q6IA 3S5LG 1IAOB 1ACYL 4U1NA 1LEKA 5I9QC 3KYMA 4JDVA 4IJ3C 3WNNA 2OJZH 4Z7OE 1EV2E 1F6AB 1ZS8B 3EO0B 4GSDL 4JZJC 4MWFB 5DD1H 4RWHA 2PTUA 2VXSH 1DUYA 4G7VL 3QUYC 4Z9KB 3BYYA 4I3SL 5EFIB 3QZWA 1X5JA 2KUTA 3WEXB 3W2DL 4S1QH 3VXSB 3GBLA 4ZO8A 1QPPA 3FOMA 4RIRB 2ICEB 3ZL4H 1AIFA 4PUBH 4QRQA 1RMFL 5CEYB 5IFAL 5FYKH 3OR6B 3HR5A 1DSFL 5TDNB 1QTYT 1TJGL 1ERNA 1MFAH 2R1WB 2I9TB 4P49A 5TQ0H 4OZFG 1FZJB 3O4LE 1OLLA 4HZAA 4KTDL 4PG9A 2ZOKB 3FO0L 3O6KH 1HI6A 4D0CB 4BFIA 4NM8L 1VSCA 1NAKH 4HSQA 1A3LL 3RUGF 5T1MB 2AEPH 2Y6SC 4U1LB 3RVVC 2QQNL 1PG7X 3IGAA 4OZ4B 3CVIL 2OXHA 3M45A 3T1FB 1CFQA 4XAKD 4FQXC 4PJBB 5T5NF 1KFAL 2CJUL 1RV6X 5DHVH 4G5ZH 1DVFC 1R3IH 2Y7QA 4N8PA 2EDRA 4EUPG 1CFSB 5DC0A 1D5XB 4MD4A 3MLXH 4LPVA 5B8CB 1FL5A 5T33L 2XA8L 4KRNA 4CKVX 2OSLA 4P9HL 3PWLB 1ZLSH 5T3XL 1J05A 4IOIA 1VKXA 4GRWH 3GJEA 4HKZB 2G75A 2NYYC 4V1DE 5EIQA 3RIFK 4X8XA 4XXCA 4OI9A 4UT7H 3RWIA 1OY3B 1NCDL 1MFBH 1I7ZA 2FIRT 3F7YB 3MLSH 5HHVL 2A73B 1B90A 3CD4A 3U4EB 5EBLB 1KGCE 2CIIB 3RTQA 1UB6A 2IMNA 4Y4HA 4NOFA 4RRPA 4S1RL 4YDKL 4YFDB 1BWWA 3FTGA 4TUOB 4QGTA 5DO2C 4LHUB 1CICB 2OJEA 4M03A 5FHAL 5J89A 4AY0A 1T0MB 4N9OB 1FFRA 3F65A 4N0UB 4QXUL 5IQ7L 5FUZL 4N8VG 4JFDD 5I8OH 2W60A 1CFBA 1LO4H 4FN0A 2YN3A 3TPKA 3N1MC 1T7ZA 2EIDA 4NQVB 5DLMH 1EUTA 1MWAB 4LSDA 5EC1B 4RMSA 1CDGA 3O4OB 2A9MH 1TCRA 1U6AL 5EUKA 1WF5A 1S7XA 1OP5K 3ZKQD 1DBBL 1F58L 3TFKD 4B5EA 4P2RE 5HI4D 1BOGA 3BPOC 2V7NB 1V7NL 3STZB 5IOPB 2VB5A 4WHYG 4QXTA 1E4XH 1J11A 1W0VA 4NZUL 2NZIA 3TV3L 4MQ7A 1Q72H 2CPCA 2OMBA 5A43C 2EC8A 3VFNB 5K9OB 1BREA 3L3DA 3MV9D 2E5EA 4NFCA 3QP3A 2ID5A 3C2AL 4KK8C 4CVZA 3PNWA 3IU3B 4M93B 4XP5H 3UMTA 4LSTH 1NCCH 4WRLA 1JHKH 5BS0D 3IJYA 2D7TL 2NY1B 2VAAB 4ZMAT 2Q86A 1ORQB 4F3FA 3MV7A 4ZUVA 4XC3H 2R0WH 2BSRA 4L9DA 3QH3A 4R7DA 1CD9B 4P5TC 1WC7B 4PJIA 2IQ9H 4L4TD 3P30H 1LEIA 3RGHA 1RIUL 4NN7C 3RJDA 4KZEL 5AZEH 3ZHKA 4LSSL 4NHUA 3OHXA 5E8EA 4WV1B 4M62H 5IP4A 4UQ2A 4UDTA 3RWDB 1NC4B 2ITCA 3UJTL 2KDGA 1RJLB 4GAGL 1YEJL 1X4YA 4YDIH 4JJHA 2W9EL 1DQTA 4IEFB 3UTZA 1G7IB 3B9EA 3EFFB 4LIQH 4PRDB 4ETQA 1S8DA 2XTJE 3GSWA 4G9DB 4X6DE 3H7LA 2O26U 2DKUA 3LQZB 4M1GH 1NGQH 2VUYA 5IBTL 3SCMC 5L8JB 1K4DA 1S7WB 4M61A 4NUGL 4Z7QE 3LPFA 5GXBB 2J7LA 5FF6B 3TCLA 5F7EH 2P8LA 4QRPE 4G43B 3ZDXF 2APFA 1A6PA 1WWCA 3H9SB 5F9JB 3VXOA 5F96L 5E8OA 3KG5A 1AO7A 1BJ1H 3L95B 4PY7A 5I76B 1AKJA 1H5BA 3JTSB 4NQEE 4GLRH 1TVHA 1F2QA 5DA0B 4WEBH 5HVWA 1FYTB 1Q9KB 1FE8H 2FB4L 3LEXB 3SDYL 3V4VL 5IHZB 1N64L 2VNCA 2FD6L 4HX1B 1CE1H 4PJFA 2VR9A 3SJVE 1P4BH 3B3IA 3MRIB 4HIEA 3U9UB 3UTTB 2Y36H 1MCCA 1T4KA 3WNMA 1JBJA 5TE7H 1SY6H 3WFBH 4U1JA 1EEYA 4P4KA 2R0ZH 5KG9B 1K85A 3DUSB 1MCJA 1KPUA 4ZDHA 4ODHH 3I9GL 5DK3A 1JHTA 5EOCL 2EE3A 1INQA 4KZDL 5EZIH 3SDCC 4ZYKA 1XF4B 1QA9A 3G04B 4OCLC 5I6XC 3MLYH 1P2CB 1BP3B 5DZLA 5AAWA 4HQQH 2J6EH 4FRWA 1N8ZB 3LAFA 4C58B 4Y4FA 3DETC 4P9ML 1DQJB 4JFFA 4WY7H 5HYSB 1F42A 1YN6B 2XN9B 1C8PA 2HVKB 1CL7L 5F44A 2EDYA 4Z7VA 4ODXB 1C5CL 4D3CL 1QYGL 3ME0A 4UT9H 5C09A 5CEXA 4LCCC 4PRAB 3SKOA 1X7QA 1S7VB 1SYVB 3CFBA 1NEUA 3STLB 2YUVA 3NN8A 1X6LA 1FAKT 4GSDH 3L5WA 1KLGA 1BAFL 1X44A 2FZ3A 4G7VH 4I3GA 2QQKL 2X7LA 2NY3D 1F4HA 4MQTB 2WNGA 3FO1A 3KPPB 2GITB 4K94C 4GT7A 3RRQA 1T7XA 4CN6A 2C3WA 4GKNA 2DYPD 1OD9A 4K94H 4IRZH 5FV2A 2QADB 4P2OA 5C0BE 4E41E 1KJ2A 5BV7B 3E3QC 2ZCLL 1ZT4A 4UNTA 2MQ3A 3FT4B 1L7TH 1RSFA 3QQ3B 3FJTA 2G9HA 5DQJA 5EO1A 3LPGA 5I1JL 1PW3A 5AZ2L 1FJ1B 4JCMA 3E2HB 1UZ8B 1CBVH 2G5BB 4OZHB 2HJFB 3DUHA 1BFOA 4M6ML 3C9NA 2NW2B 2F8OA 3GSNH 5GS1C 1KB5H 4BUHA 3HS0B 4NQCE 1TDQA 4DW2H 2EDWA 3BP5B 4YHMH 1IC5L 1KFAH 1HXMA 1HXYA 4XVSL 2VXTL 3FFDA 4FTVD 5F3BA 4UNVA 1EZVY 4JPVL 3FQRB 2X4TB 5GIRB 2MOVA 1Z2KA 4P99A 1D9KD 5LXGL 3SGEH 4JFOB 3GUTB 3X13B 4ZQKA 4HPYL 3QEQD 3MNWB 2L7UA 2YRZA 2CR6A 1GJIA 4MJIA 4P9HC 3TA3A 1Z5LA 2R2CA 4WFGD 3MBEB 1NH6A 3ZSSA 4P9HH 4P23D 5T3XH 2D7PA 3UYRH 4PJ8D 4C56E 1BF2A 3IFLL 5EBMA 4P2QD 3T0VA 2VIRB 4LVEA 2AS5M 1G9EA 1YA5A 3RGVA 2A77H 2CXGA 4JY6B 4XCYA 2WP3O 4LU5L 1ES0B 3ARBC 1IGYB 4EI5B 4BKLA 3SO3B 1FG2A 2R9HD 4O4YH 5IB3B 3QXWA 3TF7C 4GG6B 4Z7UB 4YDKH 1VPOH 1MI5D 1XCQA 4OLVL 3ORJA 2NY4D 3KXFB 4MSWB 4OCYL 3UAJD 3RZCC 4D8PA 1YUHB 1TJIH 1Q38A 1QFPA 2J2ZA 5IVZA 3MRJB 5FHAH 4QTHB 1IL1B 4WHTA 3CX5J 3VXSD 5GHWL 3D87B 4QXUH 5IQ7H 2CKBL 3P2TA 5FCUL 4DZBA 2M2DA 1EZVX 3BGAA 5HHMB 4NCDA 4ZTOL 4LHQB 5I74B 3V5KB 1U93B 4LPYA 1NDGA 1ZWIB 4LVNB 4TSBL 1K2DB 1PQZA 1GZPB 1DBBH 4RGNB 4KQ3H 3REVB 3C8KA 5DYOA 1A6VL 4XP9H 4U6XB 4F7PB 1OAXH 3FMGH 3Q1SL 1GRWA 4RFEA 4Z7UF 1ZHNB 2PYFB 1T1YB 1TPXB 5GSRA 1UM6L 1OT2A 5E56A 4GRMB 1F3JA 4KJWC 1W0WB 2BY2A 3PDOA 5IVNA 3H9HB 1F6LL 4LBEB 3IDNB 2GHWB 2XXCB 4Q74A 5BO1L 1NMBH 5JZ7D 1JN6B 4L1HA 2IPUK 3C2AH 4U3HA 2VKWA 5J1AB 3N85L 5K9KB 1MHEB 1KELL 1MJJB 5T1LD 4LCUB 1OAUH 1PG7H 5F7DA 3X3FH 2BSSA 4MJ4A 2IPUG 2VSCA 1FLRH 1JGEA 2FATL 4Q9QL 3AM8C 3MJGX 4LSSH 3BE1H 4OI8A 3FONB 3H3BC 4QRTA 3QEGL 2VH5H 3SQOL 4WDIB 4YHPA 2UY7A 3WIFB 4RDQG 2VE6A 4UQ3A 2HLAA 4ZXBB 3UJTH 1YEHL 1KCUH 4GAGH 3RWEB 4LHUD 4OTXL 5SX5K 1U8QB 1AHWA 1HIMH 1S5HA 2AKRB 3BX7C 1R0AL 1ADQA 3OKNA 3WUZA 4PJHB 1I85C 3DV4A 1MJ7L 4NYLA 4ZUTA 1BIIA 2KQNA 3FO9B 2EXWC 2ED7A 4KKAC 1U91A 5JTWA 4C57C 1ZHLB 3B2UC 3L7FB 4MA3B 4X9BA 3QWRD 1XAUA 4WW2A 3P4MA 2XYCA 2OBGA 3OKDA 5E8PA 4BZYA 3K2MC 4QOKB 4M6NL 5LBSL 3CFIC 3V4VH 25C8H 3HE7C 3E0GA 1I1YA 3UP1A 1A0QL 1YMHA 3MFGB 4NDMB 1DZBA 1TJHH 3SY0A 3NFSH 4UIKH 2IANE 1V8HA 5E4IA 5FO9B 4MJ2A 3LIZL 4DFIA 5GGUB 3V0VA 2C4FU 3C5ZD 5I1IH 5FO7A 1IGCH 5HDOA 1JK8B 5CGTA 1FFQA 4PJHF 3VFOA 3FQWA 3VWJC 2BFVL 4HWUA 4KZDH 4Y1AA 1FGNL 3QQ4A 5FOBB 3LKPA 4GAYA 1YYLH 5KS9E 5HGBA 1RZ7L 5FKPA 2GKIA 4MNHA 1EFQA 4JR9L 5GGVY 1P9MC 3INUL 1QYGH 1KEGL 2R2BA 4Q9BA 2WBJD 1L4IA 3V52L 5E7BA 3NAAH 4GRLB 5I1CL 3D3VD 4L3ED 1XGQB 5CCKH 4LNRB 2D4DA 4ZO9A 2IALB 4ACPA 1N5YL 3RWHB 4P5MB 2HWZH 5IGXL 2GK0A 5HD8D 5HYFA 2QKIA 5FGBA 1J18A 2FGWL 2HTLC 3AMLA 3TZVA 3U6RB 1A6WL 4H1LA 4NKOA 5ICZA 4OLEA 3O3DA 2X42A 3CDFA 1XR9A 2HP4A 4J4PD 4ALAH 1JGDA 3B9KD 4JZJA 5DHYA 1HQ4A 1J8HA 3UROR 3QUYA 1A7OL 5I1JH 3Q48A 5AZ2H 3MRLB 5AUMA 1RK0A 1MAJA 1FYTD 4OD2A 3B6SB 4IRJC 5K9QG 4M6MH 1CFNB 4H25A 2CXKA 3NZ8A 5JA9A 3UTTD 4OI7A 2YD3A 4JPKL 5GISH 1Y0LB 3T2QA 2QHRL 2X1QA 2XPGB 1J1XL 1XGUA 1WWBX 4RGMB 5FM8A 4YBLC 4BSVB 5FM4A 4LARL 4IRSB 5MP6L 2VXTH 4JN2B 2XT1B 3DRQB 4AH2B 3DIFA 1Y18B 2F9BT 4OFIA 2YPKB 1E28A 4V1DB 2V9TA 1PAMA 4PRBA 3IKKA 3ZHLA 7FABL 4HPYH 1O7SA 4FQXA 3EGSB 4HG4J 5DHVA 2VAJA 2VQ1B 4KJQD 5LGJA 2XN9D 2VDPH 4KKBD 3PDGA 1DVFA 3D0VB 4UAOB 2E27H 3GKWL 3FN3A 3T0DA 3DOSA 1ZLVK 5EU3B 3ARDB 4IHOA 4M6OL 4H26A 4R97C 4FFZL 4LU5H 1FH5L 4IDLA 2BRQA 1FNFA 5ISZB 5FYLE 1RU9L 5EU5B 6FABL 4PB0L 5CIPH 4OLVH 1M7DA 4OCYH 3HPLA 1I3VA 2W91A 3QG7L 1NGXB 3T4YB 1I8IB 2A9NL 3L5XL 2X89D 3EKCA 3REWA 1JWSB 1S7TB 4UUJA 1QLEL 4HC1A 5FUOH 4J8RA 4P2RB 2CK0H 2OCFD 4U0RB 4TNVK 1CLCA 1MVUB 4KI1A 2FBJL 4MNQE 4AQ1B 2VLMD 1N6QL 1U95B 1DEEB 1J0IA 4W81A 2YRLA 4K71C 2QTEA 4GQ9H 2HFEB 4XWOD 4HT1L 5FK9A 3D5OF 2CK2A 1BD2D 5JHDA 1A1NA 1ORSB 5JW3H 4A6YB 5HI4C 4NN5C 3QXAB 3Q1SH 3CVHA 1F3RB 1CR9L 1PJ9A 4MXQD 5JOFA 5D2NC 1T2JA 4FMFA 3MGTA 4XPHH 3AXLB 4HIJA 1UM6H 2ZOLA 1IZJA 5JW4N 2CLVB 2LVCA 5I17A 1AXTL 4WI8A 4HBCH 4PJ5B 4L1DA 4MCYA 1A9EA 3Q0HA 4Z7WE 5GGVL 3C5JB 5A2JH 3E6FB 3PV6B 4U3XA 1P7KA 3W0WE 3ZLQC 2H26B 3NA9H 1KELH 3GZKA 2VRAA 4FZ8L 1LK3L 2BNRA 3TN0D 2DMBA 5FKAA 5K9JL 1BVKA 5MERB 1TETH 1UWXK 1V3JA 3BZEA 4Q9QH 2EH7L 3HAEH 2OR7A 2X4OA 3MV7E 3HZKA 4QHUA 3Q5YA 4C4KO 2OR9L 4KY1L 1E4KC 3T0EB 3I02B 3DV6A 5DVLA 1U8JA 1B4JL 4HF5H 1E27A 3L9RB 4P5TA 5GGRA 1BQHA 3SOBL 1QZ1A 5I8CB 4E0RA 4MZ2A 3W39B 2ZG3A 3LB6C 4NQEB 1KBGH 3EOTL 3ECBB 4KMTL 5HHMD 1W0YT 3ARPA 1HOCB 3KLHD 4EDWL 3DBXB 3ESUF 1OLZA 3V6FA 4ISVA 3SJVB 4KV5E 4FG6D 4JFQB 2F8VA 4Y8DC 2CDEA 4RGND 4NIKB 3ARFD 4KRPD 2VXVL 3VGFA 5GGQL 3DVFA 1E4WH 4TUJA 43CAA 3SCMA 1FLTX 5LBSH 3G5VB 1AO7E 1SEQL 4JJ5A 2GTZB 4PBWD 1GYAA 1N5AB 2NXZB 4DKDC 5KTEL 3S8WA 1MLCB 4EXKA 4CADA 4PJAE 3RX7A 1SBBA 3VG9C 1CD1A 4CMMA 2Z93A 3H9ZA 2LAGB 3WCYA 1JPSH 4UU9A 4PJFE 1WFOA 3IDIA 4OUUA 4XNQA 3DYMA 2OTPA 5GRVK 3U7YL 3KJ6H 1EGJL 2A74B 4OD3L 4QYOA 5EOQH 1PLGH 5D1QB 3NCBB 3M1BA 3QO1B 3NIDE 4HZLA 3HNVL 1SY6A 1RZ7H 4IBLT 1U8PA 1W72L 3ZYZA 4BFBD 1U2CA 4Y5VB 1MCHA 5FYJD 2F5AL 1G7MB 5CSBA 4FXGA 5EIIA 2AGJH 1C5DB 4PJEA 1CU4L 2J6EA 3SE4C 3V52H 1UZ6F 3ULVE 2OK0H 1MQKL 3BXNA 4DKAA 2R0LH 3CFCL 3VFSB 4DOHE 1JZ3A 1RZFH 2E7LC 3FN9A 1RULL 1PX3A 3QIUB 2X05A 1WQVT 4OGYH 4F7MA 3GK8L 2K9UA 1F3DJ 5J11C 4TVPD 4O51A 3TIDB 1WTLA 4LCCA 3VMNA 2FGWH 3WYRA 5DTFB 5BVJA 2NY3C 1A6WH 4ZUWA 4WI3A 1KENH 4MAYB 5AYUH 2HFGH 1H3XA 2GTWA 4Z95H 3JVGC 2IQAA 4EVNA 1OGAA 1P7QA 4WU7B 1JTOA 4P4RA 5CD5D 5C6TL 1QEWA 3QIBB 3SKUD 4KKLD 4JRYB 2P24A 4QOKD 5E6ID 5I66A 5KVFL 4PLKD 3EYUH 1A7QH 1C7SA 1MRCH 3L5JA 3P0YH 3M8OH 4M00A 3BVNA 5C0EB 1EHAA 3U30B 4EJ1C 5DUBB 1FNGB 2BVOB 3X12B 1M71A 3DTXA 5MP6H 1HHGB 4G42B 4EN3B 1XCTA 4WW1A 1JP5A 3MXWL 4G80A 5E00A 2BX5A 5KVGL 3WNOA 3GMRA 5GS1A 1D9KC 5CUSH 3DROB 3OKLA 1HH6A 5B39B 2ENSA 2GI7A 3MODL 3FAWA 5HDQH 3D25A 1JYWA 1XGTA 2EDJA 2GUOB 1MRDL 3MUZ1 1RIVL 5DD3L 2Q8AL 5B38G 5CS7A 4P23C 5TF0A 4PJ8C 3G5YB 4XC1L 4MJIE 4HPOL 4NOBA 4DUVA 2YA2A 3Q2CA 5IROC 5ESQA 3CCHB 1FH5H 2NY2B 3MJ8B 1S9VA 3O2VL 1RU9H 4KTEH 4ZUUB 2K1MA 4PB0H 2R9HC 3QFJE 1I4FA 1MCOL 3QG7H 4JFEA 3QNZB 4HLZH 1NGZA 2NY4C 3UAJC 3FT3B 3VH8A 4XPAH 3O4LD 4XPTL 3L5XH 1NCWL 4GH7B 3DSFL 2KZWA 5DJ6B 3AMKA 4X7EC 1FCCA 4YO0A 1OARL 3HI5L 2AV1A 3ARBA 4M7LL 4YXKH 3TBTA 4TUKL 4ETYA 2YZ1A 5C08E 4ZNEA 1A22B 1CGVA 3JV4B 3D18A 1FGVH 1IM9B 5C07E 4R7NB 1N2RB 3VFRB 2A6DB 3LD8C 3QUZD 4H8WL 2R4SH 3GRWL 3WL9B 2OP4L 3PHQB 2CDGA 5F1NB 2MHAB 1R3HA 1D5MA 2FJGA 2APTA 3BP6A 1SMAA 1OF2A 4J1UA 4NCC2 2VITB 2AEIT 3D85D 3TC9A 4M1CD 4MVBD 4YNYB 1BBJB 2DMCA 5I18L 2GJZA 2K7QA 1NMAH 4HW6A 4Y0GA 1XGRA 4ORGA 4XNUL 1SJXA 4V1DD 3ZO0A 2OL3L 5JZ7C 3MRFB 4S0SD 5GGVH 1OAKL 1T21B 3QXDA 4NO3A 3G5ZA 4L3CA 5E03A 3V5HA 5D6CB 3RDTA 3F8UB 1KGCD 3SBWC 4FABL 4GAFB 1R5IB 4N5UA 2XKSA 4XBEH 3IDYB 4FZ8H 3QDME 2WUCH 1XIWC 5EN2B 3HC0B 1LK3H 4UMGA 3O45A 2WMPA 1LQSR 4OV5B 2HKHL 4I9WE 4ZD3H 1D3CA 1U58B 2BOCA 4JFXA 3I2CH 3T3ME 5I30L 4PJCE 2R4RH 5E9DB 3RPKA 3W9DA 1CDHA 4YHZH 1FFPB 3OMZA 2OR9H 3VXUE 2BDNL 4HUMB 4X98A 3WFDH 5C1MB 1B4JH 4OF0A 1ZGLP 3QCTH 5ESVA 2EH8H 3MPCA 5DEFB 3AM8A 4Y16D 2V7HB 4MQSB 4K55A 4ODWB 1JRHI 1WLHA 2I60L 2LABA 4KMTH 3U46A 3MO1B 2DQCL 4P2RD 3MV8E 1MCPH 4OV6F 4XP4L 1QSVA 3K0WA 3PP3H 5SX4H 3LDBC 4CN1A 2LU3A 3O3EA 3OR7A 1JZ6A 3QHZL 1IZKA 4TRPL 2IANB 3IETB 3O4OC 4LVHB 1HK6A 1MWAH 2D7QA 3GMPA 3QA3A 3VI3E 3S35X 1A6AA 1I7RA 1T22B 1RZ8A 4NJ9H 1UM5L 1QQDB 5EUOE 1HN1A 1I1CA 2DQHH 4S1DD 4PJ9A 5CJOL 5EU6A 1CD8A 2NY0D 4POUB 4LSUL 2KPNA 4MLIA 5KS9B 3TH3T 3AU1A 3RX5A 1QVOB 1LP9A 3ILPB 4YZFF 2Q76A 4G9FE 1KJVB 1J87A 5DZOA 4NO2A 3C5ZC 1GGTA 3IFNH 2IH1A 3VXRE 3NH7L 2NLJB 1PD6A 3HE7A 4YEEA 2ADIA 5I1DB 4N9GB 1MLBA 1LVEA 4LQ1A 4RFOH 3SKMB 2XG5A 4GXUN 5ADOL 1FHGA 5INDA 4YDJA 1W72H 3O11A 2F5AH 1MHHB 5IF0B 4HJJH 4Y1AE 2W0PA 1EO8L 1JI2A 4M5ZL 5HGAB 3RIAF 4Q6IB 3MCKA 3WXWL 2XTJD 1CU4H 1LEKB 4U1NB 3KYMB 5FYJL 4JDVB 4YHYB 1NDMA 2WBJC 1MJUH 1PBYA 2ADGB 4XNYL 3UTOA 4PGCA 1ZLWK 3T3PE 1TNMA 5KS9F 4U7SA 1DUYB 4PJXA 4QRPD 1QRNE 1P9MA 2NXYC 3QZWB 5EULV 3CH1A 3GK8H 3MLRL 3FOMB 1AIFB 4NQED 3B8YA 4QRQB 1KULA 2JJWA 1JHLH 1JI1A 2YD6A 3DXAA 5HD8C 3HR5B 5BXFA 1F4YL 2OR8A 1FN4A 1UXSA 4OF5A 2HVJA 4FQJL 4F57L 1CZ8L 2VZUA 4F7TA 1PDKA 3SJVD 4DAGH 2PNDA 4AMKL 3FB8A 4PG9B 1CK0H 3B9KC 3QCUH 4HIHA 5CSZA 1HI6B 3S37X 4BFIB 2HN7A 4G8GE 3RVUD 5C6TH 5F1IA 4KAQL 1HHKA 3ZKMD 3IGAB 3GMMA 3OG6B 5KVFH 3GBMH 3C09C 3A67L 1J8HE 4YDVA 4MYWB 3T09A 1CFQB 1IQDA 4OQ1A 3TM6A 4KC3B 4ZSOA 1R5VA 1Q1JL 1IJ9A 4F7EA 4FQQA 1A7PH 5DMKA 3V7MA 2P43B 3A6OA 4WI9A 2UZIH 2Y7QB 5ADPH 4MD4B 4YGAB 4IRJA 4WGVB 1VESA 2X9XA 3CX5K 3LEVH 5CBEA 1WT5A 1FL5B 4KVCH 3GDBA 1GGCL 3PWUA 1UG9A 3UJJH 2OSLB 4XWGH 2X40A 1J8KA 1J05B 4IOIB 3I50H 1VKXB 2IF7A 2ZCKH 3GJEB 2G75B 1IAMA 5H8DA 3PWVA 5DD3H 2Q8AH 3RWIB 4KJQC 1HNGA 4RBPH 1IAKA 4KKBC 2JKXA 1I7ZB 1VGKA 1CI5A 4HPOH 3RTQB 1UB6B 1X5IA 4XTRD 4Y4HB 1CXFA 4E41D 2P47B 2VDKH 5C0BD 1DQML 3FTGB 5A2LH 2OJEB 3SDDD 3EJJX 3ZDZF 1KPRA 3H9YA 4M02A 4YXLH 4PD4K 2W60B 3P0GB 4HDIA 4R3SA 5DGRA 4AJ0A 2AJ3A 1F4XL 4M3JA 2ORBL 4W70A 1FQ9C 2V5RA 5BV7H 1TCRB 4D9LL 4NQCD 3Q6GH 5EUKB 5L88H 1MEXL 1S7XB 2EE9A 4U2ZA 2ZG1A 2DL2A 4H8WC 3BP7A 1KPVA 1RI8A 2D03H 1BOGB 4H8WH 5I0ZA 4CUCA 1M4KA 5D7IF 3E2HC 3PG2A 4QXTB 1YC8A 2C3GA 4XWOC 1W0VB 2HRLA 2EIBA 5GS0D 1J1PH 4MQ7B 1YPZF 5TQ2L 5CSGA 3NIGF 3R1GH 2W9DL 3L3DB 4MXQC 2VWEC 4OCXL 5JHDE 3GI9H 2MCG1 4Z0BL 1OP3K 4C56D 4JY5H 2B4CL 3QWOA 4XNUH 4NKMA 4CVZB 3PNWB 4Y2DA 1JCKA 4YPGA 2C1OA 3RP1A 4ZFOL 3IJYB 2Q86B 4F3FB 2RCSL 3MV7B 5D2NA 4ZUVB 4UT6L 1T0PB 1DBJH 2BSRB 3QH3B 4R7DB 2QSCH 1TQCB 3G5XA 4LDEB 4PJIB 4LPCA 1LEIB 1EJ6A 35C8L 4NWTL 3CLEL 2HKHH 4KKNA 4NHUB 1RHFA 3OHXB 2D2OA 3MV9A 5E8EB 3TN0C 2FJHA 5A40E 2XY2A 1LO0L 1X5GA 4UQ2B 4OSUH 4UDTB 5I30H 4XNZB 1N59A 2BNRE 2ITCB 2MKWA 2Z8RA 1F45A 3QULA 1QKZL 3SO3C 1BOYA 3MYJA 2AK4E 1JNHA 1UWEH 3UTZB 2QEJA 4ETQB 1S8DB 3GSWB 4XHJD 2JB5L 1BQUA 2YR3A 3OAUL 1PYWA 1IAII 2AJZA 1K4DB 2I60H 2IFFL 3G08A 3IJSA 4M61B 2DQCH 1EJOL 2FBOJ 3TCLB 2P8LB 1HZHH 1E4KA 3LPWA 3VXOB 4PRHE 5E8OB 1AO7B 3KLHC 2D9CA 1V5JA 4PY7B 4PJIF 3H6JA 5I1KH 1AKJB 1H5BB 2XQYG 3LH2L 4TRPH 1TVHB 1I9JL 4LVNC 4FG6C 3JWNC 1FZOA 4UOW0 2EXYD 1N3NA 4YWGL 1RUMH 2I24N 2VXUH 1F90L 4RGNC 4E5XA 1UM5H 4PJFB 3ARFC 5C2BL 3VD9A 4KRPC 4HIEB 3B3IB 4QTIH 4RMVA 5C0RL 2PETA 1T4KB 2D0GA 2E6JA 5CJOH 4N1CA 2C26A 4U1JB 1EEYB 4P4KB 1C12A 3ALWA 3KLSA 4KV5F 3FKUS 1KPUB 4ZDHB 2C7UA 4YH6A 1JHTB 3MRPA 2DTMH 1INQB 1DQQA 4RMWA 4ZYKB 2RJMA 1QA9B 1QO3A 2L0DA 4FNLL 5IM7A 4OM0H 3CLFL 4HUKB 4U1MA 3S3SA 4Y4FB 3D9AH 4JFFB 4PGJA 4DOHB 1U3YA 4PP1D 2VTFA 4FA8A 2WIMA 1PGRB 4Z7VB 1GGIL 5FFLA 3V9FA 2O5YL 5C09B 5CEXB 4OZFH 3MLWL 3SKOB 4Q9RL 1X7QB 1ZT1A 4PJFF 4ODTL 1CIDA 5GJSL 5IVXA 5FYJH 1KEML 3CFBB 2BOBA 3NN8B 4XNYH 1FORL 3MRNA 2XOTA 5F89A 3L5WB 5JW4Q 1KLGB 3AC0A 3C6LA 3LEYH 2FZ3B 2X7LB 1H3WM 2O5ZL 3SGJC 3V7AE 3FO1B 5IR1A 4GKNB 2BVQA 4P2OB 1KJ2B 3CUPA 3NCEB 3SE4A 4ONFL 4R9HA 5SWZA 3AS0A 1VENA 1ZT4B 5TPWL 4CDHA 1EHXA 1FVCA 5I1AA 4P3WA 3U82B 2YWYA 4JM2C 4TVPH 3NIFF 4LRIC 2E7LA 2G9HB 5DQJB 5F7YC 4JVWA 2HAZA 5EO1B 1BBDL 3TNMA 2DBLL 2E3VA 2IAND 1AD0A 4Z7VF 1T03L 1S7RA 3S36L 4HG4K 2HH0H 3CGTA 3IVKA 3LRSA 2CGRL 1BFOB 1NLBH 3C9NB 5CD5C 2DYPA 4KKLC 1OW0C 1VADA 3X14A 1OGAE 5E6IC 4MCZA 4ELME 1V3KA 4UV4H 8CGTA 1LE5A 3BIBX 1HXMB 1HXYB 2FJFA 4OM1H 2IPKA 3FFDB 3MZGB 4MNGA 3ZDYE 5F3BB 1KJMA 3NABL 5TE4L 4RWYL 1CXIA 2N7AA 4CN4A 4ZQKB 4LFHD 2DQDH 2R69L 3BT2L 4MJIB 3TA3B 1Z5LB 1JV5A 3S35H 1RUAL 4WFEE 5CKAA 5JLZA 3H42H 3LS4H 5EBMB 3JV0A 3OJMB 3CFDA 3KPLA 4DQOL 3RGVB 1A1MA 2H1PH 3K4ZA 2VC2H 5L2KA 4XCYB 5MI0C 3HUJA 2IMMA 4FTVA 4HXBH 4WI4A 2DQFA 4BKLB 1UWGL 1FG2B 1F8TL 1D9KA 4UI2A 5B22A 2B20A 5D96B 1I8LA 1XCQB 1DQMH 4OLYL 3QEQA 4WHYH 4D8PB 3RNQA 5IVZB 3I3DA 4LQFL 4HIIA 4WHTB 4XB7A 2BRRL 3OZ9L 4P23A 4H20H 4DZBB 4PJ8A 4P2QA 4EQ3A 1LHZA 1LE9A 5CILL 4U1IA 3BP4A 4BFGA 4KI5E 2QJDA 3F12A 5T1KD 3BZ4A 4LSQL 1NDGB 3RJQB 4U1GB 4LMQE 1F5WA 1FNSL 5GRXG 1PQZB 1MI5A 2BSTA 3TBSA 2P46B 1BJ8A 5GQBA 4OT1H 3C8KB 5DYOB 3V7AG 3QO0A 3NZHH 4LASL 3CK0H 3VXSA 1RY7B 2D0FA 1DJSA 4YQXL 3QUZC 4RFEB 4U4BA 3KAAA 1E4XI 1X3DA 5FDWA 5GSRB 1INDH 1DN2A 1XF3A 3WLBA 3TGXA 2DQTH 1F3JB 3PDOB 2Y5TA 2JIXD 3WO4B 1JF1A 1RQ5A 2B4CC 4ZO7A 4M1CC 2FX8L 4MVBC 1JF6A 2B4CH 4CRPA 5I75C 3BGMA 4I13B 3FN0H 3S37H 2ARJQ 4KPHH 3RWCA 3L6FA 2RCSH 4UT6H 5FYLD 5F7DB 2BSSB 4NRYA 1RUQH 1JGEB 2YA0A 5DJDA 5ITFA 4NWTH 4W6WB 3CLEH 3MRRA 2RHEA 4U7KA 4PG2C 3O41A 4PLJD 3BH9A 3KPNA 1UEYA 4QRTB 5IHUL 1LO0H 5E8DL 3RTQD 4Y4HD 2CRIA 2DQUL 4YHPB 2VE6B 4M4RA 3QPQD 3SBWA 4UQ3B 2HLAB 3L7EA 1QKZH 1XIWA 1AHWB 1S5HB 2GY5A 2BJMH 4MNQD 3HI1A 5T1LA 2NY6B 4PPTA 5E99L 3OKNB 3QSKB 3LKQA 3CMGA 3DV4B 3VXMA 4Y16C 4NYLB 4ZUTB 1BEYH 1BIIB 4HBQA 4LGPB 2UWEA 3LMJH 1MCWW 1FVDA 5I19L 4J6RL 1ZA6A 4OJFH 1U91B 4X7DC 4LLVA 3MRHA 2Y23A 1YJDL 2HKFH 3MYZA 4WW2B 4XVTH 3U0TA 3P4MB 3TO4A 3OAZK 4X6BA 3OKDB 3CZJA 5H35A 5E8PB 3UPCA 5IEKA 1IT9H 4XB8A 2GJ6E 1V7MH 2VDQL 1I1YB 1YMHB 2DQIH 4Y89A 3SY0B 1JPTH 5HPMA 4ZPTA 1L0YA 2C4XA 4A6YH 3V0VB 4K3JH 3W0WD 4S1DC 3AB0B 3BD3A 5FO7B 4HAGA 2NY0C 1WEJL 4KH2A 4RMTA 3VFOB 3R4DA 4WENB 5AG8A 5HJ3A 1H15A 1UH3A 3FQWB 3P9MA 1YMME 3QWRA 4Y1AB 3LZFL 3QQ4B 5D7JD 1QHPA 3LKPB 2I9LA 4GAYB 3UX9B 3VFTA 2B1AH 1IEBA 4OGAD 5F3HA 5HGBB 5FKPB 3MV7D 2ZSVA 2YPVL 4MNHB 4DKFL 1U3HD 4YHIA 1XF5A 5A3IC 3VWKC 1GGIH 2R2BB 3C5ZA 1EGJA 2VISA 3MLWH 4OCNC 4F8TA 1MFNA 1P1ZA 1S5IH 1DLHA 2DD8L 2XTJC 1FORH 1W72A 4O5LH 4NZRL 1NL0H 2HJLA 3ETBF 2GK0B 2O5ZH 3IKCA 2QKIB 2W92A 2VOTA 5IT2H 3TZVB 5A2KH 4H1LB 4NKOB 5I9QB 5ICZB 4JB9L 5IWLC 3O3DB 3EO9H 3ILQD 5D1ZD 3T0AA 2R1XA 1XR9B 2WBJA 5TPWH 4PJXE 1JGDB 4JZJB 1WBZA 1T20A 3D3VA 5DHYB 1AO7D 1HQ4B 3OL2A 1J8HB 1EERB 2FCBA 4L3EA 4F37K 3QUYB 3AGVA 1OB1A 1VGEL 4WWKA 1C08A 4WCYH 3LQMA 4G7YL 1T89C 3S36H 3MJ9L 1BJ1J 5AUMB 1RK0B 3BZDA 3S3JA 4OD2B 1R5WA 1FPTH 5J8OA 4H25B 3MX0A 3RVUC 3RAJH 3NZ8B 5DWUH 3K8LA 4B7LA 1GC1H 2GFBA 4HEME 3ZKMC 1XGUB 4CNIA 3B9KA 1NEZA 2H32H 3DRTA 4I18A 3DIFB 4P59L 4WEMB 1E28B 3S34H 2X10A 4V2BA 5TFSL 4PRBB 3WS6C 4ZSOE 2DBJA 1AD9A 4Z7NE 1Q9LA 3ULVD 3CX2A 3MOQA 4FQXB 1N4XL 2YK1L 3FQUA 1YY9D 4PJDA 5DHVB 3VMPA 3IDXH 5LGJB 3DUUA 2FDBP 1AE6L 1DVFB 1RJCA 5MENE 4P46A 4Y5VC 4DQOH 4HH9A 4IHOB 3VRJA 4GW1A 4H26B 4X6CE 3RX8A 3O9WD 4PTUA 1IQWL 2HTKD 1RAMA 1F8TH 2M8XA 3VW3L 1M7DB 4XTRC 1GIGL 3HPLB 3VFMA 1IEAA 4DCQA 4TOYL 2ZSWA 2BRRH 3FRPG 3REWB 4JG1L 3SDDC 2WQ8A 4D9QE 4UUJB 1TTFA 4KHXH 4BFEA 4J8RB 3EYSL 5I71C 3ALXA 4TQEL 2EEBA 4OIIH 4R8WL 2A1WH 3PP4L 3UJIL 1VFAA 3HA0A 2E8YA 4URTB 3TT1L 1FNSH 1WAAA 1BVLA 5I15L 4ZTPL 3NCCB 3KLDA 5DUML 1YEIL 1T6VN 1FNLA 1QFUH 5DD0L 5FK9B 4QXGL 2DM2A 5JHDB 1A1NB 2JJUA 3UYPA 4LASH 5E2UH 1SBSL 3O6LL 4HS6A 3CVHB 3DGGA 3KYOA 2V17L 4QHKJ 5ALBH 4GRWF 5JOFB 2BXYA 4JN1L 3ARXA 3MGTB 4HIJB 1GPOH 2ZOLB 3BUYA 2ERJB 4OLUL 1KTKE 5HVHB 1A6ZA 2NX5A 4OFKA 4EI6A 5GS0H 2Q7YA 3GRWA 3CSGA 5E4EC 3UTSE 3V0WL 5C6WH 3M07A 5I17B 3BPOB 4MCYB 1A9EB 4OIAA 5FGCE 1G9MH 1YQVH 2BY1A 5FGSA 2H2SD 2P7TA 1BD2A 4MJID 1P7KB 3TA3D 43C9A 1DR9A 3GHBL 1BECA 3UBXG 2BNRB 4HKBB 4Y2OA 5SX5H 1BGXH 5FKAB 1BVKB 3QFJD 5T3ZL 1LD9A 1IBGH 3BZEB 3RGVD 1C5BL 2ADFH 4PV8A 2OL3A 3K1DA 2X4OB 4O58H 5ITBL 4N90E 1PEZA 3BISA 3HZKB 2ZUYA 1F11A 3EOAA 4QHUB 2R29L 4Y19A 2DQUH 4QCIA 4LAQH 3DV6B 1U8JB 4G3YH 3B2VL 1E27B 2RQ8A 5C08D 4P5TB 5GGRB 1BQHB 2BHUA 4E0RB 4NN7B 3CDGA 3VD5A 3JUZA 1AC0A 3TN0A 4GJTB 5C07D 3VJ6A 4Q0XL 2F58L 3BIKA 4M7LT 4XHJC 4PY8J 3U1SL 2CRYA 4M43L 1GOFA 2DQEH 3V6FB 4ISVB 1YJDC 5I19H 2ESVA 4PP2A 1KSRA 2CDEB 1YJDH 4LLUA 2Q6WB 5FDYA 4K8RL 4ZOBA 5T1DL 4TUJB 3SCMB 4M7JL 4Z0XA 4UZGA 2HG5A 2VDQH 3GSVA 2EXYC 3CXHJ 4JJ5B 1G6VK 5GRZA 2V5YA 4Q9CA 4CADB 1QFOA 4X6FA 1CD1B 4CMMB 2Z93B 4CMHB 2EDLA 3MC0A 2FX9L 1CFVH 4JO2L 4UU9B 3QDMD 3IDIB 4OUUB 1EMTL 4XNQB 3R06A 4M8VA 4I9WD 4QYOB 4X7CC 3LZFH 1HSBA 3U79A 3ARFA 3BKML 5ICXA 3MLZL 1TFHA 3M1BB 3S5LA 4HZLB 3QUML 2M1KA 1U8PB 1A9BA 1IGJB 4LEXH 4DKFH 3QRGL 3VXUD 4WFFE 4FXGB 1AQKL 4POZD 3IDYC 5EIIB 1CL7I 2UUDK 4PP1C 1KCVH 1J0HA 4PJEB 5F7UA 2R8SH 5I6XB 1SJHA 3BXNB 3K2UL 5C0AE 5IV2A 1RJZA 1NSNL 1Q0YH 1QFWL 2WM0A 2SEBA 3MV8D 3O8XD 4YHKL 2ZUTA 4NQDE 2J1KA 1MHEA 4NZRH 4F7MB 2DJSA 4OZFA 1QNZL 4O51B 4LCCB 5BVJB 3CFKA 1U8LA 4ZUWB 3T0BA 4KDVA 4RISH 2W0LA 4YX2H 2P44B 2P8MA 5MEQA 2AJYL 2GTWB 4R4FL 1T66D 5ETUA 2IQAB 4EVNB 1OGAB 2MKLC 1VGEH 3SGJA 1YYML 4G7YH 1RPQA 4P4RB 5SWZE 5JQHC 1QEWB 1M05A 4NUJA 1T3FA 4PJEF 3MUGA 2P24B 4G9FD 5I66B 2V5SA 4ENEC 4EUPA 2BC4A 1CDYA 3JZ7A 3VXRD 5HHOE 2Z31D 4JM2A 2W07A 4LRIA 3BVNB 3OB8A 3J8F7 3FO9A 3PHOA 4P2CG 5IBUB 2X4QA 2XKNA 5DRXA 4HJGA 1M71B 3DMMA 3DTXB 32C2A 1XCTB 4WW1B 5ACZA 2VDNL 4G80B 5E00B 1NQBA 4Y1AD 1ZLVH 1SVCP 2QL1A 4UTAH 3GMLA 4KUCD 3GMRB 3F7VA 4L9LC 5GS1B 1OW0A 3T0WA 5E6IA 1HH6B 2WW8A 3MLTA 5H37H 3HC3L 2YK1H 4MNGE 4NGHH 4YR6A 3D25B 3ZYIA 1XGTB 2X4SA 4GW5A 1LDPL 3LRGA 2DIBA 1AE6H 1URLA 1QRND 2XIDA 2P48B 2W1NA 2Y25A 4QF1A 5JIKA 4NNXA 3HNTL 1AR1D 5BVPH 1JK8A 1B88A 1C7TA 4N8VA 2AEQL 1MCKA 1IQWH 5ESQB 3LS5L 4PJ7F 4Q6IC 3RVTD 2VQUA 1S9VB 2W0FA 4JFZL 5EWIL 1N26A 3WLWD 4NM4L 2HT2D 1I4FB 3SE9L 5KSBA 1GIGH 4MLSA 4JFEB 1NGZB 5L2KE 3HUJE 3VH8B 4JG1H 3L5IA 3MBXL 4MA8H 4YO0B 1DQDL 3MRDA 4G8GD 4E42A 3B9VA 2AV1B 1R3KA 1I3GL 3ARBB 3TBTB 1JZ5A 1NCUA 1LEGA 3FHQA 2NTSP 4M7KL 1J8HD 1S7SA 4R8WH 1VB9A 3UJIH 3D18B 2OQJA 5I15H 2VLRA 3ARZA 2J8UE 3GSRA 1N0XH 1YEIH 1CGXA 2CDGB 4HMCA 1GOGA 1R3HB 1D5MB 1Z3GL 2FJGB 3O4LA 3BP6B 1OF2B 4PBVC 4J1UB 2Z8WC 2EIZA 4D2NA 3HPJA 1I1RA 2MPAH 3CDCA 1OTUC 1U9KA 2GJZB 1WFTA 4D94A 4I2XA 3EYVA 1XGRB 3S7GA 3L3OA 4ORGB 4DN4H 5F7WC 3EJZD 1UWXH 3LHPL 1I8KA 1DEDA