4AG4L

Crystal structure of a ddr1-fab complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
210
structure length
210
Chain Sequence
DIQLTQSPALMSASPGEKVTMTCSASSSVTFMYWYQQKPRSSPKPWIYLTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSNPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/transferase
molecule keywords EPITHELIAL DISCOIDIN DOMAIN-CONTAINING RECEPTOR 1
publication title Structure of the Discoidin Domain Receptor 1 Extracellular Region Bound to an Inhibitory Fab Fragment Reveals Features Important for Signaling.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2012-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ag4L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ag4L01
1T89A 3TYGH 3MJ7A 3RWFB 1QBML 1FJ1B 2X89D 1SHMA 3DI3B 3IF1A 3KR3L 3WIHL 3UPAA 3UZQA 4HMCA 1AO7A 1GZQA 5IHLB 4YR6B 2FLRT 3ECBA 5DQDL 1INDH 2PTTA 2VLRD 3QO1A 4Y4FD 4OF6A 3P77A 3MRGB 4AL8L 5FFLA 3QUKB 4OKVB 4ZXBC 1R0AL 1WFTA 4XC1H 5E1HB 1U8JB 4MWFA 1YJDL 5CMAA 3OJMB 2KKQA 5MEND 2FX9H 4EBQL 1WWAX 3SHSA 3I50H 1Q9LB 4X8XA 4Y5VB 5ESVB 3VFRA 1G7PA 5SWSD 2CLRA 4Z7UF 3UJTH 4ZFZB 5IV2B 3CXHJ 1U8PB 1KELH 5D1ZC 4IRSD 2EH8L 5F7NC 1D9KD 4I0PD 1YECL 2CDEB 1MJJB 2FZ3B 5ICYB 1NJ9B 4GRWH 3VDBA 3QHFH 4OFPA 4PR5A 4HPYL 3MJ9A 3P73A 3U30B 1IBGL 1HHHB 3ZMRA 2Y6SD 3GJFK 2A0LC 1LILA 2E3VA 1MFDH 4FRWA 4ODVH 1A1MB 4Z77A 5JHDA 1IM9D 5DJ6A 3EO0A 3UO1L 3I2CH 5F9WC 3JV5A 1A7QL 1IAMA 3GSRA 3P4OB 4NRYA 2FIRT 3RDTB 5BVPH 1LDPL 5DJDA 4NT6A 4XMKH 4C57C 2EXWD 2BX5A 2PTUA 1QFUH 2A38A 2ZNXA 5C86A 4L1HA 2CLZB 5FCUH 1XIWC 1TPXC 1GAFL 1G7IB 3QG7H 5D7LB 5D70L 2R8SL 1CICB 1A6PA 1IQDA 1QR4A 4MLSA 2DBJA 3RUGE 3OR6B 5B3JF 2P8LA 2DQFB 2K7PA 4HBQA 3LZFH 4JDTH 1CDBA 1WITA 4JG0L 3QPQC 5C0IB 1S9VA 4I18C 2DQCH 4OD3L 2AXJA 5TE7L 4TVPH 5E8NB 5KOVC 5INCB 1LO2H 1DBML 3EJJX 5K9QI 3G6JB 3GBNL 3ARGB 5GJTL 4AEIH 4G42A 3RVTD 3P11H 1MCNA 4UU9A 1KJ2H 5D6DC 4APQD 3I75B 4LCYB 1DBAH 3F12B 2PW2A 3FL7A 1HWGB 4TTGA 4YNYB 3CX5J 2L4OA 2ZOLB 4LSRL 2W0FA 2H1PH 4Y5YC 4MCYB 1XF2A 3WN5A 4K7PH 4HHAB 1PVHA 5LGKA 5ETUB 5CLTA 5IEHA 4JFPB 4M1GL 2F53B 5JMOC 5LWYH 1FFNA 4PJIB 1ULVA 3RWDA 3OKNA 3QEHB 5JXEA 1WFOA 1GC1H 4ORGA 3DJ9A 3QCUL 3SE4A 4OZIA 4OCWH 2DDQH 2F9BT 4HCRA 2H2SD 3GMNA 4J6RH 1R5VB 4ONFL 1ORQB 4F37F 1FDLH 3OMZA 4Y4KD 2Z92B 3QWOB 3QDMA 4PYHA 5C0BE 2OSLA 4PJ7E 4KXZI 1NC2D 1XFPA 5EC1A 3G6DH 2YD1A 3QXUA 3VXNB 4N5ED 3FO2B 4NRXA 4PP1D 3GMRB 1QLRB 4ELMF 2P45B 3HS0B 4PJCB 4MDIA 5BOPA 4NQDA 3HZVA 4HWNA 4KHTL 2Y5TA 4YHZL 1OP9A 4UOW0 3T0VA 1TCRB 4N0UE 4FABL 1QFWH 4CN6A 5AD0A 1U92A 4OLZH 3VFWA 2IBBA 1JRHI 3P4MA 3NPSC 4GXVL 4ENEC 3P9WB 3RIFK 5C8JA 2RR3A 5C0AA 1KB5A 2E6QA 3Q5TA 4GBXA 4L3CA 3PDOB 4NGHL 2AXGA 3C08L 4JZJC 4Z7UE 1T20B 4ZPVA 3L5WB 5FO7A 1QR1B 3I84A 4P5MB 1OAYL 3O6FC 4PLKD 3ARDC 3MNWA 1ED3A 3OJVC 1BQLL 3I6KA 1DL7H 3I3DA 4NHUB 2GSGB 5CUSL 4BH7A 4UOJA 1MVFA 1PYWA 1JZ6A 3PNWA 5FECA 4O51A 2R0WH 2G75B 3EFDH 3UPCA 1EMTL 5EU5B 3DROB 4IIQB 5GZOC 4GUPA 4JJ5B 1KLFA 3KDMA 4O9HH 3BZDA 2KDGA 5D2NE 1U41A 2GK0A 1YEDA 3G9AB 3V52L 1RK1A 2GQHA 3VMNA 3EGSB 5EUOB 4ETQB 1N6VA 1YPZB 4U1JA 1CIDA 1TCMA 4MAYB 1QRND 3U2SB 1P6FA 2WIIA 5JQ6H 4HWBL 4XNMB 4UIMA 1ZTXH 4U1SB 4MJ5B 3L6FB 1MHPH 1ZXQA 2IALA 5EBGA 4MXWL 4IDJH 2X4PA 1A6AA 2HFEA 4HWUA 4QOKD 5F1IB 3SJVD 3D2UD 1FV1A 1J1XL 5DK3A 2YPKA 3VWKB 1I9EA 1QSEB 1KFAH 4JE4B 5B3JE 1UM4H 4JY5H 5HHOB 1P4LA 2NY1B 4WHYH 2AK1H 4K9EL 3HUJF 1P1ZB 2AJSH 3BWAB 5J6HB 1F90L 2UWEF 3BO8B 4PS4H 1TVHA 2J8UB 4TPRL 5IB5B 1N64H 4JFQB 1PQZA 4RMSA 5C08E 3MR9A 3QUZD 2RIKA 3VMOA 2BVOA 3NCJH 5JO5B 1JL8A 3UP1A 1CE6B 2ATPB 1G7LB 4GKSB 2W92A 5CCKL 4KQ4H 4AEEA 1JHLL 4TVPD 3MRIA 1QVOB 4HJGB 4ZUSB 4P5TB 1ZE3C 3OG4B 3C5JA 4OD2A 5HHNA 1SM3H 3E6FB 1AGFA 1NLDL 3L5JA 5T3ZE 4LLQA 5TFSH 5EBMA 4M93B 4PRIA 1Y6NR 2K3TA 2EXYD 4NZTL 4KI5D 1YEGH 3BMWA 5DTFA 4P3DB 2BFVL 2DQUL 1MFEH 3FN0H 1E4JA 5J0BA 4OM0L 4JB9H 4LCCC 4HUUB 4OZFA 5L2KA 1OAKL 3B4NA 4MXVF 4OGXL 1FL6B 1DQTA 3EHBD 4N0YL 3GSNH 1F42A 1J18A 2OJEB 3OF6A 5K9KB 4BQBA 1A3RL 2KH2B 3TGXA 2UV3A 1VHPA 2YRLA 3LKOA 5HD8C 4ALAH 1EO7A 1DBJH 1MWAA 1X5XA 3R06B 3RAJL 3BP7A 3F58L 4XP4H 4ELME 4PP2B 4XP1L 4Y16C 5F9OL 3K8LA 2X1XR 3RHWF 3FZUD 4Y7MA 3T77B 4G6AD 1G0YR 5IVXA 1KB9K 5TDPA 3V5KA 1KTLA 4X4ZA 5ISZE 3EFFB 4U6VL 1X5LA 3UJJL 3KWWB 1QHOA 1NGPL 2VZUA 4F2MA 4EUPA 5E6ID 3HPJA 4IOFD 5GRXG 2JTDA 3U0PB 2BSTB 4FXLA 5CKAA 1XR9B 1KLUA 3VXTB 4QRRE 1G7MB 1CD8A 4HIXL 4X9FA 1FPTH 2JCCB 1RUKH 4DKEL 2CGRL 3D87B 4FMKA 2LQRA 3PHSA 1QBLH 2VZ3A 1JPTL 3BRFA 1SJEB 3MLWL 5IBUG 3ZTJH 4LOUC 5MHSD 3TT3H 2AGJH 4E5XB 3CDFA 4Z76B 4CADA 4W6WB 5C0JA 1E27B 1NFDA 2VIRB 3KPSA 2PO6D 5EZIH 2QADC 3O3DB 3MOAL 3F8UB 3CSGA 4JQXC 1I1YA 1MELA 1CFTA 2D0FA 4R8WL 5F1NA 3JV6A 4D0BA 3RTQD 1AGDB 3VGAB 2WQRA 4RFNC 4G8EA 2VLKB 4I3SH 2FSEB 5CZKA 1SY6L 4O5LH 2XZQL 3DIFB 3J8F7 2ESVD 5T5NF 1JI2A 3PQYD 5HYSA 3NZHH 1FORH 2D7TL 1EJ6A 3BH8A 5GS0D 3KPMB 2G5BB 4I4WA 3MXWL 4HKBB 4A2MA 4LSPH 3O6MH 2YC1B 2A6DA 4WO4A 2KL6A 1A6VH 1IKNA 1C7SA 3O6KH 1U8KB 1DBBH 2VR4A 2NY0D 2QL1A 3PV6A 1OP5H 3PGDA 1NUNB 5I2IA 2ENYA 3HE6C 5CJ8A 1OGAB 5DHVA 4UIKH 1IAIH 5F7MC 1PG7W 2R2EA 3WEXB 4FMFA 1D5XA 1I1FA 5EZOH 1CL7H 3RWHB 1AY1H 4Q0XH 4NBZB 5DRWA 5FUCC 1U3HC 4LSVH 1XGPB 4K3EH 2XZAL 4XMLH 4U6HB 5FUCE 1UJTA 1ZHLA 3D3VD 1S8DA 4RNRB 4WW2B 3I3BA 2OTUB 3KPRE 1ZHBA 3VXUE 2YPLB 3PWJA 1U42A 2IH1A 3U9UA 1J12A 3ARFA 1FZJA 1J0HA 2ED7A 4X0KB 1TVBB 1CXFA 4XMPL 3AROA 3BKYL 5I73C 4NQUA 2FWOB 1FCCA 3PWVB 1H5BC 1JRHL 5T3ZH 3GHBL 4GRLB 4KVCL 4UTAH 2P4AB 2YUWA 5J1SC 4FFYL 3VXSE 4OCYH 4OT1L 4P5KA 1FN4B 3NN8B 1MI5D 3QDJA 4MNHA 2C4FU 4WI5A 3OKMA 4L4VA 3BVNA 3LB6C 1CDIA 2CKNA 1BOGB 5HGBA 3QI9A 3LEXB 3RWCA 4YHKL 1SVZA 4J3TA 3T08A 4OCSH 5J11B 5JHLH 3HKFA 1CE1L 1P69B 5FM5M 3HR5A 2X4UA 4HPOH 1A9BB 2BJMH 3IJHB 5CJQH 1UCBL 3QIUD 3W39B 1WIOA 4RMVA 2OTPA 4RAVA 2CIKB 1YY8A 1NFIA 3GBMH 3ARBA 3O2WL 3BN9D 1IRAY 1UYWL 3ZKNC 4N8CH 4HDIA 1BVKB 4NO2B 2PETA 3PABA 4EOWL 1OW0C 4NKIH 1JUFA 4YO0A 1I1AD 1G9NL 5JZ7C 1MFNA 1DLFL 1S7RA 1F3DH 4HK0A 1IGYB 4IRZL 4K3HA 3BKMH 3SDXF 3BGMA 4U31A 4KJPC 1RK0B 3VFNB 3AFLA 4JQIH 1X44A 5LCVL 2B5IC 3STZB 1NGYA 2FLBT 3B9AA 3EZ8A 3BDXA 2VDPH 4KAQL 4NZJA 2DJSA 1TNMA 3MV8D 3TVMB 3MRGA 1I8LA 3U4AA 3QUKA 4OKVA 3HZYA 3VFMB 1U8JA 1L0XA 3SO3B 3DX9B 2DQHH 4XPHH 2C1OA 5HI4C 2PXYB 2ZOKB 3O3AB 3EDJA 3C60B 1Q9LA 5F1SA 4G7VL 4Y5VA 2NY7L 4FQIL 5CZVH 4I3RL 4NWUL 1U8PA 5DO2C 4H88H 5I71B 1D6EA 1JYNA 2CDEA 2FZ3A 3DMMC 4KRPD 4N0CD 4WTWA 2V6HA 3HI5L 4MVBD 4YXHL 4L8SC 3SCMB 3FFDA 43C9B 3QUXD 1F4YH 4TRPL 1T2XA 1KTDA 1YN7B 5E4EC 3W9EB 1N6QL 3MODH 4DKFL 1V5JA 3PUCA 3RIFF 4HS6A 5I66B 1KEGL 1KCRL 4LU5H 5SWZE 3DXAB 4B7LA 3OPZH 4G43A 3M1BB 4XPGH 2HJFB 4PRNB 2VN4A 4QRPD 3QEUB 1EIBA 1QBMH 4OV6F 3JZ7A 3WNOA 2CIIB 1C8PA 3FOLA 3PWPB 5MI0C 3KR3H 5FCSH 3WIHH 3BPNC 4ZAKC 1RIVL 1JBJA 3UTOA 3GUTB 5I0DA 5DQDH 1OQXA 1T66C 3CFCL 5D1QA 1CICA 1P7KA 1NQBA 4AL8H 3UC0L 4KK8C 3OR6A 5TH2A 3D0LA 3T0XA 1R0AH 2JJSA 2DQFA 1TZIA 2H6PB 5DEGB 1IL1B 1YJDH 3HE7C 5DJ0B 2P5WB 1EVTC 4JDZB 4EBQH 4NKMA 1JGVL 1WWCA 3QNYB 5E8NA 4BFBD 3GO1L 3QUMA 4Z7OE 2E7MA 2V7NA 4NOBA 1FZKA 1BVLA 3DX8A 2EH8H 3G6JA 1N5AB 1FNAA 1HQ4B 1TZHB 1AHWA 1YECH 1A5FL 2EC9U 3NVQA 2IQAA 4P4KB 2AV7A 5DJXB 5D7SL 4HPYH 4LCYA 4YHNB 3ELAT 4GQPH 2E7HA 5J1TC 3MV7A 4KROD 1IBGH 4S1DD 4GKOA 4OF0A 4NO3A 4XT1C 5D7IE 5ETUA 3KLHD 1M6OB 4JG1L 5CIPA 4BA8A 1T6WA 4JFPA 2F53A 4ONHB 4CVZA 1UEMA 3UO1H 2IMMA 5LXGL 3GMMB 2WWMD 4K9EC 4MCZA 1A7QH 2YRPA 2IG2L 3AGVA 3H9SD 1LDPH 4K3GA 1R5VA 2MJWA 2M8XA 5BS0B 5CBEB 5IQ7L 4ZMAT 1EHXA 1B0RB 3DWTA 5KN5A 2C4XA 1GAFH 1U0QA 5D70H 2R8SH 2JB6A 4QRUA 3SDXE 2YSSA 2C4FT 5D1XD 2IF7A 5EUKB 4TSAL 3FO2A 5FO9A 3GMRA 1QLRA 3BP5A 4PJCA 2ZKHL 4JG0H 3VGGA 1NBYB 1IE5A 4JFFD 4LRIC 4OD3H 3TYFB 2DKSA 5E5MA 5TE7H 1TCRA 2W60A 4G6FB 5DXWA 5F7YC 2BY3A 2NXZB 3N1MC 4I0PC 3G5YB 1M7XA 2AEQL 5IJVB 3B2UD 1FCGA 1DBMH 4MB5A 3W0WB 1WCBB 3JTSB 4OZ4A 2OJZL 3GBNH 3OJDB 5GJTH 5BW7A 1WK0A 2E7LA 2XKSA 2PW1A 2R0KH 5JW5B 5IFJA 2JK5B 3T2QA 4DGIL 4JM2B 5ELIA 4KUZL 1T20A 2PCPB 2P24B 3L5WA 4LSRH 4L4TE 1PX4A 3TH4T 4UUJB 3KYOA 4TULL 5C0CA 4P2RA 4XTRD 4WWKC 4KJWC 3RZCC 4M1GH 1A4JB 4Z7VB 5HPOA 2D4DA 4E42B 2F58L 1TETL 5AYUL 4OCRH 3QCUH 5CHNA 5ALCL 3DROA 3GKWL 3RL2B 4JJ5A 5KW9L 2LE9A 4ONFH 1ZLWK 1N3NA 1UWXH 2P8PB 2ADFL 2APVA 3KPLB 3WFCL 3EGSA 5EUOA 5INDB 1MNUL 3LV3B 4GG6B 3RY6A 4ZFOL 1RVFL 4MAYA 1T4KA 4PJXE 4U0QB 1CDCA 5MEOB 43CAA 4XNMA 3ESUF 1CU4H 3MLTA 5EC2A 4MJ5A 4PJ5D 2ID5A 4PB0L 3S6CA 5F1IA 4GXUN 4KHTH 4YHZH 3PWNB 1LE9B 4KK9D 2Q7YB 4I2XB 4FABH 4ZUWB 1FVCA 3QO0A 4NUJA 3MRHA 3RWEA 1Z5LB 2XFXB 4GXVH 4TQEL 1D5ZB 4APQC 2VUYA 1FG2B 3BWAA 5J6HA 3MUHL 1J8HB 2VAJA 2I26N 4U1KA 5IB5A 3B9KB 4NGHH 1YMHB 2VUOA 1LDSA 3C08H 4WRLA 1NC4B 4ZYKB 5F3BA 3KPQB 5FDWA 3MRPB 3UYOD 1ZVSA 1ZGLA 3H0TA 4F8QA 4F8TA 1OAYH 1ZHNA 5EZLB 2OQJB 5IB3B 1BQLH 1FNSL 4YBQC 5CUSH 1AR2A 2K1MA 1SMAA 4HJGA 4ZUSA 4P5TA 3F7QA 4NNYA 3QRFM 1EV2E 4XBGA 3TWCL 1EMTH 2UZYB 4ELKB 2D3VA 5D5ME 1NSNL 4Y4KC 4JKMA 3CDYA 4L9LB 1UVQB 3VXRD 3T0EB 5DJZB 4X80L 5I9QC 3V52H 4XBPA 2GITB 3TA3B 2F8VA 1ZWIB 3UTSB 1FVEA 1M05B 4JHAL 3PF2A 2YUZA 4LCWD 5LKNA 1QKZL 1NMCC 4HWBH 1Y6MR 1EK3A 4QXTB 3MX0A 3PHOA 4UT6L 4MXWH 1PG7H 2XTJD 5DD0L 1J1XH 3QDGE 4NYLA 2EC9T 1MY5A 2ZCLL 3ROOA 4NN6B 4HG4K 2HTLD 4PP2A 5HI5C 2RFXB 1RHFA 2AV1A 3KLAB 4K9EH 1X5GA 1GL4B 3LQZA 1UM6L 3T77A 3GFUA 3JUZA 3O8XB 3T4AB 3TO2A 2VISA 2CR3A 3NZ8A 4TPRH 2UY7A 4ISVB 5T1LA 2VDML 5E8PA 1MCPL 1U8NB 4U1LB 1D5MB 2OI9B 2AJUL 1CXEA 2LFGA 4YDLC 3BP4A 3JVGA 2IGFL 1JTPA 2DJ4A 1E4KC 2Q87A 1HNGA 4TUJA 3RVWD 3JWDC 5CCKH 3U0PA 4K7FB 2BSTA 2VNCA 1VCAA 1XR9A 3G5VA 1JHLH 3RVXC 2X2YA 3VXTA 2DM4A 5BVJA 4Z7WB 1OTSC 4U1MB 1NEZG 4Z18A 3IXAA 5DVMA 1NLDH 5FIEA 4ZNEA 1Q94A 5FK9A 5F96L 2OYPA 4NZTH 2W0KA 7FABL 4OD1L 5C0FB 1E27A 3WIFB 4H1LH 2BFVH 2DQUH 1XGYL 1OY3B 3ARFD 4XZUA 4YXLL 3FFCD 4OM0H 2N7AA 4OAWA 4OLEA 1OAKH 4OGXH 2IBZX 4LFHG 4E0RA 1JVKA 2AKRB 4N0YH 5D72L 1K4DB 3P40A 4MLIA 1CF8L 5AZEL 4PGEA 2D2OA 1A3RH 1CGSL 3WNMA 1EGJL 3ZLQC 5GRVL 3OAZH 4JFYB 3UBXI 1N59A 1UB5A 3SBWC 3RAJH 3F58H 1B6DA 3WS3B 4XP1H 1AP2B 4OLXH 4ZUTB 5KS9F 2HWZL 3KPMA 2VJXA 5EU4B 4MD5A 2HA1A 2YC1A 4IJ3C 5DUML 4Y1AE 3TN0C 1RZJL 2OP4L 3QUZC 1OVZA 1G9NC 4U6VH 3UJJH 1NGPH 3QQ3B 3VWJA 1PY9A 5HSFA 3ARWA 4Y2DD 3RY5A 5EOCL 3SPVB 4X5WB 3DVFA 3WEXA 5K9OA 3W11C 2HT4C 5FKAB 4EVNB 3VFOA 3RWHA 4HIXH 4K07A 1BAFL 2CGRH 3F7PC 5JIHA 3NAAL 1NUGA 5IEKB 1JPTH 2OXGA 5EO9B 3MLWH 5F8QC 3B6SA 4M6AA 5K33A 1F4XL 5GGVL 1ZK9A 5D7KD 4EEEA 3B5TA 4RNRA 1WBXB 2YD2A 2OTUA 5DA4A 3IRZA 3MLVL 3DUUB 1KGCE 3EHBC 3MOAH 4YHLL 3HNVL 3V7AE 4MGXA 1MAJA 4R8WH 4X0KA 5AUMA 3KHOA 1HQRB 4YDJB 1V8HA 4HQQL 2XZQH 5DVNA 2WBJC 2Y9RT 4ZXBB 2D7TH 5JW3L 4G6AC 3ROLB 1MQKL 5ID0A 1FQ9C 3MXWH 5ACZA 4HFWB 4JRXA 3LKNB 4F7PA 2NTFA 2V5YA 1KTRL 3E3QC 1S7UA 2PYFB 3PL6A 1ACYL 3ALXA 2J88L 1CFSB 1GOHA 4XI5C 3RGHA 1N2RB 2R39A 3CVHA 4D0DA 4OIAA 4LHUG 3QULB 1A2YB 35C8L 3PP3K 5GGRY 1P7QB 4GOSA 4N5UA 1L9MA 3QIBB 4I1NB 4OF5A 3QRGL 4BSVB 3SDCC 4YUEL 1A9BA 3IJHA 4M7ZC 1ND0A 2BDNL 2XZAH 1MHHB 3K80A 1OM3L 4KJYB 3ILQC 2DL2A 1KEML 2FCBA 4PLJC 1U93A 5F9WB 1S5IL 4RISL 4QNPF 3DV6B 3IFNL 3L9RA 3Q1SL 1BVKA 3MFFB 4NO2A 3H2WA 1JWMB 1T04B 4GG8A 4U6XB 3RUGB 5HYJD 1XIWB 4NFCA 1TPXB 4HUWA 2JIXB 4XMPH 3ZSSA 1IGJA 3BKYH 3VFNA 3LPWA 1W0YT 5GS0C 3QQ4A 3G6AA 5D1QD 4X4XA 5J12C 4MNQB 1TMCB 3MRRA 1JRHH 5KSAC 4IMKC 1X5FA 3GHBH 3QYCA 4I18B 1Q9KA 4KVCH 1UG9A 3TVMA 3HRZB 3ARYA 4QY8A 1BOYA 4FFYH 4Q6IA 5D7JD 1IC4L 3MBEC 4OT1H 4PJ8D 4J3WA 5JXAL 2VE6A 3DX9A 3VI4F 2DM2A 3BIKA 3TH2T 3OHXA 4HH9B 2W0LA 5KS9E 3UCRA 1ZA3B 4EI5D 3DOSA 4YHKH 4WI4A 3LN9A 3QEQB 4X6CF 4PJAB 3ZHKA 1T0NB 1CE1H 2NX5B 1KPVB 4Y5YB 1AJ7L 1EAJA 1T0MB 3TEUA 4HIJB 1UCBH 4IBLT 4K94L 1Z9LA 1ZMYA 3SCMA 3W9DB 43C9A 2D7MA 1T89C 1JTTA 1AGEA 1YN7A 5GS1A 3IFPB 3O2WH 1CQKA 1F6AA 2BCKB 1AQKL 1UYWH 5T5FL 1CGXA 3WDJA 4WUUB 4Q6YA 1E28B 1YQ2A 1GOFA 3DXAA 2EKSB 3MROB 5DDHB 4EOWH 4KMQA 1G9NH 1DLFH 1UZ8B 4IRZH 3P4NB 3V79C 1KULA 3QWQB 3HLAA 3TBTB 1AO7E 1DJSA 2APTA 1IAOB 2NR6C 1PX3A 4QTIL 4NQVB 5LCVH 1A7RL 2WW8A 3KS0J 1GRWA 5E2VL 4QT5B 2F5AL 4OUUA 2Z8VC 4KAQH 5DJ8B 4P57B 1DEEA 1SEQL 4UQ2B 2FO4A 1HKLL 3VFUB 3B2VL 2H6PA 5DEGA 5EA0L 3OXSB 3FB6A 3NPSB 3CXHK 4HC1A 3RWGA 2NY2C 4G7VH 2NY7H 4PRHE 1VENA 2EECA 4FQIH 3RI5K 3FQWB 4MQ7B 4OLYL 1NDGB 3FT4B 4I3RH 4XXDB 2VXVL 4JZJB 1N5AA 3T1FB 1TZHA 2EYRA 1INQA 3HI5H 3TM6A 4YHNA 4YXHH 3D6GA 4UINL 4P9HL 4CVUA 4P2RD 1NDMB 1N6QH 2WWKO 3SGJA 4DKFH 3VFTB 1EXUB 5ID1B 4O2CB 3G08A 3S5LB 1KEGH 3VXOB 5JHDE 4JDVB 1IAKB 1KCRH 3SY0A 3TCXA 3WLWC 4JREC 4DZ8B 4L3EE 4WI3A 4G8GD 3SKJL 5DK2B 5JOPE 2EDXA 1RZIA 4S2SB 2WINB 4K3DL 1PSKL 1RIVH 1UT9A 4EXKA 3CFCH 3UTTA 5KSBB 4LEXL 4AH2B 2WZPD 3VXME 3UC0H 2OR8A 4F7TB 4QTHB 3HC4L 4FTVA 1BF2A 1XEDA 1ZHKA 5IGXL 3BZ4B 2F8OA 1J8KA 4GKZA 2XXMB 4PB9L 1EFXA 1JGVH 3S88L 4PJ9D 3O4LB 3GO1H 3MRQA 3G5YA 4X4YA 2DTML 3MYZA 4P2OD 1WCBA 3JTSA 2AK4E 2R29L 1A5FH 2ED9A 2ZNWA 1QD0A 2NLJB 5D7SH 3MCKA 3WN5C 2JK5A 4FQHA 4JM2A 4YGVB 3IFOB 3N1FC 4R2GD 2A6IA 5HYQA 3CH1B 3S35X 2VABB 4M8VA 3GSOA 3CSPA 4H26B 4X6CE 5JXEC 4NN5C 4OZGB 3SE4C 2AS5M 1UWGL 1IC7L 1P5UA 4JG1H 1PKQB 4I48A 1A4JA 4D9QD 1BIIB 2IAMD 4PRAB 4OZIE 5T1MA 3FO1B 3CU7A 4E42A 5LXGH 1ZLUK 1FYTA 1JF6A 2IG2H 3NA9L 3ZDZF 1P53A 3ZSTA 3U48A 3QDME 5IQ7H 4JEGB 1T6VN 4GKNA 4V1DA 4OV5B 4WHCA 2VQ1A 3HB3D 4WI6A 5INDA 3VE0A 1MLBB 4X6DA 3LV3A 4GG6A 2W9LA 1XF1A 1OCWL 2YEZB 2D7NA 1G9EA 5MEOA 4TSAH 2IBZY 4NQDE 3C6LD 2ZKHH 1F3JB 1P9MA 5J1AB 2WSKA 1K2DA 1JPSL 5ISZB 3PWNA 1LE9A 3CDGB 4I2XA 1M1SA 1CGWA 5DRXA 4GBXC 2AEQH 4LK4A 3FRPG 4U0RC 1VEPA 1EEZA 3KJ6L 2XFXA 5C0AE 2OJZH 3EAKA 1FG2A 3A6CL 4G80B 1J8HA 4P46D 5DZOA 3KXFA 3QXAB 3RX5A 5AAMA 1OAUL 3B9KA 4QRRB 4DGIH 2HH0L 1XF3A 4I0KA 4KUZH 1L9NA 3IVKB 4UQ3B 5LGHL 3MRPA 4Y88A 1FLTX 2Z31A 4TULH 1BJMA 2L7UA 3BIBX 4PGJA 5EZLA 2OQJA 4MB4A 1HXMA 2QSTA 4WW1B 2X7LB 3D5OF 3OTTA 25C8L 2F58H 5FA3B 1TETH 2VDKL 5AYUH 1I3UA 2R1YA 2EDYA 5ALCH 4L9LA 2X4SA 1BWMA 1FNFA 3GKWH 1UVQA 5FHBL 2E6PA 5KW9H 1RZJC 1DBKL 2QADB 4RFEA 5DJZA 4OBRA 2ADFH 4KKCC 4FS0A 4A6YB 3MOQA 3TA3A 3WFCH 2GY5A 1MNUH 5F21B 3UTSA 3LHPL 5CD3A 2ZJSL 1WQVT 1RVFH 2G5RA 3CPLA 5EH1A 1D5IL 2MQCA 1BLNB 1MVUA 3D39D 2Z9TA 4NRZB 1RUPL 4PB0H 2BNRD 4U3XA 1KN4L 3CDCA 2XN9A 3G04B 3TJEL 3RPKA 4H8WL 2ZUUA 1J5OL 1T80A 2APBA 5CINL 4TQEH 6CGTA 3KLAA 3L3DB 1BJ1J 2J5LC 3HE6B 2WBKA 2XT1B 3O8XA 5C07A 3T4AA 1LP9A 3VWJD 5ADPL 2ED8A 4RAUB 1AKJB 4AQOA 4FFWC 4XTRC 4U1LA 5JORB 2NY3C 5EU6B 3ARZA 4C83B 3O45A 5FOJA 5IJKA 1U3HB 1FNSH 2PUQT 1YEHL 3EBAA 2XOTA 1MUJA 1QOKA 4LBEA 1K6QL 3OWEA 4GW1B 3BDBA 3TWCH 4PRIE 4LNRB 2GEEA 3UROR 1NSNH 3HG1D 5JPNA 4KHXL 2HG5B 4NO0D 4YLQT 1RHHB 2XKUA 3ARRA 4X80H 5GGTA 5C0FA 3WIFA 3ILPB 4JHAH 5L2KE 3SE9L 3T0DA 3KYMB 4GLRI 4BKLB 1QKZH 5I73B 2UUDK 4MB3A 5DJYB 4X7EC 2PYED 1S9XA 1Z0MA 4UT6H 3UTZA 5K59F 2I5YL 1UB6A 3FQXB 4KK9C 2MHAA 5DJCB 1BQSA 1H5BB 1S5HA 2AJXL 5DD0H 5DK0B 1G7QB 5GGQL 2YN5A 1C08A 3QIWD 4FQQB 5DFTA 5HHMB 2ZCLH 1FZOA 4XVTL 3WS3A 5E70A 1AP2A 2KBGA 4ZUTA 4D8PA 4JRXD 4DEPC 2X40A 3MO1A 2AJZB 2DD8L 3PL6D 1UM6H 5AYQA 5J7CC 2IMNA 1ITCA 4AM0B 2Z35B 1G9MC 3P3YA 3AC0A 1U8QB 2VDMH 1MCPH 4TNVK 5HVHB 5E1AB 2AJUH 3PXJA 4PJEA 2IGFH 4JKWA 4D9LL 1QQDB 4X5WA 4Y19B 3TCLA 1JV5A 2VDQL 5FKAA 1VFMA 2CKBB 1REIA 1IILE 2HT2D 1QZ1A 5IEKA 5IK3B 3FO0L 2VKWA 3K4DA 5EO9A 5FYLL 3DX7A 1NFDE 5F96H 2HVKB 3KPSE 1NCTA 2EE3A 2DYPA 7FABH 4W4NA 1G0XA 3TZVD 4OD1H 2XY1A 1GGYA 3UJIL 5TF1L 1J0KA 1XGYH 4YXLH 1EDQA 5JIPA 4PJGB 1LNUA 4OGAC 1JK8B 4YHPA 3HR6A 3JUYA 2XTJC 1GOGA 2FX8L 3V6ZB 5BO1L 2YPVL 5D72H 5AZEH 3MCG1 1CF8H 2B5IB 2OZ4L 3V0AC 4PPTA 5HBBA 4MHHG 5KTEL 1CGSH 1EGJH 5GGUB 3F5WA 2AJYL 3ZHDA 4WO4C 1IKNC 3ROLA 2HWZH 2CDGB 1DQJB 2M1KA 4XPFL 3OG6B 1R24A 1ES0B 3GIVB 4HFWA 1H0DB 3CFJB 4LAJH 1BD2B 2X6MA 5DUMH 5DMKB 1HSAA 1RZJH 2OP4H 2X42A 2GTWB 1N2RA 1RZKL 4WU7B 3RVWC 3QFJA 4HMDA 3ZL4L 5E94B 1UJ3A 3DMMB 5EOCH 2ZUSA 1FNHA 3V4PL 5C0GB 4L8SB 4L3ED 1P7QA 3C9NB 1WEJH 5E4EB 2I9TA 3QIBA 1NMAH 5IIEB 1IEBB 2Q1EA 4RMWA 5SWZB 4DK3A 4NN7C 1BAFH 2HFGL 3NAAH 3GSXB 5FKPB 4CBPA 1S7WB 2OLDA 1CD9B 4KJYA 5DYOA 2MQ3A 1F4XH 3ARFC 5GGVH 3M17A 1FL5B 2I07B 3BAEL 5JIKA 5SX4I 3MLVH 1U36A 1G6RB 3VXMD 4JKLA 2BNQB 3MFFA 5MI0B 2Q3ZA 5BOZG 3BRDA 2Y7QA 1KIQB 4YHLH 3BPNB 4ZAKB 1VERA 3HNVH 5ITFB 1F11B 1HOCB 2G2RA 4TNWK 1A22B 5I8OL 3ZKXC 4HK3J 4HQQH 1KUMA 2Q86B 4NQCB 3A6BL 2E27L 4MNQA 5JW3H 3N85L 4BUGA 3HE7B 4LCUB 1MQKH 1UENA 3WS6A 2OMBA 3OX8A 3G6JF 3QDJE 4G9FB 1K85A 3MC0A 4R6UA 2XY2A 3QI9C 1ACYH 4L4VE 3WJJA 1SBBA 2J88H 4LDOB 4PJFB 4HH9A 2CLVA 3H8NA 35C8H 1LEGA 5B8CA 2GT9B 2VLJA 4EN3B 2MMXA 4LARL 1CT8B 3DPBA 1QPPA 3ARBC 3QRGH 5D7IB 2NX5A 3WJLA 2H41A 1YC7A 4OFYD 3U6RB 4YUEH 2VLMD 4PJIF 4CNIB 2BDNH 2A6JB 4XAWL 3SKNB 3W9DA 3GSVA 2UYLB 1OM3H 5ABDE 4F7MA 1DVFA 3N50A 1HEZB 1O7VA 3IFPA 4AENB 1AD9B 1KEMH 1KOAA 5A16A 4NDMB 3T3ME 5JNYB 3NCYS 4HULB 1S5IH 4RISH 2EDTA 3HAEG 4CVWA 1CLCA 5T3XL 5HYEA 3BD3A 3IFNH 3VA2C 1NCNA 1ZGLP 3Q1SH 5IB4B 1A7OL 2GKIA 3EUUA 2VLRB 4H25B 1J10A 4Y4FB 1JGEA 1A6TA 1UZ8A 3L3IB 4PRDA 1J0IA 1B4RA 3FKUS 3I02B 1NFKA 1MCDA 4WFHE 3THMH 1IAOA 2GTZB 3DV4B 4MA7L 4DZBB 1I8LC 3HPLB 3LQAL 3NCEB 3UTTD 3K8MA 3PDDA 3HZMB 5DJ8A 2X1OA 4Y5VC 5BRZA 3TNMB 4FTVD 4M62L 3MJ8B 1IC4H 3BPLC 5DJAB 1D9KB 4I0PB 1MCWM 5IR1B 5JXAH 4UZGA 2ADGB 4I8DA 1G6VK 5L2JB 3KHQA 4NFDA 4KKLD 4U3HA 2IQ9L 4L4TB 1NDGA 3FT4A 1GXEA 4X9IA 4XXDA 1FFPB 3ULVD 4TYUA 3DURB 4U6YB 2EDJA 4P3WA 1XCTA 4KUCF 3MV9A 3WLBA 1AJ7H 3FT3A 3RKDC 4RGND 4F9PA 4IHOA 3X14B 4K94H 5E6ZA 4WWKB 5B22A 4W81A 2NXYC 1NDMA 3QQ9D 3RZCB 2E9IA 1J0JA 3VFTA 5EOQL 4DAGL 3TNNA 3NOIA 1AQKH 5ID1A 4O2CA 5T5FH 3EYFB 3H9HB 2VZSA 3EOBA 4JDVA 5EPMB 2ADIB 5CP3A 3RDTC 1YPZF 4DZ8A 5B38B 2HYMA 3BQUA 4YDVA 1H15B 1M7IA 4PJXB 4Y8DC 5DK2A 2ICES 5D1QC 1CICC 4V1DD 3FQUA 2P46B 4XVJL 4S2SA 2W91A 2WINA 4QTIH 2JJSC 5D7LE 1L0YA 1A7RH 5E2VH 1S9KC 2F5AH 5KSBA 3Q0HA 4FOMA 2MKLC 4AH2A 1BX2B 1Z9SA 2GJZB 4JFED 5MEPA 2A6KB 1SEQH 5HHPB 1UKSA 1HKLH 2FL5B 4F7TA 4L8CB 3B2VH 3RGVD 4NWTL 2IADB 2J8UF 32C2A 4XHQA 5EA0H 3NA4A 3BZ4A 5GHWL 4APQB 2XNAA 5CSZA 3DVGA 1AHWC 4WJ5B 1WBYB 3PP3H 2P47B 3O4LA 1FRGL 4FQLL 5IMLB 4OLYH 3G6JE 4LGRB 3CFIC 3KLDA 2VXVH 3CFDA 4LAQL 4TSBH 1RIHL 2EDQA 4CVXB 2FRGP 5C09D 2J6EA 1WWBX 1RJLB 1H3TA 2NLJA 3L7FB 3MV7E 4YGVA 3NMEA 3IFOA 4P9HH 4UINH 4Y4HD 2NW3A 1P4IL 4HUVB 2FEDC 2X4RA 2VABA 1BIHA 5D5MB 5IBLC 1ZT4A 4H20L 3NFPB 2Z4QB 4OZGA 5DT1L 3ZDYF 3W5MA 2F53E 4H8WC 4Y4KB 5DZLA 1KV3A 1BIIA 4PRAA 2E9WA 4CGTA 1NC2B 3FO1A 3SKJH 1TJGL 3UAJD 2FDBP 2D4FA 5DSCB 5DEFB 1NCAL 4LCIL 4MNGA 3RWJA 3HI1B 2ZUTA 4K3DH 1PSKH 1FC1A 2ZSVB 5FGSA 5C6TL 5CEXA 2C9AA 3S3PA 1Q9OA 4OV5A 5EZJA 5GGSY 2XZZA 2EKJA 4LEXH 3QXVA 4FQ2L 3VMPA 3GMOA 2ITCB 4ZS7L 4MJIA 4PJCE 3NACL 3LRSB 4OI9A 5FGCB 1NAMA 5HI3D 3HC4H 1F3JA 5F89B 2QKIA 3MLYL 2ADJB 5IGXH 4X6EB 4PB9H 2D03L 5BW7C 5FEBA 3S88H 5AEAA 2E7LC 3VFGL 4UNVA 5E9DD 2ICEA 3HRPA 1S7QB 4ZOCA 1S9WB 1JTOA 2DTMH 4DJMA 3AAZB 5C07D 1WFUA 2F19L 4L8BB 4ZQKA 2R29H 2DN7A 1CD1B 4YDLB 3BD5A 4AT6B 2JCCF 1MRFL 2XWTB 5I30L 1FNEB 1SBSL 4PRPD 4CL7A 4JZNA 3IDMA 4UQ3A 2EEDA 2DLHA 2FATL 5J4MA 1AI1L 1T7XA 3W5NA 3MGTB 4E41A 1UWGH 5T1KD 1IC7H 4ZO8A 1D5BB 2V2XB 2X7LA 1W72B 4ODXA 1QRNB 1PDKA 3LEYL 3D0VA 1ZT7A 3NA9H 1AXTL 3K74B 4R9HA 5IMKA 3RY6C 4MAYC 3VA6A 1AGBB 3B3IB 3MYJB 5EUOE 8CGTA 5CGYD 1YPZE 4JY4B 5E5RB 2J8OA 1KJMB 4K71C 3EYUL 3R4DA 4WUKL 1OCWH 3GRWL 4WDIB 3TPKA 5DUPL 2VB5A 2D7QA 5GS2H 1KJ3L 4XNXL 5F8RC 4NRZA 3DO7B 3GMQA 2NY1C 1JPSH 1GZPB 3P0VL 4Y1AB 4ZS6D 1QSEE 3G04A 1FIGL 5HHOE 1W8OA 4K8RC 4Z5RB 3TN0B 4DKDC 3QUZB 3KJ6H 1WCQA 1NGQL 4F7CB 2E9BA 3FQTB 4UT9L 4OGZA 4MXQC 4HKJB 1FO0L 2P5EA 3A6CH 3ZE2F 2BRRL 3O9WA 5GGRB 4H0IA 4RA3A 1CXLA 1ZKAA 3AREA 1PAMA 4B7IA 1OAUH 3QISA 5KAQG 2HH0H 2HN7B 4KDVA 3VJ6B 4HJ0C 4I13B 5LGHH 4WFGD 1BQHG 1TTGA 5EU6A 5D4QA 3BFOA 4P5TC 4C83A 2MPAL 1MJ7L 4PGZA 1TNNA 4WW2F 1H3GA 1FLRL 3BHBB 4BSWB 25C8H 4NZRL 2VDKH 4EJ1C 3SKOB 2HLFC 5DMIL 4M9PA 3FRPA 4LNRA 4ZG1A 1F45A 5IVZA 1Q1JL 2GJ6A 5FHBH 1NANI 1GH7A 3S4SG 1DBKH 1YYLL 5H94A 5TQ0L 1RHHA 4LPWA 3WSQL 2NW2B 4RIRA 3WUWB 1E6OL 2IAND 1WWWX 1I9RL 3LHPH 2ZJSH 5CZXD 4WU5B 3CCHB 2A83A 3QPXL 1NL0L 1U95B 2ZCKL 1GSMA 5EBWA 1D5IH 4WHYG 4QYOA 4L4JA 3LRGA 3MRLB 2W9DL 5LG1A 4BQCA 1RUPH 2BOBA 4OZHA 2W59A 1KN4H 3CUPA 4MDJB 4AEHL 4PJBB 1UACL 3ULUC 3IJSB 3TJEH 1IM3B 5LGJB 2H45A 4LIQL 4JFDD 1QSVA 1HI6B 1J5OH 5DURD 4GMSL 5E6IB 5CINH 2AEPL 2OL3A 3ME0A 1Y6KR 3PGCB 4F15C 2AJZA 3DI2B 3TO4D 3JVGC 3VRJA 3GJEB 4X8JA 5LAXB 3IU3B 4AM0A 5B39B 5ADPH 4NSKA 1NCDH 3DX6A 4IEFB 5AZ2L 4LFHD 2X4OB 2BNUA 1L7IL 4YHIB 2AABL 4Y19A 2GYSA 2YUVA 4M7ZB 3KPOA 1YEHH 2JCCE 4CJ1A 3UDWA 4XCYB 1K6QH 3IT8D 4JPIA 2VXSL 3QHTC 4C56A 2XIDA 4POZC 3L3OA 3SDAA 8FABB 4KHXH 4R3SA 2QQQA 3N1QC 3EYVB 4GAJL 3V4VL 2QSVA 4I5BB 4ZTOL 2ESVB 1BHGA 3PQYB 3SE9H 5JPMB 2BVEA 3TFKD 4PJGA 1K8DA 1NUDA 3D85D 4QRTA 2QHRL 5MEQB 3L7EB 1RPQA 2I5YH 3V6ZA 3RVUD 1Y18B 5J12B 1TVDA 2AJXH 5KSAB 2EDFA 5GGQH 3V0WL 5D6CB 2CSPA 4LEOB 3K3QA 2NY0B 4AIZB 2WUCL 4LF3A 4XVTH 1DQQB 1YEEL 3MBEB 4LSSL 1IT9L 3VWJC 1T3FA 2CDGA 1WAAF 4YHML 2C3VB 2DD8H 1ES0A 1RZ7L 4Z6AT 3CFJA 1J88A 2R0ZL 1BD2A 4J1UA 2GTWA 1I7UA 5T3XE 4HIIB 1OGAE 4F3FB 3NFSL 4WU7A 2H2PD 2VLJD 5A40E 2AJ3B 2XWBA 5E94A 2FJFB 4D9LH 3ZE2E 5J06A 2FYYA 2Z91B 4QHNA 5C0GA 2Y07L 5IMMB 3VFSB 3D3VB 4QRSB 1HCVA 2VDQH 4PFEA 2FGWL 3MJ7B 5IIEA 3IAQA 1CBVL 3EOTL 1T2QL 3FO0H 1S7WA 1I1RA 2J7LA 3C6SA 4NCC2 5FYLH 3IF1B 4M6ML 3PG2A 2VL5A 1FAKT 5F3HB 1LO4L 1AO7B 1GZQB 3CLFL 2YPLE 3UJIH 1DE4A 4NP4L 5TF1H 2PTTB 5FV1L 1XAUA 1JNNL 3QO1B 4LHUD 4MQTB 1KIQA 1VPOL 5EOTA 3V0VA 1JN6A 2FX8H 1MCRA 1YYML 5BO1H 2YPVH 4JHBA 4W6YB 2OZ4H 3M07A 5KTEH 1ADQA 1MI5B 2Q86A 2AJYH 3V5DB 1DQML 4NQCA 1IGIL 2CLRB 2YBRA 4NC2B 3PL6C 3S98A 1I4FB 3BGAA 1KCKA 4XPFH 5C0EA 2NY2B 5DQ9A 4OCLC 4G9FA 3SE3A 1WGOA 4PR5B 3KJ4B 4V2CB 3MACL 1AH1A 4PJFA 4XBEL 5J11C 1RZKH 4WENB 4EZMA 1QNZL 3ZL4H 3WKNA 3V4PH 4NQSA 1OTUD 2GT9A 3L3KA 1CLYL 4EN3A 4JGUA 4Z77B 5DJ6B 3EO0B 2ZUWA 2HFGH 4PJDB 4AG4L 4CNIA 1I1AB 3GSRB 2LU4A 4NRYB 3ARTA 5DJDB 3MPCA 2X89A 2HFFB 4NT6B 1R3LA 4TTDC 4MD4A 1ACZA 5C6WH 3BAEH 1NUFA 2UUDH 1U91A 1IQDB 2R9HD 5EU7C 3OGCB 4H25A 2XXCB 4Y4FA 2P8LB 4HX1B 5J3HC 3MV8B 3DGGA 2BSSA 5I8OH 4KK5D 3HI6L 3LPFA 3TVMC 3DV4A 2DIBA 4Q6IC 4BH8A 5MENA 4XWGL 3A6BH 2E27H 3KYNB 3N85H 5FXCH 4O4YL 5SWSA 2B4CC 4MJ6B 3V8OA 3MJ8A 2R69L 3WFBL 4IRSA 4AJ0A 3LN4A 2ARWA 5IR1A 3P9MB 2PW2B 4HEPG 4KRPB 5L2JA 4ZO6A 5TPWL 2W0FB 1WAAE 4OSUL 1FZMA 3K2UL 4KUCD 3QUXB 1CK0L 3WN5B 1VACB 3LH2H 1K3IA 2CUMA 1FFPA 3SCMC 1DP0A 4U6YA 3DURA 4ZOBA 4LARH 5I18L 5IEHB 5GS1C 1YMMD 1ZSDA 5TQ2L 2X70A 3OKNB 4Z7VF 4XP5L 2X1WL 4ORGB 4KRNA 3X14A 1IM9A 4XAWH 4IM8A 2HAZA 3GMNB 5KZCD 5EN2B 5FYJL 3X11A 1PKOA 1ZAGA 3DXAE 3QDMB 5T3XH 2OSLB 3LDBC 5EPMA 3K1KC 5EC1B 1ZVHA 3EYSL 1A7OH 2A2QT 5TJWK 3S37L 2MKWA 4K2UL 4GG6F 2EZ0C 3O2DL 1H15A 3VRIA 4HS8L 4MDIB 1OAZL 3HZVB 2H32A 3GM8A 2Y5TB 4MA7H 3LQAH 4HBCL 5HHOD 1J05B 5DS8A 1XCQA 5AD0B 5FYLD 4MJID 1V3LA 5IMOA 4NC1E 3BZFB 3P4MB 1BX2A 2GJZA 3IKCA 5C2UB 4OLUL 3IJYB 5HHPA 4M62H 4GAGL 1EUUA 5C0AB 2P5WE 2X41A 3HAEA 2IADA 2YD5A 5I15L 2AXGB 2XQYG 4ZPVB 4Z7QF 1JPFB 4KZEL 4QHKJ 1YC8A 2IQ9H 5IMLA 3U46A 4KROB 3ARQA 1ED3B 4Y89A 3T0WA 3I6KB 2EDRA 3C8KA 3K81A 5KG9B 2VWEE 4CVXA 4XC3L 5FHAL 3SGJC 1PYWB 5FECB 3WL9A 4O51B 1A8JH 1CXIA 5SX5K 4XX1E 1TJHL 1XH3A 1BFVL 2QEJA 4UBDC 1U8OB 2E9JA 3MQIA 3KDMB 4HUVA 2BSRB 3PXHA 3SQBA 2DOCA 4UDUA 5EOQH 1P7HL 3H9SB 2GK0B 1YEDB 2O5YL 4DAGH 1JMXA 1F3DJ 1MHEB 3RNKA 1RK1B 1JWUA 1WIPA 4U1JB 5E03A 4GLRH 4AEFA 5E2UL 3D9AL 3WFHB 1QFOA 2WIIB 1CFNA 1NC2A 2VLLA 4UIMB 4HJJL 3FT2B 2LV4A 2IALB 3CFBA 3I85A 2BHYA 4KKAC 5BS0E 5GJSL 2X4PB 1A6AB 2HFEB 4XVJH 3HI1A 4J8RB 2DIJA 1FV1B 4U7KA 2ZSVA 4JFFB 2WLZA 2LAGB 4YZFF 4ODUB 2DS4A 5FYKL 4ZO9A 1P4LB 1WLHA 2ITCA 5D9SA 4GMTL 3EYQD 3S97C 3CSYA 2BXZA 5F89A 4NWTH 1I8IA 1PQZB 3D25A 4X6EA 5GHWH 3MR9B 1CD0A 5GRJL 3FHQA 3ULVC 3NABL 1FRGH 4FQLH 1NMBL 1S7QA 4JM2C 3QWRD 3HTLX 4H5SB 4LAQH 1RIHH 4YJZL 5FAAA 3VRLE 3ARED 2I27N 4L8BA 4RMTA 4QO1A 4FA8A 1CD1A 3QQ9C 1KN2L 4Z7WF 3C5JB 1NPUA 5HHNB 2XWTA 3SGKA 5F7UA 4LLQB 4M7KL 5EBMB 4F9LA 1P4IH 3DETD 4NZUL 1A0QL 4L3AA 4H20H 1R3HB 4LPXA 5DT1H 3I9GL 3QXTA 1CGTA 5DTFB 3MGTA 1P2CA 4QWWC 1Z2KA 4YBLC 5E24E 3TBYA 1FYTE 1W72A 5L2KB 1ZT1B 2YA1A 2VLKD 3VH8G 5IFHL 3HFML 2GJ6D 1TJGH 5DMGD 4XWOC 1UADC 4DTGL 1NCAH 3HNSL 4LCIH 5GRYA 4PJ5B 5C6TH 3MYJA 5D93C 4ZPTB 4QOKA 1WBZA 2XWJA 4X6DE 1QSFD 3D2UA 3SJVA 4JY4A 3TJHD 3WFDL 5JLZA 4GG6E 1MWAB 3SGDI 5E2WL 1KJMA 3BP7B 3HUJB 3MLPA 5HVWA 1P9MC 1OSPL 1XR8A 4RGMB 1GPOL 1YUHA 2L7JA 2UWEB 4FQ2H 4LQ1A 4IS6A 2NQCA 4ZS7H 1XMWA 5IVXB 5TDPB 4Q74A 1KTLB 1U3YA 5T3XD 3K0WA 5C7XH 1OGAD 2VERN 4I2XE 2DQJL 1MFAL 4DUWA 2D03H 4DEPB 2R15A 4EUPB 3HPJB 5KVDL 3VFGH 2MQ0A 4PLNC 3T4YA 3GM0A 3B9KC 4U1NB 3FQTA 1J8HE 5T5NG 4DW2L 3KXFE 4P2QD 1KLUB 4ZDHA 2Z31C 4FQCL 5F1KC 4Z7QE 5C9JB 5I1DA 1CTNA 2CRZA 5E95B 5I30H 1MRFH 1S9YB 1A4KA 4JJHA 1SBSH 4HGWA 2OTWB 5CD5C 5H8DA 5HGHA 1P84K 2FATH 5C3LD 3I3EA 2HMID 2YPLD 1ZOXA 1AI1H 5C0JB 1NFDB 3KPSB 2NY6D 3ZE1E 5CSGA 2YOCA 3DSFL 5SX4H 12E8L 4L9LC 1KJ2A 4PGCB 1CTOA 4BSWA 4C56D 3V4UL 3SKOA 3LEYH 4DFHA 5JDSB 3TA3C 4CW1A 2ICWJ 5ICZA 5F1NB 1AXTH 2Y4SA 3JV6B 5IOPA 1A6WL 1JCKA 4G8EB 5I19L 3KLSA 4M8QB 2Y06L 3UTSE 2XTJB 4XVUD 4GRLD 4Y0GA 3U1SL 3EYUH 3EO9L 4WUKH 5IP4A 1C7TA 4JRYD 1IC5L 2IPKA 5HI3C 3GRWH 2APFA 3PE9A 4I4WB 5DUPH 3EO1B 1OGTA 1KJ3H 5I1LA 4Q9RL 4XNXH 2A6DB 2NYYD 2XN9E 1JE6A 3TBVB 3P0VH 3PV6B 3LKRA 3CIQA 1AIFA 4MDJA 3PGDB 1T5XA 5I2IB 1FIGH 1J87A 4LHJB 3O8XC 3UTPE 1RSFA 4KZDL 5DHVB 1HI6A 2R2EB 3AY4A 5E6IA 1NGQH 1KG0A 4UT9H 1D5XB 3SDDA 1LP9E 2HP4A 1FO0H 2A9ML 2BRRH 1P6AB 2YD3A 3GJEA 3MZGB 5IROA 5DRWB 5IJKC 4LVEA 3O41A 2ZUVA 2FECI 3L5HA 3OB0K 1UQSA 2QQKL 2MPAH 2CQVA 4NN7B 1ZHLB 1MJ7H 4YHIA 1BVZA 3FCTB 2Q8BL 5B3NA 1FLRH 3PWJB 5IB2B 1UEYA 2PO6A 2IH1B 4FZEH 4NZRH 3ARFB 4XCYA 3RRQA 3U9UB 1FZJB 3FFCB 5DMIH 2X44D 1VGKA 5F7DA 3EIFA 5JUEL 1Q1JH 2AEWA 3RUGF 4JKKA 3ZTNL 4AIOA 1T7YA 1YYLH 1JZ2A 1A6UL 5TQ0H 3WSQH 4KVNL 3RTQA 2F54D 1KNOB 1LD9A 1E6OH 3L1OL 1I9RH 2ESVA 2P7TA 5JPMA 3QPXH 2ZCKH 1BQHA 4EI6B 2E5EA 2XTLA 1I8MA 2GCYB 5J57B 1B3JA 3L7EA 2PXYD 4M9OA 2W9DH 4MHHI 3RVVC 1L0QA 1Y18A 3K4ZA 4RX4D 4HV8A 3OKMB 3VFPA 4AEHH 1UACH 3BVNB 4LIQH 2LAAA 3RWCB 4GMSH 2AEPH 1MAKA 4LLYA 4Y2DB 4A6YL 3S4SA 2VDNL 5CSBA 1JZ5A 4EXPX 1RU9L 3CLEL 4PJAF 3HR5B 2X4UB 4Q9CA 4KJQD 2VAAA 5E7FA 4ONGL 3WXWL 5AZ2H 3DYPA 3MRBA 3K7UA 2EE6A 3DGCR 3NCYP 2IPUG 1YY8B 1NFIB 4PG2A 1Q0XL 1LEKA 1U6AH 4UV7L 5DMYA 3QUYD 1ZLVK 5H2BA 3QNZA 2FJFA 1L7IH 2AABH 5D2LA 3WDIA 4NM4L 2Z91A 4P99A 1I9IL 4HDIB 3VFSA 3D3VA 5ADOL 3IAPA 3PABB 3UPRA 1I3RB 2NTSP 1HK6A 3PWPD 1JUFB 4YO0B 5TGBB 1S7RB 2VXSH 4PJ7F 4HK0B 5A2KH 1A1NA 2JJVA 4KK6C 3BGMB 4RCAA 5FF6A 3BISA 1INEL 3AB0B 5F3HA 4GAJH 3OL2A 5L8JB 3PV7A 3V4VH 5EIIA 4ZTOH 3T0AA 2JJTA 1NGYB 5I1HL 2YD7A 1X6NA 3FONA 4IMLA 3EDEA 3EJZC 1HDMA 4BFEA 2P5WD 2QHRH 3NTCL 3VFVA 3HZYB 4FG6C 4U1IA 5DVOA 5EDXA 4JPKL 2C1OB 3V0WH 1MI5A 4UV4L 3V5DA 4IOIA 2WUCH 3EKCA 1BJ8A 4X7DC 4GH7B 1YEEH 3BPLB 4LSSH 1IT9H 4N8VB 3NPZB 1A64A 1I4FA 4P4KD 3KNBA 4FNLL 4YHMH 5H35B 3GSNA 1E6JL 2VKXA 3RJQB 4PTTB 5FYJE 1D6EB 1X5KA 4U4BA 3H7LA 1UJ3C 2R0ZH 3QFJE 1LO0L 3FFDB 5I8CB 3NFSH 5I1GL 1TZGL 1KTDB 3C8DA 3QIBC 3QIUA 1K3ZA 1MFBL 3MJ6A 4HS6B 4U49A 2Y07H 2P44B 5C0BA 1NEUA 4FQXD 4G43B 4LSTL 2FGWH 2NXYB 1T1WA 1YEFL 2LU3A 1CBVH 1A14L 3EOTH 4PJDA 3OKDA 2A9NL 1T2QH 3Q2CA 1I1AA 3FOLB 5C70A 4M6MH 1M71B 5HYJB 2HFFA 1LO4H 4J4PD 1RZFL 4NC0B 3CLFH 5E08L 4NP4H 4KKNA 1JNNH 5D1QB 2AAVA 1WIUA 1P7KB 3RVUC 3GDBA 3W2DL 5KSBF 3GB7B 3V5HB 3A67L 3OGCA 1VPOH 5GGSB 1ONQB 3CK0L 3D0LB 5TH2B 5HDBE 1TZIB 1YYMH 4FXKB 3MV8A 4HX1A 1KJVA 2NXZD 2CKBL 3WS6C 4H1LB 4NKMB 3CFEA 1VKXB 4PJ8B 1B90A 4MNQE 3W0WD 3I6GB 4WVRA 1DQMH 1IGIH 4JN2A 3QUMB 5BV7C 1JFQL 5EB9A 3KYNA 3WJJC 2NY4C 2V7NB 3DX8B 1FZKB 1BVLB 1CCZA 3SOBL 1M4KA 1TJIL 2DM3A 4R96A 4MJ6A 3MGAA 4MMZC 1VFOA 1KSRA 2VOTA 1AHWB 1T83C 3CNKA 2IQAB 2AV7B 1FYHB 2C3GA 5B8CC 5HDLA 2HT3C 3P9MA 4FHBD 3MXVL 4XBEH 4NJAL 2VC2L 3R0NA 3MV7B 2OBGA 3WJLC 1QNZH 5J9PA 5FUOL 4MQXD 3EW3B 3QUXA 5D2NA 3WFEL 1VACA 3QEQE 4PJAE 4NO3B 1CLYH 3Q48A 4OZGF 2NX5E 3OKKA 4JFXA 1DVFC 5CIPB 4HFUL 1V3MA 4CVZB 3IETA 3IDUA 1N8ZA 4AG4H 4MCZB 4JVWA 4QRPA 5FYKE 5FOBB 3IDYB 5EN2A 4R26L 1I9JH 4WUUE 5KN5B 3M8OL 4JANB 2JB6B 4QRUB 2YSSB 2VZVA 1XZ0B 3IRPX 1CN4A 4U7MA 5FO9B 4XB7A 4MJ2A 1PLGL 3BP5B 4BJLA 2DI9A 3BEVA 3HI6H 2RAMA 4M5YL 1AGCA 5E5MB 2W60B 4N90E 2D31A 5C08A 3FAWA 4XWGH 1J05A 3AS2A 3QCVL 4WY7L 4WI9A 2OR9L 4O4YH 4XNQA 1YN6A 5BRZE 3BZFA 2XPGB 2VDOL 3SGEI 1LVEA 15C8L 4OZ4B 4F80A 1EH9A 3IJYA 3QJHB 2R69H 3WFBH 1G6RL 2PW1B 2V9RA 5IFJB 4PY8J 4LVNC 1TQBC 2E7BA 3MTRA 4X9GA 3C5ZA 5TPWH 4XCEB 4LVOB 2KPNA 5F9JB 1JPFA 4OSUH 3K2UH 4HUXA 5AAWA 3KYOB 1ADQL 1CK0H 1WICA 4P2RB 5C0CB 4F9PC 5F7EL 1J0ZA 1YQVL 5KG9A 5I18H 1R3JA 5TQ2H 5ICXA 4LSQL 4M7LT 3LCYA 1EEUA 3T0ED 4XP5H 1FL3A 4HXBL 5CHNB 3RX8A 4G8GB 1U8OA 3CGTA 4GW4B 4QKXB 2BSRA 3BQUC 5FYJH 1N3NB 3H9SA 1MHEA 1OD9A 1HH6B 3LD8C 3EYSH 4QHMA 4NQED 4YPJA 4ELMA 1T4KB 1OP3K 3S37H 4K2UH 3WFHA 5IM7A 4XHJD 3O2DH 1Z3GL 43CAB 2B1AL 4LLWB 3MLTB 5EC2B 3FT2A 5D1XA 4HS8H 5E4IA 4K71B 1OAZH 2DQDL 4R97C 2M2DA 1U8LA 4J8RA 4XAKE 1L6XA 1SYVA 4HBCH 1ITBB 4JFFA 4FFVD 4H0HB 5KSBE 3ZT6A 1FVCB 3QO0B 4NUJB 5CKGA 3V7AG 3MRHB 3RWEB 2G60L 4ODUA 3PP4L 5GZND 4JFZL 4OLUH 1OAQL 4JKPL 3EJYC 4U1KB 2R23A 4YC2C 5DFVD 4POYA 1HYRC 4Z9KB 5I15H 4PLOB 3H3PL 5F3BB 5FDWB 4HKZA 3O4LE 4X7CC 3DRQB 1WF5A 1ZVSB 1ZGLB 4KZEH 2YKLL 3H0TB 4R2GB 3WNNA 1ZHNB 1JGDA 1K4CA 1DSFL 5FO8A 4H5SA 4HIHA 4D9RD 4XC3H 5FHAH 1Y0LA 2QTEA 5IKCA 1T1XB 4NNYB 1TJHH 4RDQF 4XBGB 1BFVH 2AJVL 1X5ZA 5SV4A 4OZGE 2O5YH 1R3HA 4XBPB 4Z78B 5IHZB 1PKQE 1I7TA 1F8TL 5IW1A 1FVEB 5E56A 4S1SH 2VITA 5E2UH 2H3NB 3D9AH 4KKBD 4JPWL 4ETYA 1XGUA 1ZT1A 2W1NA 3LSOA 3PHOB 4HJJH 1BFOA 1EVUA 5GJSH 3DUHA 5HGDA 3WNLA 2OCFD 5T1DL 2XA8L 2XG5A 4PJ5A 4NYLB 2JELL 4ZPTA 1NLBL 4Q2ZA 4HEME 4PREA 5B4MD 1HIML 2YZ1A 3ROOB 3UEZA 3HUJA 2GAZA 5FYKH 2UWEA 2WANA 2AV1B 4P23A 3LQZB 4KRMB 3WIHA 4GMTH 3TO2B 2VISB 3NZ8B 4RBPK 5T1LB 4P46B 5E8PB 1DTUA 5GRJH 1VSCA 1YA5A 4F15B 3NABH 3BP4B 5A3ID 1IGTA 3SDDD 1NMBH 2DKMA 4U1NA 4TUJB 3T3PE 2D7PA 3KPRA 4WHDA 5E8OA 3G5VB 1BREA 3T2OA 1FHGA 3Q6FA 5BVJB 4BZ1L 1A7NL 5C9JA 1C5DA 1KN2H 3IXAB 1S9YA 5FUZL 2NCMA 1LO5B 4M7KH 4Q97A 2OTWA 1Q94B 5FK9B 4E41E 4J23A 3VXRA 4XP9L 3I9GH 5DR5L 4XZUB 3BWUC 4PGCA 2AQ2A 4OAWB 3HN3A 3N06B 5F7FA 4PJGF 3Q3GA 5IFHH 2EICA 3HFMH 4E0RB 5JDSA 4LCWA 2NZ9C 4PGEB 3VXSA 5CJXA 1CDUA 4DTGH 5JMRA 1FG9C 4QRQA 3HNSH 3HA0A 1DQDL 1DN0A 3S36L 3QT2A 3DSNA 2BNRB 2HTKC 4HK3N 4M8QA 1AXIB 3CFKA 3WFDH 1N59B 1UB5B 5E2WH 1OSPH 1GPOH 2A73A 4P9ML 4MD5B 2RBLA 3EO1A 4NQXA 2ATKA 5CP3H 2YN3A 5D1ZD 5I16A 3U7AA 1ERNA 3TBVA 1MFAH 1T7ZA 3VWJB 3IGAA 2ICWA 2E8ZA 1FFOB 3O9WC 1I7ZA 5KVDH 2JJUA 3AREC 4OKDA 3U7YL 2P5EE 1N26A 2AERT 4DW2H 5K9OB 3QHZL 5EORL 2A0LD 3INUL 5SX5H 4S1QL 1JHKH 3VFOB 4FQCH 1TLKA 3BUYA 5E99L 1QSZA 3HMXL 4HGKC 1E4WL 5EU6E 4F7EB 5C71A 3IDJA 3O4OB 1DLHA 3RBSA 2V7HB 5DRZA 3B6SB 4M1CD 1UXWB 1HYSC 3FCTA 3DSFH 12E8H 2XRAL 5FM5O 5IB2A 1B9ZA 1JYXA 2CMRL 2JIXD 3V4UH 3MLRL 1JZ8A 3FFCA 5C9KA 5F1OB 1V3KA 5IW6A 1A6WH 1JJUA 2PYEB 4UTBL 5AUMB 5I19H 4NQTA 1TTUA 3QPQD 2Y06H 5JOFA 2E6JA 1KNOA 3JWDL 3BH9A 2GFBB 3JWOC 3IS1X 3U1SH 3EO9H 1F13A 5I17A 3QIWB 1IC5H 5ID0B 5IBUB 1C16B 2AVGA 4EI6A 4JHWL 5ACZB 4Z7OF 2GCYA 4JRXB 4LLMA 4F7PB 2NTFB 4Q9RH 1S7UB 3PL6B 1W72L 3G9VA 3N1GC 1QA9A 5HHME 2I25N 3VDAA 4XPTL 3VXPB 3CVHB 3X12A 4D0DB 3L5XL 3U36B 4LVHB 4KZDH 1LK3L 4Y2DA 3IDIA 2A9MH 3S36X 5HVHC 1IZKA 3K46A 3FOMA 2DWEA 5D7IF 1SJVA 1AR1C 4YFLF 2HVJA 1XF4A 1ND0B 2FBOJ 4JM4L 4DN4L 2NY6C 3AXLA 3RP1A 4WUUD 4Y19E 3UDWC 3MMEA 2QQKH 5FCUL 1U93B 5C0BD 1OT2A 2Q8BH 5DHYB 1JHTA 3L9RB 3TZVB 2R56L 3SDAC 1IGCL 1I3RA 4GG8B 4R4NC 1NBZA 5TGBA 2Q3AA 3WYRA 5JUEH 4LASL 3KPPA 3OR7A 4Y5XB 4HUWB 1IGJB 3C09C 3ZTNH 3TESA 1A6UH 4KVNH 3FQNA 3G6AB 3QQ4B 4X4XB 4PJGE 3L1OH 4AQ1B 3MRRB 1QO3A 4JZOA 4O00A 2VRAA 3SO5A 1Q9KB 1N0LA 4QY8B 3DARA 2GI7A 4Q6IB 4KV5E 4ENED 2C1PA 3O11A 2VE6B 3GSWA 3BIKB 3I6LE 3OHXB 4WEUD 2YA0A 3ULSB 1IAII 5CEZE 1BPVA 4HWBA 1ZS8A 2EDNA 4N8VA 3VG9B 1U3JA 4A6YH 1BEYL 3O6FD 5H35A 1BD2E 3ARDD 4QHLA 4PTTA 1BQUA 2VDNH 3L3HA 4P4RB 5DZNA 3RU8L 1RU9H 3CLEH 1T03H 1T1YA 4XRCA 4ONGH 3WXWH 4BYHA 4O2FB 3UZVB 3TIEB 5I8CA 2P43B 1AGEB 5C0RL 1OAXL 1Q0XH 5GS1B 4UV7H 2FIKB 5GZOD 5EO0A 1F6AB 3BE1L 2JE8A 5JDJA 2HFTA 4NM4H 1I9IH 5A2JH 5ADOH 1MCEA 3G5ZA 4NHCL 5DUBA 4OM1L 3HLAB 3LDBB 4PJXF 1M71A 5HYJA 2J3SA 1INEH 2Z8SA 1BF8A 1X7QB 2BNQE 5A43C 3K2MC 5I1HH 2EDKA 5DGRA 2FR4B 4OUUB 5M94B 3GB7A 3V5HA 5I1AA 1DEEB 3NTCH 5GGSA 1ONQA 2FO4B 3ZE0F 3QP3A 4FXKA 4JPKH 5C08D 5D7JA 3FB6B 4NQCE 1BJ1H 4H1LA 4XH2A 2CH8A 1UFUA 4PJ8A 3RWGB 1VKXA 1NKOA 1LEIA 3I6GA 5CAYB 3MA7B 3SE3C 1J1PL 1JYWA 5FDYA 4EI5A 1VB9A 4O02L 1AD0A 1F4HA 4FNLH 2DBLL 1E6JH 4G9FE 2W0PA 1BZQK 2EYRB 1K5NA 4PJFE 1INQB 3C5ZD 5T3ZD 3ZHLA 1LO0H 3Q5YA 4EN3C 5GS0L 3OB0H 5I1GH 1TZGH 1KPUA 3V7MA 3QR2A 1MFBH 3KAAA 3OSKA 5D5MF 4YAQA 3LAFA 4HIEB 3G08B 3DRTB 4J3VA 3SY0B 5HDQL 2N7BA 2WWKT 4LSTH 4WGVB 5JQ6L 1MF2L 1YEFH 1EFQA 1RV6X 4K7PX 1AE6L 1A14H 4DCQB 5BXFA 3KYAA 1N6UA 2MOVA 3KGRA 2A9NH 4MS8D 2EE2A 2EIZA 2ZP0T 3PIQB 1MCJA 5FOBA 1RZIB 3KPNA 3NCFB 4Y4FC 1X4XA 2P48B 1RZFH 5E08H 2NY5C 5JR1L 3UTTB 5HD8D 1MLCB 4FQJL 2VLRE 3BD4A 2N1KA 4JANA 3QZWG 5DQJB 4G8FB 3A67H 1XZ0A 2P42B 1H3XA 4Y16D 1U3ZA 5ISZD 2R1XB 4WV1B 2DLIA 4FTVB 4DQOL 2CKBH 4BZ2L 1ZHKB 1CFBA 5MENE 4BZYA 4GKZB 2FJGA 1EFXB 1OP5K 3NFNB 2JJWA 4RMUA 2FH8A 4IRSC 3MRQB 4ODHL 5SWSE 1JFQH 1D9KC 5L7XL 5ERWB 2EDHA 4X4YB 4JLRA 3SOBH 2BHZA 1T2JA 2XPGA 1TJIH 4QRRD 3R8QA 4TUKL 3QJHA 1N7ML 2I9LB 4X6BB 3BZEB 3WHXA 3MCKB 4FQHB 4J3SA 5BZWA 2Y6SC 3MXVH 2A6IB 5HYQB 1ZLVH 4M3JA 4RGNB 1O0VA 2VC2H 4XCEA 4HZLB 2WP3O 5F9JA 5GIRB 3GSOB 1U8IB 3LKQA 1VA9A 5FUOH 4LOUD 3WFEH 2R1WA 3MRKB 4X99A 2F74A 3VG0L 3L3GA 4HFUH 4I48B 3JTTA 4NKOA 5T1MB 1FYTB 1TQCC 2EXWC 3ARSA 4G8GA 1AC6A 3AM8A 4GW4A 2NZIA 4YBLB 3MLSL 3OGOE 4R26H 3MJ9L 3IDGA 4GKNB 4V1DB 5DC0A 3BYTA 1IARB 2VQ1B 5MERB 2CXGA 3M8OH 1HH6A 3VE0B 4X6DB 1U8MA 4GQ9L 3STBA 1GIGL 5D93B 4HG4J 2XA3A 1PLGH 1CG9B 4LLWA 5IHBA 1AFVL 4LP4A 1K2DB 3O0RL 5CILL 4M5YH 3NCBB 3RGVB 4BFGA 2JB5L 3MREB 5EBLA 3VXQB 5DRXB 1B4JL 3QCVH 4WY7H 4IOSD 2OR9H 4P23D 1QRKA 2RGSA 3ZE0E 4PJ9A 5ANMB 1EEZB 5JQHC 2VDOH 3RVTC 15C8H 1RJCA 2MWCA 2VYRE 3WNKA 1AKJD 2MFNA 3RPIB 4P2OA 5HYSG 1RUKL 1RZGA 1CDGA 1G6RH 1S7TA 2LVCA 3KXFB 3C8HA 3T2NL 3ZKQD 3D18B 5C09B 1XF3B 4R0LA 5F72S 4MA3A 4KMLB 3TT3L 1U3HD 3DRQA 3P30L 5F88A 4J3OC 4QCIA 3GJFH 1BM3L 1SJHA 1UXSB 2Z31B 4Y4HB 1FFQA 4AMKL 1ADQH 2LABA 4NBXB 2Q76B 3KPRD 5F7EH 3VXUD 3VD7A 2SEBA 2VXQL 1HXMB 1YQVH 5F70A 3HCVB 1T1XA 4LSQH 2H2SC 4YHOL 3T09A 2WM0A 4HXBH 1Q9WA 2IAMA 2R1YB 5MP6L 2VZ1A 2X4SB 3FAXA 5EWIL 1G84A 4LQFL 4RFEB 3L3JB 4N5EC 4Z78A 5IHZA 3MRJB 2X4TA 1ZGLM 4PP1C 3MGOA 5CD3B 4NO5B 3CPLB 3C5SA 2H3NA 4GS7B 1JNJA 3VXSD 3O6ML 3OKLA 1UZ6E 1Z3GH 1MVUB 1X5AA 2B1AH 1U58A 4KRLB 5EIVA 1O5DT 2DQDH 1J11A 2GIYA 3C6LA 4HAGA 3GSUA 2XN9B 3QCTL 2VXTL 4HCRL 4PJBF 3HMWL 3DUSB 3U4EA 5C0DA 2G60H 3MRCA 3PP4H 5FGCE 3D48R 4JFZH 1F90H 4JKPH 3TT1L 3MUGA 5C07B 1LP9B 1CLOL 4P46A 1S3KL 2ARJB 4XMLL 4PLKC 2Z8RA 4ZSOB 2YKLH 4PRPB 1MQ8A 1VFUA 4MQSB 3X13A 1NBQA 3O45B 4QXWA 4OF7A 2YS4A 1DSFH 1Z9MA 3SGKC 4OJFL 4C4KT 4F9LC 5DC9B 3ZKND 5T1KB 1L4IA 1MUJB 4LBEB 1LK2A 5FA4A 3PWLA 3MUZ1 3U9PL 3BP6A 2AJVH 5JZ7D 1LO5A 5JPNB 1KB5L 2ZUQC 1F2XK 4KJPD 4GRWE 1W0VA 1F8TH 3UBXG 1R5WA 3S34L 3VCLA 4MSWA 1QRNE 4JPWH 3QH3A 1WC7A 5IQ9A 3G5XA 1S9XB 3UTZB 1CDYA 1MOEA 1UB6B 4NPYB 4KWUA 2XG4A 2MHAB 3ZYIA 5KSVB 4RWHA 1S5HB 4QOKE 5I1KL 3SJVE 3D39A 5T1DH 2XA8H 1C08B 2JELH 1NLBH 2BNRA 4M5ZL 5HI4D 1FZOB 1HIMH 4D8PB 5FGRA 3F6IA 5F9OH 1X9QA 3MO1B 4X9BA 4NM8L 5DO2D 2EO9A 1S7SA 1ZA6B 5DD5L 3WUZA 2IEPA 5I74C 2ZSWB 4UI2A 1FFOA 1B0WA 1FVDA 3LS4L 3PDGA 3VD9A 1QFHA 3NIGE 4PJEB 1A3QA 3L95A 4KY1L 5SWZD 3TCLB 3RY4A 1MRCL 4W70A 5F9AC 5E2TL 3QB7C 1JV5B 1U9KA 4TVPE 2DTSA 1CZ8L 3O81A 4BZ1H 1A7NH 2BOCA 3TLRA 4DKEH 2EXYC 3CJJA 3RHWK 4C55A 5FUZH 4KI5C 4F7EA 2V5SA 1EHNA 4PGBA 3DX7B 2V7HA 5IUSA 3MSPA 4NOFA 1UH2A 1UXWA 2DYPB 4KI5E 4WCYL 3HG1A 4XP9H 1K9TA 1PW3A 1HHIA 4NO0A 4ZAKD 5KVFL 1F4WL 3R0MA 1NCBL 5DR5H 1OP3H 2NNAB 1JNLL 2IANB 1LNUB 3PJSA 1T66D 4YHPB 1KLGB 1KYOK 1VGEL 5KSUA 3MBXL 4KK8D 1GC1C 2BRQA 1Q72L 2DMBA 2PYEA 3MFGB 1SY6H 1DQDH 2DWDA 1VFBB 3F5WB 1S7XB 3DBXB 5KS9A 4N0RA 1NEZB 4LSDA 2GFBA 1FNLA 3FZUC 1NCWL 4CDGC 1CVRA 3QIWA 5CLWA 3WE6A 1R3KA 1MREL 4JFDB 3KPTA 1C16A 2JF1A 2DMCA 1TIUA 4P9MH 2YHGA 3EDFA 4HKXA 5DURB 5IF0B 5GXBB 1MH5B 1R24B 2ZG3A 2DRUA 1HSAB 3AY4C 4PJBE 4ZODA 5E6IC 4DUVA 1QP1A 3TO4B 2X9WA 4IOFC 1F4YL 3SDDC 3VXPA 4OBSA 3GSQA 4HW6A 4LL9A 3E3QE 3QFJB 3U36A 1YEKL 3FB5B 2H26A 1UJ3B 5IROC 1A21A 3U7YH 4Z0XA 2QSQA 2KQMA 4F57L 3QHZH 5EORH 3F7YA 1ZEAL 1MWAL 5L8KB 2DAVA 3GEWB 3INUH 2I9TB 4S1QH 2FH6A 4LHQB 5E99H 3HMXH 1E4WH 4PJDF 4AYFA 4HS3B 1JF1B 1JNHA 1HZHL 2FB4L 2PO6C 3WIIL 5HGGS 4UILL 5DYOB 5MHSE 1UWXK 3ARUA 4LP5A 3GGWA 3M17B 3OKOB 3A6OA 1ORSA 1SYSA 4KXZH 2X09A 5DHYA 2XRAH 3TZVA 2Y7QB 5FV2A 2E8YA 2CMRH 3RTQC 1G9ML 3MLRH 4HXAL 1XGRA 4K7PY 4NNXA 1VADA 3D85B 4Y5XA 1OARL 2G2RB 4UTBH 4HF5L 5DD1L 3ZYZA 9CGTA 2ESVE 1V7NL 3PQYE 3JWDH 4XCCL 3H7BB 4PRHA 3SGEH 3OKYA 4RRPG 2COQA 3FTGA 4JHWH 3OX8B 4RBPH 2C5DC 2NY0C 2DLGA 4YHYC 1LMKA 5BV7B 4KI1A 2NY4B 1W72H 2IC2A 4X4MA 4LPYA 2R4SL 4L4TD 4XPTH 2CLVB 1RURL 3MOBL 3L5XH 4ZFOA 1BZ7A 3ZO0A 3ULSA 1LEGB 1NAKL 2JLLA 3STLB 1LK3H 5B8CB 2VLJB 5I1IL 4XPGL 4M6OL 1BECA 1A1OA 2VQTA 4PG2C 2IFFL 4P4RA 4WWKD 3UTQA 5BJTA 4KJWD 4L3EA 3RZCD 4M1CC 2YK1L 5ENWA 4N1EA 4O2FA 4JM4H 3TIEA 4DN4H 4OZIF 3GSVB 2CD0A 1BWWA 4F7MB 1DVFB 4R7NA 4PTUA 5E8EB 5D2LE 4KTDL 2FIKA 4G6ML 5DEZA 2X9YA 5A16B 3D3VE 3MNZA 5CP7A 2R56H 3IDNB 4JN1L 3RL1A 1IKFL 1IGCH 4LHUB 1JYVA 3VXMA 3EYOA 1JGEB 1A6TB 4PRDB 2JJTC 4LASH 5J89A 1GGCL 5EU3B 3OXRA 2GSIB 1RJZA 5GRZA 4AK1A 1X7QA 1H9VA 2XKNA 1Z0NA 2C3HA 4CMMA 3BW9B 4OI7A 2FR4A 3B8YA 3S35L 5IG7A 4JVUA 5BRZB 4PBVC 2R0KL 4OFVA 2AK4A 3NGBC 1U2HA 1KIRA 1CLZL 1MI5E 1GCFA 1OB1A 4YDIL 2DQEL 5E2JA 1W0WA 3MA7A 2V17L 1TITA 4ODSL 4PY8I 4X6CA 3KJ4C 1KBGL 4MX7A 4LVNB 1TQBB 1BEYH 4NWUH 3QXWA 3AVEA 3QIUC 3WFZA 1XCTB 3RU8H 3MV9B 3O6LL 3WLBB 4OCRL 4ZTPL 3FT3B 4X98A 4S0SD 4YBQD 4IHOB 4XXCA 3BN9C 4MJ4A 2IPUK 4OFYA 1UKQA 4TRPH 1T21A 4OFDA 1OAXH 5C0RH 1C1EL 3PWUA 3UYPA 1S7VB 3BE1H 3TNNB 3SQOL 4CJ0A 3OKEA 4HIEA 4F58L 2OR7A 2R2CA 1I1AC 3DRTA 3EOBB 3D69A 4B41A 3REVA 5GSVA 2YD6A 4PJDE 4RWYL 4U7SA 3BQUB 4YDVB 1CU4L 1M7IB 4TUOB 4NHCH 3T0BA 4DCQA 4R4FL 4LLDB 4OM1H 2HKFL 1CWVA 5F7HA 3LD8B 3FQUB 3PIQA 1T1ZA 3QDGD 4M43L 4P59L 2EIEA 3OAZK 1PBYA 2X4NB 3AS0A 1MLCA 2H9GA 5DF0A 5MEPB 4ZFFA 4R97B 1QHPA 1FFRA 3MV8E 4G8FA 5DQJA 2ENSA 3HC3L 5HI5D 4PY7B 2R1XA 4XB8A 1KTKE 4WV1A 5EFIA 32C2B 5J6GB 5IBTL 2XNAB 5CSZB 3DVGB 2P49B 3NFNA 1J1PH 2QR0A 1MEXL 4YC2B 5ERWA 2EDBA 4O02H 4KRPC 3CFDB 4N0CC 2DBLH 3DTXB 5GPRA 1H8SA 5F9DC 4MVBC 1FGVL 3W81A 3CX5K 4CDHA 2I9LA 1EGJA 4X6BA 1JMZA 3QUXC 3BZEA 5D2NC 3FB8B 3RVXD 1YMMB 2J4WL 4Q9QL 3KYKL 1OTSD 5GS0H 1RUML 2NW3B 2FHBA 2X4RB 4HZLA 4U1GC 5GIRA 1U8IA 1ZT4B 1WV7T 5KZCB 2DB8A 3GBLA 4QF1B 1MAML 3BGFC 4OI8A 1BFSA 1W2KT 4JAMA 4NNPL 4LSUL 3MRKA 5HDQH 1YZZA 2C26A 2VO5A 4IRJA 1UCTA 1MF2H 3DLQR 4QRPE 4WI7A 1AE6H 3MLUL 3QFDA 1DDHA 1PG7L 3T8XB 3B9EA 5ACLA 4MNGB 5HVFB 3RWJB 4POUB 5CEXB 3GHEL 1Q9OB 4WFEE 3DVNA 2HRPL 3U7WL 5JR1H 5MERA 1WTGT 5EZJB 4FQJH 4PBWD 2YXMA 2DI8A 3GMOB 1YEJL 4MJIB 4JFEA 4Y1AD 1CG9A 1HSBA 1NAMB 2O5ZL 5LBSL 2O61B 5IVXF 2OS7A 1G7HA 2QKIB 4DQOH 4BZ2H 4YGAB 2WBWB 4QXGL 3RGVA 3TN0D 3CZJA 3MREA 2Z93A 3VI3F 3VXQA 4ODHH 5L7XH 2ICEB 5ANMA 1R5IA 4K23L 1HHKA 4U3CA 3C5ZC 1K8IA 2CPCA 4TUKH 3RPIA 1N7MH 4WI8A 4ZQKB 4M02A 3ES6A 3W11D 2Q8AL 2HT4D 3D18A 4KROC 5C09A 4JRWA 4Z0BL 1RFDL 4S1DC 4CMHB 3QZWA 4JZNB 3IDMB 3H9YA 3KLHC 4LKCA 1UXSA 4Y4HA 1XGTA 2Q76A 2O26U 4E41B 2YR3A 1OF2A 4G6KL 1PEZA 1B0GA 1KGCD 1NFDF 2WWMC 3FMGL 3O3BA 4HUNB 2VTFA 3QUML 1AC0A 3VG0H 4MS8C 3HCVA 3WO3B 3LMJL 4ODXB 3BJLA 4OF8A 3RA7L 1WZ1L 2X4QA 3D0VB 1ZT7B 1CVSC 5GSRB 5IMKB 3X3GL 3H9SE 1MCLA 3MLSH 4JO4L 3MJ9H 5I8EB 3L3JA 2IJ0C 5D1XC 5DRNB 3QSKB 4OLXL 3MRJA 5KBNC 2WBJD 2MNUA 5ESAA 3CH8A 4NO5A 4M00A 4GQ9H 3Q5OA 1GIGH 2M26A 5A2IH 3S7GA 2GY7B 5DC4B 1KT2B 4GAFB 2W65A 4NBYB 3GMQB 1AFVH 2DQIL 2WQ8A 4JFFE 1RZ8A 4HLZH 2B1HL 3O0RH 5CILH 1BZ9A 2JB5H 3B2UC 3C2AL 4DOHE 4XI5D 1B4JH 5ALBL 3DUSA 1PG7X 4RQQA 4QLRA 3T65A 2Q6WB 5E9DA 3CSBA 2X05A 2DLFL 1HH9A 2P5EB 3O9WB 3T2NH 3AREB 4HD9A 2BXYA 2ARJA 3SDCD 4OTXL 5HJ3A 3P30H 4ZSOA 2LU7A 4PRPA 1BM3H 4AMKH 1YNTA 3ILQD 3QJFA 1G7JA 2VXQH 3B9DA 4PLJD 4ZUVA 4QHUA 4TOYL 2OMNA 5T1KA 4YHOH 3QEGL 1T5WA 5CJOL 5MP6H 5IVZB 5IFAL 5EWIH 2GJ6B 4LQFH 4DVRL 5H94B 3S9DB 4RIRB 1Z9OA 1QSFB 2A83B 5EBWB 5CGMA 2WIMA 3LOWA 5KSAD 4QYOB 5CEYA 5T33L 3WD5L 2QBWA 4D0CA 4NPYA 4JQVA 4ZFGL 5KSVA 2BOBB 4PJ5E 4RGMC 4OZHB 3U0TA 1MIML 3MBED 3CUPB 2YXFA 4P23C 3QCTH 2DM7A 4QGTA 2VXTH 3HUJE 3GI9L 4HCRH 1LWRA 4HMEA 3NH7L 2UWEE 3HMWH 4YK4C 3ZZ1A 2DQGL 4I0CC 4S1RL 2OL3B 5F97E 5IVXE 4UB0L 4PV8A 3TT1H 1CFQB 3NIFF 3VRJB 4X8JB 1CLOH 1ZA6A 4P2QB 3VI3E 4NSKB 4G8IA 3DX6B 1S3KH 2DI7A 4PYGA 2ZSW