4AG4L

Crystal structure of a ddr1-fab complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
210
structure length
210
Chain Sequence
b'DIQLTQSPALMSASPGEKVTMTCSASSSVTFMYWYQQKPRSSPKPWIYLTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSNPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPITHELIAL DISCOIDIN DOMAIN-CONTAINING RECEPTOR 1
publication title Structure of the Discoidin Domain Receptor 1 Extracellular Region Bound to an Inhibitory Fab Fragment Reveals Features Important for Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/transferase
total genus 49
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2012-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ag4L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ag4L01
4RBPK 2I9LB 2X4OA 3V5KA 1TJGH 7CGTA 1JN6A 4XAKD 2RQ8A 5ECJE 2X10A 3KLHC 5HHNB 3ZDYF 1RUQH 4MHHI 1H3WM 1RJZA 2DQEL 3TA3A 3V9FA 1UYWH 3LZFL 1AGDB 4G6ML 2HWZH 3RZWA 2YD1A 5I75C 4G9FA 4ZUTA 1TZGL 4MQXC 1AGEA 1L9NA 2BDNH 1FZJA 3G6AB 5D1QC 3U46B 1HI6A 4J3UA 1JP5A 4XRCA 4JR9H 3NPSC 2ESVA 5C0NC 3I75B 4NRZA 1MJ8H 4AIZA 4NQCA 4CVUA 5FKAB 2IAMA 5HY9B 4Y4KA 1IC5H 1ZHLB 3P4NB 1P7HL 4WWKA 2UYLA 2D0HA 2WIMA 1B0GA 1QBLH 3VFPB 1V3JA 4WDIA 1JYNA 1R5WB 2XZAL 4RSVA 3EW3B 4NQXB 4P2CG 3P0GB 3TJEL 4HS8L 3UC0H 1BVKB 3GSOA 2H2SD 1NCDH 15C8H 2FATL 3PL6B 4NO3A 1MCJA 4ZPTB 5KAQF 3RP1A 4K55A 4YHZH 4FZ8H 2X4RA 3PWPD 2DTMH 1RFDH 2AV7A 4MXWL 3SDDB 2P5WD 4U1JA 1F6AA 1H8NA 4YBLB 1INQB 3MROB 4M6ML 2JF1A 4ETQB 3EO0A 3SGDH 4RGNB 2WWKO 1KJVB 1L0YA 3MRQA 3CDYA 4TSBL 1OWRM 1PZ5A 3IU3B 1AI1H 5DA0B 1KCSL 2OR7A 3QWOA 1T3FA 3UYRL 1QA9A 5DUBA 3IFPA 3U7YH 3L3HB 2XI9A 4N1EA 1NCWL 4OZIB 2Z4QA 3EOTH 3IDMB 2WK2A 4XVSH 3LOWA 4H8WC 3T3PF 5T3XH 5I1JL 3RUGE 4DZ8B 1XFPA 1NCAH 3C2AH 6FABL 1FDLL 3WFZA 2YZ8A 3ZYIA 1JHTB 1U8NA 3K80A 5D2LA 3HZMB 4PJ5E 3S97C 4DCQB 1B0RB 3CVIH 4GAYA 4WI5A 4Y1AE 2DJ4A 2D7MA 3ARBB 1WWAX 1N0LA 1WWCA 2FJGA 3BPOC 4X7FC 5D2NA 3V52L 2VR5A 1QQDA 3QO0B 3X13B 3MXVH 2ZUUA 3B3IA 2FO4A 4MJIA 3VFTA 1YYLH 2FX8H 1KJMA 2W38A 3DURB 4IDJL 2WNGA 1JV5A 5F97E 3P2TA 4BH8B 3DIFB 1JGLL 1QNZL 4NDMA 5IGXL 5D6DA 4URTB 3OR7B 4FXGB 1LMKA 5HDLA 3A67H 4HWEH 2XG4A 4NM4H 1YEFL 2E3VA 3UDWC 1ZA6B 5I75B 5EO9A 5ITBL 1RJYB 5SX5H 4JPKH 3EO9H 3KS0H 2BSSA 4GKNB 5D1QB 3HC0A 4QWWD 2J4WH 3VFMA 4EBQL 5D2LF 3LQAC 3MV9D 3HAEA 1D6VH 3PABA 5JW3H 1SBBA 2F54A 3U83A 3VDAA 1WWBX 1BQHB 4OZGA 1RZGB 3D69B 4AYFA 4TYUA 3VFWA 2A1WH 1Y6NR 4FFWC 1J0JA 1T0MB 5F71A 4KKAD 1M71A 1PZUB 1L4IA 3WS6C 3RVUC 3DETC 1ZVSB 2R2EA 5L2JB 3LS5H 4DGIH 4LHQB 1VDGA 5T5NG 1ZLSL 3P11L 1U0QA 4OM1H 1NMBL 4U6TA 5FYKL 1YN7A 4N8VA 4OLUH 1QFUL 5J6HB 5HI5D 2YC1A 3HA0A 3BIKB 1MQKH 5IT2L 4IRJA 3MCG1 1A9BB 5GSVA 2NYYC 2VDML 1E4XH 1F97A 3UEZA 4F7PA 3QUKB 1C5BL 1OT2A 4EDWL 3FRPA 5HHQB 3GKWH 2DWEA 3T0EE 4NQED 4LLYB 3UJIL 5D9SB 4HT1H 3ULVL 3N1PC 4OZGF 5IB4A 5CJXA 5DK3A 2X70A 3F58H 3S7GA 3CFDA 2IJ0C 2W0KA 3MRPA 5DJ0B 5F3BB 3GI8L 1CD8A 1MCFA 2DM3A 3VD3A 5BZDB 1MVFA 4WUUB 1UCBH 1I1FB 3WXVL 3KXFE 1IAKA 3B5TA 1B2WH 5EIIB 4UNTA 1FYTA 3KPPB 1BQSA 4D0BA 3PWUB 5C6TL 5L2KA 4C56D 5HYJA 1RVFH 3OX8A 3TBVB 3L1OL 3MRGA 4RMSA 1BBJA 4BUHA 5D7LB 4YHKH 5D72L 3O45A 2PW1B 4I3GA 3BPOB 3QXUA 4Q9QH 4NFDA 3SY0B 3ZE1F 4PLKC 2FEEL 2LFGA 3VI4E 3MCLH 1UXSA 5IK3A 2VH5H 3OKDA 5E7BA 1TQCC 2XXCB 1JNNH 2UVFA 5JNYA 4TTGA 3FQRA 2O26U 2XZQL 5E4EC 2ZCHH 43CAB 5DUMH 3D1MC 1B4RA 3AAZA 4NJ9L 1D6EA 1G0DA 4LRNH 2JJSC 4NBXB 3TCXA 2XN9E 2OZ4L 2R29H 1K8DA 2AJZB 2R9HD 4JZOB 5ALCH 1RHFA 2CKBB 3V6ZB 1GAFL 3HE6A 1NJ9B 1TDQA 2JCCE 2JTDA 2FBOJ 5FCSH 2YXFA 3RPIB 5GRWA 1KOAA 2ED9A 5JW4R 1T89A 1VFBA 4KHTL 5GJSH 4XNQA 5L9DL 3K46A 3F62A 5AD0A 4UT7L 4KZEL 3UTTA 2VLRE 3EJZC 3I2CH 3NACH 3RWJB 3MRJA 2VRAA 5FO8B 4LU5H 2J8UE 4MNQA 3WO4C 5MEOA 2BY2A 3S35H 1WTGT 3AM8A 4L4VB 4PRDB 3D25A 5I8KL 4J3XA 5C0RH 5T1DL 5HHMB 5CHNB 4R9HA 1M6OB 2X89D 3VRIA 4QRUB 5DDHB 1GGIH 4PJBF 4ZO7A 3F5WA 3FCTB 3VD4A 2FX9H 4DJMA 1X5AA 1CXIA 3D2UB 3MYZA 5F8QC 1Y0LB 1WT5A 3FL7A 2FD6H 2IQ9L 1LHZA 1DDHB 4GMSH 1LO0L 2DM7A 4N0RA 4EQ2A 5FGCE 1A6PA 4YXKL 4AQOA 3BKML 2VN4A 1S3KH 3MCKB 4OKDA 3HRPA 4R96B 1AE6L 3G08A 1DE4A 4EOWH 4B0MM 1UM4L 3EFDH 1YEIL 3EDDA 1IC4H 3MGTA 3MNWA 5DD6A 2R23A 4FTVE 2P5EA 2LVEA 4HG4J 3FTGA 3EYVB 4RNRA 2APXA 3IKKA 4L4TB 4WU5B 4YDVA 2RAMA 1IM9B 3T0DA 1EXUA 1NMCC 3P4MB 4C54A 1FGNH 5HPOA 5E95B 3GJFH 2R69H 4UU9B 4JZNA 2QLVB 4LEXH 4K7FA 3B2VL 3D3VB 2D7OA 5E8NA 1PX3A 3JWOC 2R2BB 2E7HA 3TBYB 4ERSL 4X5XB 1C1EL 1BZQK 4JM4H 1U8LA 2EZ0C 2RJMA 4TVPE 3Q1SH 5F1OB 4K94C 3E6FB 3BKYH 4PB0H 4X6BA 3H3KA 3CH1A 1TQCB 5JORA 4FG6D 4PJDB 1FLRL 1P6FA 3MGOA 2BVQB 4KI5D 5TGBB 5MENE 3B4NA 2IH3B 4G8GA 3VXNA 2FL5A 3UX9B 1U8KA 1F00I 1WZ1H 3WIHL 3TYGL 3ARTA 3ES6B 5ANMB 3OZ9H 2Y9RT 2RB8A 3IDIB 3BRDA 3OHXA 1U8OB 3JV4A 5BQ7B 2AEPL 4KQ3L 3L5WB 4UILL 1NMAH 3SKMA 3V6OE 3SKNA 4K3GA 4K9EL 5DZNA 1SJHB 2HJFB 4CVWA 4LSTL 3U79A 3GSWA 1P4BH 3SDAD 3TF7C 5JXAL 2AJUH 3CSPA 4X9BA 2CLVA 4FQXC 4PJEE 1V8HA 4YWGL 1FL5B 5KVGH 1QYGH 2A0LD 4WV1B 4P49A 1HQRA 2B4CC 4KK8C 4BQCA 1HEZA 3WO4B 3DXAE 4TVSa 3PGCA 2E8ZA 3PDGA 3X11B 3FAWA 4G5ZH 5TFSH 4QXWA 1MCHA 4UQ2A 1J8HD 3H0TA 5DK0A 1I7ZB 1I3RA 2IANB 3NTCH 3VGFA 2CUMA 5DYOA 4Q74A 4GBXC 4X8JB 2Q86B 4YUEH 3QIUD 4PLJD 4OCRH 3L3OB 3QFDA 1T4KA 1AGFB 1BHGA 1U8PB 3QHFL 3MRRA 3WCYA 3IVKA 2HKFH 3E6HA 1C5CH 1HOCB 2VDQH 3HC4L 5C08E 2IPUK 4ODXB 4WI7A 5KSAC 1Q72L 3LEXA 5CINL 5FCUH 1IQDB 5AZEH 3RL2B 4N68A 4EQ3A 4WI6A 4DN4H 1UZ6E 1PFCA 1F45A 2CLZA 4P9HC 2CRYA 4HK3J 5EO1B 3ZMRA 5E6IA 3MZGB 4PJGB 2DQJL 3L6FB 4HS6B 1J1OH 4PJ7B 4FMKA 3ROOB 3SDXB 5E8DL 3S35X 4GW4A 2V6HA 3O8XB 1DFBL 4LLVA 4TUOB 2FGZA 1YDPB 3U36A 1NMCB 1DJSA 4P2RE 5FM8A 4JHWL 3U7AA 3VI3F 5ID0A 2Z93B 4PRHD 2VXTL 1X6LA 3M8OL 4QF1B 4XVTL 3AY4C 3V5HB 2DQDH 1NGQH 2APBA 3NIDE 1OP5H 5BXFB 1JHLH 4PYGA 1EBPA 1EH9A 4YFEA 2R1WB 5EZJB 3TBWB 1EO7A 4GSDH 4X9HA 4HHAA 1YMHA 1A2YA 1KLUB 3PWNA 1JGDB 3BH8A 4YK4C 1UJ3A 4POUB 2BNUB 1EMTL 3W9DB 3BP4B 1NBYB 2VL4A 2V2WA 3ARDC 1HH9B 3BSZL 5DJXA 4AT6B 2V2TA 4GW1A 5EUKA 4BZYA 5LAXA 5E2TL 5CSZA 1PQZB 5C09E 5JIKA 4BSWA 4DTGH 1DN0B 3VMOA 5C0DB 3AMLA 5DJZB 3PDOA 2XTJC 3UTOA 5IFJB 5CZVH 5CEZL 4EZMA 5JOFB 1GIGL 3BEVA 3FB8A 4DKAA 2YBRA 3VRJB 1CFQA 4LNRB 4HV8A 3MJ7B 2DBJA 4M3JA 3W0WD 2CDEA 4JFYB 4ELMF 4H1LB 1DQQB 1D5IH 1FV1B 1J1PL 2NQCA 2WV3A 4P9ML 2PYEA 4FQXB 2F53E 3QDMB 2APVA 5DRNB 1LO2L 4RFOH 5JR1H 4ZPVA 1UG9A 2DM4A 1U8IB 1WJ3A 4OD1L 2QADD 5TQ0H 2OSLB 1CGSL 4QRQA 4I2XB 5DQDH 4MAYB 2UY6A 4OCWL 2IADA 1SYVB 1I1AB 5BVJB 4OZFH 3EYQD 4NO5B 4XT1C 3QFJA 4HLZH 3H3PL 1IKNC 3C08L 3MUJA 3GSNB 5DURB 2GJ6A 2WBJA 4FZEH 3EJYD 3T08A 2EDNA 5JO5A 1DBML 5GGRY 4PJ8D 4R97B 4XTRC 2R8SL 4S1QL 4XCCH 4LBEB 5CKGA 5KSAB 1OARL 2BJMH 3GRWA 12E8H 2GAZB 4UIMA 3O3BB 4WIQA 5T1MB 5DI8B 2DYPD 3QXDA 2EDOA 4CVZA 2X41A 4JKKA 5L6YL 2W60A 2FEEI 3STLB 2N7BA 1MHHA 5I16B 1N8ZB 2PW2B 4HIJA 4LRIC 1A6AA 2UWEB 4ODUA 3EOBB 5ALBH 2DQTH 3UZQA 4K8RC 1JF1B 4WFGD 2VZSA 1H5BA 3FO0H 1KPUB 4LCCC 43C9A 1WCQA 3O2VL 1AR1D 1V5JA 3HMXL 3OKNA 3QUML 3TBTA 1G9MH 4JCLA 4YHOL 5GQBA 5CZXC 1KFAH 4MAUL 5DHVA 5KS9E 1BJ8A 2ICES 2P8LA 1RZIA 3MODL 4GRWF 1RU9L 3VFNB 4NQEB 5JOPD 5C0CB 4PV9B 1FLTX 3UPRA 2KUTA 2B5IC 3HTLX 2C1OA 1ED3B 1PBYA 4YK4B 3VXPB 4OT1L 4P4KA 3Q3GB 1I9JL 2D03L 3DBXB 3RBSA 3TWCH 4ZFFB 4LKXB 5MEQA 1KCVL 2OJEB 3HG1E 5F7YC 1UM5L 4APQC 5EU6E 5J6GB 4M6NL 1RIHL 1N0XL 5IMKB 1XF2A 1R5VA 3WBDA 5DEFB 4JQVC 1MI5B 2ZCKL 3C60C 1A6VL 2PXYC 3O9WC 3VFUA 1RHHA 1U2CA 1S5IH 2CH8A 3U82B 2CK2A 3QWRA 3IDNB 1A3QA 3FFDB 1PKQE 3W82A 3MLZH 2NZ9D 1CLYL 3S34H 1FVDA 2XNAB 3BW9A 3LKPA 3QI9D 4O4YH 1YMMD 4KZDH 2CSPA 4IMLB 2DKUA 3KGRA 1C08B 4PRID 3MRCA 3EOAA 3WE6B 4C58B 5IM7A 3WFCH 5E0QA 4CUCA 4RGOL 4GG6E 4XNMB 2JE8A 5T3XE 4WFEE 3PDDA 4J4PC 1T66D 2PN5A 2A6IA 3TJHC 3IJHA 4JRXE 3WXWL 1DUYB 1G7PB 1NPUA 2YA1A 2FZ3B 5C1MB 4PG2A 2R2HB 3TGXA 1U91A 1S9YA 1NKRA 1MRCH 3HNSL 1G7QB 4M7LL 4NQVB 5FGRA 1RK1B 4HUXA 4NQSA 4TOYL 4Y4FA 3SGEH 2Y07H 4GRLA 4ZUSA 3WN5B 3ABZA 3SE4C 1ZHBA 3MJGX 3DV4B 4DUVA 2BSTA 4FNLH 4HFWB 4F8QA 5IV2B 5IEKA 4KHXH 1YYML 5D7JA 2IPTL 2PTUA 3LMJL 1N5AA 4H8WH 3BZ4A 3RUGA 4HWBA 1U6AL 1S7QA 1VCAA 4MLSA 4N1HB 2MNUA 4JANA 1OY3B 4XAWL 4LLQB 3IDGA 4OGYH 1A7PH 5I30H 1B6UA 3G5YA 4WI9A 4PJ5A 4NCC1 4WU7B 1LO5A 1UKQA 4NO0B 2GYSA 3GHBL 4Y1AA 5DQJA 2VDKH 4PJXF 3BZFB 1PX4A 5T3ZH 3IFNH 1J1XL 4CADA 4ZUUB 2HVJA 3U1SL 2GITA 4LSQH 4LVHC 1KTDA 4LCWD 5KVEH 2B5IB 3MLSL 4LMQE 4JKPH 5IW6B 2BVPB 4UIKH 3STBA 3VXUE 3S36L 3IFLH 3FT4A 3IRPX 1OAUH 2VSCA 2M1KA 4NKIH 5GGRB 2DMKA 3MBXH 1YEEH 4PJHE 4F7EA 4PGEA 2ED8A 4NNXB 5CAYB 4MLIA 4KMQA 4Y4HA 3V0WH 4APQB 2PR4H 2DIBA 3RUGF 4IIQC 2N4IA 1AQDA 1CFVH 1W72B 2KZWA 5EOCL 4G8FA 5KSBE 2VZVA 4G3YL 4JY5H 1RV6X 3CH8A 3HZYB 4MA3A 4TTDC 2RGSA 3C60B 4U6VH 2PXYB 3QPXH 3O9WB 5TDNA 3O4LB 3LQAH 5IEHB 1MH5B 5SX5K 3DJ9A 3VFGL 3EAKA 4Y16A 2GTWB 1A9EA 3C6LD 2ZWLT 1RQ5A 3ZKQD 3GBML 4Y19B 1G7IB 4OIIL 3G6DL 4YHNA 3QNXB 3G9AB 3GSRB 3Q6FB 5F6HI 3IF1A 1FJ1A 2CJUH 1YNLL 5SWZE 5DJ2B 4HEME 4OLVL 4UOW1 3B2UD 4EJ1C 1MUJB 3I84A 5KTEL 1JTOA 3ARFC 2IPUG 1AO7E 3HLAA 1JI1A 4G8EB 3QDGB 5CGYC 5AEAA 5I76B 1EHXA 4LVEA 2WM0A 5ESVB 2YPLB 3ZYJA 2SEBB 1L7IL 3JVGC 4K07A 4Y2DD 1S9VA 3C09C 2UZYB 2OL3H 3RJDA 1UC6A 5I1AB 4J6RH 3T0EA 3TBSA 4R6UA 2HT2C 1IT9L 1TVHA 2AXGB 2HLFC 3IYLW 5DEGA 3MLYL 3LKOA 3QQ4B 2X09A 2YD4A 4IMKC 1QTYT 4KUZL 4Z0BH 5E1HB 5GJTH 5FGSA 2ATPB 2J8OA 2OTUB 2V17L 1U8QA 1KCKA 2XWJB 2FRGP 5C3TA 1Q0YL 2PCPA 3KXFA 4K3DH 1IRAY 1F4AA 4YHIB 5L8LB 4NNYB 4H5SB 3LPGA 4LPYA 1BWWA 3SE9H 3KYMB 4XNYL 1T04A 1KLGA 2Y23A 4XMLH 5C9KA 1OD7A 3QHTC 3AS3A 2XFXB 4WTWA 4F57H 1KIQB 3ULVC 1UZ8B 4JPWH 5GGVL 4OLZH 5T1LD 5EO0B 4AEHL 4W81A 4I3SH 1R3IH 1TJIL 4LVHB 4W4OA 5E6ZA 5JPMA 1NGWA 1U3ZA 3T1WA 3UBXG 3BKCL 5GGUB 3EO1A 3RWFA 4PPTA 4IOIA 1XGQA 5H94A 5EPMB 4P5KA 1ACZA 4M62L 3K2UH 4S1SL 4CJ0A 3VMPA 4JY6B 4PGBA 5E2UH 4IIQB 3EZJB 1AD0B 4M7JH 1HH6B 5IOPB 3ZKMD 3C8HA 2QKIA 1KIPA 3QXVA 3ET9F 3MJ9L 5CP7B 4YQXH 5DJ6B 1DEEB 5D7SL 2JCCA 1CDUA 4NZTL 3PP4H 2GT9A 2HN7A 4HXAL 1MWAA 4ZMAT 1YZZA 3E0GA 2HFFB 3RX5A 5SV4A 1F4WL 5I1KH 4TQEL 3RAJH 3L3KB 2XYCA 3PE9A 1CLZL 1ZHKB 4NHUA 4KRPD 3TZVA 4R2GD 5B4MD 1CDJA 4XWGL 1JPGA 1RPQA 4JRYB 4MDIB 2J8UA 4G7VH 3LN4B 4MJ6A 4RAHA 5IKCA 4WHYH 4CVXA 5FUCE 5FDWB 3O2DH 1QVOA 2YXMA 4JLRB 5D5MB 4XC3L 1VPOH 5EBMB 1MCSA 3ARFB 2V2XA 3BP7B 3ARUA 2XTLA 5ETUA 2MTPA 3C6SA 2EXYC 3C2SA 4JAMB 1HZHH 5FYJL 4FQIH 5GRJH 4G8IA 1LNUA 2OBGA 3GO1H 2C3VA 3A6BH 3C09B 5DD5H 1HHKA 3NBNA 2JCCF 1TZIA 4OBSA 3W0WB 2MHAB 2EDXA 5LGHH 1DL7L 1PYWB 1WZMA 4KY1H 4JDTL 3WNPA 3NN8A 1OB1A 4M61A 1RIVL 3QUZD 4JDZB 4O58L 1JNHB 2Y6SC 5TQ2L 2A73B 1D7FA 2J8UF 5DFVD 1I7UB 2IGFL 4ENED 5EA0H 2ADJA 5GISL 1R0AH 4X6EB 4FTVA 5IW3A 1G1YA 2YWYA 1OPGH 3BO8B 3SCMC 3R0MA 3L7EB 3MC0A 2MJWA 5DXWA 1AQKH 5FA4B 4QOKD 5IESL 2W9DH 5IMMB 1GRWA 1X5FA 1FORH 5F88B 2CIKA 3BPNC 3GMOB 3VXSB 3W9EA 2ENSA 2NLJA 4J3OC 4HKZB 3ALWA 5C3LD 2Q20A 4S1RH 3QCVH 3DUUA 4Y5VA 1VEOA 3GJFK 1LEGA 1C12B 2DD8L 4JDVA 3NABH 4YHPA 3VW3H 1NCUA 1UB5A 2NR6C 3PGDA 4K94H 5DMKA 4ZSOB 2B20A 1LO4L 2KBGA 2EDTA 5CJBA 1BIHA 4GAGL 3RDTC 4FQHB 4OGXH 5MENA 3VGBA 1EHAA 5DHXB 1MAML 1AC6A 3T0XA 4LLMB 1DZBA 2MQCA 1FO0B 1P5UA 4X7TA 3N9GL 5FGBC 3UAJC 5C7XL 1DBBL 1IEBA 1WFOA 4L8CA 4XPTH 1NLDH 3KR3L 4K7PX 4L8DA 1ZLWH 4JFOA 3V6OA 2B7DT 4OZ4A 2WIIA 4J3TA 1RIUH 3I50L 2C3WA 1ORSA 1DANT 1J12A 3QB7C 1NAML 2BNQD 1N64L 4H1LH 3P0YH 1M05A 2V7HA 3S8WA 4PJEA 4GLRI 2GCYA 3SKJL 4OGAC 5INDB 4TSCL 3GMMA 1U58B 1H15B 2B4CH 2G5BB 3ARGA 4JG0L 4U0QB 3DXAA 4FS0A 4KMTH 2AJSH 3KPRB 3ME0A 2ICEB 1N6QL 1ZOXA 4JKWA 5E08H 2DJUA 5ADOL 4OTXH 1RUML 1GVIA 1YEGL 1LD9A 4FQLL 1GZQB 3L3GB 4HWNA 4K9EC 3GSNH 2VN7A 4R4BB 3QH3A 3WFHB 4RGMC 5JW4M 4DZBA 3V4UH 4ZUWB 4H88H 4PR5B 3UYPA 1G6RA 3BP5B 5TE4L 5IB5A 5IQ7L 3UO1L 1IMHC 2OR9H 4QRPB 5CEXA 1B6DA 1MCWW 1XIWC 4KXZI 2HRPL 3KYNA 1MFBH 5C86A 1S5HA 4LSUL 5D8JL 4OAWA 1KPVA 1BQLL 4PJEF 2H45A 1Z5LA 4P9HH 3OGCA 2NY1C 3ZTJG 5D7KD 5J1SC 1CT8B 4Y2OA 3HI6L 2HTKD 2QQNL 1YY9D 4UUJB 1IE5A 3UBXA 4ZS7L 1JGEA 5EZLA 1FZMA 4KRLB 2A83A 3L5XL 1K4CB 1IM3B 1KEGL 3MMEA 3GMNA 4MX7B 3LB6C 3SDCD 1CQKA 5IUSA 2H8PB 4P2RA 2BHYA 4ZFOA 3B6SA 4Z8FL 2BFVH 3BPNB 4D9RE 3KPMA 3BH9B 3IJSB 4ZQKB 4BQ9A 4QTHA 3QQ9C 4N0FA 1P4LA 3JZ7A 3QQ3A 4YX2H 2NY3C 4POYA 1MHPH 5FOBB 3GSXA 1H3PL 3MRDA 3WLBA 5KANI 1E27A 2C3HA 1UZ6F 1H3VA 3CLFH 4KI1A 4GQ9L 4PGDB 1OP5K 4ESKA 2BSRA 1OTSC 2XKNA 4YXLL 3RDTB 5HBBA 1X5IA 3PNWA 4IOFC 4P3CL 1QFWL 5SWQA 3CFEA 1OW0C 4M3KB 5GGQH 4KTEH 2J88L 5FV1L 3KHQA 3MBEA 4GBXD 5IROA 3BEWB 2FJHA 1KG0A 5HGHB 4V2CB 1NC2B 3I02B 1IKFH 1OTTD 3CU7A 2YOCA 1AKJD 1NFIB 3HN3A 4AG4L 2IPKA 1A7OH 4MQ7B 5FM5M 4XXDB 2HJKB 4KQ4H 2VC2H 1A0QH 1MCDA 2F53A 1I8MA 3MUGA 4YGAB 4ZS6D 3T04D 5MERB 4K3EH 1UWGL 5C2BL 1JPTL 4CDGC 1JUFB 3B9EA 1ZT1A 3BKJH 5SV3A 4HK3N 2Q8BL 3E8UL 4UV7L 4NPYB 1MCRA 4NZRL 4CNIA 1XR9B 1A3LL 4PRIE 3ZHDA 5HVHC 1OAKL 4OZIE 3GMQA 4K3HA 4EI5D 3OAZH 4MDJB 3NGBC 5DD3H 3KPSB 4MVBC 1SYSA 4BFGA 4M48H 3WHXA 1S7WB 4HJJL 4RGMB 1DANU 4WFHE 4HKJA 5JA8B 4C55A 1BM3L 2D3VA 5C9JA 1UM6H 3PWPA 1EFXD 3U6RA 4KKLC 5E1AA 2R0ZH 3X14A 3WL9A 3G6JA 4U1LB 3RY5A 1JYXA 1IEAB 2BRRL 3AVEA 3RWCA 3IFOA 4XCEA 3T77B 1NBQA 4OD3H 5FV2A 1X5ZA 32C2B 4ODWB 2KQNA 2NY1B 1R3KB 3HPLA 3GSVA 4O51B 3AU1B 3ARDD 3QJFA 4P2QB 2ILLA 2GSGA 2EEDA 2PO6D 2EC8A 4OCNC 7FABH 3T2NL 2FYYA 4U6XA 4NC1C 1I85A 3GHEL 5F9OH 5JHLH 5INCB 2VL5A 2YD6A 2HFGH 1ZT4A 5HYEA 4LFHG 3OKOB 2XTJD 2HMIC 4M02A 4O2EB 1HDMA 5KSVB 4RFNC 4Q9RL 3HMWL 4NJAL 5KS9A 2HT3C 1C16A 2V5RA 5ITFB 3BAEL 4JFPA 1T20B 5JIHA 1KN2H 4WCYH 4HDIA 4F37K 5FDYA 3LIZL 4QRRD 1XGUA 3KYOA 2AV1A 5LWYL 5GS1A 5ILTL 4NZUL 4X5WB 1S8DA 1GC1L 1Q9OA 2GJZA 4XNUH 3SQOH 4LCIL 2WMPA 1ZHNB 3HG1A 2CDGA 4L8SC 4LPUA 2DDQL 2VIRA 2YEZA 5EU6A 4NUGH 4HBQA 4P3WA 4ZAKD 1VENA 4RZCA 1K5NB 5CCKL 1KXQE 5LBSL 4CN6A 4W70A 1WBXA 2HFTA 1W72H 5HGGS 5DHYB 1HSAB 2BHUA 4MSWB 5DTFA 1D5MB 3KPQA 1Y6MR 4K71B 4M43H 4ODHL 5KS9F 1KT2A 1U93A 3SE8H 3RZCC 1PKQA 3O3DB 2Q76A 4OF7A 2EDFA 3MV9A 2VXSL 4BKLA 1VEPA 3DTXB 4PLOB 3UTPD 1KB5B 5EBWB 4J2XA 3QIBC 2EDHA 5D93C 4LEOA 1L9MA 2AERT 4I18A 3MV8B 2QHRL 4RA0C 1OGAB 2IG2L 1QLFB 1XCQA 5ERWB 4PB9H 2MQ3A 3MRNA 2DQEH 1FIGL 1SEQL 3LZFH 4G6MH 4I0PD 5BOPA 3CFJA 1A22B 5HVHB 4U7MA 5CIPB 2AXHA 3SJVD 4GG6A 4PY8I 4JFDB 2ATKA 4WUUE 2VXUL 4BH7A 3RVTD 1ITBB 3BHBB 3NGBB 1U95A 5EU4B 3QA3B 2K9UA 1IFHL 3HI1A 2R0LL 5DWUH 2C7UB 3TH2T 1YNTB 3TO4A 1WISA 4JRXA 4KKCD 4LKCA 4HK0B 3BGMB 1Q9KB 2AVGA 1F3DJ 3CSYA 3I6GB 1A1MB 5D7LE 3VFVB 3UTQA 5DMGD 2HT4C 3QXTA 2R1XB 1MLBB 1I8KA 1NGZA 3HZVB 4S0TD 4L29A 5T3ZE 3F7YB 4O2FB 1KCUH 3BD5A 4HS8H 3HE7D 1XGYL 4PTUA 2J8HA 1IC1A 5DVMA 5J0BA 1D9KC 1WC7A 1CDBA 1G0XA 4LIQH 2BOBA 5ADPL 3MREB 1FE8L 5ACZA 3D85D 5KN5B 1INEL 2FATH 4LQFL 1ZVYA 2B2XL 3SPVB 4GG6F 3FO1A 1WUNT 3QZWB 2VISB 3CLEL 5BRZD 2OCFD 2YKLL 5K59E 1Q9WA 4RFNB 2AQ1A 5HYQA 5I6XC 4N90E 2I26N 4M6MH 3H9SD 4HLJA 3TCLB 1R3LA 2UZIL 1XEDA 1QFOA 1TTUA 3BISA 3DHJA 2Z31C 1KCSH 2Y25A 3VA2C 3VGDA 1X5YA 4I48B 3UYRH 1ZVHA 2NNAB 3VXUA 3MQIA 5HYIA 2WQRA 4DQOL 4HKBA 4PJHA 3LEYL 1K8IA 3RWDA 5I1JH 5BW7A 4MA8L 1L6ZA 5FYLL 6FABH 4OZHA 3PWLB 3S4SB 1FDLH 2ADIB 3QUMB 4NKOB 1QFWM 1WZLA 5F6HJ 5KSBA 2MKLC 4L4VE 4QHKI 1H0DA 1YUHA 4KKNA 3H9YA 3DYMA 5ACLA 4AH2B 1U2HA 3DX9B 4H20L 5H37H 3RZCB 2VQ1B 1FFPB 4G6JL 4D8PB 2CDFB 5BS0D 4IDJH 1T03L 4HJ0D 5IHUL 1JGLH 1IL1B 2G2RA 5E5UB 5D93B 3F7RA 3MLVH 5DUPL 5IGXH 2X4QA 1A4JB 4EVNA 4XXCA 3TA3D 2FWOB 4NO2B 1VKXA 4GW5A 4PJHF 3CFBA 5SWSB 5SWZA 3O11B 1YEFH 4YO0A 4L3AA 2DQUL 5JQ6L 4TPRL 1AO7A 1G9EA 4X4XA 5FECB 4P46D 1FNLA 2ESVD 5KSBF 1LEKB 3GMLB 4NQCD 2I9TB 5GS2H 1T5WB 3VGHA 2X89A 4L4TE 4KAQH 5KSUB 4Y4KD 4OCSL 4PS4L 4HD9A 3CPLA 4MD5B 5JZ7C 4AM0A 1SVCP 1E6JL 4Z76A 1KCRH 3D3VE 4F58L 3P30L 5C8JB 5EU7C 1JI2A 4YJZL 4V1DB 4D0DB 1CFNA 1F11B 3QUYD 1NUDA 4WGWB 1AY1L 1IGJA 5JXEC 2DQFB 4ZDHB 3EYUL 3GGWA 3VXTA 1ZLSH 2FSEA 3WLWC 1NMBH 1WITA 5CBEB 5HPMA 3VRLE 1D9KB 4HGWB 3PIQA 4JO1H 5I1HL 1QFUH 4P2YA 3ULSB 2COQA 2EIDA 3GJEB 5GGVY 3AGVA 3M1BB 1S7RB 5IT2H 5HGBB 1QFWI 4N0YL 4XC1L 3ILPA 2N7AA 2VDMH 2C4XA 4WUKH 3VWKB 1NANI 3AS1A 3BZEA 3MRHA 5I6XB 5ANME 1C5BH 5TDPA 4QOKE 1FNSL 3RGVC 2VITA 3OKEA 3UJIH 1QLEL 3FQTB 3ULVH 5HVFB 1MLCA 1I9IL 2XQBH 3PQYB 2Z0BA 4O2CA 1FNGB 5D70L 3OKMB 2Z31B 4LPCA 5IIEA 1EEZA 5EDXA 2IBBA 2WW8A 1P1ZA 3WUWB 2GK2A 3WD5L 2W59A 4F33A 5L7XL 2D7TL 4QRTB 5K9QG 3ZE2E 3FQXB 3V6BR 5E8EA 3WXVH 5J12C 4NHCH 5ISZB 3MYJA 1A5FL 4L3CB 3KHOA 3JUYA 3MUHL 3L1OH 2FJFA 3FFCD 4Y5YA 1H8OA 1BOYA 4F7CA 1CYGA 4ORGB 3IETA 1MEXL 5GS2D 5JHDB 3BQUC 1OQOA 2IANE 4OJFH 4P2OA 5D72H 4ZUVB 1H3TA 1XF3B 2NY0C 4GT7A 4GRMB 1JFQL 4MJID 1VACB 1JWUB 2EH8L 3EIFA 3Q5TA 4FN0A 4AIOA 3MACL 4LHUB 1EGJH 1E4WL 3OV6A 4B53A 2I07B 1K4DB 3SDAA 2DICA 1UWEH 1KJ2H 3MNVB 4HGKC 3VFOB 4MXQD 2XZQH 2B8OT 5K33A 2VZUA 2ZUYA 5DJYB 5T33L 2E7CA 3V0AC 3IAPA 3QO1B 3G5XA 1AGBA 4PJGE 4HLZG 3DRTB 1T2JA 1CFTB 1UXWA 2GIYA 4PJ7E 4OV5B 3SDXE 2A6KA 4X4YB 3OGOE 2DKMA 1Z9OA 2QSVA 1AFVL 1GAFH 4WW2A 1CFSA 1S9WB 1P69B 4I3RL 3AREC 5H35A 3QIUA 4XWOD 5L9DH 1U8JA 3GJFA 1FNEB 3GMPA 1S7XB 5IB1A 4KJQC 3AB0C 1ZS8A 4PUBL 4I4WA 5K93A 3GEWB 1XCTA 5E70A 3WFDL 3I9GH 1EAJA 3QQNA 2IALA 1XGPA 4KU1A 3LKQB 4ZOAA 1L7TL 4Z7VB 1K3ZA 2XPGA 4N0CD 4QKXB 4YEFA 2HJLA 4NN5B 4A6YB 1BX2A 5IMLA 4QTIL 5I8KH 4I5BB 5T1DH 3MRIB 4OQTL 4HIIA 3M07A 3IDJB 2MPAL 3GZKA 2D0GA 4EI5B 2CRMA 1Z0MA 4P23C 3CFCL 2YUVA 4G6FB 2EXWD 4WW2F 1P4IL 2N1KA 5CFHA 5DLMH 1LEIB 2IQ9H 5J06A 4LPWA 3RGVB 2G5RA 1LO0H 4GKOA 4X4ZA 3D0VA 4YXKH 3GRWL 4NGHH 1CICC 3OXRA 4C57C 1RUPL 1AE6H 1HCVA 3U0WH 5C2UB 2VO5A 4GJTB 3KPOA 9CGTA 1UM4H 2GTZB 3GM8A 5J8OA 1OAQL 5IG7B 5C0AB 3QDME 1F2QA 3EFFA 5I1CL 2I27N 3A0OA 5J12B 3C5JA 5HYJD 2CKNA 1EHLH 4LPVA 1P7KA 2P4AB 3WEXA 4I2XE 4QXTB 5IJKC 1PKOA 4CN1A 2EXYD 5I17A 4P5TA 3WJLA 4LSRL 1QUNA 4X9FA 3B2VH 3U0TA 3BQUB 4ZD3L 1S7VA 2EDBA 4NCC2 2AAVA 5M94B 3EDKA 1HHHA 5EC1A 2NY0B 4OI8A 5JMRA 1BQHG 1C1EH 4DAGL 4EXPX 1MSPA 4IRSC 2YD8A 3HS0A 3QJHB 3HZKA 2AK4B 4JQXC 1ZLWK 5J57B 2B1AL 3RWEB 4EN3A 1BQUA 2Y6SD 5CWSA 1F3DH 1F02I 2HP4A 2ERJC 4YEEA 4JG1L 2FR4B 3HFML 3SCMD 3WIHH 3TYGH 4F9LC 3SQBA 2AXJA 3TV3L 5DD0L 3O3AA 3SGKC 1QRKA 2UWEE 3HE6D 3PV6A 1IAOB 4M6OH 3TT1L 4CDHA 4GS7C 2AEPH 2IBZY 2BVYA 2QJDA 4KQ3H 4UILH 1JYWA 2FIKA 1ZGLB 2MFNA 3BGFC 1RZKL 3DO7A 3AREB 5CBAA 4OM0L 3DROB 3BN3B 3NZHL 4LSTH 3PWJB 3T8XA 5EUOB 4OUUA 2Q87A 1T80A 3REVA 1WBYA 3RVWD 4PJ8A 4WNQA 2VDLL 2DBLH 5JUEL 1KXTB 4MNQD 1KJ3L 2C4FT 5C0CE 4LF3A 5EU3B 4MMXC 3P0VL 5IB3B 3U2SB 3R0NA 2I9LA 3GNML 1MCCA 4ZYKB 1WBZB 2VAAB 4NC2B 1ADQL 5FYKU 5CUSL 3C9NB 1FNHA 4AIXA 4KK9C 5HHNA 3UAJD 2OK0H 4RMQA 1C5DB 5ICZB 5M95B 1AGDA 5EH1A 3SE3A 3WNLA 4P23B 1T1YB 3R06B 1V3KA 3QHFH 4LLAA 2GUOB 2IAMC 3CSBA 1MI5E 3HC4H 5EOQL 2XTJE 5CINH 4NQDB 5EFIA 5FM5O 4AMKL 4LSDA 3UTSD 5FA3B 4HUMB 1CICB 5ELIA 3IS0X 4JM2B 1Q94B 1RSFA 4NFBA 5FKAA 4OGAD 5HY9A 1ZHLA 2DQJH 3KLAB 2WINB 3NCEB 4ZNCD 3WS3B 2XZCL 5C0GB 1BFVL 2NY4D 3VFPA 5E8DH 1R5WA 4GKZB 1U92A 4I77L 4ELKA 2VTFA 4YE4L 1DFBH 2F19L 5DJ8B 1F4XL 1WEJL 2ZG3A 3K1KC 1LQSR 1AP2A 1BFOB 3KNBB 1CGVA 3VXMB 4EI6B 3FN9A 4BSVA 3GMRA 4JHWH 1BVKA 1XF5B 4EUPB 4OUOA 4M9OA 4OZFA 4XVTH 3M8OH 3ISWA 1RZJL 2H3NB 3MRKB 5A2JH 3H3BC 2CRIA 3QNYA 2HH0L 5C71A 1XIWD 1GHFH 1F90H 1VADB 4IRSB 4XPBL 3FT2B 4QYOB 1PLGL 5MP6H 1INQA 3MROA 4Q7DA 4ETQA 1EMTH 1T1ZB 1MCKA 3WFEL 4MS8C 4XP6L 2EE3A 2R0WL 3BSZH 3QI9A 4G8GD 3MLUL 3VCLB 1JZ3A 5BJTB 2W0LA 1GGCL 2ERJB 2XWBB 3QDJD 4PRIA 2HYMA 4OZIA 3IDMA 3H8NA 1HWHB 4FQQB 1PG7H 3RFZC 1A7QL 25C8H 2J3SA 5CEZH 3OMZA 3LB6D 4X0KA 4GS7B 2GI7A 5F70A 3SJVE 1FRGL 2ICCA 1HIML 2YS4A 3BGFB 1WFNA 4LAQL 3BJ91 1NSNL 4XNXL 3UTZB 3OAZK 3KLDA 4PLNC 1J1PH 4P9MH 4DCQA 1OQXA 3L3IA 1B0RA 3EYFA 2NY3D 1NBVL 4QRSB 3V5KB 2JIXD 4ACPA 1JN6B 3ARBA 1HXYB 2VLKB 3JV6A 1CR9H 3UMTA 4AL8L 3QO0A 3OB0H 4GH7B 1V7MH 4OF5A 3DURA 1CGSH 1RJZB 4YBQC 5F7MC 5I0ZA 1V05A 3DIFA 3ZO0A 3NAAH 4Z7NE 4G9FB 5IWLC 2XXMB 4ONHA 2ZUXA 1NL0L 2EDEA 3OR7A 4FXGA 4OZIF 3C08H 4XRCB 4TNWK 2NXYD 5K9KB 1RY7B 1RJYA 2VZ3A 4NRZB 3UPAA 1DBMH 1MELA 2R8SH 2ZG1A 2IAMB 1QRNB 5I19L 5D1QA 4F37F 3CX5J 4WWKB 4XI5D 5CD3B 2UYLB 5I71C 3O4LE 4XVUD 1B0GB 3VH8B 4NBZB 1NKOA 3MUY1 4WDIB 2F5AL 5L6YH 1J0ZA 3JBG7 4Q0XL 5E6ID 2UVEA 3KYKL 1BQHA 1RMFH 2NY5L 4H25A 5D1XC 1ZA3B 4Q6IC 1TETH 1EJOL 1Q0XL 4PTTB 4Y19E 1C8PA 1DBKL 1OL0A 2JJTC 3O2VH 1ZVSA 5GS0D 3HMXH 3NPZB 1MFCH 2EYRB 4IRJC 2X4RB 4U1GC 3HKFA 3QEQB 4U1JB 3KVQA 4MAUH 5A2KH 1F6AB 5J6HA 5D1ZD 3QDGE 4A2MA 1QSFB 5C0FB 2EEAA 4PY8J 4YC2C 3MRQB 1TPXC 1RU9H 1W8OA 2YPLE 1A9BA 2EDQA 3U7WL 1WFUA 4OLXL 4ZODA 1T1WA 1NGXA 5BMFL 1GC1C 2IC2A 1T3FB 3N85L 1I9JH 2D03H 3IFPB 3BPCB 4NUJA 3WJJC 4LLYA 3QIWC 2Z4QB 1CU4L 2F5BL 2OI9C 5DF0A 4WHYG 5GXBB 2EEBA 5J11C 1EFQA 4M6NH 5DJ0A 5BZDA 4GAJH 4WUUA 2ZCKH 3ALPA 3TVMC 4UDTA 4X9GA 1A6VH 3D39D 1NCTA 5EOTB 4GAYB 3GB7B 4RFEB 5EIIA 3PWUA 3EDFA 3TBVA 4YLQT 5ENWA 1H3XA 2EH7L 4JFED 3O6MH 5D7LA 3TIEA 3MA9L 2FO4B 2ZSWB 1KJMB 4Y2DA 1JV5B 3RX8A 3RVVD 4QHUA 4NDMB 1IGYB 5E94A 1EEYA 3ZKNC 3EZ8A 4JFQA 3BN9C 4M03A 1CS6A 3QDAA 1IEHA 5KVFL 3NH7L 5EO9B 3INUH 4RGOH 3QFJD 4FFVC 3RNQA 4M4PA 3IDXH 3ZYZA 1JNLL 2BSSB 1AXTL 5DO2C 2GJ6D 2WBJD 1DUZA 1R3HB 1GH7A 3WXWH 43CAA 2BMKB 4ODSL 3HAEB 3UDWA 1PG7X 3PABB 2F54B 1RD6A 3HNSH 3W11C 3SKUD 4Z7QE 4JZOA 1JMZA 4GLRH 4M7LH 5B38G 1LO3L 2CKBA 4QHKJ 3K8KA 1WQVT 3P9MA 5I71B 1UKSA 5EN2B 3QIBD 4G6KL 4JO3L 3PHQB 3S9DB 1YYMH 3DYPA 1I3VA 1RI8A 2R2EB 3LMJH 4N8PA 4QNPF 1BPVA 1QSED 1YN7B 5D1XB 4N8VB 4Q6IB 5KG9A 4XMKH 4L9LC 3RWJA 1U6AH 2LU4A 3MJ6A 2F58L 4JRYE 2YC1B 1QKZL 4MWFA 1T22B 4JN1L 4XAWH 2VYRE 1G9NH 4IRJB 4K2UH 5GSVB 2YPKA 4L4VA 4OLEA 3NCFB 2NY2D 3NCCB 4U1GB 2AJYH 2W9EL 5CHNA 1M6OA 3WSQL 2DWEB 2VLME 4IBLT 3FFCE 4EKXA 5DDHA 1J1XH 4YC2B 1NUFA 1TPXB 1U3HC 3K1DA 4H1LG 5IB4B 2HTLC 2X70B 2X4TB 4XBEL 5IBTH 4ZOBA 3MLSH 2FBJL 3P9LB 3D2UA 1M4KA 2OL3A 1WTLA 4HZLB 1Y0LA 4NM8L 3S36H 5B8CC 4MJ2A 2OI9B 2DQIL 4Z7UA 2WLYA 3MCKA 1OCWL 1OT1A 4R96A 3CU1A 3PXHA 5HHOB 2ADGB 2MMXA 4JFXB 1FYTB 4D0BB 3C5ZC 5L2KB 5FYKE 5EOCH 3OX8B 3QUXC 4G3YH 1T5XA 1BBJB 3TVMB 2GEEA 1RJLB 3DGCR 3MZTA 5HGDA 2BNRB 4HULB 2A74B 4WU5A 3I3BA 4L4TA 3LHPH 1IM9A 8CGTA 3P4MA 4M1CD 2VXQH 4KVNL 4O02L 4HS3A 1YEHH 1CIDA 5TE7L 1UXSB 2OLDA 2YR3A 2DLFH 3VXSE 4PRPB 4YGVB 3GBMH 3VXRB 3ULVE 3TBYA 4OIIH 3H9ZA 2Z8RA 2EDJA 4M7LT 4X5XA 1AIFA 1YNLH 5JNYB 4OLVH 3E6FA 3HUJA 5KTEH 1MREH 1I9EA 3DSNA 1D6EB 5FKPA 1BVZA 2BVQA 2PETA 3RIFK 3BZDA 5K9JL 5F7NC 1NBZA 3ZSSA 1L7IH 2E8YA 3H42L 5K9QI 2WZPD 1I8LC 3DNKA 3ES6A 5ANMA 2CIIB 3KPTA 2JJSA 3L5JA 4XNQB 1FGVH 1PG7W 4QOKA 4DK3A 4Y4FD 1U8OA 1G7HA 2PF6A 5BQ7A 4GRLD 5LQBL 1IT9H 1F42A 3UTTB 2B1HL 4LSSH 4XP9H 3G9VA 4KTYA 5DS8B 2YRZA 4OCYL 3GKZA 4U1KB 2HJFA 4KUZH 4NN6C 2NX5B 1F58L 5F9JA 2EICA 4F3FB 3V6FB 2V17H 3B5HA 2I60H 1Q0YH 3D25B 4G9DA 1LE5A 3BXNB 4L9LB 3VRLF 4KKBC 1P6AB 1SQ2N 4PJDF 8FABB 4XNYH 3KPRE 4PJ5D 3REWA 3X11A 1HHIA 5ACMA 2D31B 5I18H 1QR4A 1W0VB 1J5OL 1J87A 3QBTB 1I7ZA 2IANA 5EC2B 5FHBL 2Q86A 2YN3A 4UMGA 4ZTPL 3L3OA 5GGVH 2I25N 4X99B 1U3HB 4CMHC 1A6WL 2OQJB 1AGFA 3K8LA 5E2JA 3U9UB 4R4FL 1TJIH 4WEBH 5KVMC 1RAMA 1CZ8L 1AJ7H 2AK1L 3VJ6B 3G08B 2A38A 2XY2A 4HUKB 4ODXA 3BKCH 5B8CB 4JZJC 1DBAL 4UTAL 2JB5H 1GXEA 4Y4HD 3RBGA 4S2SB 1IQDA 2FIRT 2R23B 4FQCL 4NNPH 5GZND 3RL2A 2P5EB 2AKRB 3WLWD 4M62H 3ZE2F 3UROR 1TZHA 3FTGB 3K2MC 5EO1A 1UEMA 3C5ZB 1VFMA 4PJGA 4HS6A 3ROOA 4O00A 3QUXB 4PJ7A 1FL6B 3SDXA 5JDSB 3GBLA 4NYLB 4ZFZA 3MJ9H 4PJBE 4WI2A 1UEYA 4K7FB 5D7SH 2ZOKB 2E6JA 2VLJB 5KBNC 2DL9A 5E8NB 1A6TA 4YXHH 2DI8A 3LQZB 4HXAH 4TUOA 2RFXB 1YDPA 2NPLX 1N4XL 3V5DB 1OVZA 3S5LB 4P5MB 1F4WH 5FO9A 4TQEH 5F1NB 2DQGL 2FX7H 4QF1A 3V5HA 1CLZH 4DVBB 1X4XA 5BXFA 1OM3L 3CH1B 4YDKL 2IQAB 3V4VL 2R1WA 4GG8A 5EZJA 5B38A 1CL7L 3FOLB 1BWMA 4PJ9C 3O6FC 4R26L 2YA2A 1KLUA 4XX1E 1JGDA 4JN2A 4XC3H 3VXNB 4OB5L 5DRZA 4JO4L 1YEDA 2A9MH 3BP4A 3W9DA 5BVPL 1E6OH 4WGVB 4PJGF 4AT6A 3OHXB 4PJ7F 1SJXA 3SDXF 4C83A 3S37X 3SKNB 3T0ED 4ALAL 2GHWB 1TMCB 5C0DA 4OFYA 3GSWB 5IFJA 1DL7H 4XGZA 2B39A 3VRJA 4JDTH 4PIRF 1INDL 4J1UB 2KPNA 1RIVH 3MJ7A 5KZCD 1T6WA 4O58H 4NN6B 1HQRB 1CXHA 2H32B 4H1LA 2VDNL 4NKDA 1FV1A 1ZE3C 2IGFH 4FQXA 5GISH 3QDMA 4F15C 3UJTH 4H26B 3KXFD 3P77B 5IJVB 2ZSVA 2P42B 1YEKL 5DK0B 1I3RB 5DYOB 3KWWB 1RUQL 3QFDB 5IESH 2OSLA 4S1DC 1UYWL 2J1KA 3BT2L 1SYVA 2H6PA 4YHMH 4EUPH 4NO5A 2R39A 4GBXA 2F74A 5DVNA 3CXDL 2Q6WA 5CGTA 3GSNA 3A6OA 1Z2KA 3HR6A 4CMHB 2VE6B 1OTUD 3T2QA 4KJQD 4LNVA 2DD8H 1MJ8L 1KTKE 4HPYL 1LO4H 4LBEA 1SVZA 1QOKA 4JZJB 4GAGH 5B21A 5DI8A 1E0OB 1MAMH 2VOTA 4HFUH 3STLA 1QG3A 3N9GH 5C7XH 2AXFA 2XN9D 1DBBH 4ZO9A 4E42B 1X3DA 4UTBL 2EYTB 3U36B 5F44A 4P2QE 2NY7L 4I9WE 5ID0B 1JF1A 1QFHA 3RQ3A 4KK5C 5HI3D 5HVWA 4AK1A 15C8L 2IEPA 5FHAL 4JEGB 3I50H 1P7QD 4YDJA 4YHZL 2BK8A 4FZ8L 1NAMH 4RQQA 5KJRL 1RFDL 2QSCL 1CD0A 4CMMA 2VLRD 4HHAB 1YMHB 4P59H 1MJJA 4LL9A 3PWNB 5FFLA 4XVJH 2KL6A 2YN5A 3MV7B 3AY4A 3K4DA 4EDXB 3VFNA 5J3HC 4PV9A 3CVHL 4PJ9B 3O6FB 3DUSB 4TRPL 4JG0H 2V2TB 2FO1A 4LDOB 4GW1B 3BESR 3VXPA 2IMMA 3Q3GA 5CSZB 1QBAA 3DBXA 4E41B 4BSWB 4LKXA 5HGAA 3GM0A 4XVSL 3WFBH 3ARDA 1XZ0B 5A2LH 1MIEH 1XGTB 2UWEF 3BEVB 3LRSA 2PO6A 1YC8A 1RZKC 2BXZA 5IMKA 3QHZL 4U1NB 4HV8B 1ZEAL 1HKLH 5IQ7H 2CDEB 3BRGC 1OWWA 2X9WA 3HRZA 2PYEB 2HRPH 1VFAB 4FQ2L 4LSUH 2YD5A 3JUZA 4HCRH 5F7KC 3IDNA 1BQLH 3FFDA 1KENH 35C8H 1FG2B 2X2YA 3OPZH 2K1MA 4ZPVB 2XKSA 2XNAA 5KVDL 1FH5L 3MXVL 4J3SA 5L88L 4FTVD 1YYLL 3ZE0E 2QQNH 2XKUA 1XGRB 4QRQB 2EKSA 4F15B 2IADB 3MV8E 4IMLA 1GPOH 4ZS7H 4NN7C 1C08A 1OGAE 3L5XH 3MV11 1KEGH 3WE6A 1IGTA 3T0BA 3A67L 4ZAKA 5EIVA 4NM4L 2WBKA 4Z8FH 1T1XA 3IU4H 2HRLA 4MJ5A 5JO5B 5GGSA 4JFDE 4XNMA 2L7UA 1BD2B 5CEZE 1CG9A 1MQ8A 3OQ3B 1HYSC 5CLTA 1DUYA 1SM3L 4TVPD 4UIMB 4QT5A 4ELME 2FZ3A 3P4OB 1J05B 4X7CC 1H3PH 3DSFL 1UH3A 5F21B 1MCOL 5B3NA 2VDRL 4AEIH 4GQ9H 1G7QA 5D7JC 1MHHB 1M7IA 1S78C 1NAKL 2J5LC 1RK1A 5MEND 4HIJB 3OR6A 2BY3A 1A6AB 1RULH 4B50A 1KBGL 1BOGA 4NBYB 1QFWH 3DV4A 1MRDL 4HFWA 4LGPB 2LU3A 5IV2A 1WLHA 2BCKB 5CSBA 43C9B 1NANH 5HHXL 2I5YL 2J88H 3LS5L 1Z3GL 3OKNB 3TBTB 4JFFD 4LRIA 4IJ3C 1KUMA 4OLUL 1MCPL 1DBJH 4OFKA 1FL3A 1RZJC 3SJVA 4LCCA 4NC1E 4U1SB 3MNZB 1I7TB 1RZIB 1FPTL 2NMSA 4LLQA 1Y18A 3D39E 1VERA 4F7TB 1QEWA 4J3VA 1CGUA 4U05A 1F3JB 1HSBB 3UPRB 1E4XL 2C1OB 1DN2A 4NO0A 3SO3B 3NA9L 4P4KB 1QD0A 5CILH 2C3GA 3BZFA 1UWGH 5C2BH 4ZUUA 3RL1B 3ARGD 5MEQB 4ISVA 5JW4N 5E2WL 3FMGL 2Q8BH 3E8UH 4UV7H 5IW6A 3OG6B 2BVPA 5ID1B 1A21A 1A3LH 4KJWC 1OAKH 2KQMA 3HE7A 2HKHL 4NNXA 4XCFH 3OB0K 4TNWF 1UCBL 2CO7B 2DLIA 2QQLH 3DX6B 1RHHB 1MFEL 4HJJH 3ZHLA 4C4KT 4LASH 5FYJU 1SEBB 2NXZD 5F1KC 3LRHA 1W72A 5C08D 1RVFL 3SDDC 4JQVA 5BRZA 3G5ZB 5LJYH 1FVDB 3HZYA 4NSKB 4YBLC 3C60A 2PXYA 3O9WA 4UOW0 3RY6A 2BRRH 2WQ8A 3O4LA 4YHKL 5EIQA 2IH1A 5IEHA 1LK2A 1MH5A 1CK0H 1IAIL 5HSFA 2GTWA 3ZKXC 4DGYL 4DN3L 3S6CA 3BFOA 1I9RL 3EDJA 1V7NL 1FAIH 4Y19A 1CGWA 4Z7NF 4NN7B 3T2NH 3Q6FA 2MWCA 3GHEH 1QSEE 1ITCA 5J13C 1CI5A 5DJ2A 5SWSE 2O61A 4UAOB 2X7LA 3Q5YA 4LLWB 2V5TA 4OIBA 3IJHB 4PYHA 5C0BB 4Q9RH 3HMWH 1A7BA 4NJAH 1MJ7H 1U91B 4JHAL 4G8EA 3JXAA 4TSAH 3QDGA 2P7TA 3TNNB 3BAEH 4J4PA 5M7QA 1NQBA 2O5ZL 5ESVA 3D9AL 2YPLA 3LIZH 5DMIL 1J0KA 4NZUH 1DSFL 1GC1H 5I1AA 2NY5C 5D7JB 3SOBL 2V5SA 4LCIH 5BS0A 2J5LB 1UENA 3QQ4A 3SE4A 1CL7I 1TCMA 4LCUB 3H7BB 3NACL 5C09D 5CCKH 5LBSH 2ITDA 4LU5L 4JHBA 3MBED 1CXEA 2ATPA 3VWJC 4A2LA 4JANB 1Q38A 3IDGB 4IJ3B 2XWJA 2FEDC 3G5YB 3K4ZA 5C0RL 1M7DB 5AG8A 3EGSB 4ODHH 5HVGB 4Y1AB 1GGYA 1UJTA 4NNYA 1U41A 4H5SA 1D3CA 4P46A 3KYMA 3LN9A 4PG9B 2VXSH 2VNCA 1MFDL 2F53D 3G04B 4M1GL 2OM5A 5IP4A 2G60H 1GSMA 4OCMC 1T2QL 5JIPA 3QRFM 3HR5B 4AQ1B 1KIQA 5IVZB 3FT4B 1UZ8A 2QHRH 2K7QA 4I13B 2D7PA 3PQYE 4U6YB 2IG2H 4F7EB 4E0RA 2CK0L 1F3RB 1FIGH 1SEQH 4X6FB 1QSVA 4U3HA 5I2IA 2VDOL 3QUYA 4EOWL 5GGUA 3MRLB 2VXUH 1IC4L 1UVQB 2H2PD 4G8FB 1NC4B 3CJJA 5EPMA 4MA3B 4P4RA 4CU7A 2ICWI 3CCHB 4FQ1L 5I15L 2P47B 4IIQA 3FB6B 2VKXA 4PP2A 4HIXL 4YIQB 4Y16B 1FGNL 3QEUA 4PJXE 3RTQC 1G7MA 4G43A 5JHDE 2Q1EA 5CP7A 1DEEA 5J56B 4XX1G 4LLDB 1C7SA 3QIWD 1FJ1B 1XGYH 3RX7A 5GRYA 2XA3A 1E4JA 3ARVA 3ZKXB 1NCBL 5DSCA 3AC0A 4Q9CA 1D5XA 2CO6B 4ODBD 1ZHKA 3CFKA 3ZTJH 1FE8H 2JB6A 4JRYA 2X40A 3LN4A 2B2XH 2ZUSA 5J13B 5A3ID 3CLEH 3Q48A 4YPJA 3TN0D 2ZNXA 5C07B 4JLRA 3OB8A 3ARFA 1S9VB 3BP7A 3OJ2C 3QPQC 2KDGA 3NFPA 3OZ9L 4M9PA 1AH1A 3FFCA 2CXGA 3EYOB 4Z7QF 1EX0A 1CBVL 4DKFL 4OLWH 5DEGB 2YD3A 1IILE 2CGRL 1CLOH 1A14H 2V9RA 3DMMC 4DQOH 3HG1D 2AJUL 3LEYH 5EU6D 3WKNA 5CD5C 1S9XB 2GJJA 4JDZA 4HC1L 2PCPB 3T3ME 5KVGL 1JNHA 4KK6C 4J7RA 1ZT7B 1GGUA 4Z7VE 3MXWH 4FFVD 2A73A 3VWJB 3C8KB 3LDBC 1T04B 2EO9A 1KLGB 5I73B 4G5ZL 1ZAGA 3RVXD 4N8CL 3L7EA 3I6KB 5D5MF 3MO1A 1NCNA 4BA8A 5AUMB 1IZJA 3BVNB 3NTCL 4Z5RB 4H20H 2WUCL 2VDPL 1N2RB 4G6JH 4KJPC 3U4BL 1HHGB 5IMMA 1FNAA 4Y5VC 2Q7NA 5F88A 3VXSA 1C5CL 5IHUH 5JPMB 1NGWB 1BVLB 5IQ9B 4HKZA 1CWVA 1KB9J 1P53A 5IBLD 1IBGL 5CJQH 1XGQB 4OD2A 2OP4L 4P5KB 2DQUH 4L3EB 3RWGA 1ZANH 5JQ6H 2AQ3A 2OMBA 1IGCL 3RIFF 5T3XD 4WFED 2O5YL 5C0AE 2ARWA 4KROC 5HD8C 4FQHA 1J1OL 4YBHA 3TO4D 1DQDL 4JRXD 1FIEA 2XG5A 1LDSA 5HDOA 2GT9B 4OCSH 3QG7H 3RTQB 4YFDB 3P30H 4LOUC 4NHUB 1NGQL 3D48R 3TZVB 4G6AC 1AY1H 4WO4D 1JPGB 3ULVF 3PHOB 3EYUH 2H32H 4NT6B 4GSDL 4MD0A 2YUZA 4CVXB 1EGJA 4POZC 1DVFC 1IAIM 5IF0B 1KJ2A 2V2XB 2V9QA 3GIVB 5ETUB 1H15A 3C6SB 2G5BA 5JDJA 1FZKA 1N7ML 4N0YH 4XC1H 5CLWA 3KPRA 3WKML 2ICEA 1FO0L 4G8IB 3O0RL 5E9DB 1XF4A 2C3VB 1HHKB 1TVBA 4DTGL 5HI4D 3FZUC 1FNSH 3DGGB 2VR9A 3MLXH 1I9IH 1GZQA 3T0AA 1QBML 3L3GA 5FGCB 5D70H 3WFHA 3ZKSD 4JE4B 4M61B 3VXUD 3BP5A 3GI9L 5L7XH 4DK6A 3DMMB 1CF8L 2D7TH 1D5IL 4CN4A 4NP4L 4N9GA 3WHE1 1A5FH 1EVUA 5E5MB 3VGGA 4MGXA 1I8IB 1NGPL 5TQ0L 3LDBB 4U31A 2NW3A 3HPJB 5DQDL 5IMOB 3SCMA 4PJBA 5E5RB 1CDIA 3ILQD 3ZT7A 5DD1L 3W9EB 1U8HB 1XAUA 2NLJB 1R5IB 4Z95H 5FYJE 1JFQH 4MX7A 4LPXA 3VXOB 2H8PA 3DUUB 3K8MA 4Y5VB 3FB5B 1LEGB 4FZEL 1EZVX 3MACH 4JDVB 3NFSH 1E4WH 4PRAA 1WVZA 4ZQKA 3RWHA 5DMKB 3B9KC 1RK0B 4NQDE 5CEYB 4XPHL 4DUXA 1JYVA 2C5DC 5SWZD 3DV6B 5FOBA 3BUYA 4WV1C 5T33H 1IAII 4Y8DC 1AO7D 4O5LL 4MA7H 2D4FA 4UV4L 4X80L 4NZJA 3A6CL 4NRXA 4KROB 4DW2L 2AEQH 2DQCL 2IMNA 3CX5K 3GFUA 4JFOB 5E03A 1W8NA 3FO0L 4I3RH 5FGBA 2L0DA 3HNTH 4LFHD 3U4EB 1XF1A 1ORSB 1GJIA 3MOBL 3IJYB 5HGHA 1TITA 4PUBH 2GSIA 3WFDH 2AW2A 2HLAA 1G1CA 3GMMB 4E9LA 1WICA 1L7TH 1PY9A 3CX2A 1BGXL 4NWTL 1RZ8B 3UTSA 3DXAB 2WAHA 3GIZH 4QTIH 1JCKA 1DVFB 1TQBC 2XA8L 4GMTL 4ZXBD 2EYSA 4X6CB 2HVKA 2D2OA 5MERA 4OQTH 3S4SG 1MFAL 1UQSB 3T4YA 4XCNB 1JUFA 3OBAA 5DVLA 3T65A 2MPAH 5F96L 4NOFA 3ZT5A 3O8XC 4AENB 2DL2A 3CFCH 3FOMB 4FFYL 1XR9A 5DT1L 3WIHA 3QH3B 5E00A 1P4IH 4NWUL 4DZBB 5IB5B 3F12A 5EZOL 1ZSDA 2V9TA 4MDJA 5CEXB 1NDMB 5BOZG 4DKEH 4PD4J 1CIUA 3KYNB 5GRZA 1S7SA 1RUPH 4OAWB 3WIIL 4PREB 1NGYA 4PP1D 3R8QA 3OGCB 4U33A 3VE0A 1XIWA 4W6YB 2AS5M 4U1LA 1IEAA 2VLKE 2NY6D 5I1CH 3DPBA 2VZ1A 2PYFB 4R4ND 1JGEB 2G9HB 5EZLB 4ODWA 1FZMB 1I85C 4MB4A 1T0PB 1R3KA 3MMEB 4Y7MA 5ESQA 1WV7T 1PDKA 4P2QA 4P2RB 4P2OD 3B6SB 3QDJA 4QXUL 4BM7A 4ZD3H 3FQNB 3U9PL 2VZOA 3C5SA 4U1IB 3KPMB 4JFFE 4OFPA 4QTHB 4QHLA 3NFNA 1P4LB 3OKOA 5CZKA 4RMWA 1I1YB 4O2EA 5KSVA 1HXMA 3QRGL 3WLBB 2B1AH 3GDBA 1QRNE 1E27B 2DRUA 5ITFA 1HILB 3B9KB 2V5YA 3CFIC 2BSRB 4M8QB 4XNZB 4UB0H 3KPLA 2JIXA 1CGYA 2EDKA 4Y89A 1WZKA 4JG1H 3THML 4X5WA 1T2XA 3MA7A 3T09A 4JFHE 1B90A 3TV3H 1FVCB 5DD0H 1NEZB 4JQIH 5I1LA 4MAYC 1ZHNA 4RMTA 2FJHB 3TT1H 1I1AC 2D7QA 2IBGA 1K5NA 1N3NA 5F3HA 1RZKH 4PBWD 2MCPH 2W91A 3SO5A 5EULV 3NZHH 1P84J 2Z35B 5DHYA 4YHYC 5I30L 3QEQE 1D5MA 4GFTB 4LPTA 4R97C 1IGML 2OTWA 4HX1B 5A40E 1QSFE 3MUGB 4MNGB 5JUEH 2YA0A 1KJ3H 1BFTA 3WUWG 3P0VH 2LVCA 1A02N 1ZT1B 4KKAC 3V4PL 1KN4H 3RRQA 3GNMH 1KGCE 4FFZL 4UIKL 1TQBB 1ADQH 1A6ZA 4U6HB 3KDMA 3MV8A 4KFZC 1OAUL 4N5ED 3MBXL 1OGAA 1QLFA 5ERWA 5ICYA 4MD4B 3L3DB 1SYSB 5GGTL 3WHXB 4E5XB 2WSKA 3K4AA 3ARRA 4HKJB 1FVEA 3QNZA 3WDJA 4JFDA 3D0LB 5C9JB 2YZ1A 4F8TA 1A1NA 3BHBA 3PWPB 1BZ7A 3QA3A 3X14B 5E1AB 2P5WB 1VFUA 2C7UA 3G6JB 1YNTA 4PRBA 3QPXL 1B4JL 2BVTA 1QO3B 5D1ZA 1PSKL 4ELMA 1BJMA 4HK0A 1WAAE 4LHUG 5IBUB 1A1MA 3S88L 4X7SL 2EIEA 4QGYA 4FA8A 2DLGA 3GSVB 1KB5L 2XZCH 1BFVH 3ZE0F 2ICWB 4OIAA 2GSGB 3F7YA 4O2FA 4YE4H 2F19H 1F4XH 2ITCA 1WEJH 1ODAA 1ZT4B 4P5TD 1HHJA 2AGJL 2FHFA 1ZGLP 3LKNA 2LE9A 1G7LB 1WIUA 1C16B 5J1TC 1RZJH 5KN5A 3F7QA 2Y36H 3MR9A 2AJVL 1OAYL 4M5ZL 2QV2A 5KANG 3D39A 2HH0H 3CK0H 1HQ4B 4XPBH 2G75A 2Z8SA 2AV1B 2OTPA 1TXKA 4EN3D 2OL3L 4JFEA 3ULUL 1Q1JL 4XP6H 3DVIA 5H8DA 2R0WH 2CDGB 3MLUH 4N0UB 2BOCB 5GIRB 1GGCH 1SJEA 4I48A 4RZCB 4YDLC 3RKDD 3N50A 3U0PA 2ARJB 4LSVL 1A7QH 4L8SA 1FN4B 4NIKB 2PTTB 5GRVL 5JMOC 3VU2A 1EERB 3S4SA 2ADIA 1HIMH 3HMXA 1KT2B 4LAQH 3QUMA 1U93B 3MTRA 2R9HC 4XHQA 4XNXH 3UZEA 5D7IB 3E3QC 2Q76B 4K7PL 3MV9B 4YHYB 1RUKL 2FGWL 4AH2A 3V0VA 1Z6JT 1A64A 4F57L 2E27H 4LEOB 1HCFX 1WIOA 3RZCA 3CVHB 2VQ1A 1EO8H 4MCYA 4OLZL 3WN5C 1XCQB 2CDFA 1LILA 3MRNB 4FXKA 5JPNA 1R3IL 1A3RH 4QCIA 3QIBA 1IL1A 2HAZA 2ZNWA 5F93C 2P24B 4HH8A 1NL0H 2LAAA 5FUZH 2ATKB 1R6VA 5HHPB 1QSEA 2H1PL 5SWSA 3KPNA 3HI1B 5HHOE 3O11A 2ZUWA 1KELL 3B83A 5HXMA 5J7CC 5T1KA 2AI0L 1ZWIA 5E2UL 5L2KE 4D9RD 1I4FB 4KGJA 4XPGL 1QR1B 2ZJSL 3UTQB 5FECA 1IQWL 2BNRE 4WHDA 3GMLA 1Q9LB 1NGZB 1YQVL 4JJ5B 2I9TA 4HUWA 4YQXL 2C1PA 1T5WA 2F5AH 4L29B 3PP4L 5KSUA 4Q0XH 4U1MA 5DJDA 3KYKH 2NY5H 4PRPE 3QG6B 2JJVA 1M7XA 2LTQC 1EJOH 1WC7B 1Q0XH 5EWIH 3RA7L 5F7WC 3VXRE 5FB8B 3LH2L 4D0DA 5HDQH 1DBKH 4KJWD 1RURL 3C8DA 4ZDHA 5ACZB 4X9IA 4G7VL 1WWWX 3BWAB 5BZWA 5LVEA 3FO1B 1BEYL 5BV7L 5CBEA 3O2DL 5HHVL 3RWIB 1BLNA 1Q9WB 1VPOL 3ZL4L 5HYQB 4C56B 2FH6A 3PL6D 1J11A 3M1BA 1S7RA 1R3LB 5IR1A 2X6MA 3SDDD 3T4AA 3ZDXE 3U7WH 3ECBA 1N6UA 3P3YA 5I1DA 2ICWJ 4FQIL 5GRJL 2P44B 4OLXH 3GO1L 3K74B 4JGJA 4RGND 5DD5L 4HWZB 4LLUB 3N85H 2DI9A 5FXCH 4Z18A 2R4RL 1TTGA 3MPCA 1FFNB 3UTTE 3IRZA 3PQYA 4HKBB 4PJHB 3RWDB 1W0WB 3BDBA 3OKMA 3FT3B 5GZOC 4XH2B 3ALXA 1PVHA 2NX5E 5FAAA 4OZHB 4YDLB 1W2KT 4DGVL 3X12B 5LGJA 3CC5B 4KI5C 2DWDA 5AG9A 2J6EL 5EA0L 5J89A 1KIUA 1ACYH 1H0DB 4PRNB 4WFHD 3OXSB 2ZUVA 5IFHL 3D6GA 2PNDA 1N26A 4L3CA 3DYOA 1LDPL 2AABL 2EH7H 4XP5H 2GK0B 4PJXA 4F7MB 4ORGA 1MCEA 3ARBD 1F2XK 5JHDA 3OKYA 5JIIA 4ZUVA 1AD9B 2G2RB 1ZK9A 3GBNL 2RCSH 4JPVL 4GRMA 1R3JB 3EHBD 4EVNB 3TLRA 1VACA 3QCVL 1JWUA 1VKXB 4GW5B 4MZ3A 3CFBB 4YO0B 3AS0A 2A0LC 4LHUA 5KVFH 3NH7H 3FHAA 3OF6A 4ZNEE 1K4DA 5AYUL 3Q0HA 1JVKA 2QQKH 2ZOLB 3KLHD 5EBGA 1H3GA 3W2DH 2ZG2A 4X4XB 1MRFL 5JW5B 3VFOA 5FYLE 2BY0A 4HIHA 4MQXD 4EUPG 4X6DB 1X4YA 5D1QD 3QIUC 3DRTA 3F6IA 1CFTA 4AM0B 2R0KL 4XPTL 2EE6A 3RU8H 4Z76B 5C0ND 3MRFA 2VLJE 1S9WA 4NZDA 4G6KH 3FONB 4JO3H 3G5VB 1UB6A 5LKNA 1YPZB 5H2BA 1RIUL 1S7XA 3O41A 3P0YL 4X7EC 1XH3B 1R24B 3ETBF 3K7UA 4GUPA 2LTQB 1UGNA 3DWTA 3TPUA 2F58H 2ZCLH 3LS4H 4Q2ZB 3LKQA 5JXEA 4JN1H 5TF1H 2YPVH 2R56L 3DO3A 1JWMB 4WFFE 3U30C 4KMTL 2AJSL 4KUCF 5I9QC 1LK3L 2W9EH 3SKOA 5TDPB 3WSQH 4OTXL 3IDJA 3N1QC 2VITB 1O7VA 4OCXH 5J9PB 2CKBH 4PGCA 4BFEA 3AXLB 4O2CB 1SBSL 4DWHA 1CTNA 2FBJH 3V4UL 2AJXH 4H88L 4JFZL 4NM8H 1LEIA 2OX5A 4H0HB 4JVPA 1FAKT 4F33B 4DOHE 3IS1X 3IKCB 2DQIH 3TO2A 5HDBE 2OR8A 1OCWH 5E8EB 2P8PB 3MYJB 1V3MA 3T3MF 4WUUD 2DIAA 5C0AA 4A6YL 1IGIL 4UQ3A 4Z7VF 4F7CB 4LQ1A 3DX7A 4P3DB 1P9MC 3L5IA 3D5OF 1FZOA 2AQ2A 5D7LD 1MPAL 4GXVH 4TN9A 4QXTA 1KIRB 5EU5B 2VZTA 5TE7H 2BC4B 5CJ8A 3VH8G 5T3ZD 5FK9A 1T0NB 4PJCB 3SDAB 4HKXA 4YX2L 4L8BB 2H26B 2H41A 3CLFL 4MNHB 2QADC 1ORQA 4HH9B 3X3GL 2A6KB 5K9JH 4NC0B 2A6DB 4QXGL 1J8HB 3H42H 1S7TA 4N90D 3O2WL 3EYQC 4M6AA 5D6CA 4KWUA 3QIUB 1U8JB 3GJFB 2VLLA 4M7KL 3V79C 4UNVA 1IAOA 3MJ9A 1J10A 5LQBH 3EJYC 2B1HH 1OGTB 1HINL 1KULA 1ZS8B 4PJ8C 4I4WB 4OCYH 5F9DC 4XPFH 3DROA 5AZ2L 2VABA 4HUNB 4FFWD 2DKSA 2O5XH 4NOBA 3MOAL 3MV7E 3VDCA 3RVUD 3DETD 1DQLL 3ARXA 5EU3A 5IB3A 4XBPB 4L4VD 3BKJL 2X4UA 3U30B 4ZYKA 1WBZA 1MHCB 5I9QB 3ZZ1A 5HHMD 5C0EB 1A8JH 3C9NA 1J5OH 2JJUA 4E41E 2XN9A 5FHBH 4Z78B 3TT3L 4ZTPH 1JPFB 2F8VA 1UACL 2NYYD 1NUGA 3JV5A 4M48L 5ICZA 2EDWA 2APFA 1A6WH 4P23A 4PRHB 1OAZH 3D2UD 4R4FH 3R06A 1U8MA 1BF2A 2OMNA 1CZ8H 2AK1H 2NTFB 2OXGA 2GUOA 3CMGA 2O93L 1P7QA 4XZUB 4F2MA 1UM6L 1DBAH 4NQDA 1O0VA 4XPAL 4R7DB 3FB7B 5EUOF 2PYEE 1KXVC 2VLRA 4FQCH 5FA3A 1CVSC 2C9AA 4YHLL 1EJ6A 4POZD 3K0WA 2Z92B 3RNKA 1YN6A 3C5JB 2JLLA 3WUZA 1YECL 1P7KB 2ZZUT 3WS3A 2ARJQ 5C0GA 4U3CA 1CGXA 4XBGB 5I17B 4NKQB 3QP3A 4L4TD 1IM9D 2DM2A 5JTWA 5DQ9A 5DJ8A 1F8TL 1KTLA 2R15A 1BFOA 2HFGL 3KNBA 3O6LH 2WBWB 4L1HA 4EI6A 5IJKA 4J12A 3D3VD 1MJUL 4EUPA 2DQGH 3HZKB 1BD2E 5TPWL 2ENYA 1OM3H 3V4VH 4PLKD 3MRKA 5KW9H 3QULB 1CL7H 3SGJC 1UH2A 2BERA 4R26H 4HWUA 3NCYP 1VADA 5DZLA 5IVXB 4QYOA 1OLLA 4OB5H 4JQXA 4J8RB 1T1ZA 4JO4H 3QEHA 4LGSB 4IS6B 1HKFA 4JM2F 4LHJB 1BAFL 5F89A 3GSUB 5BVPH 2QADB 3MV01 5C70A 4QHMB 3QAZC 1TNMA 1NDGB 3O3AB 3PV6B 5BJTA 3HNVH 1XMWA 2FIKB 4WEUD 3WO3B 4PJAB 4F9LA 5T5FL 3BE1H 5IW1B 2PUQT 4ALAH 2CLRB 3CMOH 1T66C 4FQQA 4G7YH 3T8XB 4HJGB 3SGKA 2H9GB 1WBYB 1INDH 3JWOH 4HW6A 4M43L 4PJ8B 2X4NA 3SE8L 1NAMA 4LF3B 2VDNH 4NKMA 4PGJA 2DYPB 4QRSA 1MCLA 3EJZD 1CXKA 1HXYA 2VLKA 3O3EB 4WW1A 3UP1A 1YEKH 4Y8AA 1NLBL 5E4IA 5AYQA 1T7WA 4PJIB 5DJAB 4PB9L 3BT2H 3MJ8A 1TVDA 2IAND 5E2VL 4JVWA 4RIRA 4F9PC 5HJ3B 4JFFA 4DFHA 2C3XA 3T2OA 3CXDH 3D18B 5EFIB 4HUUA 4X8XA 5DWUL 5K9KA 1RUAH 1QRNA 4HPYH 4R7NA 1AR2A 2X4PA 5CD3A 4HCRA 3VH8A 1F4YL 1U92B 4ELKB 4Z0XB 3OJDB 4RISL 1KCUL 4XMPH 3LEVL 5E8OA 3WIFB 3KYAA 1LE9B 4R8WL 4PJFB 4UTBH 1AP2B 3MGAA 1K2DB 1ZA3A 4BSVB 2NY7H 3GMRB 1ZTXL 2GY5A 3FO2A 4PTTA 3O8XD 3I85A 1G0YR 3HB3C 4OZFB 4LIQL 3FRUA 3ZHKA 1J0HA 5FHAH 2EYRA 1QLRA 3NZ8B 5KJRH 2QSCH 3QNYB 3QT2A 5C0BE 3QEQA 3KJ4C 4YR6A 5C08A 5C0FA 1QSFA 4HGMA 2A2QT 4K3JH 4PV8A 5MEPB 3C6LC 1I3UA 2EZ0D 3T1FB 3CVHH 4TRPH 1JZ8A 3QI9B 4D3CL 1YMMB 4ONGL 5FF6B 1MIML 1EHNA 3BPCA 4PRIB 4U1HB 2WP3T 3S98A 3VD5A 3QAZB 3B2UC 1DLFL 1AHWC 1OSZB 1NH6A 3MRBA 4NRYA 4TUJB 4X0KB 5CJOL 1GYAA 3QHZH 3MSPA 1BJ1J 1KEML 1ZEAH 2DOCA 3STZB 1JZ7A 4MQTB 4M7ZC 4OFYD 3TPKA 1D5ZB 3L3IB 4Y2DC 3EYFB 5EOTA 3GB7A 4FQ2H 3K81A 4RFEA 3JV6B 3L3JA 1WAAA 3MOQA 2X4SB 5KVDH 3FN0H 4P0DA 1FH5H 4FQXD 5B39B 5L88H 3QDMD 3LD8C 2ZSWA 2OS7A 3IAGC 4KK8D 3MLVL 1IGYA 5AWNL 1SY6H 4ONHB 4R3SB 4MAYD 4BK5A 2YK1L 5C09A 4M8VA 1I1AD 5IWLA 5E99L 2VKWA 1ZLVH 5DURD 4N9OB 1EAPA 4ETYA 4K71C 5TDOB 1R3HA 4UT9L 1KB9K 1SM3H 1YJDL 2BMKA 3S5LG 2JK5B 3NPSB 4RAUB 2J12B 3DSFH 3X3FH 1MCOH 4U7KA 4KAQL 2VDRH 4N1CA 5KSAD 3O81A 4D0CB 1WAAF 3CUPB 4L4JA 1PEWA 1ZGLM 1NAKH 4WHCA 4H25B 4LCWB 1KCRL 4RGNE 5EN2A 1KBGH 1VGEL 3QCUH 1MRDH 1TCRA 3GSQA 5DC0A 3PHQA 2Q8AH 4K7PY 3AROA 4ONFL 4GKSB 4WHTA 5HHXH 2I5YH 3T0WA 1Z3GH 3BGAA 5D1XA 3PWVB 4EIGB 1MCPH 2RR3A 4Q6IA 4JO1L 3LSOB 4OF6A 1KPRB 2JJTA 4LAJH 1T22A 1TJHL 2W0FB 2XY1A 3ZKMC 1FPTH 3ZT6A 5C07E 3PUCA 4WUKL 5F7EH 4OKVA 3KJ4B 1T1WB 1NGXB 2YMXL 3NA9H 3ULUC 3BUTA 1LGVA 4AJ0A 2XT1B 4NUJB 4YH6A 5C0CD 1J0IA 3IGAA 4F80A 3C6LB 1VGKA 2DF3A 1E4KA 2XQBL 5E2WH 3FMGH 5JQHC 2X4TA 1JGVL 3P9LA 4KRPC 3OWEA 4HZLA 3HCVA 4R2GC 5B4MC 4HSQA 3WJJA 3QDHA 3QIWA 5E8PB 2HKHH 3ARSA 4U49A 4D9LH 1UKTA 2Y5TA 1AHWB 4UDTB 5EZIH 3BD3A 4K8RH 5HHOA 4NHCL 1MFEH 2ADGA 3MFFB 4JFXA 3LCYA 4HIEB 5I1EH 1MI5D 4M7ZB 3L9RB 5JLZA 3TN0A 5ENWB 4GXUM 3TVMA 2DB8A 1JZ6A 1DCLA 3TIEB 4D9QE 2L7JA 1RJLA 2BNRA 2KKQA 4KDVA 2A6JB 3FQWB 2A74A 1ZMYA 4Y2DB 4OJFL 4X7DC 2A77L 4QHNA 3ORJA 4QHUB 4HMCA 2Y06L 5I1IL 1IAIH 4OGZA 5E94B 1WCBB 2Q7YB 1EEYB 3U4AA 5EORH 1N59B 2QSTA 3LD8B 4JFQB 4DGYH 4DN3H 3QUZC 4PRPA 1URLA 4YGVA 1I9RH 1J8KA 1EGJL 1V7NH 3VXRA 3SDYH 1KNOB 1UWEL 3RNQB 1KJ2L 5DFVC 4ENEC 3PHSA 3CXHK 4B7LA 4WRLA 4L3EE 1DUZB 2BP3A 1BBDL 3JTTB 4JHAH 1JTPA 5CMAB 2O5ZH 3D9AH 1Y6KR 1P2CB 1ZKAA 3LKRA 3P9MB 3VGAC 5DMIH 3PJSB 4R0LC 4U2ZA 3ZDZE 4XTRD 5C0JB 1MVUB 2CIIA 3I6LE 1DSFH 2VERN 5DJCA 4L1DA 1T21A 3SOBH 5T1LB 4G80B 5DS8A 1ND0A 3DVNA 4U1KA 5KG9B 1OD9A 3I9GL 2HFEA 2NX5A 1FFOB 3JWDL 3TNMB 1QHOA 4MWFB 5BV7C 5F7DB 4AZ8A 4F3FA 3V6FA 1BFSA 1CD1B 2YPKB 1TZGH 4K8RD 4B41A 3BXNA 4L9LA 2DMBA 4C59B 4WVRA 3JSSA 8FABA 5CZXD 5C0IA 4LARL 2D31A 1MFDH 4M1GH 3MLTB 2IWGA 4NO0D 5E9DE 1W0VA 2R4SL 3ZDXF 1T2QH 3IAQA 3LRGA 2OL3B 4JPIA 5EC2A 5CP3H 5DLML 2B0SL 3UCRA 1LP9B 4X99A 1JWSA 4YPGB 1U3HA 2CK0H 1DP0A 2OQJA 3U9UA 3IXTB 4WWID 4Z7UB 4NGHL 2X1QA 2XZAH 3M17B 4HBCL 2VDOH 3VJ6A 4KRPB 3U0WL 4R2GB 5LCVL 4QNPE 4XB8A 4N5UA 3TJEH 1GOFA 4WO4A 4ZNEA 5B8CA 2CXKA 4APQD 1CE6B 5DC4B 4S2SA 5JOEA 1T5XB 4FABL 1L6XA 2AKRA 4FQ1H 5HGDB 5I15H 1EHLL 3C5ZA 4PD4K 4HIXH 4MXWH 4YDIL 3VWKC 2ADFL 3QUXA 4YAQB 1FL6A 1Z0NA 3C60D 3DVFA 2PXYD 3O9WD 5JDSA 5K9OB 5F1IB 4NYLA 4BZ1L 3O4LD 2E7LC 4HS3B 4G42B 1QHPA 2ZOKA 2VLJA 1ETZA 3SBWC 3LQZA 4TSBH 2RFXA 4NCDA 3FO9A 3V5DA 3S5LA 1AIFB 3DI2B 2YWZA 4P5MA 5I8OL 5EBLB 5F1NA 1NCBH 3QUZB 3HUJB 3LY6A 4Y19D 3V7AE 1NCWH 5GZOD 4DVBA 2IQAA 2ZKHL 3E2HC 5FKPB 3FOLA 4HF5L 1A1OB 2HTKC 1A7NL 1YY9C 1A47A 3OL2A 1NBZB 1JBJA 5E4EB 1BIIB 3QXAB 1A4KB 2WWMC 3W39B 3P73A 3QDGD 4WTXA 1GZPB 3ROLA 1ES0A 4J4PD 5DGRA 1I7RB 4QOKB 3SDCC 2YPLD 2P43B 3TJHD 3F7VA 3FQUB 5HHME 1G7HB 4M6OL 4RWYL 1CBVH 2R2CA 4DKFH 3Q2CA 4BYHA 1DQJB 3V52H 3VGAB 1HK6A 4R0LB 1I8LA 1EDQA 3UXFA 1JHKL 2CGRH 2GFBB 2HG5B 4PY7B 2JELL 5F9JB 3VFSA 1X5HA 2NW2B 3M45A 1QNZH 4J1UA 4G9DB 1JK8A 2DBLL 1V3LA 4HC1H 1LE5B 4FRWA 1WF5A 2H32A 4Q6YA 5BV7B 5ITBH 4OF0A 1F6FB 1SMOA 3REWB 4H26A 5IJVA 1HHIB 2PTVA 3P77A 5AAMA 1P84K 4N8CH 4X6CE 5F8RC 1EV2E 1IGFL 3OAYH 2WUCH 3KWWA 4EBQH 2VDPH 2OK0L 5C92A 5T5NF 3U4BH