4AGCA

Crystal structure of vegfr2 (juxtamembrane and kinase domains) in complex with axitinib (ag-013736) (n-methyl-2-(3-((e)-2-pyridin-2-yl- vinyl)-1h-indazol-6-ylsulfanyl)-benzamide)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
318
structure length
304
Chain Sequence
b'YLSIVMDPDELPLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
publication title Molecular Conformations, Interactions, and Properties Associated with Drug Efficiency and Clinical Performance Among Vegfr Tk Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 100
structure length 304
sequence length 318
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4agcA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4agcA01
5HD4A 4ONAA 4XG7A 4ANMA 2F2CB 1M17A 1YVJA 3FC2A 3GVUA 3QTWA 4FTIA 4R7IA 3ZH8A 3C4FA 3TDVA 1GZNA 2UW8A 4F70A 4ZJIA 5CSHA 4KKHA 3OF0A 3UIBA 5FP5A 2Q0NA 3OWLA 4M8TA 5IA5A 4EC9A 1IAHA 3OW4A 3PPZA 4L45A 3KRWA 3NYXA 3THBA 4C4GA 5JZJA 4M15A 3O0GA 4YHFA 5BVFA 1PXOA 2JDOA 2IJMA 1Q8YA 2XKEA 3GP0A 4G16A 4Y5QA 3RCDA 3V5JA 3WF7A 2WEIA 2JITA 3OFMA 3DXPA 3MPAA 2C6EA 4HVIA 1FPUA 3UQCA 3GOKA 1OECA 2VTHA 3O8PA 3P7BA 2UVXA 2NO3A 4Y46A 3OBGA 5BUIA 1UWJA 5GJGA 2QOFA 2WZJA 4C59A 2F7EE 2R3IA 4X6QC 1WCCA 5EQEA 4FIGA 4JBPA 2O63A 1ZMVA 3VS4A 1XBBA 2HCKA 2CKPA 3AMYA 5EFQA 1XQZA 3CLYA 2WMBA 3HL7A 2RL5A 2QO2A 4KBAA 4LL5A 2VWYA 3GGFA 4ITHA 3SV0A 3ZO4A 2WTCA 2ITQA 1NW1A 4O83A 5EQPA 4OBQA 3P86A 2J7TA 3FMLA 3V5PA 4IH8A 4CSVA 3WI6A 4E6QA 4EWQA 4TYGA 2W5AA 4EH3A 4LRKA 4DEDA 2GS6A 2Z60A 2OKRA 1TQMA 5CVFA 4YTCA 5KO1A 2CDZA 4ZSJA 1PF8A 5D1JA 5HTBA 1OL1A 3E8NA 5HG8A 4AXAA 4WHZA 4FV5A 4PTEA 1H24A 5FQDC 5HX6A 1H1RA 2WTJA 1CKIA 1UNLA 5TE0A 3EOCA 1J1BA 3PWDA 2OLCA 4BIBA 3R6XA 3BELA 3JY9A 2JKQA 3VN9A 3P5KA 5CAUA 4HZRA 3BV2A 5G6VA 4TL0A 3NW7A 3PA4A 3PP1A 3R63A 3BHHA 3F3VA 2HZIA 1OGUA 4UMRA 3EFWA 4YC6A 1XWSA 4A06A 5EW3A 3Q3BA 4BCOA 3IO7A 3OUKA 4DC2A 3GCPA 4QMXA 3AT3A 4MD8E 2PZPA 4W4WA 4FV2A 2C69A 4MQ2A 2X0GA 5M53A 5D12A 4CVAA 3LLTA 5K4IA 3HAVA 4M7IA 3FPQA 1W84A 3IDPA 4GT4A 3VUIA 4BDIA 4XG4A 1JKSA 2WAJA 3E7OA 3OD6X 4BTMA 1ZYLA 3MS9A 2WEVA 5A6OA 3EL8A 3E8CA 1WVWA 3LW0A 5AAGA 4FODA 4GJ2A 2BZJA 2QOLA 1WVXA 3ZO1A 5AFVA 4FZDB 3ZEPA 4JRVA 2WMXA 3I7CA 3RWQA 2PVRA 3I5ZA 3D7ZA 3LPBA 5AV4A 3HMPA 4BGHA 2X8EA 4EORA 2OFVA 4F99A 3KXZA 2UZOA 4YSMA 4I94A 1ZLTA 5JQ8A 3B8QA 3A8XA 5AM6A 3IW5A 4N6ZA 3VBXA 5KKRB 1WBTA 4QP4A 4FKIA 2YAKA 2VWVA 1DI8A 3GCSA 2HYYA 5EYMA 3NW5A 3CR0A 5T68A 3VS6A 3LVPA 3ZLXA 4YJNA 1F3MC 3UYSA 4LUDA 5HNGA 4BWPA 4M12A 5CSXA 4NTSA 4ANBA 4EH4A 5CF4A 2HK5A 3DPKA 3EQIA 4BB4A 4C35A 4HGTA 3V8TA 2FSLX 5KHXA 3FYJX 3TZ8A 3DV3A 4Q5HA 2I7QA 5KBRA 1Q97A 4B0GA 4PMPA 3DT1A 2X7FA 3UG1A 2PVLA 4L42A 1DI9A 5JZNA 4YC8A 1OKWA 4JOAA 2YCSA 4DBXA 3MSSA 3POZA 5I0BA 3RPOA 4IB0A 4FICA 2G2HA 3RK7A 3AGMA 3HEGA 3F3TA 5HORA 1IA8A 3QF9A 2W4JA 1Z5MA 3SC1A 4D4YA 3KVXA 1BUHA 3HA8A 3OP5A 2A1AB 3TL8A 3QZFA 2ITUA 4FX3A 5FXSA 2GFCA 2WMUA 3F3UA 3ZXZA 4QYFA 3RAWA 3V04A 3VVHA 3DOGA 5J9LA 3I5NA 2DS1A 3T9TA 2I0HA 3E8EA 3L9MA 4QYYA 2GS7A 3QQJA 3RCJA 3VAPA 2IZRA 3AXWA 3JVSA 4MXXA 3G6HA 4E7WA 4XV9A 4KS7A 4HW7A 3EQHA 3M42A 3N9XA 3LCKA 3JS2A 5DPVA 4ALUA 5A46A 4DFUA 3I6WA 4U79A 4CT1A 3O8TA 2HW6A 4D2PA 2VTIA 2QR7A 2VNYA 1YWNA 3HYHA 4S31A 1H26A 4J8NA 2PL0A 5BYYA 5HE0A 3N4UA 2CGXA 3DKFA 4KAOA 3WILA 2XK4A 4CMUA 4DGNA 4PMMA 4QNAA 4F65A 3C5IA 1SYKA 4I6BA 2IVTA 3NDMA 4ZTQA 3UVQA 3OVVA 2Z2WA 1NY3A 2BZIB 2QOIA 4AE9A 3VHKA 1OB3A 1UU3A 4M0YA 4N4SA 2C5NA 4N6YA 3BRBA 4HNFA 5I4NA 1P5EA 3LJ1A 3OUNB 3IG7A 1GIIA 1P2AA 4MEDA 4YHJA 5ANKA 3FZSA 5K0XA 4H39A 4FZ7A 4KIPA 3C50A 5M4FA 1A06A 2ITOA 5JGBA 5CEMA 3G9NA 3DKGA 4OTPA 3FV8A 4XP0A 4YBKA 5L2SA 2IG7A 3I1AA 5M4UA 1OBDA 5LVOA 3QLFA 3GOPA 2RKUA 4GFOA 4DG3E 4BTFA 2WO6A 3PJ8A 3F2AA 2GNGA 2HY0A 5KMNA 5FUTA 2LGCA 5IG1A 4WNPA 5J87A 5LMAA 3LQ3A 1SNXA 5IQIA 3TIZA 4U81A 2GCDA 5LWMA 3IW6A 2VWWA 3MW1A 4BKZA 4I22A 5CF5A 5GNKA 4K2RA 4ALWA 4WG4A 4TY1A 3DNEA 3ZM4A 1Q62A 4BDHA 1FVVA 5DYJA 1DS5A 4KSQA 4W4YA 5CU2A 3QC4A 4ZY6A 1S9JA 2UZDA 3Q4UA 4IJPA 4PX6A 4DAWA 3LCSA 4JJRA 4MVFA 4O0TA 1R1WA 4EJ7A 3F2RA 2OZAA 4DEAA 5J1VA 1K2PA 1ZYCA 5HLNA 2XK8A 3WIKA 2XK9A 3QD4A 3TZ9A 3FMJA 4GU9A 2QONA 4BZNA 1XH5A 2OG8A 4LOQA 2UW4A 5KMIA 4UX9A 2QKRA 2PYWA 4RRVA 3V5LA 3TTJA 2BROA 1Q24A 2EU9A 3DY7A 2GQSA 4QP9A 3QGWA 4S2ZA 3ZHPC 3MH3A 2XA4A 1ZRZA 1H07A 1YOLA 3M2WA 3SG9A 3SDJA 2REIA 4OW8A 4APPA 2VU3A 3P4KA 2BFXA 5IMEA 4AGUA 2JFLA 2WMSA 3UNJA 4FNXA 4CT2A 4Y72A 2XRUA 5EOBA 3BPRA 4KNBA 1KE7A 3P9JA 3PG3A 1V0PA 2PSQA 4KWPA 3LFSA 2X6DA 4K6ZA 4M67A 4BIEA 2C4GA 1H0WA 1ZOEA 2NRUA 4ZMFA 3EHAA 3QA0A 4BIDA 5CXZA 5KMJA 2EB3A 4FT7A 5M09A 3BHVA 5CYIA 3NZ0A 4BYIA 1M7NA 3UE4A 5AIKA 1HOWA 5EW9A 1YKRA 1ZMUA 2C5XA 5JQ5A 4RX9A 4GS6A 4EL9A 1J1CA 3EN5A 4FYNA 4LL0A 2PULA 4B8MA 3TI1A 4K18A 3HA6A 3LFQA 1GIHA 5AR7A 3MY5A 3RVGA 5LMKC 4BCPA 3KFAA 2J5EA 5F95A 2UW0A 2RFDA 4R1VA 2C0TA 3W2SA 4BDGA 4KB8A 4C2WA 4ZEGA 4XYFA 2OXXA 5I9VA 1YHVA 3PXYA 3PLAE 4DEBA 1XJDA 4TTHB 3CGOA 3BCEA 3MBLA 3KCKA 4MXYA 2PUNA 5C01A 2E9PA 3F7WA 2XIZA 3NGAA 3VIDA 4XLVA 5A4LA 4ANQA 4HZSA 3R1NA 4ZLYA 5HICA 3U6HA 1H8FA 3PIXA 2AUHA 4FKQA 4J52A 4YTFA 2QLUA 2W06A 4RC3A 4G3CA 3DQXA 2JKKA 5IUHA 4JVGA 4FNWA 4DCAA 1PYXA 5J95A 5J8IA 5DGZA 4LM5A 4DFXE 5E8WA 4E4XA 3KK9A 3NLBA 3ORKA 3LXLA 3QKMA 3RPVA 4FTUA 5CU3A 4IWOA 3WF9A 4APCA 4OT5A 3D9VA 4MXOA 3DNDA 3KXNA 3B8RA 3PJ2A 4FV4A 3VC4A 4D58A 4LUEA 5J5SA 3UZRA 4AZWA 2Z7RA 2R3FA 3AGLA 4R6VA 3UPZA 4FIEA 2VX3A 3C13A 4UMQA 4HOKA 2QU6A 1NA7A 5B0XA 1F0QA 4ZK5A 4MYGA 3DS6A 3PLSA 1J7LA 3GU8A 5FDXA 3ZRKA 4YSJA 4FT3A 2XIKA 4V0GB 3S3IA 4G31A 1MRVA 2ESMA 2JBOA 4FSUA 3VBTA 4BWKA 4B8LA 4ZOGA 1GAGA 5H8GA 4E73A 5I9YA 2O65A 4YMJA 4DFNA 5KBQA 4PP9A 3ZRLA 4G3GA 1LEWA 3UIXA 2RG5A 4PP7A 2WMWA 3CBLA 4A4OA 5M08A 1WBVA 4NM7A 3NUYA 4WIHA 3QTUA 4BL1A 4KIOA 3S2PA 3HX4A 5BVNA 5EDPA 2C1BA 3EN6A 3DAKA 4QTEA 3D14A 2QOOA 4KINA 4FTNA 3NW6A 4FT0A 5D7AA 3ITZA 4C38A 4PMSA 2VTSA 3E8DA 4RQKA 5LWNA 3W18A 4DFZE 4L8MA 5E90A 2YIQA 5IA2A 5EDRA 3RINA 5BVEA 4O81A 3CTHA 5JMSA 4L3PA 3UZTA 2H34A 4FKSA 3UOHA 4L52A 1P4OA 3C4XA 4GJ3A 2G9XA 5HZNA 2WOUA 3K3IA 4JBOA 3HUCA 4AZVA 4U3YA 4DE4A 2QHMA 2HZ4A 4XG3A 2HWOA 2JBPA 4W4XA 4E4LA 4FIIA 1P14A 1MQBA 4WUNA 4AA4A 3PA3A 5BMSA 4M69A 1STCE 3KXXA 3TWJA 4MNEB 4KIKA 4K8AA 4AW1A 4C33A 1YXUA 3ERKA 4N0SA 3W1FA 3TZMA 4KABA 1SZMA 2R0IA 2JD5A 3RM6A 3L8PA 5AA9A 2I1MA 1YXTA 4TN6A 5HX8A 2XJ1A 3ULIA 4GUEA 1VJYA 3BLHA 2XJ2A 4QNYA 2YIXA 5LMBA 4IX6A 1IG1A 4F9BA 3K5VA 5KCVA 2YIWA 5I3RA 5L4QA 4E5AX 1MRUA 2YM6A 4ZTNA 4FKVA 2J2IB 4R7HA 3ZS5A 1PXKA 4AT5A 1SVEA 2VTOA 3E87A 3R21A 2ZV9A 3ANQA 5LJJA 5T6KA 1ZAOA 3CJGA 4BCJA 3AD4A 4IC8A 2CGWA 2XIYA 4U7ZA 3S95A 3AD5A 4D2TA 4DINA 4Z3VA 4CZTA 5I5ZA 1H28A 1YDSE 4JI9A 1YOJA 4X3FB 1JAMA 4AA0A 3IQ7A 3WOWA 3BEAA 4F0IA 4RA4A 2PZ5A 5FGKA 2RIOA 1YI6A 1M14A 4LV5A 4RVKA 5DMZA 3Q4TA 2BHHA 4IWQA 2CKOA 3HP2A 3PRFA 2BIYA 4FI1A 4KBCA 2UW7A 5J5TA 2XM8A 3TNQB 2J51A 5BMMA 3PRIA 3PSCA 4ITJA 4CQEA 2YIYA 3VJOA 2C6TA 3P7CA 2VO7A 4JAIA 2XK7A 5CNOA 2CCIA 3OWPA 2BRBA 4B6LA 4ASEA 1XH8A 2JLDA 3ORZA 4CRLA 1SVGA 5AX9A 3E5AA 1HCLA 4O84A 4PMTA 2C0OA 4CFNA 4QMTA 3ZDUA 3QQHA 3PY1A 4OTGA 4IZAA 4MXZA 3AC5A 4II5A 1GZKA 3Q5IA 4Y83A 2XH5A 3QGYA 4IACA 2BILB 4WD5A 5E8UA 5GZ9A 4FKPA 2VTRA 1JQHA 2BRMA 1JSUA 1U4DA 2FGIA 1OKZA 5EYKA 4NFNA 1UU8A 5HHWA 3DB6A 3COMA 3KN5A 1OM1A 5CQUA 3HNGA 4FV9A 3FDNA 5ETFA 4EEVA 4F09A 2VNWA 2OW3A 4XV3A 3FMNA 5TO8A 4DEHA 3EN7A 3Q9ZA 2BRGA 2HY81 4IDTA 4BCQA 4DCEA 5JFVA 4O96A 4NH1A 1DM2A 3HKOA 4YUQA 4RFMA 3I79A 3T8OA 1OI9A 3OEFX 2ZM3A 3TXOA 3GB2A 2J6MA 2OF4A 3SLSA 2IN6A 3G51A 4EOLA 1KSWA 4GCJA 3HV4A 5CEOA 4CFWA 4IM0A 3QBNA 4GYGA 5IISA 4J1RA 1OPKA 3AC4A 1KWPA 2VTQA 3O2MA 2OZOA 2NRYA 2XNMA 2B55A 4G17A 2JFMA 5IH4A 1RJBA 2OIBA 2OWBA 2Z7LA 3NAXA 2PMLX 3GUBA 4FKTA 4DH5A 3UG2A 4EQMA 3MFUA 4O82A 2F4JA 5BVWA 4FT5A 2GHMA 4USDA 4AN2A 5DR2A 2JAMA 4Q9SA 3ATSA 3PUPA 1B39A 4B4LA 3CS9A 3MV5A 4I93A 1YHSA 3V5QA 4BI2A 2C68A 4F1MA 3BGQA 2GQGA 4R7BA 5AJQA 3ZUUA 1H1QA 4KBKA 4A9SA 3Q6UA 4OBOA 4OBPA 5J79A 5HO6A 4J98A 4ZY5A 5GJDA 2VTJA 2CN8A 2OJGA 2VTMA 3D83A 4UALA 4WKQA 3OWKA 4EH5A 4EI4A 5JFXA 3IONA 5IZFA 1WAKA 2Z8CA 2XMYA 4A4XA 4JRNA 3NUAA 4QYEA 4RFZA 5JN2A 4KA3A 1FVTA 1O6LA 4D0WA 5DN3A 2XZSA 3IGOA 2GTNA 4FKRA 3TIYA 4AU8A 4AOIA 2IPXA 3R04A 2RG6A 5I9ZA 1UA2A 1XKKA 4EBVA 5M55A 3BGPA 4X2FA 1Q61A 1REJA 4RIWB 4FEWA 3RAKA 3Q4ZA 3P23A 5JK3A 4QP8A 2C3JA 4LOPA 3ZFXA 3EZRA 5HCXA 1URWA 3LMIA 3R30A 5CENA 3ULZA 2UZUE 3L8VA 3FI4A 3GNIB 3U4UA 2GNFA 3A7GA 4L9IA 4NT4A 5ANJA 4HCUA 2OI4X 5FTGA 4CNHA 2GTMA 5IU2A 4YBJA 5CNNA 4E1ZA 2C30A 4CV8A 4FBXA 3OZ6A 3KN6A 2EWAA 3NEWA 1U59A 3F3ZA 1FINA 3SW4A 3BHUA 4BICA 3D2KA 3LJ2A 4TPTA 2W0JA 4U5JA 2XNBA 5K5XA 4ASXA 1JSTA 2YLFA 2EVAA 4UB7A 2X8IA 3BHYA 3FL4A 3U87A 3JXWA 1OL6A 2BAJA 5BX0A 3ZZWA 3AOXA 3NVKI 4G3EA 2R3LA 4F0GA 4RIYB 3A7JA 3CC6A 4I41A 5FBNC 1TKIA 5GZ8A 2GQRA 4JBQA 4FG9A 2ZMDA 1E1VA 1PXNA 4EK6A 4IWDA 3Q04A 3QRIA 3U54A 3R71A 2P2IA 3KY2A 3R8UA 3WBLA 4Z7HA 3KXGA 3R1YA 4NK9A 3U9NA 1ZOGA 4QP6A 3P79A 5DH3A 5C4KA 4B9DA 2JDSA 2WQBA 3EB0A 4FUXA 5ANEA 4PL5A 1H1SA 1WMKA 3Q32A 4O91A 5H8EA 4C36A 4A9UA 1B38A 3U6IA 1K9AA 4Y5HA 4RLKA 3F5UA 5LVMA 2OJ9A 2B9JA 1WVYA 3ZTXA 3MA3A 5JT2A 2R7BA 4TWOA 3TNIA 5JEBA 3IOPA 5M56A 3CIKA 5IMXA 1OKYA 5L2TA 2P55A 1NVQA 3GC8A 1U54B 2B0QA 5GZAA 3NX8A 1IR3A 1ZY5A 4DT8A 4OTHA 4BHZA 3QTZA 3QLGA 2WMAA 3SRVB 4QYHA 4G3DA 3ZC6A 4J95A 3C7QA 4L01A 3ZM9A 4UMPA 4UXLA 3MDYA 3ZEWA 4RJ6A 4TWPA 5JFSA 1WBPA 3OCSA 4L3JA 4J96A 1PXJA 4RVLA 3JY0A 2UW6A 4JG8A 3WZJA 2C6DA 3LCDA 4E20A 4RWJA 4JQEA 1R0PA 3C0HA 3BQRA 2C6IA 5KZIA 4WSYA 3FZRA 4I5PA 3LM5A 5DRDA 2E9NA 2Y4PA 4FTMA 3NUPA 5HTCA 3O51A 4C4EA 4ID7A 3WZKA 4GG5A 2QU5A 2RFSA 5IQBA 5JGDA 3NUUA 4YLLA 4RMZA 1UNGA 2VZ6A 3GFEA 1PRYA 3PXRA 2J9MA 3RMFA 3KULA 2C5YA 5M07A 5GHVA 4RVMA 4LRJA 4QMLA 2UZNA 3DZOA 1MRYA 1QPEA 1IEPA 4YZCA 4IB3A 3FZOA 2W9ZB 4ZTSA 4UYAA 2QG7A 3NVMB 4IVCA 3IW4A 4XG9A 2CLXA 2W1ZA 1MP8A 2X1NA 4R3RA 2VGPA 3BBWA 1H08A 3E62A 3KEXA 3TNWA 2ONLC 4NM3A 4L6QA 5DI1A 5FXRA 2WOTA 4CCBA 3K54A 4F6WA 4DFLA 2C5OA 1LUFA 2XUUA 2H96A 2Y9QA 4FKWA 5EHYA 3FXWA 4QT1A 3OXZA 3SHEA 2Y8OA 2YEXA 2R64A 2PPQA 1REKA 1PMUA 3CJFA 4NTTA 4RC4A 1J7IA 4FV6A 2QOBA 5C03A 3ZLSA 5A9UA 1Y8GA 1ZWSA 4I0TA 1CKPA 4AUAA 3KRJA 1SNUA 3NUSA 3SXFA 4CYJA 3UPXA 3F5GA 1SM2A 2HXLA 4PDOA 5CS6A 3QD2B 2PVNA 3Q4CA 1KE5A 4EKKA 3D7TA 4D1SA 4EH6A 3TKHA 1MUOA 3W32A 4P5ZA 4FSYA 3JYAA 3KF4A 4L44A 4EBWA 2CSNA 3GCQA 4RIOA 5F20A 2OF2A 2H8HA 4QP7A 4O1OA 5EG3A 4HYUA 3KXMA 4PUZA 1ZYJA 3UVRA 2X2MA 3FYKX 3G6GA 3UMWA 1GJOA 2VUWA 4MD9E 3OT8A 4HCVA 4LRMA 5DT4A 5HCYA 4YP8A 3FC1X 3DGKA 3LFNA 3TJDA 5L6PA 1T45A 5FTOA 3UODA 2Y4IB 1WBNA 3ODZX 2KULA 2PY3A 2OXYA 4ANOA 4D2SA 5A14A 4FGBA 2YABA 4H3PA 5IPJA 3KXHA 3R7GA 2ITTA 4QMQA 3DDPA 1U46A 4UMUA 2P2HA 5EDQA 1IASA 3BU5A 4D28A 3N4TA 3EQGA 4YNOA 3QA8A 1IRKA 1WZYA 1UU7A 3O7LB 4FVRA 4RX8A 3R2BA 4IB1A 3VW6A 5IUIA 3ZZEA 3JUHA 1RE8A 5HG9A 4ZS4A 2OK1A 5JKGA 3TUBA 5AP1A 3LFDA 4XG8A 5E9EA 5GIPE 3G2FA 4W9XA 2ACXA 4GG7A 2X2KA 3A4OX 1Q99A 2PE2A 4QMUA 4I5CA 4X2NA 5CF8A 3Q9WA 1BMKA 3QRUA 5D9HA 3FZTA 2YFXA 4IAFA 2BRNA 4EQUA 3IGGA 4FV8A 4GK2A 3ZCLA 5LXMA 4F7JA 5CT0A 3BYUA 1GZ8A 3EQDA 4IFGA 4LQMA 5JH6A 1HCKA 4ACMA 4HYIA 4R1YA 3TNPC 2R3OA 4J99A 3WF5A 4F9WA 4ZP5A 4U6RA 4IM2A 4FV3A 2DUVA 4ZTHA 5AWMA 3QRTA 4FEVA 3TUDA 4ZZOA 5AR8A 4ZTLA 3UOLA 4I5HA 2OU7A 3R7OA 4HVHA 4W8DA 2YA9A 5CSWA 3KRXA 5EKOA 4UWYA 2IZTA 3DXNA 4CD0A 2R2PA 3T3UA 4TYEA 3P0MA 2GNHA 2EUFB 4C0TA 2IZUA 5I9WA 4I6QA 4G9CA 3W55A 2JDTA 1K3AA 2XYUA 1YXXA 1V1KA 3R7YA 1ERKA 3CY2A 3BLQA 3H9RA 5E1EA 4O0YA 1J3HA 2X4FA 3QCYA 3VS1A 4CKIA 1XR1A 4CG8A 1PXMA 3QX2A 4IM3A 4U44A 3VBYA 3LE6A 3RNYA 4C62A 4I6HA 4DGLC 4OAVB 3I6UA 5AUVA 4I3ZA 2IZSA 3PYYA 5AP4A 4FEUA 2E9VA 3LFCA 1JOWB 4IAZA 4TYJA 4B99A 3SKCA 1Q8UA 3LJ0A 1OIUA 3LLAA 3CXWA 3U51A 2WGJA 2UZVA 5M44A 4XMOA 4LGDA 4UV0A 5IQHA 1W8CA 3FQSA 4GV1A 5FP6A 4O2PA 1BLXA 3FHRA 1OITA 4WBBB 1OZ1A 4IAAA 5E4HA 3GC0A 4AW2A 2B52A 4G6LA 4L46A 2PUPA 4YTIA 4MTAA 2X4ZA 3RPYA 5L8KA 3G15A 3DK6A 3LXNA 3RM7A 5IUGA 5AR2A 5FEEA 5HLWA 2PVJA 2FH9A 2X7OA 2P3GX 5AP6A 3OHTA 4FV7A 5BPYA 2CCHA 1OKVA 2YZAA 3EL7A 2IO6A 2P0CA 3FXXA 4E8AA 2V7OA 4BN1A 1X8BA 4BKJA 4GFMA 3CQUA 3IK3A 3ZLWA 2OSCA 4X2JA 4EOPA 4C61A 4FTLA 2B54A 3OW3A 3L1SA 2ZMCA 4V04A 3PJ3A 4BBFA 4A9RA 2QNJA 1PJKA 3QD0A 2YZLA 3FI2A 2LAVA 5EQYA 5A4EA 4PRJA 2PUIA 4G34A 1UV5A 2YHVA 3CTQA 2B53A 4O0XA 4TKSA 3V8WA 3K2LA 4EHZA 3TZ7A 3ZDIA 3DA6A 4BDKA 5AEPA 3N4VA 3FQHA 5HE3A 2B1PA 2QHNA 2BCJA 4QTCA 2IVSA 5ICPA 1YRPA 3HECA 2VN9A 4P5QA 2WMQA 1CMKE 1VEBA 3AT2A 2V7AA 3QUPA 5I9XA 3TUCA 2YLEA 4FNYA 2PUUA 4D55A 3FKNA 3HZTA 3KB7A 4U43A 5CQWA 2FA2A 4RIXB 5B2KA 1Z9XA 4DH7A 2CLQA 4AGDA 1QPJA 2XEYA 4O86A 1V0OA 3P1AA 4NIFA 5K0KA 3ALNA 5M06A 4QTBA 4TYHA 2UZEA 4CLIA 5IQCA 3BU6A 2CJMA 3GFWA 1Q3DA 3H30A 4QMMA 1R3CA 2HZNA 1TQPA 3ZFMA 4C4JA 4CLJA 4WUAA 3E93A 5IEVA 4CQGA 4FIHA 2YCQA 5EHOA 4GL9A 4OTFA 4EUUA 4UWCA 4G9RA 1P4FA 1QPDA 2Z7SA 3F7ZA 4BGQA 4C2VA 5HVKA 3FMDA 4JR7A 2AC5A 5E8SA 4G5PA 5TOZA 4YZMA 3F82A 3ZSGA 4XS2A 2BTSA 4YR8A 3FMKA 3MWUA 2J90A 3ZXTA 2GMXA 3DTWA 2JC6A 4PY1A 1KV2A 3SGCA 2ZAZA 4Y73A 4AT4A 2BVAA 4NEUA 5EH0A 4XG6A 4CFXA 2P33A 4EOOA 4CFVA 3FI8A 4NYEA 3CEKA 5CVGA 4O7WA 3R1QA 4JR3A 3V6SA 4P4CA 5HIBA 1XH6A 4EOQA 3DK3A 4DT9A 4FTTA 2EXCX 1YI4A 5AUWA 4L00A 4C8BA 2OGVA 2OZAB 4XRLA 3C5UA 3OG7A 1TVOA 4D9UA 4ZJVA 3FLNC 4NKSA 4UEUA 1EH4A 5EM8A 4CCUA 3BQCA 2IWIA 2VO3A 2GU8A 1GZOA 3MY1A 3QHRA 4NZWB 4MCVA 4HPTE 4GK3A 4CGAA 4YJRA 3EYGA 4C37A 2FSTX 3PPJA 3R9OA 3MVLA 2JGZA 2PVYA 2OO8X 3HV3A 4PQNA 4ZSLA 4BI0A 3ACJA 2C6KA 3QD3A 3AD6A 2Z02A 5J9YA 5A4CA 2VO0A 3O71A 4ZJJA 4RPVA 5D7VA 4AW0A 4BTJA 2YAAA 3FY0A 4QTAA 5J7BA 3NYVA 2XCKA 4ALVA 2I6LA 3EQRA 1R78A 3FSFA 4JBVA 3R0TA 3TNHA 4D9TA 4O7RA 3ZSHA 2WXVA 2PHKA 4A07A 2WTKC 4J7BA 2FYSA 3QC9A 1KOAA 3BBTB 3D5WA 4OTIA 4IVBA 4GT5A 4DGGA 5KHWA 4IX4A 5KMOA 2A4LA 5HTIA 4D2WA 4PTCA 4NL0A 4I1ZA 5CTPA 4H1MA 1VYWA 3LIJA 4BF2A 4QQCA 1Y8YA 1M2QA 4FEXA 4NU1A 4DEEA 3MB7A 3FLYA 2FUMA 2C1AA 1Q8ZA 4IANA 2GSFA 3S0OA 5AUUA 4LMNA 2FB8A 3EFKA 5AUTA 4GVJA 2WTDA 1XHAA 3H3CA 2WKMA 3OROA 4K33A 5ETAA 2YM5A 4PL3A 4R5YA 3PY0A 2W99B 2ONLA 2XJ0A 2YN8A 3QUDA 4XP2A 2ZV7A 3TN8A 4BHNA 4DG0E 1W82A 3KKVA 5AP5A 3DJ7A 2VTLA 4AOTA 4ZSAA 2YIRA 4M66A 4O21A 1I44A 3IKAA 3LFEA 1FQ1B 2FSOX 4YURA 5AV3A 1T46A 1GY3A 4C02A 3FE3A 2XNGA 3UOJA 5L2QA 2X39A 5DEWA 4NUSA 4FMQA 1PW2A 3KRRA 3Q5ZA 2BUJA 4YJTA 4CKJA 3QWJA 4MF0A 3PVBA 3DJ6A 3V6RA 5BUEA 2W1HA 1ZZ2A 2ZYBA 4K77A 1B6CB 3MVJA 3LXKA 4YU2A 5DG5A 5CEPA 5A4TA 2QOKA 4OT6A 4O0SA 2W05A 3EJ1A 1BX6A 5CY3A 3CP9A 3UP2A 3AC1A 3ODYX 2XBJA 5M51A 2Q0BA 3RZFA 2R7IA 4ACCA 3QFVA 1WFCA 4Z16A 3C1XA 3R7UA 3BE9A 3K5UA 3O23A 3QZHA 3O17A 3UJGA 1RQQA 2A2AA 4FV1A 2QG5A 4JIKA 3FZPA 5HVYA 3R7EA 4GMYA 4CFFA 3W2CA 2V0DA 4HYSA 5ANGA 4AN3A 3MTFA 3UIUA 4AZSA 2PMNX 5AP7A 5HQ0A 4EOJA 1XH9A 1Y57A 5DWRA 3R8LA 5KMLA 3RGFA 2JAVA 2R9SA 5AA8A 5AP0A 3EYHA 4IE9A 4KSPA 5K4JA 1OIRA 4ANNA 3SG8A 2QR8A 2R3QA 1PMVA 4YZBA 3H0ZA 3MY0A 3QCSA 1OUKA 4QMSA 3WYXA 4NJDA 3PVWA 4YPSA 4XH6A 2YJSA 3VQUA 1ZYSA 4EH8A 3KA0A 3PP0A 3QYWA 5DOSA 2YACA 3KC3A 4IHPA 4Q2AA 1OIYA 4IX5A 4EH7A 4IJ9A 4AA5A 4D1ZA 4EK8A 3C51A 5BNJA 4DEGA 4FTQA 2F2UA 5C26A 4P90A 4RT7A 3DBQA 2W5BA 5IA0A 4ORKA 4Y95A 3PVUA 3T9IA 3ZONA 5IQGA 5G1XA 1WBSA 3PVGA 4RJ7A 3LM0A 4XRJA 3WARA 3L9NA 4BCKA 5ANIA 2WU6A 3G5DA 4S33A 5A54A 2RFEA 5H9BA 4XG2A 3OTUA 4M69B 2BZHB 3KQ7A 4KIKB 3RP9A 3LKMA 1YOMA 1M7QA 2WIPA 3BWJA 3COIA 3HUBA 3QXPA 3ZLYA 5KKRC 1QMZA 4HYHA 4OAUC 4A7CA 4U80A 3R8MA 4YJUA 3ZO3A 3KMWA 4JG7A 4BDAA 4ERWA 1U5RA 1JKKA 3GCVA 2P4IA 2R3JA 2XS0A 3QZIA 1JBPE 3HLLA 1IAJA 3IW8A 4ZS0A 5FEQA 2BDJA 2GNLA 1G8SA 3EZVA 4YLJA 5F94A 1M2RA 3W2PA 4BRXA 4EK4A 2VTAA 3QQKA 2HIWA 2VWBA 2V62A 3QQUA 3H10A 5CAQA 2O5KA 5T3QA 3S00A 3R8VA 1NVSA 3NIZA 3P78A 2JDRA 4FTRA 5D41A 5HVJA 2X81A 4ACHA 3MH0A 4U41A 3NRMA 4M84A 1Y91A 3C4EA 4D5HA 1OL5A 2YWPA 3PSDA 4V05A 4FKJA 4G2FA 4C7TA 4QMVA 2PE0A 1H4LA 4FKUA 4MBIA 4QMYA 5EI2A 4AT3A 4EH9A 4GKHA 4FL2A 4C3FA 3RALA 1APME 3WYYA 3RJCA 5DIAA 3UZPA 4AZTA 2SRCA 3PPKA 2XP2A 5L2IA 1J7UA 4BC6A 3IOKA 2I40A 3F2NA 4EYJA 3DU8A 1YQJA 5K9IA 2AYPA 3VF9A 2W1DA 4O6LA 1FVRA 4F0FA 3NS9A 3CSVA 4UWBA 4N70A 4FC0A 5KUPA 2GDOA 3AQVA 3PXQA 4MXCA 3W2QA 3MJ1A 4MBLA 3DB8A 4F9YA 2RF9A 2A19B 1Q5KA 2WD1A 5FXQA 4ANSA 2QOHA 3WZEA 4F64A 4K9YA 1TQIA 1NXKA 3CQEA 3FQEA 4WT6A 4FVQA 3QCQA 4U8ZA 4U3ZA 2ETKA 4RSSA 4BTKA 3BU3A 4E6AA 4ERKA 1OL2A 2PWLA 3TACA 4ARKA 2E9UA 3SOCA 1VR2A 4RGJA 3C4ZA 4PPAA 3CD8A 3ANRA 4M68A 2PMOX 4MXAA 3FXZA 3VQHA 4AE6A 4AN9A 2CNVA 2GS2A 4IAIA 3I0QA 4R77A 2OXDA 4G6OA 4JQ7A 2X9FA 5DEYA 3VS3A 1W0XC 4DTAA 4QQ5A 4OR5A 4D0XA 3LQ8A 3VUMA 3DAEA 2ITVA 3CQWA 4HGEA 2CGVA 1UKIA 4O7LA 4Y85A 2HXQA 4JNWA 5TKDA 3BYSA 3AC2A 2W5HA 3A7HA 3R83A 3B2TA 5E1SA 2XRWA 4EHEA 1XO2B 3EN4A 4BY9E 1BKXA 2ITZA 2QOCA 4R3PA 1OVEA 4JQ8A 3ZBXA 5HE1A 4FZFB 4OUCA 2CHLA 2J4ZA 4QMNA 2ERZE 3NAYA 4JDHA 3C4CA 4YZDA 3E64A 2OJFE 3EIDA 3GC9A 1JKLA 3FKLA 5LVNA 3GQLA 1GOLA 4FKOA 3BEGA 3V01A 5ANOA 1QL6A 3BYVA 3DFCB 4JXFA 4CTBA 3F9NA 2IW9A 5CAVA 4G3FA 5AUZA 3K3JA 2WB8A 2X7GA 4AGCA 4QTDA 3FZ1A 4BZDA 5HGIA 3R9NA 3P08A 2XNNA 3ZRMA 2B7AA 3OXIA 4RFYA 3H4JA 3UBDA 2R3PA 3G90X 4IZYA 4RG0A 5DLSA 2B9IA 2Y6OA 4H3BA 3TM0A 2PTKA 4L3LA 2OIQA 5IA3A 5DT0A 2OBJA 4LI5A 2PZIA 2V55A 5F1ZA 3QTRA 4I5MA 4JT3A 3QWKA 2X2LA 3M11A 3ZO2A 3ZMMA 5CASA 4I0RA 5CF6A 1H01A 5C9CA 4CXAA 3NWWA 2QO7A 4NM5A 3DBEA 4FG7A 1AGWA 4OTDA 5HBEA 4EQCA 2QO9A 3OMVA 4MWIA 1ZZLA 1XH4A 2QCSA 2C3KA 2OFUA 5HNBA 3RAIA 4BI1A 4E93A 5IQAA 2HZ0A 3A4PA 4EH2A 4FKGA 1Y6AA 2R5TA 4MQ1A 1UNHA 4FV0A 4O7NA 2JKMA 3MPTA 1ZYDA 4NWMA 2V22A 4PDPA 2G1TA 3KK8A 5DA3A 4QQTA 4RWKA 4E3CA 1XBCA 2ZV8A 4AFEA 2R4BA 4YJVA 4BWXA 3A2CA 4FF8A 3TKIA 5AP2A 4J8MA 5J9ZA 5DVRA 5M57A 4YTHA 3LOKA 4C3RA 2ERKA 4JX3A 4R8QA 4TXCA 2RSVA 3PG1A 5IDPA 1H0VA 4L67A 4YJOA 1UU9A 3F69A 3Q9XA 3ET7A 3GU7A 4XHKB 3CCNA 2CN5A 2J0KA 4RBLA 1ZARA 4KKGA 2BRHA 2YDKA 4P7EA 1L3RE 5H3QA 2R3NA 3HRCA 3BV3A 4JX7A 1YWVA 1VZOA 3WZDA 3MI9A 3NMUF 3AMBA 4L7FA 5C8NA 2VO6A 4UZDA 5HIEA 3UO5A 1G5SA 3GU4A 2R3KA 3HMIA 4PL4A 3BZ3A 4WG3A 5E7RA 3T3VA 4RLLA 4BCGA 5CU0A 4O7YA 2XNOA 4A4LA 2OICA 4HPUE 3EH9A 3HDMA 4FG8A 3FAAA 3R9HA 1BI7A 1UVRA 4GH2A 3WE4A 3HV5A 4FIJA 3PE1A 3QKKA 1BYGA 4IIRA 1CTPE 1KV1A 4L43A 4EOSA 4TZRA 2DWBA 4AX8A 3DDQA 3W33A 4QMWA 4R78A 3OS3A 3BYMA 3UIMA 4FKLA 3ZFYA 5EI8A 4CEGA 3QAME 5E8XA 4DEIA 5C8KA 4L7SA 4BCFA 5I9UA 3KRLA 1Q8TA 3EKNA 4BYJA 2CMWA 3Q60A 3GXLA 2OJIA 2WQMA 4FOBA 3RPRA 3EQFA 1AD5A 3QU0A 4I4EA 4D4VA 5E8YA 4EKLA 2QI8A 5DHJA 3PXZA 3NUXA 3KCFA 1JKTA 2GHGA 4USEA 1FGIA 1PXLA 3UO6A 1OL7A 1G8AA 3SAYA 3FKOA 2WQOA 4P2KA 3NR9A 4ITIA 4R3CA 3S1HA 5EHLA 5ACBC 3FLWA 4KS8A 1FMKA 3D5VA 3NUNA 4FSTA 4H36A 4C34A 4CRSA 4ENXA 3KULB 2W1CA 4JS8A 4YLKA 2XKDA 1BL7A 2XNEA 3ALOA 3MYGA 5HG5A 1ATPE 5HIDA 3OTVA 4EHGA 3A8WA 3R01A 5L3AA 5BVOA 1YDRE 1Q4LA 2VX1A 5FD2A 4BKYA 1J91A 1OPJA 2ITWA 5CEKA 5HBHA 3MH2A 4IADA 3LFFA 5KMKA 3ID6C 1OMWA 1YXVA 5B7VA 4KD1A 1KE6A 1PMNA 3LHJA 3POOA 1OPLA 3IDCA 4X0MA 4FSRA 4RVTA 1YWRA 2XK6A 4IW0A 3A61A 4ZAUA 1OIQA 3EQCA 3BX5A 3OBJA 5C27A 4GU6A 1O9UA 1R39A 3AC3A 4IFCA 3RK5A 1KOBA 2HAKA 3E3BX 3KMMA 2YM4A 3UP7A 4OLIA 4YC3A 4WRGA 5KX8A 2ZB0A 4CV9A 3SW7A 3JVRA 5CI7A 4A9YA 2PU8A 4E6DA 3D7TB 3I4BA 4ZIMA 3H0YA 4GT3A 4D4SA 4ENYA 5HD7A 5AADA 4CKRA 1O6KA 4F6SA 4FT9A 2GNJA 1SVHA 2W17A 2YDJA 4TNBA 1ZY4A 2WNTA 4NFMA 2ZDTA 3PZEA 2PMIA 4IEBA 5HKMA 1LPUA 2YERA 4RWIA 4AZEA 4PNKA 4GUBA 4FSWA 4AZFA 4AWIA 4ZLZA 3RZBA 3I7BA 4UBAA 2ZJWA 4IB5A 3QTXA 4WG5A 1CM8A 4LG4A 4RJ4A 1JPAA 5ACKA 4EOKA 4PWNA 4O38A 4FZ6A 3CY3A 4XX9A 5EM6A 4EYMA 3V51A 4U45A 3WZUA 3TDWA 2NPQA 3ORIA 3FUPA 4IVAA 5HCZA 3R1SA 4WO5A 4XBRA 2BZKB 3PTGA 2BIKB 3DBFA 4TT7A 5DRBA 5F4NA 4QP2A 3R73A 4D2VA 4OTQA 2A27A 2BDFA 4X3FC 1VYZA 4GVAA 4NSTA 1IA9A 4EWHA 5FRIA 3RHXA 4USFA 5IA4A 5HESA 3NCZA 1O6YA 2QOQA 3IECA 3C0GA 3PWYA 4XNEA 5TT7A 3TG1A 4O0VA 4BVUA 2BDWA 2W4KA 3FL5A 1Q41A 3NPCA 4WOVA 1MQ4A 4M14A 3TJCA 4C57A 4ZZNA 3U6JA 5J1WA 1M52A 3COKA 3EFLA 3W2OA 3R22A 4XUFA 3O96A 4O0RA 3HMOA 5HE2A 5BYZA 2O8YA 2J0LA 3B2WA 3HMMA 5TR6A 3ETAA 2B4SB 3DJ5A 5JGAA 4CFUA 4J71A 3E88A 2W1GA 4DBNA 3NCGA 4TRLA 2XIRA 2O0UA 4ZMEA 3BI6A 3ZOSA 2RGPA 4X2KA 4CYIA 3RK9A 4BCNA 4WRSA 3U8WA 5LOHA 3G9LX 2BR1A 4CTCA 5LQFA 3R28A 4YO4A 3U55A 3GU6A 3Q2MA 1GIJA 4EK5A 5EM5A 4IMYA 4QMOA 3FMHA 2C6OA 4TWCA 5CALA 3KVWA 4FR4A 2W96B 2R3MA 1PMEA 3SXSA 5DE2A 3VBWA 3HV6A 4BDEA 4GKIA 4BDFA 3FLSA 4I23A 2XEZA 4DYMA 3D4QA 4H3QA 4F4PA 5LCJA 5AV0A 2CGUA 2YDIA 3PXFA 4EUTA 3JR1A 4TNDA 4BR3A 5A6NA 2GFSA 5FEDA 3BYOA 2GNIA 4X3JA 5M4CA 4XOZA 4DHFA 3FPMA 2O2UA 5AAFA 4D2RA 4HJOA 2J0JA 5IH6A 4XV2A 3SX9A 5FG8A 4DA5A 4R5SA 3MGYA 4M13A 4DTKA 3COHA 2I0YA 4NKAA 2ZV2A 1AQ1A 4UYNA 3F5XA 3PDTA 2Z7QA 4Z9LA 4KIQA 4AAAA 4MH7A 4YJSA 5HBJA 3Q2JA 3GI3A 2UVYA 3PJCA 3CE3A 3DBDA 3KF7A 3QTQA 2DYLA 3CKWA 5HI2A 4F6UA 1H00A 1I09A 2BMCA 4MHAA 2BFYA 2UV2A 4LGHA 5BYLA 5HU3A 5IQEA 3ORXA 4JLCA 4X2GA 3TV7A 2YJRA 5AM7A 3MJ2A 4FSQA 3ORTA 4D1XA 4X6RA 4BBEA 1H27A 5JSMA 3W16A 2FSMX 3SD0A 2W1FA 4AOJA 2WMVA 3E92A 3NNXA 1CSNA 4FTJA 4RJ5A 3LXPA 3MPMA 4FOCA 4JDKA 3UNKA 5CT7A 4WNMA 1E9HA 3D2IA 4RIXA 3E3PA 3OEZA 5DBXA 1FMOE 3RBWA 3OCBA 3UC3A 3FWQA 5CSPA 4C58A 2UW5A 3SOAA 2H9VA 3F5PA 2F7XE 2UVZA 4ZTMA 5KE0A 1DAWA 4C4IA 4PDYA 5AP3A 1JWHA 3LMGA 4FEQA 4WNKA 3HP5A 4PF4A 3NIEA 4DN5A 3FEGA 1JSVA 2VWXA 5K5NA 5L8JA 4BDCA 2XK3A 3Q96A 4HNIA 5FM2A 4NW6A 4LFIA 3DLZA 4PTGA 4XP3A 4FYOA 3G33A 4U0IA 4DLJA 5EM7A 4LV8A 2WU7A 3VUGA 3F61A 1YDTE 3D0EA 2BTRA 2B9HA 2G15A 3PZHA 4IZ7A 2XBAA 5CZHA 3R8PA 1CKJA 5AX3A 2X9EA 4K1BA 4M0ZA 2VGOA 4FZAB 4ZY4A 3S4QA 4ACDA 4O6EA 5AUXA 2UW3A 4BDDA 1DAYA 3A60A 4I92A 5E8VA 4E5BA 4CZYB 4YHTA 1Z57A 3DCVA 3VW8A 1NT2A 3F66A 4ZXTA 4DG2E 5L2WA 3R7IA 2UZTA 4PNIA 4NIFB 2UW9A 4TYHB 4X7QA 1L8TA 4IDVA 4U9AA 4MBJA 4K11A 1W98A 3FSKA 3IS5A 1A9UA 3ORLA 5A3XA 3PA5A 2VRXA 1Y6BA 3VNTA 3KREA 5B2LA 1YHWA 3A99A 1SMHA 2ITYA 3ACKA 2OIDA 3UVPA 5IQDA 3MVHA 3AT4A 5ETCA 1LR4A 3LFAA 3VUDA 4C4FA 4HGLA 4HVSA 4DH8A 5HO7A 5JRQA 5K3YA 5AIRA 4GIHA 4TWNA 5E8TA 3VRYA 2UZWE 4M97A 5A4QA 5IF1A 2VTNA 5ITAA 4TW9A 3EQPA 4GFGA 5FWKK 3WF8A 2C6LA 3DZQA 1WBWA 3V5TA 5BVKA 4AF3A 4F1OA 3Q9YA 2HENA 2OH4A 2WTIA 2XKCA 2ETRA 2ITXA 1JLUE 3DK7A 4FTCA 3W2RA 4EHVA 1GNGA 3HGKA 3MA6A 2CKEA 3QUEA 3HVCA 3TTIA 1S9IA 2VX0A 4NCTC 5FM3A 5CX9A 4LOOA 3MVMA 3DKCA 3PSBA 4UXQA 3ZU7A 2ZOQA 4FUYA 2VTTA 4I24A 3VBVA 4RWLA 4RJ8A 4DF3A 3TV6A 2NP8A 5KNJA 5L6WL 3UOKA 3GCUA 3N51A 3IDBA 2XIXA 5CEIA 1PXIA 3ZC5A 4GW8A 4EZ3A 4EOIA 5DNRA 4FK6A 3UQGA 4QPSA 3BWFA 3MFTA 3R9RA 3VO3A 4DTBA 2QLQA 3KL8A 4IC7A 3GEQA 4QP1A 2CNQA 3SVVA 5CEQA 2WHBA 2JIVA 3O8UA 3OY1A 4BDBA 4D4RA 2JEDA 3LFBA 3OT3A 2QKWB 3ZUTA 3TV4A 4DH3A 3LAUA 3D5UA 2EXMA 3NYOA 4CFMA 4XCUA 3QQGA 2BKKA 3D5XA 3GT8A 3VULA 2VWUA 4ZZMA 4XJ0A 4E6CA 5CWZA 1F5QA 5CLPA 3UNZA 3VUKA 3NYNA 3R02A 4Y8DA 5IQFA 4RA5A 3I0OA 3CD3A 4AQCA 4FSZA 4IX3A 4PPCA 2HOGA 1G3NA 2ZVAA 4V0GA 5HO8A 3ZSIA 4RZVA 3VS0A 5F9EA 3L9PA 5AR3A 1PHKA 3EN9A 3H9FA 4ZTRA 5CU4A 1RW8A 3SQQA 3PY3A 2B9FA 3SXRA 2XKFA 3MIAA 5CXHA 4OTWA 5BQ0A 5CZIA 3RAHA 4Z7GA 2VTPA 4DGOA 4HCTA 2O64A 3A7IA 1BL6A 2YM8A 5C8MA 4Q5EA 4O1PA 3MB6A 2BAKA 3C9WA 3RI1A 5IH5A 4AG8A 5HOAA 5GINE 3AC8A 2F7ZE 3MFSA 5EI6A 3OCTA 3DFAA 3VS2A 3HDNA 3FJQE 4RJ3A 2WTWA 3UO4A 5HNIX 4L53A 4QMPA 5L8LA 4MD7E 2HELA 3WIGA 4IZ5A 3UC4A 3GQIA 4ASDA 2FVDA 3DQWA 3MFRA 4QOXA 4H1JA 5DR6A 2IW6A 1PYEA 4UMTA 4CG9A 4W4VA 4BCMA 3P7AA 3ZUVA 2VV9A 3NSZA 5AUYA 5ETIA 3RTPA 2G01A 3OOGA 4RZWA 3MIYA 2X6EA 4EZ5A 1H1PA 3HRBA 4AW5A 2QURA 2CKQA 2NNWB 1URCA 3EQBA 4DITA 5IA1A 3R9DA 2Y4IC 3PIZA 2W9FB 3O50A 3PFQA 3FLQA 1V0BA 4LYNA 3BE2A 3D15A 4W9WA 3A62A 4J97A 5C1QB 4MNEA 2J50A 3RPSA 3EMGA 3QL8A 4GRBA 3VRZA 4I4FA 3RKBA 3FLZA 2J5FA 1QPCA 3VUTA 2JDVA 2OJJA 5L6OA 3FI3A 3U4WA 4F9CA 5EOLA 4S34A 4WBOA 3RNIA 2A0CX 4FA2A 2JIIA 4DLIA 5J7HA 3CPBA 5GIOE 5LCKA 1U5QA 3R2YA 3VS7A 4BCIA 1Q8WA 4MX9A 4AGWA 2AC3A 2PVHA 1KE9A 4PDSA 4BBMA 3F3WA 2PVMA 4M3QA 4F63A 3GC7A 3AG9A 4YJPA 2GHLA 3BKBA 4O7VA 1E1XA 4I6FA 3M1SA 3MH1A 1PKDA 2GPHA 4XLIA 4X3FA 5FBOA 3R8ZA 4AP7A 4FIFA 2ZM4A 3OY3A 4RC2A 5DR9A 4DFBA 4E26A 2YISA 4BGGA 5JRSA 4IBMA 3DAJA 2XF0A 3FBVA 2Q83A 1UWHA 4F08A 4GEOA 4ASZA 5EKNA 5BVDA 1YW2A 4QQJA 3E7VA 4YGAA 3W8QA 2H6DA 2YCRA 1ZOHA 2F9GA 5KMMA 4G1WA 3R00A 4WNOA 3NNUA 3LCOA 2XNPA 5AV1A 4S30A 3L8SA 4FK3A 2W1EA 4FL1A 4RQVA 4O27B 4ZSGA 4CZUA 2PZRA 3E63A 4IXPA 2ETMA 4IWPA 5I3OA 4EJNA 3ATTA 4AACA 2R3GA 3HMNA 3MTLA 5EW8A 3KGAA 4BZOA 4F1TA 2YCFA 4V01A 4BFMA 2KTYA 4XV1A 4MWHA 1UKHA 3HV7A 2E2BA 4J53A 4GK4A 4EOMA 4PV0A 4F7SA 2PVFA 5DT3A 4IAYA 1PY5A 2C5VA 3CGFA 5LVPA 2C3LA 4FTOA 5EYCA 3VF8A 2IVUA 2JKOA 3NNVA 3OXTA 1KUTA 4FGRA 3OCGA 3FMEA 2UZLA 3LCTA 3ORPA 2I0EA 5AV2A 5AAEA 5IDNA 5CSVA 3TEIA 3FMMA 3KMUA 4LGGA 4F9AA 2Y0AA 4EZ7A 5CAPA 4TYIA 4B7TA 1OBGA 4O7SA 1OUYA 2J0IA 5LARA 1R0EA 2C47A 2XVDA 4JDJA 3ELJA 4S32A 2YITA 2R3RA 5E8ZA 3TCPA 2QC6A 3V8SA 3U9CA 1H25A 3QRJA 2YM7A 4FTAA 2V5QA 4G6NA 4GIIA 4I20A 4XOYA 5IEXA 4KRDA 3L9LA 1LEZA 2F49A 4Q9ZA 4OTRA 3QTSA 4C4HA 4CMTA 3HRFA 4YZNA 3KU2A 4O0UA 5CU6A 3UTOA 4AFJA 4F7NA 4UY9A 3QCXA 4W8EA 3ROCA 4E5WA 5ANDA 4KUJA 4YNEA 3WF6A 3G0FA 3IW7A 4MKCA 5LVLA 3MESA 2VWIA 2Y6MA 2WQNA 4BDJA 3LQ5A 2WMTA 4I21A 4U42A 4U97A 2WFYA 4QMZA 3UGCA 4EONA 5KZ0A 2DQ7X 2C3IB 3PJ1A 2IVVA 4HVGA 1WBOA 1W7HA 4O2ZA 2ZB1A 2PE1A 2BHEA 2W1IA 3EKKA 4FL3A 2W4OA 5DFPA 3ZBFA 4QRCA 1M2PA 2FO0A 2UUEA 3PXKA 2O3PA 1ZXEA 4UN0C 1LP4A 3GU5A 2WIHA 2G2FA 5D11A 4DFYA 4Z55A 4FSNA 4LMUA 4RIWA 4RX7A 2I0VA 3G0EA 4L68A 3FHIA 2XM9A 3SA0A 3NNWA 1PXPA 2Y7JA 4YJQA 2RFNA 2IW8A 4YZ9A 3W10A 4PPBA 5D10A 1FBNA 3FY2A 4QP3A 4E4NA 1W83A 3I81A 4NW5A 5E92A 5C4LA 5IKWA 2WTVA 2OH0E 3DKOA 4MK0A 3VBQA 3GENA 2PVKA 4OGRA 1BI8A 4D5KA 2BKZA 5TF9A 1NVRA 3QYZA 4O7ZA 4RX5A 1JNKA 3QTIA 4FVPA 2QQ7A 3UMXA 2CNUA 3QALE 5M4IA 5FLFA 4UZHA 2PK9A 3PIYA 4KKEA 1Q3WA 3CKXA 5CVHA 3TT0A 2BPMA 2ZM1A 3LMHA 2ITNA 4RIYA 3O7LD 3A7FA 5CAOA 5H8BA 4YO6A 2WPAA 4MNFA 3ROYA 3BHTA 3AMAA 1XH7A 2EB2A 4FNZA 3QZGA 4U40A 3C4WA 2C6MA 5HG7A 2VD5A 1JVPP 3RWPA 4HGSA 4KRCA 3MN3A 4JIAA 4XEYA 1H1WA 2X8DA 5H2UA 1PKGA 4ANLA 5BUJA 3QQFA 4IAKA 2VAGA 3VS5A 2C0IA 4X21A 3VJNA 3L8XA 3QX4A 4DH1A 4FE2A 3PE2A 1XBAA 1FGKA 3ORMA 3ENMA 4BCHA 4FTKA 3F6XA 2PZYA 2ZDUA 2WELA 5EYDA 2R3HA 2J0MB 3QRKA 4AS0A 2XB7A 3DBCA 3C0IA 1QCFA 2JIUA 2CPKE 2UZBA 3BGZA 3ENHA 3R7VA 4HVDA 4IQ6A 2HWPA 5FTQA 3VUHA 3JPVA 4O0WA 3UDBA 1KE8A 4H05A 1ZMWA 2XYNA 3BIZA 4XBUA 4CMOA 3QHWA 2XCHA 1U54A 4DGMA 4H58A 3CPCA 3I60A 1YXSA 3V5WA 3UQFA 2YWVA 4WSQA 4MF1A 4JL9A 3CTJA 3BLRA 4NCTA 5IEYA 2QD9A 4GYIA 4QO9A 3SRVA 4E4MA 3UYTA 4EK3A 3TKUA 2WQEA 3D94A 4I0SA 5AR5A 3EWHA 4QD6A 4A9TA 4EC8A 4O7TA 4GSBA 2YM3A 3WE8A 1A48A 2W7XA 4YPDA 3DLSA 4K0YA 3IPHA 5B2MA 3Q53A 2EXEA 4QYGA 1CDKA 3VWAA 5AR4A 2R0UA 2QVSE 3DXQA 2G2IA 2QODA 3RHKA 3GBZA 3HAMA 2BALA 4NM0A 4WA9A 3VHEA 3QQLA 4JDIA 5HEZA 4F7LA 4ACGA 1RDQE 5LMKA 4JG6A 3LZBA 3W8LA 4ZLOA 1YI3A 3ORNA 5CANA 1FOTA 4QPMA 3QXOA 3OWJA 4FSMA 3OC1A 3QKLA 5E91A 4QPAA 2VWZA 2WMRA 3ZYAA 2HW7A 3Q52A 5JFWA 3DTCA 4JAJA 5FDPA 2F57A 4NJ3A 2ITPA 1ND4A 3REPA 4O22A 4ZSEA 5EK7A 3V3VA 3F88A 5AMNA 2BAQA 5CI6A 3H9OA 3EFJA 5GJFA 2WTKB 4MAOA 5HU9A 3Q6WA 4N57A 4C3PA 3OOMA 5HLPA 4IVDA 2E9OA 4G5JA 3II5A
chains in the Genus database with same CATH superfamily
5HD4A 4ONAA 4XG7A 4ANMA 2F2CB 1M17A 1YVJA 3FC2A 3GVUA 3QTWA 4FTIA 4R7IA 3ZH8A 3C4FA 3TDVA 1GZNA 2UW8A 4F70A 4ZJIA 5CSHA 4KKHA 3OF0A 3UIBA 5FP5A 2Q0NA 3OWLA 4M8TA 5IA5A 4EC9A 1IAHA 3OW4A 3PPZA 4L45A 3KRWA 3NYXA 3THBA 4C4GA 5JZJA 4M15A 3O0GA 4YHFA 5BVFA 1PXOA 2JDOA 1TZDA 1Q8YA 2IJMA 2XKEA 3GP0A 4G16A 4Y5QA 3RCDA 3V5JA 2WEIA 3WF7A 2JITA 3OFMA 3DXPA 3MPAA 2C6EA 4HVIA 1FPUA 3UQCA 3GOKA 1OECA 2VTHA 3O8PA 3P7BA 2UVXA 2NO3A 4Y46A 3OBGA 5BUIA 4AXDA 1UWJA 5GJGA 3PFYA 2QOFA 2WZJA 4C59A 2F7EE 2R3IA 4X6QC 1WCCA 5EQEA 4FIGA 4JBPA 2O63A 1ZMVA 3VS4A 1XBBA 2HCKA 2CKPA 3AMYA 5EFQA 1XQZA 3CLYA 2WMBA 3HL7A 2RL5A 2QO2A 4KBAA 4LL5A 2VWYA 3GGFA 4ITHA 3SV0A 3ZO4A 2WTCA 2ITQA 1NW1A 4O83A 5EQPA 4OBQA 3P86A 2J7TA 3FMLA 3V5PA 4IH8A 4CSVA 3WI6A 4E6QA 4EWQA 4TYGA 2W5AA 4EH3A 4LRKA 4DEDA 2GS6A 2Z60A 3BL9A 2OKRA 1TQMA 5CVFA 4YTCA 5KO1A 2CDZA 4ZSJA 1PF8A 5D1JA 5HTBA 1OL1A 3E8NA 5HG8A 4AXAA 4WHZA 4FV5A 4PTEA 1H24A 5FQDC 5HX6A 1H1RA 2WTJA 1CKIA 1UNLA 5TE0A 3EOCA 1J1BA 3PWDA 2OLCA 4BIBA 3R6XA 3BELA 3JY9A 2JKQA 3VN9A 3P5KA 5CAUA 4HZRA 3BV2A 5G6VA 4TL0A 3NW7A 3PA4A 3PP1A 4DDIA 3R63A 3BHHA 3F3VA 2HZIA 1OGUA 4UMRA 3EFWA 4YC6A 1XWSA 4A06A 5EW3A 3Q3BA 4BCOA 3IO7A 3OUKA 4DC2A 3GCPA 4QMXA 3AT3A 4MD8E 2PZPA 4W4WA 4FV2A 2C69A 4MQ2A 2X0GA 5M53A 5D12A 4CVAA 3LLTA 5K4IA 3HAVA 4M7IA 3FPQA 1W84A 3IDPA 4GT4A 3VUIA 4BDIA 4XG4A 1JKSA 2WAJA 3E7OA 3OD6X 4BTMA 1ZYLA 3MS9A 2WEVA 5A6OA 3EL8A 3E8CA 1WVWA 3LW0A 5AAGA 4FODA 4GJ2A 2BZJA 2QOLA 1WVXA 3ZO1A 5AFVA 4FZDB 3ZEPA 4JRVA 3AKKA 2WMXA 3I7CA 3RWQA 2PVRA 3I5ZA 3D7ZA 1XMLA 3LPBA 5AV4A 3HMPA 4BGHA 2X8EA 4EORA 2OFVA 4F99A 3KXZA 2UZOA 4YSMA 4I94A 1ZLTA 5JQ8A 3B8QA 3A8XA 5AM6A 3IW5A 4N6ZA 3VBXA 5KKRB 1WBTA 4QP4A 4FKIA 2YAKA 2VWVA 1DI8A 3GCSA 2HYYA 5EYMA 3NW5A 3CR0A 5T68A 3VS6A 3LVPA 3ZLXA 4YJNA 1F3MC 3UYSA 4LUDA 5HNGA 4BWPA 4M12A 5CSXA 4NTSA 4ANBA 4EH4A 5CF4A 2HK5A 3DPKA 3EQIA 4BB4A 4C35A 4HGTA 3V8TA 2FSLX 5KHXA 3FYJX 3TZ8A 3DV3A 4Q5HA 2I7QA 5KBRA 1Q97A 4B0GA 4PMPA 3DT1A 2X7FA 3UG1A 2PVLA 4L42A 1DI9A 5JZNA 4YC8A 1OKWA 4JOAA 2YCSA 4DBXA 3MSSA 3POZA 5I0BA 3RPOA 4IB0A 4FICA 2G2HA 3RK7A 3AGMA 3HEGA 3F3TA 5HORA 1IA8A 2X0PA 3QF9A 2W4JA 1Z5MA 3SC1A 4D4YA 3KVXA 1BUHA 3HA8A 3OP5A 2A1AB 3TL8A 3QZFA 2ITUA 4FX3A 5FXSA 2GFCA 2WMUA 3F3UA 3ZXZA 4QYFA 3RAWA 3V04A 3VVHA 3DOGA 5J9LA 3I5NA 2DS1A 3T9TA 2I0HA 2ZFYA 3E8EA 3L9MA 4QYYA 2GS7A 3QQJA 3RCJA 3VAPA 2IZRA 3AXWA 3JVSA 4MXXA 3G6HA 4E7WA 4XV9A 4KS7A 4HW7A 3EQHA 3M42A 3N9XA 3LCKA 3JS2A 5DPVA 4ALUA 5A46A 4DFUA 3I6WA 4U79A 4CT1A 3O8TA 2HW6A 4D2PA 2VTIA 2QR7A 2VNYA 1YWNA 3HYHA 4S31A 1H26A 4J8NA 2PL0A 5BYYA 5HE0A 3N4UA 2CGXA 3DKFA 4KAOA 3WILA 2XK4A 4CMUA 4DGNA 4PMMA 4QNAA 4F65A 3C5IA 1SYKA 4I6BA 2IVTA 3NDMA 4ZTQA 3UVQA 3OVVA 2Z2WA 1NY3A 2BZIB 2QOIA 4AE9A 3VHKA 1OB3A 1UU3A 4M0YA 4N4SA 2C5NA 4N6YA 3BRBA 4HNFA 5I4NA 1P5EA 3LJ1A 3OUNB 3IG7A 1GIIA 1P2AA 4MEDA 4YHJA 5ANKA 3FZSA 5K0XA 4H39A 4FZ7A 4KIPA 3C50A 5M4FA 1A06A 2ITOA 5JGBA 5CEMA 3G9NA 3DKGA 4OTPA 3FV8A 4XP0A 4YBKA 5L2SA 2IG7A 3I1AA 5M4UA 1OBDA 5LVOA 3BLAA 3QLFA 3GOPA 2RKUA 4GFOA 4DG3E 4BTFA 2WO6A 3PJ8A 3F2AA 2GNGA 2HY0A 5KMNA 2XALA 2LGCA 5IG1A 5FUTA 4WNPA 5J87A 5LMAA 3LQ3A 1SNXA 5IQIA 3TIZA 4U81A 2GCDA 5LWMA 3IW6A 2VWWA 3MW1A 4BKZA 4I22A 5CF5A 5GNKA 4K2RA 4ALWA 4WG4A 4TY1A 3DNEA 3ZM4A 1Q62A 4BDHA 1FVVA 5DYJA 1DS5A 4KSQA 4W4YA 5CU2A 3QC4A 4ZY6A 1S9JA 2UZDA 3Q4UA 4IJPA 4PX6A 4DAWA 3LCSA 4JJRA 4MVFA 4O0TA 1R1WA 4EJ7A 3F2RA 2OZAA 4DEAA 5J1VA 1K2PA 1ZYCA 5HLNA 2XK8A 3WIKA 2XK9A 3QD4A 3TZ9A 3FMJA 1G8JA 4O4EA 4GU9A 2QONA 4BZNA 1XH5A 2OG8A 4LOQA 2UW4A 5KMIA 4UX9A 2QKRA 2PYWA 4RRVA 4O4CA 3V5LA 3TTJA 2BROA 1Q24A 2EU9A 3DY7A 2GQSA 4QP9A 3QGWA 4S2ZA 3ZHPC 3MH3A 3P5JC 2XA4A 1ZRZA 1H07A 1YOLA 3M2WA 3SG9A 3SDJA 2REIA 4OW8A 4APPA 2VU3A 3P4KA 2BFXA 5IMEA 4AGUA 2JFLA 2WMSA 3UNJA 4FNXA 4CT2A 4Y72A 2XRUA 5EOBA 3BPRA 4KNBA 1KE7A 3P9JA 3PG3A 1V0PA 2PSQA 4KWPA 3LFSA 2X6DA 4K6ZA 4M67A 4BIEA 2C4GA 1H0WA 1ZOEA 2NRUA 4DDGA 4ZMFA 3EHAA 3QA0A 4BIDA 5CXZA 5KMJA 2EB3A 4FT7A 5M09A 3BHVA 5CYIA 3NZ0A 4BYIA 1M7NA 3UE4A 5AIKA 1HOWA 5EW9A 1YKRA 1ZMUA 2C5XA 5JQ5A 4RX9A 4GS6A 4EL9A 1J1CA 3EN5A 4FYNA 4LL0A 2PULA 4B8MA 3TI1A 4K18A 3HA6A 3LFQA 1GIHA 5AR7A 3MY5A 3RVGA 5LMKC 4BCPA 3KFAA 2J5EA 5F95A 2UW0A 2RFDA 4R1VA 2C0TA 3W2SA 4BDGA 4KB8A 4C2WA 4QDVA 4ZEGA 4XYFA 2OXXA 5I9VA 1YHVA 3PXYA 3PLAE 4DEBA 1XJDA 4TTHB 3CGOA 3BCEA 3MBLA 3KCKA 4MXYA 2PUNA 5C01A 2E9PA 3F7WA 2XIZA 3NGAA 3VIDA 4XLVA 5A4LA 4ANQA 4HZSA 3R1NA 4ZLYA 5HICA 3U6HA 1H8FA 3PIXA 2AUHA 4FKQA 4J52A 4YTFA 2QLUA 2W06A 4RC3A 4G3CA 3DQXA 2JKKA 5IUHA 4JVGA 4FNWA 4DCAA 1PYXA 5J95A 5J8IA 5DGZA 4LM5A 4DFXE 5E8WA 4E4XA 3KK9A 3NLBA 3ORKA 3LXLA 3QKMA 3RPVA 4FTUA 5CU3A 4IWOA 3WF9A 4APCA 4OT5A 3D9VA 4MXOA 3DNDA 3KXNA 3B8RA 3PJ2A 4FV4A 3VC4A 4D58A 4LUEA 5J5SA 3UZRA 4AZWA 2Z7RA 2R3FA 3AGLA 4R6VA 3UPZA 4FIEA 2VX3A 3C13A 4UMQA 4HOKA 2QU6A 1NA7A 5B0XA 1F0QA 4ZK5A 4MYGA 3DS6A 3PLSA 1J7LA 3GU8A 5FDXA 3W0NA 3ZRKA 4YSJA 4FT3A 2XIKA 4V0GB 3S3IA 4G31A 1MRVA 2ESMA 2JBOA 4FSUA 3VBTA 4BWKA 4B8LA 4ZOGA 1GAGA 5H8GA 4E73A 5I9YA 2O65A 4YMJA 4DFNA 5KBQA 4PP9A 3ZRLA 4G3GA 1LEWA 3UIXA 2RG5A 4PP7A 2WMWA 3CBLA 4A4OA 5M08A 1WBVA 4NM7A 3NUYA 4WIHA 3QTUA 4BL1A 4KIOA 3S2PA 3HX4A 5BVNA 5EDPA 2C1BA 3EN6A 3DAKA 4QTEA 1VLRA 3D14A 2QOOA 4KINA 4FTNA 3NW6A 4FT0A 5D7AA 3ITZA 4C38A 4PMSA 2VTSA 3E8DA 4RQKA 5LWNA 3W18A 4DFZE 4L8MA 5E90A 2YIQA 5IA2A 5EDRA 3RINA 5BVEA 4O81A 3CTHA 5JMSA 4L3PA 3UZTA 2H34A 4FKSA 3UOHA 4L52A 1P4OA 3C4XA 4GJ3A 2G9XA 5HZNA 2WOUA 3K3IA 4JBOA 3HUCA 4AZVA 4U3YA 4DE4A 2QHMA 2HZ4A 4XG3A 2HWOA 2JBPA 4W4XA 4E4LA 4FIIA 1P14A 1MQBA 4WUNA 4AA4A 3PA3A 5BMSA 4M69A 1STCE 3KXXA 3TWJA 4MNEB 4KIKA 4K8AA 4AW1A 4C33A 1YXUA 3ERKA 2AEGA 4N0SA 3W1FA 3TZMA 4KABA 1SZMA 2R0IA 2JD5A 3RM6A 3L8PA 5AA9A 2I1MA 1YXTA 4TN6A 5HX8A 2XJ1A 3ULIA 4GUEA 1VJYA 3BLHA 2XJ2A 4QNYA 2YIXA 5LMBA 4IX6A 1IG1A 4F9BA 3K5VA 5KCVA 2YIWA 5I3RA 5L4QA 4E5AX 1MRUA 2YM6A 4ZTNA 4FKVA 2J2IB 4R7HA 3ZS5A 1PXKA 4AT5A 1SVEA 4AQKA 2VTOA 3E87A 3R21A 2ZV9A 3ANQA 5LJJA 5T6KA 1ZAOA 3CJGA 4BCJA 3AD4A 4IC8A 2CGWA 2XIYA 4U7ZA 3S95A 3AD5A 4O4BB 4D2TA 4DINA 4Z3VA 4CZTA 5I5ZA 1H28A 1YDSE 4JI9A 1YOJA 4X3FB 1JAMA 4AA0A 3IQ7A 3WOWA 3BEAA 4F0IA 4RA4A 2PZ5A 5FGKA 2AQXA 2RIOA 1YI6A 1M14A 4LV5A 4RVKA 5DMZA 3Q4TA 2BHHA 4IWQA 2CKOA 3HP2A 3PRFA 2BIYA 4FI1A 4KBCA 2UW7A 5J5TA 2XM8A 3TNQB 2J51A 5BMMA 3PRIA 3PSCA 4ITJA 4CQEA 2YIYA 3VJOA 2C6TA 3P7CA 2VO7A 4JAIA 2XK7A 5CNOA 2CCIA 3OWPA 2BRBA 4B6LA 4ASEA 1XH8A 2JLDA 3ORZA 4CRLA 1SVGA 5AX9A 3E5AA 1HCLA 4O84A 4PMTA 2C0OA 4CFNA 4QMTA 3ZDUA 3QQHA 3PY1A 4OTGA 4IZAA 4MXZA 3AC5A 4II5A 1GZKA 3Q5IA 4Y83A 2XH5A 3QGYA 4IACA 2BILB 4WD5A 5E8UA 5GZ9A 4FKPA 2VTRA 1JQHA 2BRMA 1JSUA 1U4DA 2FGIA 1OKZA 5EYKA 4NFNA 1UU8A 5HHWA 3DB6A 3COMA 3KN5A 1OM1A 5CQUA 3HNGA 4FV9A 3FDNA 5ETFA 4EEVA 4F09A 2VNWA 2OW3A 4XV3A 3FMNA 5TO8A 4DEHA 3EN7A 3Q9ZA 2BRGA 2HY81 4IDTA 4BCQA 4DCEA 5JFVA 4O96A 4NH1A 1DM2A 3HKOA 4YUQA 4RFMA 3I79A 3T8OA 1OI9A 3OEFX 2ZM3A 3TXOA 3GB2A 2J6MA 2OF4A 3SLSA 2IN6A 3G51A 4EOLA 1KSWA 4GCJA 3HV4A 5CEOA 4CFWA 4IM0A 3QBNA 4GYGA 5IISA 4J1RA 1OPKA 3AC4A 1KWPA 2VTQA 3O2MA 2OZOA 2NRYA 2XNMA 2B55A 4G17A 2JFMA 5IH4A 1RJBA 2OIBA 2OWBA 2Z7LA 3NAXA 2PMLX 3GUBA 4FKTA 4DH5A 3UG2A 4EQMA 3MFUA 4O82A 2F4JA 5BVWA 4FT5A 2GHMA 4USDA 4AN2A 5DR2A 2JAMA 4Q9SA 3ATSA 3PUPA 1B39A 4B4LA 3CS9A 3MV5A 4I93A 3AKJA 1YHSA 3V5QA 4BI2A 2C68A 4F1MA 3BGQA 2GQGA 4R7BA 5AJQA 3ZUUA 1H1QA 4KBKA 4A9SA 3Q6UA 4OBOA 4OBPA 5J79A 5HO6A 4J98A 4ZY5A 5GJDA 2VTJA 2CN8A 2OJGA 2VTMA 3D83A 4UALA 4WKQA 3OWKA 4EH5A 4EI4A 5JFXA 3IONA 5IZFA 1WAKA 2Z8CA 2XMYA 4A4XA 4JRNA 3NUAA 4QYEA 4RFZA 5JN2A 4KA3A 1FVTA 1O6LA 4D0WA 5DN3A 2XZSA 3IGOA 2GTNA 4FKRA 3TIYA 4AU8A 4AOIA 2IPXA 3R04A 2RG6A 5I9ZA 3TYKA 1UA2A 1XKKA 4EBVA 5M55A 3BGPA 4X2FA 1Q61A 1REJA 4RIWB 4FEWA 3RAKA 3Q4ZA 3P23A 5JK3A 4QP8A 2C3JA 4LOPA 3ZFXA 3EZRA 5HCXA 1URWA 3LMIA 3R30A 5CENA 3ULZA 2UZUE 3L8VA 3FI4A 3GNIB 3U4UA 2GNFA 3A7GA 4L9IA 4NT4A 5ANJA 4HCUA 2OI4X 5FTGA 4CNHA 2GTMA 5IU2A 4YBJA 5CNNA 4E1ZA 2C30A 4CV8A 4FBXA 3OZ6A 3KN6A 2EWAA 3NEWA 1U59A 3F3ZA 1FINA 3SW4A 3BHUA 4BICA 3D2KA 3LJ2A 4TPTA 4MUQA 2W0JA 4U5JA 2XNBA 5K5XA 4ASXA 1JSTA 2YLFA 2EVAA 4UB7A 2X8IA 3BHYA 3FL4A 3U87A 3JXWA 1OL6A 2BAJA 5BX0A 3ZZWA 3AOXA 3NVKI 4G3EA 2R3LA 4F0GA 4RIYB 3A7JA 3CC6A 4I41A 5FBNC 4JMQA 1TKIA 5GZ8A 2GQRA 4JBQA 4FG9A 2ZMDA 1E1VA 1PXNA 4EK6A 4IWDA 3Q04A 3QRIA 3U54A 3R71A 2P2IA 3KY2A 3R8UA 3WBLA 4Z7HA 3KXGA 3R1YA 4NK9A 3U9NA 1ZOGA 4QP6A 3P79A 5DH3A 5C4KA 4B9DA 2JDSA 2WQBA 3EB0A 4FUXA 5ANEA 4PL5A 2XARA 1H1SA 1WMKA 3Q32A 4O91A 5H8EA 4C36A 4A9UA 1B38A 3U6IA 1K9AA 4Y5HA 4RLKA 1G8KA 3F5UA 5LVMA 2OJ9A 2B9JA 1WVYA 3ZTXA 3MA3A 5JT2A 2R7BA 4TWOA 3TNIA 5JEBA 3IOPA 5M56A 3CIKA 5IMXA 1OKYA 5L2TA 2P55A 1NVQA 3GC8A 1U54B 2B0QA 5GZAA 3NX8A 1IR3A 1ZY5A 4DT8A 4OTHA 4BHZA 3QTZA 3QLGA 2WMAA 3SRVB 4QYHA 4G3DA 3ZC6A 4J95A 3C7QA 4L01A 3ZM9A 4UMPA 4UXLA 3MDYA 3ZEWA 4RJ6A 4TWPA 5JFSA 4BJJB 1WBPA 3OCSA 4L3JA 4J96A 1PXJA 4RVLA 3JY0A 2UW6A 4JG8A 3WZJA 2C6DA 3LCDA 4E20A 4RWJA 4JQEA 1R0PA 3C0HA 3BQRA 2C6IA 5KZIA 4WSYA 3FZRA 4I5PA 3LM5A 5DRDA 2E9NA 2Y4PA 4FTMA 3NUPA 5HTCA 3O51A 4C4EA 4ID7A 3WZKA 4GG5A 2QU5A 2RFSA 5IQBA 5JGDA 3NUUA 4YLLA 4RMZA 1UNGA 2VZ6A 3GFEA 1PRYA 3PXRA 2J9MA 3RMFA 3KULA 2C5YA 5M07A 5GHVA 4RVMA 4LRJA 4QMLA 2UZNA 3DZOA 1MRYA 1QPEA 1IEPA 4YZCA 4IB3A 3FZOA 2W9ZB 4ZTSA 4UYAA 2QG7A 3NVMB 4IVCA 3IW4A 4XG9A 2CLXA 2W1ZA 1MP8A 2X1NA 4R3RA 2VGPA 3BBWA 1H08A 3E62A 3KEXA 3TNWA 2ONLC 4NM3A 4L6QA 5DI1A 5FXRA 2WOTA 4CCBA 3K54A 4F6WA 4DFLA 2C5OA 1LUFA 2XUUA 2H96A 2Y9QA 4FKWA 5EHYA 3FXWA 4QT1A 3OXZA 3SHEA 2Y8OA 2YEXA 2R64A 2PPQA 1REKA 1PMUA 3CJFA 4NTTA 4RC4A 1J7IA 4FV6A 2QOBA 5C03A 3ZLSA 5A9UA 1Y8GA 1ZWSA 4I0TA 1CKPA 4AUAA 3KRJA 1SNUA 3NUSA 3SXFA 4CYJA 3UPXA 3F5GA 1SM2A 2HXLA 4PDOA 5CS6A 3QD2B 2PVNA 3Q4CA 1KE5A 4EKKA 3D7TA 4D1SA 4AXFA 4EH6A 3TKHA 1MUOA 3W32A 4P5ZA 4FSYA 3JYAA 3KF4A 4L44A 4EBWA 2CSNA 3GCQA 4RIOA 5F20A 2OF2A 2H8HA 4QP7A 4O1OA 5EG3A 4HYUA 3KXMA 4PUZA 1ZYJA 3UVRA 2X2MA 3FYKX 3G6GA 3UMWA 1GJOA 2VUWA 4MD9E 3OT8A 4HCVA 4LRMA 5DT4A 5HCYA 4YP8A 3FC1X 3DGKA 3LFNA 3TJDA 5L6PA 1T45A 2A98A 5FTOA 3UODA 2Y4IB 1WBNA 3ODZX 2KULA 2PY3A 2OXYA 4ANOA 4D2SA 5A14A 4FGBA 2YABA 4H3PA 5IPJA 3KXHA 3R7GA 2ITTA 4QMQA 3DDPA 1U46A 4UMUA 2P2HA 5EDQA 1IASA 3BU5A 4D28A 3N4TA 3EQGA 4YNOA 3QA8A 1IRKA 1WZYA 1UU7A 3O7LB 4FVRA 4RX8A 3R2BA 4IB1A 3VW6A 3BL7A 5IUIA 3ZZEA 3JUHA 1RE8A 5HG9A 4ZS4A 2OK1A 5JKGA 3TUBA 5AP1A 3LFDA 4XG8A 5E9EA 5GIPE 3G2FA 4W9XA 2ACXA 4GG7A 2X2KA 3A4OX 1Q99A 2PE2A 4QMUA 4I5CA 4X2NA 5CF8A 3Q9WA 1BMKA 3QRUA 5D9HA 3FZTA 2YFXA 4IAFA 2BRNA 4EQUA 3IGGA 4FV8A 4GK2A 3ZCLA 5LXMA 4F7JA 5CT0A 3BYUA 1GZ8A 3EQDA 4IFGA 4LQMA 5JH6A 1HCKA 4ACMA 4HYIA 4R1YA 3TNPC 2R3OA 4J99A 3WF5A 4F9WA 4ZP5A 4U6RA 4IM2A 4FV3A 2DUVA 4ZTHA 5AWMA 3QRTA 4FEVA 5BV3A 3TUDA 4ZZOA 5AR8A 4ZTLA 3UOLA 4I5HA 2OU7A 3R7OA 4HVHA 4W8DA 2YA9A 5CSWA 3KRXA 5EKOA 4UWYA 2IZTA 3DXNA 4CD0A 2R2PA 3T3UA 4TYEA 3P0MA 2GNHA 2EUFB 4C0TA 2IZUA 5I9WA 4I6QA 4G9CA 3W55A 2JDTA 1K3AA 2XYUA 1YXXA 1V1KA 3R7YA 1ERKA 3CY2A 3BLQA 2X0OA 3H9RA 5E1EA 4O0YA 1J3HA 2X4FA 3QCYA 3VS1A 4CKIA 1XR1A 4CG8A 1PXMA 3QX2A 4IM3A 4U44A 3VBYA 3LE6A 3RNYA 4C62A 4I6HA 4DGLC 4OAVB 3W0SA 3I6UA 5AUVA 4I3ZA 2IZSA 3PYYA 5AP4A 4FEUA 2E9VA 3LFCA 1JOWB 4IAZA 4TYJA 4B99A 3SKCA 1Q8UA 3LJ0A 1OIUA 3LLAA 3CXWA 3U51A 2WGJA 2UZVA 5M44A 4XMOA 4LGDA 4UV0A 5IQHA 1W8CA 3FQSA 4GV1A 5FP6A 4O2PA 1BLXA 3FHRA 1OITA 4WBBB 1OZ1A 4IAAA 5E4HA 3GC0A 4AW2A 2B52A 4G6LA 4L46A 2PUPA 4YTIA 4MTAA 2X4ZA 3RPYA 5L8KA 3G15A 3DK6A 3LXNA 3RM7A 5IUGA 5AR2A 5FEEA 5HLWA 2PVJA 2NYAA 2FH9A 2X7OA 2P3GX 5AP6A 3OHTA 4FV7A 5BPYA 2CCHA 1OKVA 2YZAA 3EL7A 2IO6A 2P0CA 3FXXA 4E8AA 2V7OA 4BN1A 1X8BA 4BKJA 4GFMA 3CQUA 3IK3A 3ZLWA 2OSCA 4X2JA 4EOPA 4C61A 4FTLA 2B54A 3OW3A 3L1SA 2ZMCA 4V04A 3PJ3A 4BBFA 3W0OA 4A9RA 2QNJA 1PJKA 3QD0A 2YZLA 3FI2A 2LAVA 5EQYA 5A4EA 4PRJA 2PUIA 4G34A 1UV5A 2YHVA 3CTQA 2B53A 4O0XA 4TKSA 3V8WA 3K2LA 4EHZA 3TZ7A 3ZDIA 3DA6A 4BDKA 5AEPA 3N4VA 3FQHA 5HE3A 2B1PA 2QHNA 2BCJA 4QTCA 2IVSA 5ICPA 1YRPA 3HECA 2VN9A 4P5QA 2WMQA 1CMKE 1VEBA 3AT2A 2V7AA 3QUPA 5I9XA 3TUCA 2YLEA 4FNYA 2PUUA 4D55A 3FKNA 3HZTA 3KB7A 4U43A 5CQWA 2FA2A 4RIXB 5B2KA 1Z9XA 4DH7A 2CLQA 4AGDA 1QPJA 2XEYA 4O86A 1V0OA 3P1AA 4NIFA 5K0KA 3ALNA 5M06A 4QTBA 2X0QA 4TYHA 2UZEA 4CLIA 5IQCA 3BU6A 2CJMA 3GFWA 1Q3DA 3H30A 4QMMA 1R3CA 2HZNA 1TQPA 3ZFMA 4C4JA 4CLJA 4WUAA 3E93A 5IEVA 4CQGA 4FIHA 2YCQA 5EHOA 4GL9A 4OTFA 4EUUA 4UWCA 4G9RA 1P4FA 1QPDA 2Z7SA 3F7ZA 4BGQA 4C2VA 5HVKA 3FMDA 4AXEA 4JR7A 2AC5A 5E8SA 4G5PA 5TOZA 4YZMA 3F82A 3ZSGA 4XS2A 2BTSA 4YR8A 3FMKA 3MWUA 2J90A 3ZXTA 2GMXA 3DTWA 2JC6A 4PY1A 1KV2A 3SGCA 2ZAZA 4Y73A 4AT4A 2BVAA 4NEUA 5EH0A 4XG6A 4CFXA 2P33A 4EOOA 4CFVA 3FI8A 4NYEA 4LDTA 3CEKA 5CVGA 4O7WA 3R1QA 4JR3A 3V6SA 4P4CA 5HIBA 1XH6A 4EOQA 3DK3A 1ST0A 4DT9A 4FTTA 2EXCX 1YI4A 5AUWA 4L00A 4C8BA 2OGVA 2OZAB 4XRLA 3C5UA 3OG7A 1TVOA 4D9UA 4ZJVA 3FLNC 4NKSA 4UEUA 1EH4A 5EM8A 4CCUA 3BQCA 2IWIA 2VO3A 2GU8A 1GZOA 3MY1A 3QHRA 4NZWB 4MCVA 4HPTE 3UDTA 4GK3A 4CGAA 4YJRA 3EYGA 4C37A 2FSTX 3PPJA 3R9OA 3MVLA 2JGZA 2PVYA 2OO8X 3HV3A 4PQNA 4ZSLA 4BI0A 3ACJA 2C6KA 3QD3A 3W0QA 3AD6A 2Z02A 5J9YA 5A4CA 2VO0A 3O71A 4ZJJA 4RPVA 5D7VA 4AW0A 4BTJA 2YAAA 3FY0A 4QTAA 5J7BA 3NYVA 2XCKA 4ALVA 2I6LA 3EQRA 1R78A 3FSFA 4JBVA 3R0TA 3TNHA 4D9TA 4O7RA 3ZSHA 2WXVA 2PHKA 4A07A 2WTKC 4J7BA 2FYSA 3QC9A 1KOAA 3BBTB 3D5WA 4OTIA 4IVBA 4GT5A 4DGGA 5KHWA 4IX4A 5KMOA 2A4LA 5HTIA 4D2WA 4PTCA 4NL0A 4I1ZA 5CTPA 4H1MA 1VYWA 3LIJA 4BF2A 4QQCA 1Y8YA 1M2QA 4FEXA 4NU1A 4LV7A 4DEEA 3MB7A 3FLYA 2FUMA 2C1AA 1Q8ZA 4IANA 2GSFA 3S0OA 5AUUA 3VONA 4LMNA 2FB8A 3EFKA 5AUTA 4GVJA 2WTDA 1XHAA 3H3CA 2WKMA 3OROA 4K33A 5ETAA 2YM5A 4PL3A 4R5YA 3PY0A 2W99B 2ONLA 2XJ0A 2YN8A 3QUDA 4XP2A 2ZV7A 3TN8A 4BHNA 4DG0E 1W82A 3KKVA 5AP5A 3DJ7A 2VTLA 4AOTA 4ZSAA 2YIRA