4AG4L

Crystal structure of a ddr1-fab complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
210
structure length
210
Chain Sequence
DIQLTQSPALMSASPGEKVTMTCSASSSVTFMYWYQQKPRSSPKPWIYLTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSNPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPITHELIAL DISCOIDIN DOMAIN-CONTAINING RECEPTOR 1
publication title Structure of the Discoidin Domain Receptor 1 Extracellular Region Bound to an Inhibitory Fab Fragment Reveals Features Important for Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/transferase
total genus 49
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2012-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ag4L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ag4L01
2A38A 5MEPA 4U6HA 5L2JA 5DR5H 4OCYL 5HGDA 2AJ3A 2R0LH 4K7PX 4XNQB 4R8WL 4YBQD 5FKPA 3DRTA 3H8NA 3VE0B 3MTRA 3MFFB 4WTZA 35C8L 5EU3B 1NKOA 1TETH 4OF8A 4LAQH 3DECA 1R5IB 3QWQB 1BQHB 2YS4A 2F19H 1IAOA 3NAAL 5C0CD 3GSOB 3O9WA 3FQTA 4NO0D 1MFCH 2AJZB 4LCWE 4GW5A 3V6OC 2NY0B 43C9A 3X3GH 4WEUD 4KI5F 4XWGL 4PJ9D 1VGEL 2ADJA 1P6AB 1N5YH 1VESA 5GSVA 2BFVL 1FPTL 3V6OE 1AGFA 2P24B 2H9GB 3A6OA 5C86A 2H32B 4GG8A 1IEAB 4XNUH 2D4FA 5E00A 3WHE0 3CFKB 4CNIA 3BQUA 1UB6B 3GGWA 4OLXL 1NSNH 2VABB 1HH9A 4M9OA 4LLYA 4PRIE 3OGOE 1M71A 4DKFL 3NCYS 4EKXA 2CK2A 2GIYA 3QEGL 1AXSB 4YUEH 3MLYH 4PJBB 2FSEB 3MV9B 4FNLL 3Q5YA 3AS2A 1X44A 5E8DH 1BQUA 5DXWA 3DTXB 3GIZL 4CJ0A 5IOPA 4ETQB 1J12A 2F54D 4P23B 1S9XA 4AEFA 1NUNB 4FQHB 3ULUH 1RU9H 1K8IA 4WI7A 3IFPB 5DMYA 1FJ1B 4QF1A 1NGQL 2ZOLA 1OGAE 3BAEL 3FN0H 3QZWG 5GGVH 1CICA 3SE9H 3RVXC 5I15L 5SWQB 4L4JA 4DGVL 2X1XR 1AE6H 2V5RA 4NKMB 4LQFL 4OJFL 4GG6A 3QDGB 4M7JH 2GAZB 4UT7L 1DBML 4DEPB 4X99A 1YEJL 1C16A 1TVDA 2C4FT 1FH5H 1PQZB 1GRWA 1S9VA 4K3EL 1EO7A 2G5RA 5IF0A 1MFEL 1RZGB 1KBGH 1XT5A 4ORZC 5D5MA 1FVCA 3VFMB 5FGBA 2OTWB 3CFBB 3RU8L 4AH2A 3T0DA 2Y07H 4H26A 1G7HB 4EJ1C 3CH1B 4FRWA 2CK0L 1R3IL 1Q9LB 1CLYH 4JRXD 4L3CA 1IT9H 1YPZE 2DTMH 3DHMA 4ZO7A 4JM4L 2EDOA 3MLVL 1JRHH 2ZCKL 4WW2C 2GY7B 3WFCL 1PG7H 5HGAB 2DWDB 4WHTB 5I0ZA 1QRND 2M2DA 2AK4E 4FXKB 2X44D 2R2BA 2X4SB 3N50A 4ONFL 1P4BH 2CGRL 2X4NB 2BVQA 3D18B 1CIDA 3W9EA 2V5TA 3SDCA 4WU7B 4OZIE 3H2WA 5D7SH 4ODWB 3VH8B 4I0KA 3LRHA 4JFEE 5EZJA 2JJWA 5ICXA 3KPSB 4EDXB 4F7CA 1K5NA 4PRHA 4WGWB 5EO9A 2G60H 4WY7H 3MRRB 4I4WB 1CVRA 5T1LD 1W8NA 4JM2C 4PG2C 4ELME 1NLDH 4K8RD 5HGGS 4UNUA 3X13A 1AC0A 4KUZH 2YK1L 1IM9A 5CP7B 4AIZA 1D9KD 4AK1A 1LEIB 3MCKB 4YDIH 1HNGA 1UKTA 4FTVB 5H8DA 1Q72H 3QXDA 4JCLA 5KTEH 1G84A 5E03A 1U8LA 3NFNA 1SVCP 3O2VL 1VFBB 3PL6D 4YBQC 1MFBL 4LLUB 1TTGA 4WUKH 5TF1H 3TO4B 3MRMA 4PV9B 2X40A 3GK8L 1INQA 3HI5H 4MCYA 5IMMA 2H8PA 4PJGF 2E9IA 2EIDA 1CFTB 2ZUQC 1HHGA 4WENB 3U2SB 3QDJB 3PWVA 5EC1A 2OR9L 4EVNA 3VGBA 4QEGA 1JCKA 3BSZL 3QUKA 2NY2B 2DIAA 4Z76B 4QTHA 4YX2L 3V4UL 1BQSA 2Y6SC 5TH2A 5DJYA 1YNKL 4EI5B 1G6RB 1WISA 2W0FA 3FQWA 1J0YA 3CJJA 1KEGH 2VQUA 4Q7DA 4N8VG 1I3UA 5J6HA 3UTQB 1B6DA 3E3QE 5I17A 2QHRL 4FN0A 3AREB 1A3QA 2E6JA 3ZLQC 3D0LA 4G9DB 5H94A 2CDGA 1S78C 3KYKH 5EO0B 1L7TL 4KY1H 3IDMA 1KJ2B 4NJAH 1CL7L 3QUZA 3GRWL 3AY4C 4HKBA 2DLIA 2GQHA 3Q0HA 3GZKA 5KSAD 2I9LA 3MRNB 4NQCB 2DICA 3MV11 5F88A 1LEGB 4I13B 4GKZB 2ICWJ 2JJUA 1ZLWH 4Q9QH 1WIOA 5C0AE 5E24E 1WJ3A 1IAIM 2D7MA 2VTFA 2VE6A 1TJGL 3PHOB 5EU6A 2D7NA 5I1KL 1NMCB 1PG7X 2IPKA 1RZIB 5C08D 4WJ5A 2KZWA 1QSFD 3KS0J 5CCKH 3FTGB 3IJSB 3U0WL 4MX7A 4CAGA 4FHBD 1NMBH 3PHSA 2B1HH 1F8TL 4MXQD 1RMFH 2VITB 3SDXB 1IKNC 3VRLF 3S5LB 4R7NA 3NIFE 4EOWH 1P2CB 3ILQD 3GBLA 3V5KB 4NQEA 5EUKB 3L7EB 4M61A 2ZUXA 5DHVB 3L5WA 4U1LB 4GRWF 3G5VA 5IR1B 4M6NH 5GGRB 1ZKAA 3UPCA 1ITCA 4WV1A 1K8DB 1QYGH 3WNNA 3VFVA 3T0BA 1XF3B 1NC4B 4WI2A 3IJHA 3RPIB 1RZJH 5GGTA 2EYSB 1IAIL 1G9ML 4PJEA 4Z7WB 1T6VN 3ZSSA 2CQVA 1B0WA 2Y06H 4KKNA 3ZKXC 1H15B 2GJJA 3LQZB 5JO5A 1UWXH 5A16A 1F42A 1FRGH 1X7QB 3H7BB 3JVGC 3P4MA 3EKCA 4JKKA 1OY3B 2DBJA 3KDMA 1B6UA 3HZKA 1CQKA 2FLBT 4PRPA 1GZPA 4QRQA 3RDTD 4P9HL 4K8RC 1EH9A 4JN1L 3P4OA 3VDCA 1BZ7B 1HIMH 4ODSH 5CBAA 2ZUUA 5I1GH 4KWUA 4RAHA 4HZAA 4YHYB 4Y5XA 4MNGA 5HYJD 5BMFH 3MRFA 1KT2A 5MEOB 4E0RA 1Y6KR 1IC4H 3JWDL 1FZJA 2NMSA 2X42A 1RJYA 1F58L 1IKFL 5GGUA 2DM3A 12E8L 4PJXB 1XGPA 3K74B 3T0EE 5K59E 1DANU 1JHLL 3QEUA 5L0QB 3ZSTA 1BVLB 1WQVT 3BHBB 2XRAH 1OOAA 1GYAA 5JPNA 1NFIA 2JCCF 3O2DL 5IROA 5GRVL 5J3HD 4FQCH 1MPAL 2CKBH 1N3NB 1J8HA 3RGHA 2BERA 4M1GL 5DRXA 3ETBF 4YDLB 3U4AA 3IS0X 4FQXB 3W81A 2QEJA 3WN5B 4PJFB 3QNYA 4XPHH 1WZ1L 2COQA 2BCKA 5JR1L 2QSTA 4HAGA 4BSVA 4X5XA 2AQ1A 3BOVA 4XC3H 1FFOA 2FYYB 3TZVC 4AMKH 3GJFB 5MERB 1MVFA 1U8MB 5JNYA 1BBJA 1Q9KA 5LCVH 2FECL 3OKMA 5DUBB 1R3KB 3FT3B 3G6DL 4HG4K 4ODUB 4M6OL 2GJZB 3KR3L 1LE5B 5L2KD 1NBYA 1MCBA 1I9RL 2UWEF 3U1SH 1XGUB 5IB5B 4KJQD 1N64H 4HS8H 2VLJD 4UV4H 1LO2H 2VDRL 2P5WA 2R39A 3VWKA 3Q5TA 1MWAB 3WHE1 5DJXA 4MCZA 1M6OA 1DVFB 4Y5VB 2F74A 1FL3A 1D5ZA 3HMWH 2IGFH 1W0WB 1BQLH 5ELIA 3VFPB 1RQ5A 4NHUB 3V6OA 5FB8B 3NMEA 1KGCE 2W0KA 4X9GA 5GGSY 3FRPG 1AO7E 3RFZC 5CGTA 1II4E 3MNVA 1UXSB 4PJ5D 1CFSA 4Q9RH 1I7TA 3SHSA 4MA7H 1H9VA 3VFNA 3OAYK 4JVWA 1MH5A 1UC6A 1XFPA 5IHUL 1U6AH 3MLXL 1ZWIA 2CKBA 3LKRA 3UTSA 1HEZA 3OKEB 1HH6B 4O51B 5CD5D 3BPNB 4NC1C 5CMAA 5T1KB 1M4KA 4XGZA 2H45A 3OB8A 3TNMB 1UM5H 2ZUWA 1ZMYA 4LVOB 4NC1E 2CXGA 3U46B 5BRZB 3VXSB 5FO9A 2H3NA 2QR0B 4UIKL 4TSCH 4DAGH 4LEXL 1S7UB 4Q9BA 2HN7A 1JNLH 3EOTL 4OB5L 3CFCH 2A6KA 1MAJA 3I50L 3MC0A 1RK1A 1BAFL 1OGAA 4GLRI 4U7SA 3SDYL 4ODHL 4CDHA 4LVNB 3ILPB 4UIMB 3PWUA 4YWGH 3E6FA 5IB1B 3V5HB 5IFJB 4H88L 2BVPB 4I77L 5E6YA 2OL3B 1NUDA 1KNOA 3TT1L 3HUJF 2P5EE 5JUEH 5DHXB 3MGTA 2EDJA 3ULVC 2H6PB 4BZ2H 2ORBH 5EU4A 2MPAL 3EO1B 3QUMB 3QDMD 1CG9B 1QRKA 1AY1L 3RDTC 4MD5A 2VZUA 4G3YL 5F7KC 5CD3B 3ULVE 3LPFA 4NN5B 1ZHKB 5FM8A 1YJDC 3GNML 1KN2L 3DYMA 4HZLB 4C59B 2IALB 1ZGLB 2VDOH 1N0XH 4X6CE 3UCRA 4L3EA 2PW1A 1UEYA 4P4KD 3H9ZA 1E6OH 4ZO9A 5CEXA 3NH7L 3RNQB 1CDBA 1V3LA 1A6AB 1W2KT 2NZIA 3L3HB 1SJHB 3V0VB 1JGUH 3GSXA 4OZIA 3HLAB 2BSRB 2YMXH 1M7IB 3F5WB 3PGDB 3IGAB 4JFEA 5HDLA 2Z4QA 1YYML 5DHYA 5D7IF 5GS0C 1R3LA 4Z78A 4Q0XL 1Z9SA 1U8NB 4FQLL 3ALPA 3DX9B 4NO2A 5F89B 3DJ9A 4Z7VB 3D1MC 4JR9L 4KK8D 4JM2A 3DWTA 4PG2A 5CINH 2QADC 3FQNB 3F6IA 1QOKA 2B0SL 4TTDD 5F7FA 1J5OL 2CDFB 4RFNC 3MRHB 1ES0A 4P9HC 4NKOB 3U79A 2JIXB 1A5FH 4CADA 3TVMA 1XAUA 2EEBA 35C8H 3P30L 3MRJB 3HNTL 1NAMA 1WT5C 3WLWD 2PO6D 4BH7B 2G5BA 4XP6L 3V0WL 4JFPA 3IETA 2CLZB 3E0GA 4HEPG 4D8PA 2IMMA 4OZFH 3O3AA 4XWGH 2F5AL 3T3PE 1VGEH 3QDGD 1YDPA 2R15A 4RQQB 5GPRA 2BFVH 2V9TA 1FPTH 4ENED 4U0RB 2BXYA 3S6CA 4OCWL 1CVSC 3WS3A 1RI8A 5C0CA 3PABB 2P8PA 1XF5B 4G6ML 3V6ZB 4NO0A 4ORGB 4GUPB 3QEQD 4YGAB 3MNZB 4PJ9A 3I6KB 1KFAL 3EFDL 2C7UB 4GFTB 3MFGB 5C6PB 2WWKO 5LG1A 4X5LA 4F7EA 3QHZL 4GKNB 2IFFL 4GLRH 3EDKA 3D39D 4QRTA 2RR3A 1WC7A 1MJJA 2W9DL 1YQVH 3O6FB 3Q3GB 3V52H 4U0QB 3GIZH 4Z18A 5CSGA 5DD0H 4KZEL 3C09C 5DK0A 3BP5B 5ENWB 5FYLD 1WCQA 2V7HB 1J1OL 1NBZB 2A77L 1WTLA 3BKJL 4GT7A 1JWSA 2PF6A 4V1DD 3P11H 1MLCB 1NGQH 3KPSD 3BAEH 1DQTA 2PYFB 2HKFL 4MVBD 4O58L 3TCLA 5FM5M 4M8QB 3AAZB 2EC9U 1A3LL 1S5IL 2R23B 1G6RL 2DLEA 1N5AA 4JFXA 4Z0XA 2F54A 2FH6A 5AD0A 4NQSB 4ONGH 1DBMH 2AEIT 5GISL 2NXYC 3BH9A 4M7ZC 2DF3A 5DUPH 3RL1B 4K3EH 1P6FA 1MFEH 4M48L 3E8UH 4OD1H 2DQGH 3KGRA 4P46C 3RU8H 2BVEA 2H26B 3BN9C 3DIFA 3BP4A 5GS2D 2BOBB 1KJ2L 1NGYB 3B4NA 4HBQA 5CJXC 5KSVB 4WFFD 1F4WL 3EDDA 4HJGB 3MLVH 3VXNB 3QP3A 4D0BA 5DEGB 2FD6L 3BKYL 1Z9MA 1IKNA 1IE5A 1IL1A 1I9JH 5IK3B 2CGRH 2GFBB 4ZDHB 3OZ9L 4ZUTA 3QDJD 5I8OH 2NY0C 4JRXA 1T1XB 4QHKJ 5F1IB 3U7YH 1N7ML 5C0RH 2AVGA 2NY2D 3U30B 1T66D 2FL5A 1IGFL 5HTSA 1LK2B 4RWHA 2DQJH 3W11D 2ATPB 3TIDA 4O02L 1QRNA 1AD9A 3L5JA 4NC0B 4E42A 3AB0B 2VDQL 3RZWA 1B0RA 3U82B 5BVPH 2HMID 1JV5A 4JFFD 4OGYL 2NZ9D 3HZMA 5E1AB 4DWHA 2GK2A 4OF3A 2YK1H 4OIAA 1EIBA 3DX6A 2WZPD 3DGGA 1XR8B 5T1MA 3EJYD 2VDML 5JPMB 4BA8A 3JVGA 5E8PA 2EC8A 1RUKL 4KK8C 4KJWC 5T1LA 1DE4A 4HGWA 1SBBA 4WTZG 4S1RL 3TO2A 3OQ3B 4U1MB 4PJBE 1KCLA 4TTDC 4P23C 3MV9E 4I18C 1D9KA 2FH8A 4G42B 4H0HB 5HJ3A 1V3MA 3BEVA 3GK8H 3QG7L 5DQ9B 1ZLVH 3UX9B 1MLBB 5DO2D 5L9DL 5DZLA 3WLWC 4C56D 1YEFL 2F9BT 3O4OB 3F7YB 3T2OA 4I2XA 2FJHA 3BSZH 3PL6A 4QT5B 4JVUA 4DEPC 3LEXA 5DQJA 3KJ4B 3W39B 5IEHB 5J6GA 1PYWA 4MAYB 1YNKH 2ENSA 3TPUB 3QDGE 1PZUB 4TNVK 4ZXBD 3V5DA 3O11B 3LIZL 3RVVD 4OUOA 1CE1H 4J1UB 4GXUM 3CLEH 1G7JA 3BD4A 2YD8A 4PGEB 2BSSB 5IFHH 3CFDB 3INUH 3MREA 3KHQA 4U2YA 4YZFE 3GRWH 5K9OA 1E4JA 3NCMA 4GMTH 5IESL 5CP3A 3MBEB 4EBQL 2QQLH 4G8GB 5I1CH 1KLGB 3MJ7B 2AK1L 3P0YH 4F37F 4WI9A 3RWJA 3B9EA 5F3HB 2BNQD 3HG1B 4NQXB 3UP1A 3OGCB 4FFWC 1U3YA 5KSAA 4O2EA 2ICCA 5LWYL 2B8OT 2L7JA 1AO7A 3KPSE 2WUBL 1I1AD 3ULVH 3L1OH 1GJIA 4I9WE 1FGVH 1HI6A 3BN3B 4GSDL 1VENA 4V2CB 3T77B 5ICZB 5FXCH 5ESQB 4AEHL 3BVNA 3KYOB 1F6AB 1U95A 1K6QH 1YJDH 4YHNA 1NCWL 5JHDB 2R8SL 5CEZL 4R2GB 1QSFA 4ALAH 4FTVE 32C2A 5F71A 1Z9OA 4XVJL 1W8OA 1UQSA 3MSPA 1T83C 1LVEA 3QXVA 1PFCA 4X8JA 5H35A 4NO5A 4Y2DB 5KVFH 3AMLA 1WAAE 2VQTA 2FBJH 5DYOB 4FFVD 5DJDB 4OLEA 4LU5L 4RMVA 5LKNA 2GITB 4FQXD 3V95A 5GS0H 1IAIH 3S34L 3F7VA 1JYVA 3EYVB 1IEBA 5FV1L 1A1OA 2NY2C 3BW9B 4NNXA 2IANB 5CEYB 4XAWL 2VXQL 3QDJE 1E4WL 1YMMB 4NQDB 3CSGA 1QNZL 1DN0A 2A83A 1EXUB 4EI5C 3D69A 2IPUK 2P5EA 4MB4A 3IDNB 1DQML 4RBPK 4P9HH 2NZ9C 4BQ9A 4LOUD 4XX1G 3AREC 4CDGC 3QWOA 1EMTL 3EJYC 5E4IA 5FEBA 4BFBD 1MIEH 4JFZL 3JWDH 4OQ1A 4L8CA 4OZ4B 1KF9B 12E8H 2DL9A 3PWJB 5CUSL 2NQCA 3TESA 2KUTA 5J1TC 3RDTA 3BZEB 2EZ0D 1ED3A 3QXAA 1JHLH 1V8HA 4LEOB 3EYUL 2DDQL 1Z0NA 5FKAB 4NQCE 4D9LL 1A0QL 3RWFB 5HYJA 1ZT4A 2Q6WA 2OL3L 7FABL 4HGMA 1AGEA 1NMCC 1E27B 2G2RA 5DD3H 1NEZB 1RULH 4CVXB 5HHPB 3STZB 1EEYA 2Y1VA 2V9RA 2YD9A 4GMSL 5GJSL 5JR1H 2R69H 1RZ8B 1DQDH 5K9QI 3PJSB 3ZKSD 1IFHL 5T1KD 2I27N 3REWB 2A6DA 3CSBA 4L5FL 2WINB 2CR6A 1KTLB 4M6OH 3VFRA 4ELKB 1DBJL 3SDXE 2MQCA 1NCBL 4JPKL 1T0MA 1I1YA 2BMKB 1R24B 1FFNB 2VOTA 1YMHA 3IXTB 4NUGH 1UB5B 5F1SA 1JGDB 3DUHA 5HVWA 5I19L 4UV7L 4NWTL 2J5LB 1OAKL 1F4YH 5T3XE 4OD3H 4P3DB 1ZHBA 1JWUB 2IBZY 3RVWC 2E7BA 4OM1L 1WT5A 5J1AB 2G9HB 5L2KA 3C2AH 2ZJSH 5DMKA 3KPNB 3P77A 4LHQB 2B2XH 4G8FA 5C71A 4YXHL 2BVOA 4ZUWB 1ZT7B 2VLJA 1TCRA 3MRPB 3T1WA 4Z7WE 4XHQA 4PY7B 5F93C 3RTQB 5FYKD 3VRIA 1DBBL 1TMCB 2YWZA 1ZTXH 3KPOB 1CDUA 1WFUA 2ARWA 3QSKB 4GH7B 1ZS8B 1IGTA 3P9MA 2XWBA 4TULH 3VGFA 1F90L 4U1KB 5ADPL 3T2PA 5C0ND 2P48B 1GAFH 1VSCA 5IHLB 4WTXA 3X11B 3ARYA 4JDTH 3HZVA 4YHYC 3U7WL 4PJ5A 4R4BB 1ROWA 5T5FH 1XGTA 1P1ZB 1FDLL 1MHPL 1P7QB 3IFOA 4ZFFA 1ND0B 1JGVL 4JO3L 5FO7B 4E41B 1U91A 3FQXA 1NDGA 2IBZX 4UIKH 4LEXH 4HK0B 2KPNA 4LSRL 2HT3D 1I3GH 3HCVA 2H32H 4MS8D 4CGTA 1G7QB 1BAFH 4E5XB 4H1LB 3CDYA 4POUB 4O4YH 4FFVC 2C3WA 4OIIH 3GSVA 4ODHH 5LXGH 4YDLC 1QBML 3DGCR 4FQXC 5IV2B 3L3JA 1N4XH 4H88H 4R90L 1VEMA 5ISZD 3IDXL 1F3DJ 1Q9WA 2IAMB 1PJ9A 4JRYB 1RIUH 1OT2A 4YHOL 5E2WL 4LLDB 3QCTL 4PJFE 1IBGL 2A9MH 2EDBA 1XGQA 5FECA 1MRCL 3UDWC 2BHZA 3TT3H 3TBVB 2JB5H 1OP9A 4RNRB 1LHZA 4P3CH 2X6MA 4P46A 1AY1H 3GSUA 4PJ7F 4G3YH 1KB5H 3KYMA 3IDUA 1I4FA 1OF2A 4WCYH 4KHTH 4OFYD 5EBMA 4HIEB 5JIHA 4UTAH 1KN2H 2OSLA 2VWEC 5E8EB 3CSPA 5F7UA 4N0FB 5CJXA 1J0IA 1PG7W 2Y72A 3WV0A 1O7SA 4PJGB 4HFUH 4POZD 4KKLD 3QO1A 3MLRL 4JPIA 4YHML 3VE0A 4R4ND 1PD6A 3K1DA 1DVFC 1OAQL 3QDMA 4CMHC 4Y5VC 3IDJA 2CKNA 1C5BH 2C26A 2R0KH 2EZ0C 5J4MA 3GSOA 2AJZA 3WNLA 5E2TL 1RJCA 1U8JA 2FX7L 2ICWB 5GXBB 1YYMH 1YNTA 2APFA 1MHCB 4NOFA 5E4EB 5KOMC 4P4KA 3VGEA 4FQLH 5KVDH 4XC1L 3TH2T 1U3HB 4WIQA 5INCB 4NN6B 2DLHA 2FZ3A 1JZ2A 4WW1A 3CFKA 3MGAA 3VI4F 1KJVA 1UB6A 3B3IB 3I84A 3CC5A 1FE8H 2AXFB 5FDWA 3LSOB 4MSWB 4HW6A 3BPNC 1IAMA 1IQWL 1UH4A 3IDGA 4Y4KB 1JF1A 4OGZA 4OLUL 4LVOC 3P30H 4OZHF 2X9YA 4ISVA 4NKDA 4PB0L 3C60D 5IVZB 2H2SD 5F9OL 3OR7B 5E08L 2ZNWA 4Y4HB 5IMKB 3V0WH 2R2EA 3MJGX 3FB8A 4X6FA 5BRZE 3VXSE 1ZLWK 2F5AH 3RGVB 4ETQA 4L29B 4I18A 4XCEB 5MHSE 1KB5A 4MWFB 4ZSOB 5DRNA 3PV6A 1P53A 3DV6B 4P48A 3IU3A 2PO6A 5I75B 3JV4B 4H25B 5SWQA 1HDMB 1AC6A 4G6MH 4DUVA 4OFVA 3GO1L 2ADFL 1HZHH 5AAMA 4Y16D 2XKNB 4OLVL 5ANMA 1KFAH 3EFDH 3QDGA 4FQ1L 3MR9B 4FQJL 2GAZA 3NABH 1I7UA 2Z92B 3CMGA 4XBGB 5E6IB 1PQZA 3QHZH 1FHGA 4HIHA 4HLZH 5E7FA 4K71B 2Z31D 3KYNA 2KZ1B 5EBLA 4GRWB 2CUHA 2YD4A 2W9DH 2OTWA 1R3JB 3OKNA 3SPVB 2ZOKA 4MJ6B 4WHCA 3L6FA 5C0NC 1BGXL 3ZYJA 1MRFL 2Y7QB 5HBBA 3QEQA 4ZUVA 1U8IA 2WV3A 2EIEA 4MDJB 1URLA 3QIUB 2N4IA 4F33B 1FFPA 1J1OH 2A77H 2QSCL 1WUNT 3QPQD 2DWDA 3VXMB 3D39A 5GRXG 2XQBH 5HPMB 2X4SA 2DQFB 1VFUA 2XNAB 1A3LH 1RUQL 1G6RH 4XXDA 5JOFA 4N9GB 4MS8C 1UWXK 1ZLSL 2MHAA 1C5CH 4HWBL 5C09D 1LNUB 4V1DA 1JPST 3W9DA 2JE8A 1NBVL 3KPSA 2B1AH 3EOBB 4M48H 4Y8AA 3VFGH 4LLWB 5AEAA 4D3CH 3PDDA 5ITBL 4XMKH 1Z3GH 3TBYA 5HY9B 4WNQA 1A9BB 1BFSA 2FRGP 1ONQA 4BFIB 3GUTB 1NCDL 4QKXB 3S97C 3ZDZE 3R8QA 1S9KC 4K3DL 3DVIA 3K81A 3MCKA 2J88L 2C3VA 3WFZA 1TENA 4NQVA 3H9HA 3OXSA 4U6VH 4OKVA 2JCCB 1GOFA 5IM7B 2A0LD 4OLZH 1FZOB 3GMNA 1VFBA 1MI5B 4POZC 1T83A 1JWMB 4KKLC 4YHZL 3ARTA 4LCYB 5C0EA 1G7IA 2DQTL 4R4NC 5HI3D 4LLQB 4O02H 4RGOL 3HS0A 5FGCB 4K94L 5EZOL 2ZPKL 2VDQH 1ACZA 1MCPH 4LPCA 1YY8B 3LKOA 1XCTA 3U2SA 1MCLA 2DQIL 4R3SB 4P2OB 2XKSA 3QDJA 2VAAB 1EDQA 1ZOXA 4X7TB 2DLFL 4XAKE 2IEPA 1FNFA 1NGWB 3MA7B 5EC2B 1DLHA 5EOCJ 2A9NL 5K33A 2VDMH 4GAJH 5T3XH 2UWEB 4MXWH 3WL9A 3QDAA 5HSFA 3RJDA 3FQRA 3O6FC 4UDUB 4K2UH 3G6AA 3BIAX 4M93B 4JFFA 4HQQH 4G8GD 4JPWL 5FAAA 3UTQA 2YD1A 3T2NL 3K7UA 4PJAF 2DQDH 1K4CB 4N0YH 3HI6H 8FABB 1RFDL 4FP8L 3VCLA 3PHQB 3GMPA 5C6WH 2JB6A 2GEEA 3IAGC 3C60C 2H2SC 5DUML 3OAZH 5JMOC 3VA6A 3C08H 2Q76B 1LEGA 1KCKA 3ME0A 2PTVA 2W1NA 4CW1B 1S7XA 3QJHA 1I1FB 3AU1A 1UFUA 3TN0B 2AGJL 2W65B 3I9GH 1RZIA 1I7RB 1SJEB 5C9JA 3LIZH 3V7AE 1FO0A 5HYSB 3QIWD 4BFEA 1VERA 1A1MA 4PTTA 4AIOA 3IRPX 5AUMA 2Z31C 5KAQG 3BX7C 4ZXBA 1N2RA 1TQBB 3S5LA 3QG6B 3GI9L 3SKOB 2K7QA 1P2CA 3CXDH 4MQ7B 2VXSL 1RIVL 2PN5A 4BQ8A 2EH8L 2VMFA 3TF7C 5IQ7L 3RBGA 4R96B 4U1LA 2PYEB 4DVBA 4KJPC 3U30C 1U3JA 2ADIA 5DEZA 3QPQC 3AXLA 1A64A 4GRLB 1T3FB 3HUJB 3W5MA 5D7LB 4U49A 5GGRY 3AB0C 2E7LC 3GSRA 1HHIA 1XF3A 5A3ID 2VISB 3GJFH 2EYSA 3VFSA 4Z7WA 2WUBH 1DBAH 3CU7A 5DC9B 1D5MA 3CFEB 1DEEB 2BNQA 1MVUA 4B53A 4S1DD 1VEOA 1M05A 3C5JB 1RHHB 5SWZB 1UH2A 2YC1B 1A4KB 1HSAA 1MWAH 1I1AA 4MJ5B 4EQ2A 1RPQA 3FOMA 3QT2A 4R4FL 4XVJH 4ZUSB 3H0TB 4HXAL 1JNNL 1X5KA 1JMZA 1G9EA 5F6HJ 3BP7A 2PR4L 5DFVD 5MEOA 3BZ4A 5DSCB 4P2RB 4Z77A 4OQTL 1IC7H 4C83B 3PWLA 4NZRL 4LU5H 5D7IB 1YZZA 3S34H 4N8CH 4NP4L 4XVTL 5DVLA 5J13B 1CK0L 5ESAA 2ZKHL 3ROOB 4X6DA 1P4LA 1CGVA 4YBLB 3U4EB 1J0ZA 1ITBB 1A7RL 1HNFA 1U58A 1JZ5A 5FA3A 3ARDB 3KJ4C 4TSBL 4XPGL 1VFAA 5E2VL 3BE1H 3BWAB 2P47B 4M9PA 2O61A 5BV7B 4NKIL 4Y4FD 4ODVH 4FQXA 4WTWA 1DQMH 4X9FA 4HJJH 4PJFA 1A6WH 1LO4L 3WFBH 2GTZA 3KPQA 1UJ3B 3FQUA 3O3DB 5L6YL 3HMXL 4YXLH 1ACYL 2OJEA 4LRNL 3PP3K 5MERA 1U8MA 3QUYD 3MV7B 3UDWA 4QRSA 4JN2B 4JFZH 3FT3A 1MCOL 5CUSH 1Q8MA 3ES6B 4YHKL 3WDIA 5TF0A 2XV6B 3VG9C 3BP6B 4G8GE 3D3VB 2Y5EA 3HZYA 2K3TA 4WHYG 3RKPA 2OL3H 1MREH 7FABH 3E6HB 4QRRD 1MWAA 5JORB 4XP5L 4QHMB 3TFKC 5GGQH 4ODXB 3HG1E 5TDPB 5FGSA 4DQOH 1QO3B 2IBBA 3DYOA 4HH8A 3QUMH 4MJIB 5LGHH 1LO5A 2XPGA 4K94C 1J1XH 1SEBA 4BQCA 2K7PA 2MSPA 1UXSA 2EXWD 3GI8L 3MLZL 4I5BA 1FORL 5I16B 3O41A 1WWWX 1X9QA 5HHVL 4R2GC 4Z8FH 4E41D 2APXA 1RJZB 3O8XB 1GOGA 1DBJH 5I1DB 1NCBH 2Z0BA 4JPKH 4JY4A 5JHDE 4K9EL 2VZ1A 4HDIB 3BKML 5BVJA 4M7LT 5T1KA 5E70A 4M43H 4UV7H 4Y2DC 3K3QA 1DFBL 2I07A 2ERJB 5F7YC 3AFLA 3P3YA 3Q5OA 5I76B 3MV8B 5EWIL 1T20A 5CJOL 1QKZL 4MA8H 2XZAH 2D7TL 4IJ3B 2IAMD 4DFHA 4OF7A 3RKDD 2UY7A 2IH1B 4MNQB 1NGXA 4U1SA 4UUJA 4U4BA 1NJ9A 3SKMB 4LHJB 4IS6A 3MOBH 3DI3B 2YPLD 2DJUA 5CWSB 3HE7D 3BT2L 3SE3A 2DQHH 4JHAL 2QL1A 2X70B 1YMME 4K3JH 4NQDE 1GC1C 4N5UA 1RAMA 2F5BL 4KHXL 2X4TB 3GB7A 4CU8A 1WFNA 5IP4A 3SGEI 1JN6A 2J8HA 5T1DL 3U7WH 5ADOH 4IRSD 2LE9A 4RIRA 4QY8B 5J89A 3IFLL 1FDLH 3QUMA 1W72A 2FJFB 1T7YA 3S4SB 4ZMAT 1OM3H 1X4YA 3QUXB 3KPRB 2XG4A 5CD3A 1P4IH 1OTSD 5BO1L 2MCG1 2BSTB 4MD0B 4KI5E 3W82A 5C6TL 4B7LA 3GEWB 4P5MA 5IVXB 1FFRA 1ZGLA 4ODTL 1OAXH 1HXMA 4U1JB 3L7FB 1JI1A 2ICES 1KLUA 5DFVC 1XZ0B 2NY3B 3ABZA 3NA9L 4R26L 1L0QA 2J8UA 3C5ZB 1XCQA 1YYLH 3RNQA 1NANH 2DOCA 1OPGH 2NNAA 1SJHA 3HLAA 4G80B 2BSRA 5D2LA 3BIBX 1H3PL 4KDWA 4YH6A 2EIZA 2X9WA 1EK3A 3IGAA 3BUTA 4JO4L 5D1XB 2JJSC 4H0GA 4HJ0C 3QFDA 3TBTB 3TYFB 2X1OA 2VH5L 1LILA 1JZ4A 2YPKA 1FP5A 5EU7C 4QHNA 6FABL 4W70A 5FYLL 3VWJD 3G08A 3HB3D 4HUWB 2GHWB 1XR9B 5C1MB 3D0VA 3UYRL 1YC8A 5EU7E 5ISZA 5I1LB 5HHXH 5HVHB 1B0GB 4X6BA 1FG9C 2YA2A 1MFDL 5ID1B 3A6BL 5JZ7D 1U0QA 1FV1B 2CDFA 1OVZA 5E5MB 3MLRH 4YHMH 3MACL 1CQYA 2V2WB 1ZLVK 3PUCA 2FB4H 4CL7A 4ZTPH 3RY4A 3U9PL 2NY7L 5GZOD 3TH3T 4OD2A 5B38B 1A6VH 3F6LA 2P42B 3GHBH 4OFYA 3UYOD 5IJKC 4GOSA 3QCVL 2CLZA 3QH3B 4J23A 4Y19B 2UZXB 1N8ZA 3WXWL 2Q3AA 2FX7H 4M7KL 3SOBL 1AKJB 1HYRC 5E6ID 3RTQC 2VLKB 2NY5L 1NFDF 3OPZH 2ZSWB 5DFWH 4XC1H 1UEMA 4FABL 3W5NA 1F3JA 3JTSA 4QRRE 1K4DB 1AXTL 1XF5A 4ORGA 3CMOL 1CDHA 1R5VB 4PJCF 3IVKB 2ARJA 2YHGA 3MNZA 1J9CT 2V17H 1IQWH 3I6KA 2HP4A 3Q48A 1SYVB 5E8NB 1P7HL 1U9KA 1SJVA 4OLUH 5BOPA 1WLHA 1UWGL 2J4WH 4KVNL 1MHEA 2EH7L 3DURA 5TE6L 5BJTB 4QTIH 2AEQL 4E41E 3RZCD 3GMRA 5EU5A 1EX0A 1EO8H 5I1HL 3CX5J 2V7HA 4O2FB 4W81A 3MXVH 3SGEH 2VUYA 1VCAA 3C60A 3MYJA 1I75A 5IHBA 5FK9B 3S3JA 4UOW1 5DD6A 3QFJD 4MA1B 1BZ9B 2IAMC 2CIIB 1CGSH 4EUPH 2L7UA 3FN9A 3X12B 1CXFA 1JK8B 1U8KB 5DJCA 3KWWB 3GSQB 2RCSH 4NUJA 2RQ8A 3DMMB 5FYKU 3QAZB 5IQ9B 1BOGB 3HE7C 3DI2B 3I3EA 4JO1L 4JRYE 5DWUH 4L4TB 4ZPVB 3HE6D 2VZTA 3VI3F 1TFHA 4HUUB 3KJ6H 1MF2L 2DTSA 2BOBA 4XVUD 2X7LA 1MRFH 4NRYA 4XP1H 1HOCB 2E7CA 2YSSB 3VXTA 3C2SA 1ULVA 1X5AA 1FG2A 4H20L 4RFOL 2CSPA 4HWZB 4K9EC 2R4SL 2WBKA 3VJ6B 2Z31A 4LASL 5JOEA 4PJGE 2FEDC 3SY0B 2Z35B 1AQDA 1QSED 1ZA6B 1OTSC 1S5HA 3BGFB 4BSWB 1IC5L 3NFSH 4EIGB 5F97E 2Q20A 3QHTC 1UVQB 4LCIH 5DFTA 5F1IA 5DD5L 4YBHA 5CBEA 1FL5A 5FA4A 1AQKL 5E4EC 4YIQB 3T65A 4HWBH 5L8KB 2ESVD 1QA9B 1NBVH 2FIKB 3CX5K 4NO3A 4QXUL 5TQ0H 1NL0L 1U3HC 4D9QD 3Q2CA 3BYTA 1NCTA 5DJ2A 4DKEL 4XRCA 5ITBH 3R06A 3CUPA 3NCJH 2HG5B 4X5WA 1NCDH 3KNBB 4AEIH 4HD9A 3TYGL 1A6TA 1PLGL 1XR8A 5C09A 3DARA 2J88H 5GHWH 4UDTA 1YN7B 3WSQL 4WUUD 4EUPA 1T1WA 1A9EB 3VWJC 2IG2L 2ICEA 5F3BB 4LF3A 1UCTA 2WUCH 4F7PB 3FT2B 3OKDB 4Y4HC 2XXMB 4QNPE 5CIPB 4RGND 1QSVA 5GRUL 2DQUH 4G43A 3RGVC 1BQHG 3RWEB 4WFED 5JZ7C 4IRZH 3UEZA 3KLAA 4G42A 4YHZH 5DT1H 5GSRB 4KROB 5GRVK 2Q8BL 3QQ9C 2VDNH 3TN0D 2DLTA 3BZFB 1MLBA 4RGOH 3VXRB 5L7XL 5HGBA 4K94H 5EZOH 2ZPKH 2HVKB 1LWRA 4XNZB 5I75C 4O00A 5C07B 4ZUUB 5B39A 4PLNC 1ORSA 4IDJH 3RA7H 4PBVC 2NX5B 4ZSOE 5C0DB 4NNYB 4LLMA 1OTUC 3QIBD 2FHBA 3PDOA 4PTUA 4PJ8B 1CT8A 5I1EL 4BH8B 4N9OB 2D0FA 5MEND 2E9WA 5E6IC 2A9NH 2OQJA 4XPAL 1MQKL 4N0UA 4UB0L 3VRLE 2XT1B 4ZPTB 4KK6D 4XPBL 1YUHB 1MOEA 5DDHB 1F13A 3OBAA 1CGXA 3SN6N 5C8JB 3ZTNL 3V8OA 4CVZB 1K85A 4GRWE 1LE9A 2BY3A 4PRBA 4I0PB 2YUXA 4GG6F 1LDPL 3GJEA 5JOPD 1UA6L 3QIUC 3VFUB 1IGCH 2EICA 3CFDA 3VXPB 4FP8H 4KKBD 4YE4H 4MQXC 1H5BB 1QFPA 1BJ1H 4CJ1A 2X2YA 3EYFB 5D5MF 1KPRB 5C0IB 1ZANL 2WWKT 3OXRB 1G1YA 3MGOA 4X80L 4N0CD 4IIQC 4G8GA 1HXYB 4TUKL 3VXUB 3VXME 2X1PA 3BGMA 1XMWA 3LEYH 1DLFL 4JFYB 1GH7A 4UI2A 2YPVL 3C6SB 2PTTB 1GC1H 1P5VA 5EO1A 5K9QG 1EJOH 1KN4H 5T3ZL 1T4KB 4NQXA 1I7ZB 1X5ZA 3GSWB 4O5LL 1C12A 1OT1A 3OAUL 2EDFA 1QVOB 3MJ6A 1CLOL 2AV1A 2RFXB 5SWZD 1S9YB 1A6UL 3QI9B 1QFUL 3HPJB 2DBLL 4JQVC 4M5YL 2H1PL 2GI7A 1FYTD 1AI1L 2EO9A 2A74B 4IOFC 3LZFL 2HJKB 4QRPB 5ICZA 5DF0A 4YDKL 3KYOA 2JJTC 4GQ9H 2EDQA 5JHDA 4OCXL 1A2YA 3HNVL 3FONB 4WU5B 3GI9H 1EFQA 2VLRD 3L3OB 2F15A 1FNEB 3FOLA 2O5YH 3QIWA 3CSYA 2JCCE 5T33L 3UTZA 2W07A 1DUZA 1TZIB 4Y2DA 3ARDD 3HRZB 2Z8WC 4WWKD 5DYOA 1QLEH 1MI5E 5EG6C 4QWWD 1DEDA 4YHPA 4YC2B 4M62L 5F7EL 4MA3B 2OK0L 3VH8G 3L5XH 2AXHA 4XP9H 4P2OC 3MJ8B 1XIWB 2R1YB 3IS1X 5FGCE 2EEAA 3QQ4B 4RSVA 1INEH 1QP1A 4PJ7B 3I6LD 4F7MB 2GT9B 4RZCB 3SO5A 5E5UB 1YMMA 4Y1AB 2ICWI 5SWSB 1I9IH 2YN5A 1WIPA 4N8PA 1T2JA 3WE6A 1EBAA 1CLZL 5ECJE 3FL7A 1NAKH 2HWZH 2OJZL 3T4YA 1YEGL 2Q7YB 2UWEE 1UXWA 3CK0H 4JFOB 1NMAL 3AROA 4RAVB 3VFTA 4R4FH 1CF8L 1NC2B 1UZ8B 4NZUH 1J18A 1BWWA 5I1IH 1OCWL 1FVDB 4TSAH 3WO3B 1QFOA 1PEZA 1PW3A 4HX1B 5IW6A 3D25B 4HLZG 4DUWA 3OG4B 4NGHH 5F9WB 1S7SA 4OQTH 3GMMB 1OGTB 4OZ4A 5D7JD 4NZRH 4KUCD 3BZEA 2OI9B 1U42A 4YQXL 4NP4H 4XVTH 1H3XA 2PCPA 2DAVA 3L3GB 43CAA 4H5SB 1EAPB 1CK0H 1BBDH 2BNUB 4PB9L 3CZJA 3UTPD 1Q0XL 4TSBH 4P57B 4F2MB 3AC0A 3TN0C 1JP5A 2HAZA 4X4XA 3FO1B 5HHOD 4OFPA 1D5XA 4A6YB 3C8KB 1OP5H 1J05A 1XF4B 4CVXA 2OTUB 3S36L 4N1EA 4AG4L 3STZA 4ZTOL 4ZAKB 1HQ4B 3QIBC 1LD9B 1HQRB 4HWEL 5L6YH 3EDFA 3HMXH 3LRGA 3PJSA 4OZGA 1Y18B 3ROLA 5GGSB 3CZFB 1YEIL 2OCFD 4Q6IB 5JLZB 1TQBC 2D03L 3BIKA 3NFPA 1KTLA 3WUWB 3PQYD 4Y4FA 1FZKB 1MCOH 2DKUA 4H1LH 5HHNB 2XA8L 3LAFA 4PJDA 1BFVH 2YEZB 2BMKA 2HJLA 4HEME 2IADA 4WO4B 4YXKL 5DI8B 1C5DB 4Q2ZB 3ULSA 4KKBC 1C8PA 1GGIH 4XBEL 5D1ZD 2R56L 4GRLC 2PYEE 3IF1A 1DDHB 4XP5H 1UCBH 3T4AB 4NIKB 3U0TB 3HUJE 3SJVB 4I3RL 1I3RB 5D7LE 5AZEH 1P7KA 3S35L 5IJKA 3O3UN 2FO1A 4ZUWA 1ZT7A 1J1PL 1W0VA 2QQNH 3OJDA 3I2CL 3L3IA 1T0NB 3THML 5C3TA 4LCUB 1M7DB 5FM4A 4QRRA 5IHZB 4PY7A 3RTQA 3I02B 5E8OB 5HHVH 1I8LC 1RHFA 3KPOA 1ZS8A 1RUPL 4U1KA 4PJEF 4NM4H 4K9EH 3S5LG 5IB2B 5SWZE 3BKMH 2JJVA 4BQBA 4PREB 4HK3N 3EDEA 5FV2A 1DSFL 1FBIL 4S1SH 2VDLL 1TXKA 1KXVC 5ETUB 3ARZA 3O3BA 1DFBH 2Y36H 5I9QC 1P1ZA 5EZIH 3U36A 3K46A 4XHJC 1DTUA 2NXZD 4E41A 1JPTL 5EWIH 3S98A 5KVGH 5CJOH 5TQ2L 5DJ6A 4TOYH 2EKSA 1QKZH 4JKPL 4P2RE 4YDVA 5D7IE 5JW3H 2QKIA 1Z5LB 2EDRA 5D1XD 4E5XA 3ARDC 1J7VR 4M8VA 2YUVA 3ARBD 3KS0H 4PUBH 3VXOB 5BV7C 1CFNB 4QOKD 4Z0BL 1FIGH 3LS5L 4JHAH 3I6GB 1NCUA 2VIRB 4OBRA 2D31B 3LKNA 5BW7C 1T1ZB 4PGBA 1UJ3C 2N1KA 1MCQA 2IAMA 2UYLB 5BS0D 4LPVA 1NLBH 4NPYA 4PRDB 4JRYA 5DGQA 1CFVL 3JV6B 4HKXB 4U6XB 1K3ZA 5T3ZE 3BQUD 3LEVL 4FQIH 4EI6B 5DEFB 1DUYA 2YPLA 1J88A 3HE7A 1EGJH 1ZSDA 3IFLH 4RNRA 4GW4A 5L88H 5HVGB 2NYYD 3O6LL 5I2IA 4JLRA 5BZWB 3MV7E 3RWHB 4XCYB 4HUKB 5C6TH 5IT2L 1EEQA 4N8VB 4HK3J 4N0FA 4Y19D 4PJGA 4IRSA 2OR7A 4JAMB 3NA9H 4X4YA 3QQNA 4GXUN 4YDJB 3GBML 3D3VE 3GSNB 4NRZB 4TVSa 1IEHA 1VADB 3WFHB 2W0PA 1T6WA 3M17B 4PP2B 4G9FB 1H3PH 3UJJL 4GRWH 4PJHA 4JO4H 4C4KO 3S96A 4CMMB 2BC4A 2FLRT 3SCMB 4HPYL 4XCFH 1TIUA 2VH5H 1U8OB 4MJIE 3K8MA 3OWEA 1KOAA 5GRYA 4PJAB 1A7PL 1OAZH 1U3HA 4BKLA 5HHOE 3B9KD 2PXYB 4FQQA 3OR6A 1BVKA 2AXFA 2NR6C 3LSOA 5JMRA 4MSWA 3A6BH 1DJSA 1U2HA 3LN5B 1CGYA 4HKJB 3TBSB 4GRMA 2ERJC 2FATL 3H6JA 3WIIH 3MACH 1SMAA 3GMLB 3RUGA 1AD0B 3VWJA 4LAJH 3RHWK 3REVB 4XPFL 2XKUA 3OAZK 3L5IA 3ZO0A 4LIQL 1M1SA 3MV8E 4YO0A 1X5LA 2OP4L 3G5ZA 3N85L 4NSKA 3WXWH 5K9JL 3BPOC 2FHFA 4L9LB 2XTJD 1INDL 5CZVH 4ZSOA 4D0CA 1VA9A 3OKYA 2Y5TB 3C87A 3QO0A 4MNQE 4EQ3A 5SX4I 9CGTA 5CGMA 1JGLH 1HKLH 3SKNA 1O5DT 1RZFH 4A2LA 1OHQA 4H25A 1A3RL 1HDMA 1AXTH 3NACH 1KG0B 3S3SA 3CMOH 2R0WH 4NN7B 4ZFZA 1CZ8L 2XKNA 4P2QB 4FQPA 3EHBD 4Y88A 5D8JL 3B5TA 1CR9H 1HINL 1QBLL 1P9MC 3ULUD 4JGJA 2Z92A 4M5ZH 4D9RE 5E6IA 2CUIA 5B22A 3SQOL 1UWGH 1WBZB 4MD4A 3QUXC 1YEDB 4Q6YA 3ARXA 3SPVA 5EA0H 1A7BA 5TE6H 3T0XA 2VJXA 4KAQL 3VRJA 2AEQH 4UT6L 5HDQH 1CD9B 3AVEA 1F2XK 5ALBL 1MCRA 3EW3B 2AJUL 3KPRE 3TA3B 4XCCH 4PBXA 4KTDL 3WNPA 3DSFL 5IVXE 1YN6B 2CUMA 5DK2B 5EIIA 4QRUA 5IWLC 1RSFA 7CGTA 4NBXB 1MJ8L 4IIQA 3GJFK 1WBXA 1ZHNB 3H7LA 3LRSB 2ITCA 5FYJE 3HR5B 3RZCA 2LU3A 2OZ4H 5D1XC 5FUCC 4YNYA 4K55A 4LSTL 1VDGA 4IOIB 1D5IL 2DD8L 1EHLL 1E6JH 4JO1H 2XN9B 5FUCE 4TUOA 5HD8C 3T1FA 3Q6GL 3MRGA 3HAEH 1JVKA 1GGCH 2EEDA 4FG6D 4KKCD 3QFJA 3OX8B 1FNGA 2NY1B 4JANB 3MBXL 2VZSA 1JHTA 5EUOB 3P9LA 2XWJB 3LKPA 5TPWH 1CCZA 4KH2A 4Q74A 4RFOH 3MJ9L 1E4XI 1V3JA 2JJTA 4LASH 3TJEH 3QNZA 2NYYC 4HH9B 3HE6A 3MCLL 4S2SB 1MAML 3E2HB 4NDMB 2NX5D 4JM2F 3MLTB 3B6SB 3UZEA 4P9ML 1NCAL 3IDIB 4EN3D 2NY6D 1BWMA 3FB6B 1BD2D 5MEQA 2ZCLH 1NBQA 1JGEA 3FCTB 2HFEB 2HH0L 4HC1L 4N90E 4Y19E 4XNYH 1OAYH 1QSEA 5DRZB 3MODL 2VLKE 1A8JH 4DZBA 3WS6C 2Y4SA 2NY4B 4PD4K 4X7TA 5EC2A 1PLGH 4LCCA 1CWVA 2ESVA 5IFAH 1YEKL 3JV5A 3R0NA 2IG2H 5E9DD 2OZ4A 4TNWK 1EV2E 2XZCL 5SX4H 3I3DA 4Y89A 4BM7A 3K4DA 1H3VA 5JIIA 4ZS7L 3DVFA 2GJ6B 3HAEA 4OAWA 3FRPA 3L3KB 1TNNA 3WYRA 5C0FB 3PWPD 4XH2B 3UJIH 1KEML 4WUUA 5TFSL 1I8MB 3RP1A 3D2UB 5C3LD 4OF5A 3WD5L 3KPMB 3MRLB 4MZ2A 3I3BA 2NW2B 3S8WA 2XOTA 2CXKA 3F58H 4MA1C 2Q76A 2PTUA 3VGAB 2A6IA 2P8MB 2XTJC 5IB3A 2YZ1A 2QSQA 4CW1A 3DMMC 4JHWL 4CVWA 5DVKA 1CXIA 3QAZC 3RVUD 3VG0L 2Q3ZA 4LSVL 4PBWD 5C92A 3TN0A 1WWCA 4QHKI 3ARGB 3CXHK 5D1QB 2JLLA 2HFFA 2V2TA 2AKRA 2M26A 3P0VL 3GIVA 4JFDD 5HYSA 4L4TE 2F53B 3C5SA 3QIBA 1I1CA 2FWOA 4LP4A 5GIRB 1BLNA 2W38A 5T5NG 1AJ7L 5MENA 2XICA 3QEHB 3NCCB 4AEEA 2B5IC 3G6JA 3DUSB 5FCUH 4XWOC 1HILB 1ZANH 3QQ3B 5IW3A 1Q1JL 1QFHA 3BGFC 3EGSA 3ZE0F 4TUKH 3DO3A 3SDAB 2EYTA 4A6YL 5BV7H 1J0JA 4JZJB 3DO7A 1MRDL 2HRPH 1HHKB 2DQCL 4J8RB 3M8OL 1JNHB 2VLME 3C9NB 1UYWL 3K2UL 2IQAA 4S11A 5HGHB 3PWNB 2AI0L 5T3ZH 2E27L 1DL7L 4O5LH 5D7LA 4YK4C 4RX4D 1YEEH 2Z91A 1KTDA 3O6KH 1CLOH 3WIFB 4DW2H 1FNHA 4DCQB 1KIRA 4MYWB 3X14B 4U1NA 4RFEB 2DBLH 4M5YH 2H1PH 4KQ4L 5D9SA 1U2CA 2FHCA 5DVNA 1AI1H 1Q94A 5K93A 3WJJC 1WFOA 3TH4T 2W60B 2CJUL 3EO0B 1GXEA 4U1GB 3CVHH 3DX8A 2Q86A 2YD5A 1I8LA 3EOAB 1IILE 4FG6C 3C5JA 4D0DB 1RHHA 5SWZA 4P5KB 4L4VB 4MJ5A 1FYHB 2DYPB 2Z9TA 3FFCB 1E28B 1SY6L 1FYTA 3NZHH 4U1IB 1HSBB 4KROC 1OLZA 3ARFD 5BQ7A 5A40E 3NZ8A 3B5GA 4FXGA 3W0WB 1ZT1B 3VDBA 4XNZC 5HDOA 3KPPB 3N1MC 1U92B 4X7SL 1QFWM 5F7EH 2VLRA 2BOCB 4PLOB 3VXRE 4G6FB 1CN4A 4OFKA 5CJ8A 5FOBB 5C07E 4LCWD 4X98B 2NX5E 4OLYL 2VR4A 4KMTL 2NTFB 4OIBA 4XMLH 1KJMA 3P4LA 5B3JF 3ARDA 5A2JH 4WWKA 2R29H 1KCUH 4Y7MA 4QYOB 1CXKA 1WVZA 1S7VB 5TE7L 4X4MA 1U8QB 1I8IA 25C8H 4JDVB 3VW3L 2SEBA 1NMAH 5BW7A 4EUPG 3DHJA 3V6FB 5KS9A 2IH3B 2ZG1A 3WFEH 3O3DA 1XGYL 1RZKL 1DZBA 4LPUA 2K9UA 1J11A 2A73A 4PRID 5E6ZA 3TWCL 4HS3B 2NCMA 2J3SA 4L3AA 3N1FC 3KPLB 4YQXH 1BM3L 4YAQB 1NFDB 4PP1D 3IJYB 3MXWL 1JPFA 3DROB 3CVHA 2VLLB 4JG0H 4X7CC 1T03H 2CRZA 3QA3B 1QFWL 1EHXA 3RAJL 4DZ8A 1CGUA 3VXUE 4DN3L 1WK0A 5ILTL 3TGXA 3Q1SH 1RUML 4RISL 3ORJA 3S3PA 2P45B 4PJCB 4J3SA 5D7JA 5LQBH 4WWID 1OGAD 3RVTD 3S36H 4AG4H 5DRWB 1HHJB 3QI9C 4L8BB 1IGML 1KIQB 2D7OA 4HWEH 5DS8A 4P5TB 2CDEB 2AEWA 4HHAB 1AGDB 3EYSL 1WGOA 4F15B 3RVXD 3JTTB 5CSZB 1YEIH 5HHOA 1EZVX 5MI0B 1MEXL 3MLSL 4U3CA 5E2JA 1KCRH 3FO0L 4UQ3B 4QRPE 1ZGLP 4NYLB 1N59A 2G75A 5GZND 5F9JB 4YXKH 3GSNL 3ZZ1A 5FYJH 4HDIA 2I9TA 1CGWA 1DCLA 4XBEH 4FMFA 1ZHLA 3LV3B 3LB6D 5AG9A 5I76A 3PQYA 5I1AB 2E7HA 2AK4D 4HBCH 4OTXL 2N7BA 1XIWC 4LSSL 3S35H 1GHFL 4X83A 1O0VA 5ITFA 5HDBF 1J1PH 2PW2B 4JG1H 2IH1A 2VN4A 4Z7UA 3I2CH 1HCFX 1TQCB 3EAKA 3OHXA 4KZDL 5CWSA 2OXHA 1EEZB 5D72L 4JFED 4PJ7E 3C6LD 2R2HB 4X0KB 1MSPA 1RUPH 2AAVA 5SWSE 5LGJB 3MUGB 5EN2A 3SKJH 5KN5B 4KRPB 1QQDB 4GAGH 4LHUB 1GOHA 1P9MA 4XBPA 4K7FB 4GAFB 5MEPB 1PSKL 4QY8A 1TZHA 5F9WC 4U6HB 5L2JB 5ESVA 1TDQA 2AJ3B 3MPCA 4IRJD 5D2NC 3DRTB 3WNOA 1UWEH 3O2WH 4ZFOA 3DXAD 4ZYKA 1ZXQA 3CLFL 5IVXA 4PYGA 4LDOB 1Q9OB 3G5YB 1IAOB 3BMVA 5D2NE 3O4LB 3ARFC 3O9WB 4G5ZL 2GW5A 3FQTB 2VKWA 43C9B 4Z0BH 2DB8A 2ADJB 3S88H 3VI4E 3P40A 3WIHH 5GSVB 4HCRH 1AGFB 3EO9L 4JZNA 1CXHA 1S3KH 1BFOA 3WDHA 3HN3A 3A6CH 5B21A 2AJSL 5D1XA 5E00B 1ADQL 3BPLB 2DMCA 4CNIB 1BJ1J 3ARBA 4F57L 2DQEL 3LEVH 3GGWB 1QUNA 2PUQT 3DSNA 1B4JH 4Q6IC 3MOAH 4J4PD 4QOKA 1D6EA 1HH9B 4WEBH 4LLYB 2UZIL 5JA8B 3JZ7A 2FX9L 1M71B 1XR9A 1DQQA 3MZTA 2Y6SD 3S36X 4BJLA 5BS0A 1GGUA 5KZCB 4I3SL 3K4AA 2QBWA 3ZL4L 1P84K 3SEPA 5E5MA 4DOHB 3LQAC 1S9XB 1K8IB 2FEEI 4UQ2A 3F7PC 1S78D 3KG5A 4QF1B 4PP1C 2BHUA 2ZOLB 2NTSP 1AFVL 1D7FA 4Y19A 3WFDL 1CICB 1R5WB 5ALCH 3RWIA 3SJVE 3VFOA 5C0AD 1VPOH 3G04B 1QHPA 5C7XH 3RI5K 4GG6B 1A7PH 2EYRB 4J3XA 1CXLA 4X99B 2DS4A 3RVTC 3T3PF 4ONOA 1ZEAL 1C16B 4QXTA 2AABL 4PGCB 1S9VB 5IF0B 3MUHL 3WS6A 3IVKA 5D5MB 5GS1B 1FVCB 3S35X 1FC1A 4ZO8A 5E8NA 5J57B 4H26B 3TA3D 2MCPH 4HCRA 3UPRA 2FATH 4PLJC 5B8CA 2X4OA 3CCHA 3IXAB 1FVEA 1RZKC 3B9KA 4XPFH 4LSPL 4FFZL 3MO1B 2NPLX 5CHNA 5GZNC 2VERN 2OP4H 3N85H 4KFZC 3IRZA 3MNWA 4KTEL 2BNRB 4G6KL 5INDA 4O2FA 1INDH 2BVQB 4YJZL 3LB6C 3SDCB 5JXAL 2XN9D 2KDGA 4FZEL 1MQ8A 4HUNB 4KV5F 2NLJA 1YECL 2E9BA 3S37H 1OSPL 5EZJB 5ICXB 4F7CB 2XIDA 2GYSA 3GM0A 4MB3A 1JK8A 1QLRA 5EO9B 5D8JH 1QBLH 4HFWA 1GL4B 1KELL 3IFNL 4PFEA 5IQ9A 1G9NL 5DK3A 1Q38A 3P0GB 1I85C 1UKQA 3VD3A 3X13B 4JEGB 1IM9B 3FO2B 1U8PB 3C6LC 5LAXA 4WI4A 1KYOJ 2R4RL 4HUUA 3O3EA 1VKXA 1HCVA 4YGVA 4UT6H 4DGIH 3QXDB 4P59L 5GRJL 4AQOA 1AIFA 3CIQA 1HN1A 4JFQA 1U8LB 3NFNB 5IW1A 5FYJU 1OAUL 3VJ6A 3F12B 1WV7T 4H1LG 4IRJC 5CGYC 1ZA6A 4KQ3L 1RK0B 3QPXH 3LH2L 3T0ED 1RUAL 3CGTA 1PZ5A 2CLVA 2DN7A 2GSIA 2CRIA 2H8PB 2WBJD 5J9PA 1GGBH 5F96H 4KK5D 3DXAE 3SCMC 1HHGB 4LSTH 3NIDF 4G9FE 3PWVB 4OCMC 2DD8H 4EVNB 1EHLH 1G7LA 3FAWA 5IKCA 2V2XA 5AYQA 3TPKA 4X9BA 4TPRH 4NFBA 4QTHB 3MLWL 2PXYC 1NH6A 5TH2B 5DJYB 1LO0L 3EFFA 4NM8L 5IJVB 4PJAE 4RMSA 4N68A 4LSQH 5F44A 5FO8A 4C58B 3HA0A 4NNPL 4OM0L 2W0FB 2YD3A 3RIFF 3OJMB 3BD5A 3D85D 3FQWB 2GJ6D 1EFXD 2Y23A 3WXVH 1CTOA 2VDKH 4J4PC 4PRNB 4TRPL 3WJJA 3UYPA 4N1CA 5I17B 1YEHH 3AGVA 1MAMH 3D0LB 3D2UD 1LGVA 1FGNH 2OX5A 3WUZA 5H94B 3TZVD 2CDGB 1AHWA 3IDMB 4TQEL 3QUZB 5EFIA 4HKBB 3E3QC 1KYOK 4J7RA 4J3UA 3W2DH 1JFQL 1BHGA 2I9LB 1NDMB 4GBXD 2FJGA 5GSRA 4P49A 3PG2A 2V5YA 2KQNA 1TTFA 5F88B 4M1CC 2XFXA 3PGCB 4Y8DC 4R7DA 5H37H 4L8SB 3BZFA 3VD4A 1F3DH 3U9UA 2BVTA 4JQIL 4UT9H 5D6DC 5C07A 1OP5K 2VC2H 3DVNA 3MA9H 2NX5A 4OCSL 5C0DA 3BWUC 4NNYA 2X4PA 4EN3A 5EU6B 4M3KB 4NN7C 1NKRA 2IPKB 1BD2A 2C1PA 4WJ5B 4JPVH 3I85A 1H8SA 4ZOEA 1KGCD 1IMHC 1TVBA 1AO7D 3TCXA 5KJRL 4MX7B 4P2QE 5J11B 5DDHA 3U83A 1KCSL 1IAKA 1KC5H 2XZCH 3ZKQD 3QDHA 3S37X 2F8XC 4R7NB 2HFGL 1T0PB 2EDXA 3OSKA 1EBPA 3TA3C 4ZS7H 4NHCL 2BVYA 3CVIH 1GZQB 2CMRH 3VXPA 1FIEA 2CIKA 4M61B 5TDOA 3L5WB 4MAUL 1KEMH 1KPRA 4PRAA 5E9DA 2HLAA 3OXRA 1FAKT 3BUYA 3GKWL 4K07A 4WV1B 5D70L 3VFVB 1TJIH 2Q87A 3C6SA 3IJHB 3MX0A 4PJEB 5J0BA 3AM8A 3PWPA 1T4KA 5C0BB 1I7ZA 1JPGB 3AUVA 1H3TA 4F7TA 5KG9A 5JO5B 1T04A 4KPHL 1QVOA 5A16B 3WCYA 2DI7A 2XN9E 3AS3A 3P4MB 3JWNC 3EJJX 4I3GA 3KDMB 3FO9A 2NW3A 3WEXA 5IVOA 2X4QA 4PRPB 2P5ED 1GZPB 1AJ7H 4QRQB 1JF5A 2I5YH 5AYUH 2YRLA 3R1GL 3P4OB 4J3OC 5EUOE 3UBXB 5CBAB 3OKKB 3NN8A 3W0WD 1ZA3B 1Q1JH 2Z93A 4Z7OF 1H0DA 4MNGB 4FZ8L 4X6EA 3L3OA 3MRFB 4JFDA 1KT2B 4XMPL 1FNEA 5HPOA 3ULVD 1FZJB 4A6YH 1RJYB 5GGUB 1UACH 2KQMA 2EE6A 5HHMB 1FSKB 3M8OH 1QSZA 3QEUB 1LMKA 2DKMA 2MKWA 3SE8H 4OV6F 4WI8A 1JTOA 5AWNH 1ZLUH 4OSUH 5JPNB 1NFIB 5I8KL 1RURL 2F58L 3T0EC 1LP9F 1Q0YH 1QBBA 3MJ8A 1XIWA 2R1YA 4U7KA 2WBJC 3D48R 3VMNA 1CFQA 1MJUL 4KK5C 1KENH 2FX8L 4KK9D 2BJML 3VA2C 3V4PL 3QNYB 4UILH 5EH1A 2BCKB 2CJUH 5SWSA 1V05A 4K7PL 2VQ1A 4RX4A 4X5XB 1FFOB 2YBRB 5IMOA 4UAOC 4K3GA 5GS0D 1L0XA 5JW5A 1BBJB 1Q9KB 1G9NC 3BKCH 3OKMB 4R0LA 1ZE3C 4HIXL 3MMEA 4LKXA 1T1YA 1ERNA 4LDLB 5E7BA 3LQAH 3H3PL 1SY6H 3LMJH 2A6JA 2PNDA 4PGZA 1YNLL 3T8XA 1NBYB 4UTBL 3F7QA 4G7YL 1KCVH 2QADD 2GJ6E 2KL6A 2P5WB 3VU2A 4NJ9L 3VWKB 5D2NA 5I18L 4MCZB 4M6ML 3VGAC 4H5SA 5EBWA 2F74B 1FL3B 1D5ZB 4P5TD 3RIAF 4GBXC 3I75A 5EBGA 2BNUA 4KMTH 5DTFA 1C7SA 5HXMA 2ED9A 1J0KA 3ARFA 4JDZB 4ZFOL 4OGAC 4P99A 1A7OH 4JKWA 4ZOAA 2IJ0C 3ARGC 5D1QC 2AEPL 4POYA 5F1NA 1XF4A 4LLVA 5LBSL 3LN4A 1CFSB 1I7TB 5F70A 4LCWA 4XPTL 1XGYH 1RZKH 4NZTL 5BXFB 1MH5B 4WFGE 2L4OA 2F53E 3BO8A 3CZFA 1ZWIB 3LKRB 3UTSB 4Q6IA 3QULA 1UZ6F 4JKLA 3HAEG 1SYSA 1OSZB 3ZMRA 5HHNA 2EDNA 3SDAC 2YEZA 1BM3H 4JO2L 2DM4A 4JZJC 4HT1L 4TVPL 1SBSL 2P46B 2O5ZL 5FO9B 2H3NB 1WZLA 3OMZA 3RAJH 4V2BA 3CDFA 3OF6D 4XNMA 2GTWA 2HN7B 4PRIA 1UM4L 2BY2A 4O2CA 5EULV 2P8LA 3ZKMC 3T2QA 5IMLA 2BXZA 2A6KB 5F21B 4DGYL 2J6EH 4U33A 1RK1B 3UC0L 3FKUS 5I8CA 2JK5B 5F6HI 2Q8AH 1N6QH 4F8QA 3NPSB 5EOCH 1IGMH 2EE9A 2YR3A 3PWUB 2ADGA 1BJMA 3E6FB 2HJFB 3KXFB 3EYSH 4NWUH 5HYSG 1KNOB 4LCUA 3ZYOA 4U1GC 1UADC 1D5BA 4YHIB 3PGFH 3MGTB 3FO0H 1VB9A 3LCYA 3FRUA 4PPTA 2NXYD 3LHPL 1AP2B 3BRDA 5EU4B 4U1HB 4P46D 4MD5B 4F9PC 5DC4B 2C3GA 4L4VE 2LQRA 5AZ2H 3BN9D 4KJYB 3FFCE 3NCEB 1KJ3L 2WP3O 5DR5L 3QRGL 4L3EB 4UU9A 1MFNA 3M1BB 4OTXH 3W0WE 5CEXB 4LAQL 4LARH 3F7RA 1YPZA 2F19L 2RAMA 4GXVL 4Z5RA 3O0RH 4PGDA 3GSXB 1YY9D 3EYOB 2RGSA 1A4JA 4KZDH 3N06B 1OB1A 2NY0D 4U7MA 1QR1A 2Z4QB 5DHYB 1XGRA 3FB5A 4HV8A 4Z7NF 2AK4A 1KIPB 1R3LB 4Z78B 2FBOJ 4WW2A 5TE4H 1FN4A 4NO2B 1LDSA 3MRQB 4KK9C 4X6DF 2J6EA 4XNUL 4XVSL 4Z95L 1G7MA 3KLDA 3JV6A 4U6XA 1MNUL 4JM2B 4LNRA 3MUY1 2FDBP 1HK6A 1NGZA 3ZKNC 3C6LA 2LVEA 1ES0B 1G9MC 4XCYA 4CADB 4M4PA 1F11B 3TVMB 4ELMA 3FFDB 2ZUSA 1NAMB 4YUEL 4QXGH 5GJTH 5C2BL 2HKHH 4M00A 5JA9A 2AQ3A 4PLKD 3MV9D 4KJWD 3IETB 1NFDE 3RWDA 2AV7A 4D8PB 3O3AB 4X4ZA 4JJHA 4OCYH 4YDJA 4P23D 1T5WA 1YDPB 3PP3H 2YRPA 4R8WH 4IRJA 3ULUL 3FT4A 3DXAA 4PJCE 1CFBA 5EOTA 1F2QA 4P5TC 3FN0L 2AJSH 3B8SA 3WS3B 5GGVL 5C0CB 2DWEA 1MCKA 3NAAH 4F15C 4J12A 1XF2A 5DMGC 2P8PB 2BP3A 4NO0B 3WO4B 5MI0C 1MCEA 4PYHA 3JWDC 4PJ9B 4G8IB 4PJAA 1WWBX 2UZIH 4KTYA 1RZ7L 1MCFA 2PXYA 2AJXL 4G7VL 1VACA 1KBGL 4QRTB 1WC7B 1MJJB 5KSBF 4NZJA 3TV3L 1H8NA 4I3SH 2FGWL 3ZHKA 4F3FB 2BNRD 4IEFB 3OV6A 3TBSA 4OI7A 4J4PA 4OLXH 3N9GL 1CLYL 2DTML 5DK0B 1HHHB 1LO3L 1JRHL 4DKFH 4XCNA 3LKQB 1JWSB 1PG7L 5BZDA 3QEGH 1FFQA 3HTLX 3WFDH 1V7NL 3TCLB 4QCIB 4FNLH 1TQCC 2VXUL 2OR8A 2E7MA 3DUUA 4HMCA 4FFYL 1QG3A 4MJ4A 4HWUA 1N5AB 4JFXB 4Z0XB 2F54B 4CRPA 3VI3E 5AD0B 4ODBD 3BH9B 5D7SL 5D6DA 3ZDYF 2C4FU 3STLA 2ED8A 2X4RB 1CXEA 3MLPA 4FFWD 3AY4A 4KRPC 4L8DA 2BY1A 4I9WD 2HVJA 4WY7L 2ZSVB 5I15H 3SQBA 5C0AA 4DGVH 3BP4B 1NLDL 3U6RA 1SJXA 4DKDC 3LN9A 4LQFH 4OJFH 2ILLA 1WBZA 2WLZA 2FO4A 4JJ5A 4UT7H 5CZKA 5D6CB 1CL7I 1YEJH 4D0BB 4FTVD 4OZFA 5C0JA 1VEPA 4KTEH 3DNKA 5IIEA 3TA3A 1G7PA 5KTEL 3O9WC 4PV8A 3OB0H 5I6XB 4ZUTB 1T21A 1R3IH 2CK0H 4JRXB 4XTRD 5JXAH 3O4LE 5F1OB 1U8HA 4JM4H 1JZ3A 2O93L 2ZCKH 1C08A 3TO4D 1NPUA 1OSPH 4OCNC 3WFCH 1QRNB 4TVPE 4E42B 1B0RB 1IGIL 1ORQA 2WM0A 4ONFH 3BPLC 4M3JA 5ACZA 1YY9C 1KPUB 2QLVB 1EPFA 5LVEA 1G9NH 2J8UF 3HZMB 4TUJB 3ZKXB 2XN9A 5HYQA 3DX6B 4NQUA 5HHQB 3BXNA 2ZNXA 3BPCA 4Z7QF 4PJIF 5D2LF 5E8PB 5DQDL 1SMOA 5CKAA 4JY6A 3S4SG 2Q1EA 4EI5D 5IB4A 5EUOA 3V4VL 4RDQG 2ZP0T 3FJTA 3L3DA 5T1LB 1DE4B 4HGWB 3C8HA 3KLSA 3BJ91 3N1PC 4J2XA 4U6YA 3TO2B 3OKOA 4HH9A 3RX8A 1I8KA 1D9KB 4S0SD 3ARED 2VL5A 4HKZA 5GGTL 1CD1A 2W92A 3BEVB 4KQ3H 4NDMA 4DOHE 1RUAH 4NJAL 5H2BA 1IAII 4ONHA 1CICC 4HAFA 1A7QL 1PX3A 4PLKC 4NQCD 5C70A 3FCTA 4I2XB 3O2VH 15C8L 3PL6B 4Q9QL 1MFBH 4YR6A 3LEXB 5DQJB 1JF6A 2CPCA 1BF8A 3MLWH 5D7KD 3T0EA 1X5IA 1PYWB 1LO0H 1EUUA 4GG6E 3IKCB 4P2CG 5GS1C 5KANI 2WBJA 4NNPH 3LQMA 4OM0H 4X7FC 5CCKL 3OKLB 2MMXA 3B83A 2B39A 2OR9H 5D5ME 4C4KT 3TLRA 2R1WA 1G7JB 1NMBL 2B1HL 3V4UH 4YX2H 1JIBA 1Z9LA 3EBAA 3MREB 2XWTA 4TQEH 2P49B 5K9OB 3U4BL 1JFQH 4EOWL 3D85A 1BFTA 2GJ6A 1EFXA 3WKML 3L3KA 1BF2A 4K23L 5C0BD 5T3XD 2QHRH 2BNRE 4M6NL 4KXZI 1WCBB 3RWJB 3D2UA 3TZVA 3MRLA 5T5NF 1L7TH 5DURB 5A1AA 2NW2A 4L1DA 2IPUG 1CL7H 2D9QB 5KSAB 3RVWD 5DA4A 3RX7A 4GBXA 1NC4D 4O2EB 1RZJL 2JTDA 4D2NA 1XH3A 2K1MA 2Y06L 3RX5A 5TGBA 1MJ7L 2FECI 1KCSH 1MY5A 1TJGH 3BVNB 3LS4L 4YHNB 1U95B 5F7NC 1OD7A 5I1KH 4XI5C 5C08B 4WDIB 1QSFB 1AGCA 5K9KA 3MQIA 3P73A 3B2VL 1QEWA 32C2B 2DLGA 3LKSA 2GCYB 3U0WH 5A2KH 4XX1E 1UQSB 3DUSA 4ODSL 1EJ6A 3RRQA 5I1GL 5I71B 4X8JB 5H35B 3QQ3A 1F8TH 4NO5B 1Y0LA 3GKWH 4JZOB 4X9IA 5BMFL 1IC4L 1T89C 2V7NB 4JZJA 2AS5M 3OJ2C 5JQHC 4JRWA 3F7VB 3LY6A 2PETA 4XTRC 4UINL 3T0VA 1IEBB 1A1OB 4LGRB 2XRAL 5DJ0A 4NNXB 5EIVA 4YFEA 4KPHH 3TO4C 1MAKA 3B9DA 4FQCL 2CKBL 1RV6X 2A83B 4HGKC 3P4NA 4QO1A 2FR4A 2P44B 1UM6L 4RAUB 1DANT 1G9MH 3ZT6A 4XPHL 3CH8A 4WRLA 5FF6A 1GPOL 4PG9A 2BK8A 4JFHE 3EO0A 3GRWA 1ETZA 4XC3L 5E99L 3JV0A 4AMKL 3SE4C 2HYMA 4DN4L 4FZ8H 4P5KA 1HWHB 2VDPL 5DJZA 3QUZC 1IGYA 3D6GA 4LPXA 1CDYA 4IMLA 3RDTB 3O45A 3QXAB 1HSBA 4LNVA 4P4RA 4JN1H 4NT6B 3U1SL 4L8SC 1N64L 3W0WA 1ZT1A 4HS8L 4UV4L 3TIEB 2YRZA 5I8KH 5HYJB 1ZT4B 5ID0A 2Q6WB 2F58H 4HUVA 3EUUA 3KHOA 1S7WA 1AGEB 2DM7A 4LKCB 2G2RB 5FOBA 1F58H 1IKFH 1DVFD 4JGUA 5HI5C 4KVCL 2FX8H 2CD0A 5J7CC 2BJMH 2IGFL 5ERWA 4HS6A 3V4PH 4F37K 4X6CA 1EEYB 3RWCA 1S7RA 1BQLL 1A6PA 4HIIA 4OT1L 5J11C 1U93A 1IM3A 2R1XA 5CJBA 3Q6FA 3O2DH 4IHOB 1MPAH 1U8QA 4KXZH 4N0RA 4OV5B 2A6DB 4Q9RL 3QXTA 3DV4A 3MUJA 4M1GH 4LSDA 3ESUF 5D7KE 3VFRB 1YNLH 1U6AL 4UTBH 3ZTJH 1T0MB 1I1YB 4B41A 1B2WL 1WZ1H 1KPVA 1YMHB 1F97A 4G7YH 5FGRA 2QSVA 4G8EA 2XG5A 4W6WB 1MUJB 5EIQA 4WV1C 5DD1L 2DKSA 1ZHBB 4M6MH 4YAQA 3G6DH 1D6VL 2ZUYA 3IJYA 3NPZB 5BRZD 3VXSD 3KR3H 5L2KB 3MRCA 4NFDA 4TSCL 4DAGL 3KXFD 5DMKB 2CH8A 1JNLL 3P77B 1I9RH 3CFCL 5MHSD 2BVOB 1JPSL 2VLJB 2AEPH 3ET9F 5F7DA 3EJZC 2VDRH 3MRKB 1TCRB 4PJEE 3DVGA 1GVIA 5C0BE 4OUUA 4MNHB 4L8BA 3N1QC 4P5TA 4YWGL 1EVTC 3P9MB 4NZTH 2J12B 2XWBB 5HI4D 1JUFA 4QGTA 1NAML 3RL2A 4PRPE 4JE4B 4MB5A 4UQ3A 4NYLA 4PJ5B 5KSUA 1LK3L 3V2AR 4AY0A 3TNNA 1XGTB 4U31A 4BZ2L 2BRRL 3NGBB 1SBSH 4TVPH 4MNGE 2O5ZH 3OTTA 3CDCA 1FSKC 1U91B 1MCHA 3GMQB 4YEFA 3FQXB 1NDGB 5IHUH 1WBYA 5AG8A 1M7XA 3MLXH 2DM2A 1OP3H 4K7PY 3HCVB 4DGYH 5HHME 3PIQB 4Y5YB 1N0XL 5I1AA 4GKSA 2X4UA 3RWGA 3GSVB 1E6OL 3RNKA 4W6XB 4DFIA 3FB7A 4Q9CA 3OF6A 5L0QC 4WGVB 1JE6A 3EOTH 2VN7A 2YMXL 1Q9WB 4OB5H 4PJXE 4HUXB 1EEZA 3I50H 1XGQB 1PEWA 5FECB 5LGJA 5IG7A 1TNMA 3SDYH 3VD7A 2UVEA 2GK0A 4MLIA 1QQDA 1CE6A 3GSUB 3WN5C 2MQ3A 3KYMB 3M45A 4I77H 1I4FB 1OF2B 1CD8A 4K7FA 1IGJB 5EBMB 3TT1H 3U48A 2OSLB 2ZWLT 4QHUA 5CINL 1KJ3H 2HTKD 3QRGH 4J3WA 5I73B 3VWKC 3QO1B 4AT6A 4JPIB 2C1OA 1A5FL 2JIXD 2MPAH 1IZKA 1LEKA 3T0AA 3QDMB 3TC9A 1ZVSB 3IDJB 2P5WE 5DMIL 1Q9OA 3G5YA 2LU4A 4GXVH 3O4LA 5FHBL 4GO6B 3GNMH 1U8JB 4YFLI 4XNQA 1YNTB 1CI5A 4P4KB 3MFFA 5EU3A 5CEZE 3BGAA 3NH7H 4XVSH 5D96B 4Z95H 1R5IA 3MRIB 1BQHA 2FZ3B 4WW1B 4FXLA 4XAKD 1KJVB 1B88A 1MNUH 3CC5B 5FDWB 4M02A 1HYSC 3IDGB 4Q0XH 3UTSE 1BIIB 1JF1B 2P24A 2H9GA 2GY5A 2H32A 4ISVB 4NKDB 1IEAA 5C2BH 4IM8A 1YQVL 4OZGF 4UBDC 3O6FD 4JR9H 2R2EB 3V52L 3ZT7A 3FB8B 2RBLA 2YA1A 1IQDB 4X6FB 2GUOB 4IBLT 2VABA 1CDGA 5DD0L 2B0SH 4IDLA 1J5OH 4I18B 4LPTA 1KB5B 4PJDF 2ID5A 2MJWA 5DRNB 3NPSC 3PV6B 2CLRB 3P11L 2WIMA 4N5ED 3HNTH 3IU3B 1AXSA 4NRXB 5JIKA 2PO6B 4PJBA 4XP6H 1R5WA 2UV3A 1A6ZB 2FSEA 4X7DC 2HA1A 3EYQD 3MV9A 5JXED 3FZUC 3DTXA 3G04A 5ANMB 2ARJQ 3KXFE 2EYRA 4P23A 4CU7A 3J8F7 3E1F1 4ONGL 4FQHA 5CAYB 1I7UB 1RZ7H 5KVEL 4K8RL 5DUPL 3IFPA 2UVFA 3LOWA 3MLUL 4FOMA 2AJXH 1FJ1A 5FHAL 4PGCA 4HIHB 4LVNC 4G7VH 3KYNB 5HYEA 4OCWH 3DETD 5EBLB 4LRIC 3E8UL 4OD1L 3WUWG 2DQGL 2LVCA 5GS1A 1MFAL 5HI4C 1SQ2N 3OKNB 3TV3H 2ZOKB 2FGWH 2UZYB 3L6FB 2EC9T 3QEQB 1SM3L 3N9GH 4ZUVB 1U8IB 4NKMA 3IXAA 5SX5H 1IZJA 1LO3H 5SV4A 3UBXI 1FFPB 3MO1A 2IFFH 4W6YB 1RZGA 3D39B 4L3EE 2AERT 3VFMA 1CIUA 3CFBA 1V7NH 1I9JL 2BNRA 2VXUH 1G7HA 4NN5C 3CH1A 1JZ6A 4FFYH 2CR3A 5I8OL 3SKUD 2KH2B 4XXDB 1Q9LA 5JOFB 3UAJC 5C0RL 3U7YL 4KZEH 4BZYA 4KJPD 2MHAB 2DQJL 4V1DB 3BKJH 5HGAA 3W9DB 4WHTA 2HFTA 4FXKA 4RMUA 2HKFH 5BVPL 3HC0B 4O58H 2BDNL 2X4NA 3TBYB 4WNQB 3G9AB 4F58L 1S5IH 3D18A 2AP2A 4KU1A 1ONQB 2EXYD 3FO2A 1U8PA 4WU7A 5IBUG 5GISH 2VL4A 4ODWA 3VH8A 2C3VB 3TVMC 4NQVB 4EDXA 3H9HB 5GGVY 3OXSB 4OKVB 1EA9C 3MRRA 4I4WA 5B4MD 1LP9B 2OYPA 1KJ2H 2AXGB 3GMNB 4LSUL 2HTKC 4Z7VE 3F12A 1ZLUK 5CP7A 1SEQL 4OCLC 1F4WH 1LEIA 5C0EB 1G7IB 2FD6H 2DIJA 1RK0A 3BKYH 4FTVA 3HS0B 3HC4L 1T89A 3IKKA 4PY8J 1IGIH 3AS1A 2DMBA 3LKOB 1XCTB 1NEUA 1DN2A 2UUDK 3WO4C 3OZ9H 1WAAA 3GMOB 4RWYL 4UNVA 4PJ9C 5C0CE 1N7MH 4G6JL 2EE3A 3IAQA 4R6UA 4LLUA 4C57C 1DLHB 2RJMA 1IGFH 3TO4A 2W59A 4PV9A 1X5XA 1X3DA 4U0RC 3WL9B 4MAYD 5IJVA 5DQDH 4PJHF 3ISWA 3V4VH 3FQRB 3G6AB 4M7LL 1CFTA 4JFFB 1HKFA 2E5EA 1EHNA 3G5XB 4OGYH 4PRNA 1CE1L 3CLEL 4Z76A 5GGTH 3ZT5A 5IFHL 3INUL 3VCLB 3SE4A 3GMPB 5DURD 5DHVH 3S9DB 2JB6B 4EI5A 1G6RA 4GMTL 3QJFB 4HSQA 3ARUA 1JBJA 1NDMA 1A7QH 1RUKH 3MBED 2QQLL 1X5FA 5I1CL 1CTNA 4S1RH 1MY7A 3RUGF 3ARWA 5CJ5A 4QNPF 3PGCA 4GJTB 15C8H 3P0YL 2EDYA 4L8SA 3AREA 1S7XB 4G9DA 3QJHB 3AU1B 5EO0A 3HG1D 3QG7H 1KJ2A 1QZ1A 4N5EC 2F54E 5L9DH 4C56B 1YEFH 3EYQC 5JXEC 3TFKD 3CFJB 5C9JB 4HIJB 3MRNA 2W9EL 1OL0A 4NQCA 1FO0B 5CS7A 3ULVL 4W68A 3L1OL 4GKZA 1X4XA 1FGVL 3ZE0E 1A1MB 4PTTB 5GS3A 5AUMB 3PHOA 4GAYB 1YJDL 3DETC 1K6QL 4ZXBB 1N2RB 5JHDD 3U4BH 4R2GD 4ALAL 5LGKA 5I6XC 1L6ZA 3FTGA 3WKMH 1GZQA 3IJSA 1FNSL 4K23H 1GGYA 2E8YA 4DVBB 1U41A 3FHQA 1DQJB 2ADIB 5KVFL 4Y2DD 2FBJL 2VITA 4JRXE 3AXLB 3SDXA 1H3GA 3BD3A 3GSRB 5IESH 1HHIB 2VR5A 5GS0L 4EBQH 3V5KA 3VFSB 1QRNE 5EUKA 3L7EA 5C0BA 2AK1H 3F62A 5DHVA 1JPGA 5IR1A 1D5MB 3TBWB 4MHHI 5GGRA 2IAND 1MJ7H 4BK4A 2CO7B 2BNQB 1YMMD 3QWRD 4HG4J 1MCDA 4NQDD 2JELL 5HYIA 3LS4H 2RHEA 1MVUB 1K8DA 1M05B 4WVRA 4ZFGL 1NC4A 3K1KC 1OQOA 3RPIA 5LWYH 3B2VH 1HSAB 1I1AB 1Y6NR 4OZFG 2EO1A 3FOMB 2EXYC 1H15A 3UBXA 4J6RL 2YD2A 3OKKA 3LQZA 1D9KC 4GSDH 1ZA3A 4LDEB 5IEKB 2IWGA 4AQ1B 3MUZ1 1X7QA 2EDKA 3BP7B 3H7BA 4AEHH 1BIHA 1MIEL 3BZ4B 1NCWH 4MXVF 2R8SH 4Z77B 5CEZH 3NCFB 4KI5D 4TN9A 3PWLB 5B3JE 5B4MC 3RY6C 4UINH 3PL6C 4RMRA 1BZ7A 5ESAB 3VD9A 4X6DB 3L9RB 1P4LB 2DJ4A 1U58B 1AR2A 5FA3B 1SHMA 4I2XE 1VFAB 3MRBB 2X10A 2O61B 4WI6A 5DD3L 3O4OC 1RULL 4PJXA 1UM6H 1S9WB 4AENB 2GTZB 3KPQB 1A1NB 1GPOH 1BVLA 2R69L 3FQUB 1DQDL 3BHBA 2YBRA 4G6AD 5E99H 2DI8A 2OJEB 4XAWH 2VXQH 1GSMA 1E4WH 4DN4H 5JDSB 4HJ0D 1JI2A 2VDPH 4MAYC 1N3NA 1QNZH 4QRSB 4OF0A 1QBAA 3WN5A 2X89D 2ATKB 4MGXA 5HVFB 4NUGL 3KLHD 5EZLB 2I25N 1EMTH 2FYYA 1NCCL 3HZYB 3GJFA 1F4YL 4OD3L 1NANI 4KC3B 5DUBA 1R3KA 1BJ8A 4CMHB 3X3FL 5KSAC 4ODUA 4KVCH 1MCCA