4AGGA

Structure of a tetrameric galectin from cinachyrella sp. (ball sponge)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
144
structure length
144
Chain Sequence
PIQSIKVDPMKSGGLGVVYRSPDKGRVSLYLYNDGEDILLVVDARFDWRGEQNVLVLNSKFAGGEWGPEVRPEGFPFPCCGYVTTITVRVEIGADGFTLSANGIEIVKYPYRDGLPPPVTKFQYVFQDQGASETAQLESLSAYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Tetrameric Galectin from Cinachyrella Sp. (Ball Sponge).
pubmed doi rcsb
molecule tags Carbohydrate-binding protein
molecule keywords GALECTIN
total genus 23
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4aggA00
1IOAA 1XQNA 3AP6A 4NOTA 4LBQD 1C1FA 2DU1A 3C2UA 1C57A 5DXDA 4BPZA 2VXRA 4FPJA 1SLAA 4CZSA 1LENA 2NN8A 1V6MA 2YROA 3LSEA 4ISRA 1N1VA 3V65A 1HDKA 1BYHA 4XE9A 2EXHA 3WG1A 1CQ9A 5CAZA 2ARBA 4BOWA 1SACA 3BODA 1FX5A 3WDVA 4K20A 4LBNA 2GNDA 3AK0A 4GKYA 5GM0A 1EPWA 2ZACA 2WSVA 3MPPG 1JN2P 1LOCA 1W6QB 1APNA 5JVVA 4KBBA 4AGVA 3V0BB 2A6ZA 3AP4A 4YM0A 2DVDA 1MACA 4WVVA 1KITA 3I4IA 3RSJA 1CPMA 5KXEA 1Q8VA 3MW2A 3TAYA 1O4YA 1UL9A 2ZGRA 1F5FA 3LCPA 3V64A 2ZMNA 1G9DA 5T50A 3N7MA 4XBLA 5IUQA 3SNMA 3MW4A 3VKFC 1DYKA 3ZPYA 1DBNA 2R1DA 5T5LA 4Y22A 3VKNA 4TZDA 4PBPA 2GN3A 3ZSMA 1UN1A 5DG1A 4YZ5A 2EAKA 5EWSA 1LOBA 3O5SA 3POYA 5DUUA 3RMXA 1ZM1A 2V5YA 3RMYA 2DUOA 3WOGA 3ZSJA 3IPVA 4H55A 4LBLA 1C4RA 2AH2A 1QNYA 2PHWA 1W6NA 3AYAA 4TYSA 5E8AA 1W6PA 1URXA 2CY6A 2R0HA 4YGBA 2PHFA 1Q56A 2D44A 5GJ6A 3WDXA 4YM1A 1MZ5A 2A6XA 3O0WA 2OUHA 4XIOA 3UK9A 2GNMA 2ZGSA 3W58A 3B3QE 3ZYRA 5E89A 1H9WA 1MS0A 4FPLA 1W6MB 3AP9A 1Q8QA 2DTYA 3M2MA 5GZEA 2ZGTA 1ENSA 1QMJA 2XG3A 4YM3A 1LOGA 1LHNA 5GZDA 1V00A 3B69A 3USUB 1UZYA 1LOEA 1MZ6A 3CNAA 4YGCA 1G7YA 1AJOA 1U0AA 3HR9A 1KRIA 3N7JA 2ZHLA 2VU9A 2D7FA 1GZCA 4XXPA 4Y22B 2ZMKA 4R9DA 1FYUA 5L73A 3O12A 4GALA 4M3CE 4FPEA 4DPNA 4YW3A 2ZAAA 2WQZC 5T5OA 1LU2A 3HMYA 2E51A 5GLTA 3SLIA 3D5OA 4YZ2A 1SCSA 5JOZA 4FQZA 1W6PB 1S0CA 5H9RA 2RHPA 1LHWA 3IPVB 2FHRA 3WLUA 1ULEA 1W6NB 4XZPA 1HQWA 5EXOA 3OYWB 2KM2A 3O0XA 5GZGA 5HCFA 2JDZA 4XJUA 1ULGA 1YO8A 2SBAA 2OW4A 1JOJA 2WJSA 2WT0A 3OY8A 1LHOA 1LESA 4M3CB 4R9CA 4U2AA 2ERFA 4AGGA 4XYXA 1LJ7A 4WVWA 1KDKA 2DVGA 1GZWA 1N3OA 1YI7A 2GNTA 5JLVA 3ENRA 1QDCA 4YM2A 1SCRA 2OVUA 2E7QA 1GKBA 1KQRA 1UX6A 3V0AB 4K21A 2PHTA 3H0OA 4RA0A 3USUA 5DUXA 1AF9A 2I2SA 5JOXA 2EIGA 2VH9A 1R1ZA 1IKPA 3OBTA 1V6JA 3OJBA 3UJOA 3VKLA 4ITCA 4FP2A 4Q1RA 5SV8A 1BJQA 2YV8A 1QOTA 3ASIA 4R9BA 4YG0A 5F9TA 4XMIA 2GN7A 4Q1PA 1KJRA 3M3CA 2GALA 4DFSA 1LEMA 1GZ9A 1W6OB 3APBA 1MS3A 1WBLA 3OPZA 3WG3A 1IS5A 1S0GA 3IKWA 3KM5A 4F83A 3ZXEA 4JC1A 3BIWE 4LBQB 3RQ0A 1S0DA 2ZGLA 2GMEA 1GYKA 3QLQA 4Q26A 3VV1A 3WDTA 2R1BA 1KJLA 4M3CA 1JBCA 2ZGNA 2A3WA 3AZXA 1FAYA 1LULA 2V73A 2WLQA 1WW7A 4FPCA 3AZZA 1GICA 4UW4A 5GLVA 2ZHKA 2CTVA 1HLCA 1NLSA 1GSLA 1S1AA 4PCRA 1IS4A 4M3CF 3OBRA 2D6MA 4Z8BA 3A0NA 1A3KA 4XMAA 3ZXLA 4HANA 1GNHA 1YYNA 2P34A 3R05A 3WDWA 4Y24A 2PHRA 1H30A 2UU8A 3ZSKA 2D3SA 1WLWA 1WW6A 5H9SA 5IK5A 2NYYA 3SH5A 1G9AA 4XIKA 1SLIA 3WDYA 5GZCA 1SBFA 4RL7A 1G9CA 3D6EA 1WLCA 2C9AA 3AFKA 2A3XA 1DQ4A 3ZSLA 1MS1A 1WLDA 3JU9A 3DGTA 1S0JA 2ZGMA 3ATGA 4GWNA 4Y1VA 1BKZA 1N1TA 3R4SA 1QU0A 1GBGA 1Q8OA 3ZXFA 2WT2A 3M1HA 1Y7BA 2ARXA 1SLTA 1B09A 1FATA 2ZBJA 1JXNA 4C1WA 1CN1A 2ZGKA 5T55A 2VUAA 4SLIA 2CYFA 3WG4A 3N7LA 4D69A 1OKQA 4FPYA 1WW5A 2CWSA 3O0VA 1CJPA 2ZGOA 2AYHA 2UWCA 4YW4A 3N35A 1G8WA 1LEDA 2DWRA 2ZA9A 5GLUA 3AZVA 1VAVA 1V6OA 1YXWA 2ENRA 2R49A 3NWKA 1FNZA 1NXD1 5KXCA 1IS3A 4I30A 4ATFA 1G9BA 1DZQA 1FV2A 1VLNA 4P9XA 1O4ZA 2YMZA 3SISA 1QNWA 4XJWA 4Y1ZA 5EYXA 4FOYA 1F9KA 3AXDA 3V0BA 1DQ1A 1LCLA 3RG0A 1G86A 1A8DA 1QKQA 4XILA 2LTNA 1LODA 5GZFA 4AWDA 5HCBA 2D3RA 1DIWA 1IS6A 1HQLA 5AVAA 5GLWA 4LBOA 4P14A 5CB7A 5BYNA 1AX1A 2DURA 2DVBA 4LBJA 2D6NA 4LBQA 1OQ1A 1S0IA 2D3PA 2W39A 5FREA 5T52A 2WT1A 1FNYA 3M3QA 5LK5A 1Z78A 3SH3A 4YFWA 1LECA 2P3JA 4BMBA 1ENQA 4C1XA 4FPHA 2NZ9A 3BOPA 4XJ8A 1SFYA 3POWA 4XTPA 1D2SA 1W6QA 4W65A 5CNAA 1S0FA 5H9PA 3UJQA 2DTWA 4YG3A 1RINA 2BQPA 3R4UA 4Y20B 1LU1A 1PZ9A 2A6VA 3AXEA 3N36A 3AJYA 4FOQA 1MS8A 5DZGA 2A7AA 4BLIA 3ZXKA 2JKBA 1Q8PA 2PELA 5E88A 5CA6A 1V6KA 3ZXJA 4GWMA 4YW1A 3HN1A 1BXHA 4GXLA 3WNXA 2PHXA 1Z0HA 3NV2A 4XJZA 1JW6A 1WD4A 1C1LA 4XHXA 2JE9A 3ILRA 3AP7A 1WD3A 4YZ4A 3AZYA 3VKMA 5FRAA 2WNEA 4CTEA 3AYEA 2DVAA 3ZYPA 4DQAA 1JUIA 4YFZA 1JHNA 2B7YA 2P2KA 2EXIA 2XB6C 3ZVXA 3VUOA 1BZWA 2DUPA 4U36A 1ZA4A 2AUYA 2WKKA 4YGDA 2ZABA 4AYUA 2DYCA 4GA9A 2E6VA 5JDBA 3FLTA 5GLZA 2ZGQA 3D4KA 3AJZA 3UL2A 5IK7A 4Q8KA 1DYPA 1UKGA 1PZ7A 1QOSA 2EALA 2EF6A 1LOFC 3ILFA 5KXDA 1JYCA 1AXYA 1LOFA 2ZHNA 3L2YA 3MEPA 1ULFA 4BMEA 2NP0A 2A3YA 3JUUA 2ZGPA 4FQ4A 3KQRA 2YXSA 1SLBA 4AVTA 2G4IA 1V6NA 1QF3A 3AYCA 1GV9A 2GDFA 1UAIA 2EXJA 4XBNA 1SBEA 5HCAA 1DGLA 1DQ2A 2P3KA 2Q5TA 1N3PA 2W52A 3ILNA 4Q27A 4P9YA 2JECA 1WUVA 1CIWA 2VW1A 5KXBA 3AYDA 1AX2A 3I8TA 5IK8A 1CR7A 2A6WA 4LBKA 2ZMLA 4XJ9A 4FVVA 4WZFA 5T5PA 4DRRA 2JD4A 3FUOA 1GNZA 4XDQA 2D6KA 3WZ1A 1FV3A 1MS9A 2A5ZA 3V0AA 3U4XA 1RIRA 3AP5A 3VKOA 1N47A 2A71A 4ZXKA 1LTEA 1MS5A 4Q8LA 5IK4A 4Y1UA 1V6IA 1CVNA 2A75A 2Z42A 3IMNA 1CONA 2NMNA 1S0BA 2YY1A 1HKDA 5EYYA 5H9QA 4FOWA 4HL0A 3B00A 1VAMA 3FLPA 3WHUA 1AXZA 2GMMA 4P9WA 1UZZA 3WG2A 2E7TA 4PF5A 1DQ0A 1VALA 3AZWA 1F31A 3OYWA 3WCRA 1ENRA 1TEIA 3WDUA 3A0KA 2H0BA 4PBOA 2D6OX 2CNAA 2OUJA 2P3IA 3FFZA 1QOOA 3PVEA 3Q9OA 4ISQA 1UMZA 1UPSA 2VW0A 4NO4A 1Q8SA 2NMOA 5IT6A 3LSDA 1LGBA 1GZWB 2P37A 1AJKA 2HYKA 2UWAA 1J1TA 1MS4A 1DQ6A 5DZEA 1OFSA 2CWMA 3TB0A 1JYIA 3BTAA 1SBDA 4FPGA 4XHBA 1WW4A 3M3EA 2FMDA 4OZXA 4M01A 5JOYA 4XXAA 1I1EA 5JMCA 1S0EA 5T54A 4AVSA 1WCSA 3WCSA 4JRAA 4ATEA 4MYEA 4DS0A 2W68A 1WBFA 5T5JA 4FPKA 3B9CA 1D0HA 4UW5A 4YW5A 3SH4A 2PHUA 3QCWA 1I3HA 3WUCA 1G9FA 2CL2A 2D6LX 4Y1YA 1W6MA 1ULCA 4FOVA 1N1YA 4AGRA 1X50A 3FUQA 4AVVA 3WHTA 5F5QA 1DHKB 3RS6A 4XBQA 2W08A 4JCKA 1A78A 2EXKA 3T1LA 2A6YA 1DLLA 1LOAA 1LGCA 1W0OA 2D43A 3MW3A 4BM8A 3WUDA 3FBYA 2ZHMA 2GMPA 3OGGA 4UW6A 4DRVA 2ES3A 2DU0A 2ZZJA 5CBLA 4IQPA 3FLRA 1SLCA 1MVEA 3INAA 2SLIA 3A4UA 1QGLA 2JJ6A 2DUQA 3IN9A 1V6LA 2GNBA 4R9AA 1YRZA 3DUIA 4XJAA 1GLHA 1QDOA 4BQ1A 2DVFA 3GNEA 1AX0A 3POSA 1H9PA 2A70A 2D6PA 3N7KA 3GALA 1AZDA 4UW3A 1AVBA 5DUVA 1MVQA 4FPFA 4FPOB 1YIFA 3PJQA 4Q2FA 1DFQA 3N3HA 4YZ3A 3SITA 2YZ4A 2VW2A 2LALA 3WVJA 3OY8B 3NV3A 4Y1XA 1IKQA 1PZ8A 3WV6A 4Y20A 3PVOA 4XTMA 4GKXA 5GALA 4YG6A 2UURA 4YZ1A 4ZKTB 2WSUA 1DQ5A 5JOWA 2ZKNA 2AR6A 4WV8A 4ASMB 2NM1A 4Y26A 1CESA 1VIWB 2C5DA 2R0FA 3IM0A 4K1YA 4L8QA 5DUWA 2DV9A 2AGSA 2JE7A 2R16A 4PQ9A 3AX4A 4CRQA 4FP3A 4XOGA 3B01A 4YW2A 1MR5A 3M3OA 3PMEA 3NV4A 3T2TA 4LBMA 1CPNA 5DZFA 2AENA 4BLJA 2UWBA 1RITA 4YGEA 3PVNA 1KDMA 1ONAA 1W6OA 1W0PA 1AXKA 1GANA 2E53A 4YLZA 1LHUA 1ULDA 1BQPA 1LGNA 1N1SA 1N3QA 4M00A 2ZGUA 4K1ZA 3W59A 3RRDA 5DG2A 2TEPA 3T1MA 1LHVA 2AREA 2VY0A 3NV1A 1SLLA
chains in the Genus database with same CATH superfamily
1PHMA 4E8DA 4CEWB 4OVEA 4OI4A 5CYYA 4CZSA 4GD4A 4K6BA 2OX0A 4XPVA 5HI0A 2NN8A 1JZ5A 2OYZA 1N1VA 1XYNA 5C71A 1SHWB 4MUVA 1NY71 2EXHA 3WG1A 1CQ9A 5FPXA 1U12A 4JQTA 4N90A 1REFA 3ZYGA 3HNMA 1SACA 4Q0QA 1FX5A 4CDWC 3IAQA 2K46A 3AK0A 2WABA 1O5LA 2XJRA 4AAXA 3DPRA 3MPPG 2WSVA 1JN2P 2EIBA 3HQUA 4MGSA 4ZY9A 5A3LA 3V0BB 1NLRA 1RUC3 2DVDA 5C4WC 4WVVA 3VZNA 1Q8VA 4RS5A 3TAYA 4QXBA 1OBNA 4LQRA 4RQPA 5EJ3A 1F35A 4YVSA 3K3NA 3GZEA 1YUDA 3N7MA 2BVBA 3BTYA 3A21A 1US2A 3ZM8A 2LS6A 2Y64A 3VKFC 1DYKA 4CDUC 2Q8DA 3H3ZA 1W8ZA 2YBSA 5I8TA 2Y34A 1XNCA 5T5LA 5FYCA 3VKNA 3ZSMA 2PTMA 1AR81 1Z7S2 1AR91 3ES4A 1D4M1 4XQ4A 5DG1A 4YZ5A 5FPBA 1LOBA 3O5SA 2K0GA 3VD7A 3KV6A 1WCUA 4C0BA 3C7EA 4H55A 2VC9A 3WR0A 4JTNA 1C4RA 1DGRA 1ZBA2 3AVRA 1QNYA 1QQP1 3TYJA 4Q4Y3 5IVCA 2LROA 1HW5A 3T08A 4QB2A 4YARA 5FMOL 3O7OA 4MGKE 5FPZA 4OQ9A 3VBHA 3T4HB 1UMHA 2BUKA 3O0WA 1GMMA 5A6YA 5C3RA 2R30A 3UK9A 2XJSA 3RZGA 3BVCA 3DL3A 2WZ8A 1UF2C 2ZGTA 1RUOA 4XEZA 1GP5A 1RUH3 1JYNA 1O3TA 4R4XA 4PIXA 1V00A 1JMUB 4P00B 1MZ6A 2YG0A 3CNAA 1AJOA 1U0AA 1KRIA 2QQJA 2ZHLA 2VU9A 4B7EA 4KGGA 2FCUA 2FDHA 4GZ9A 3RYRA 4FTSA 1XYPA 1CZSA 1ZVFA 4GJYA 5HCHA 2BNMA 3LD8A 1QIQA 4HK8A 4M3CE 1JU3A 2PAKA 1H1IA 4HPKA 1ND3C 4HMZA 4YYOA 2ORXA 4XACA 3E6CC 1RUF1 1HRV2 2VBBA 5GLTA 4Y5SA 5C33A 1RUH1 3SMHA 4FQZA 2J1EA 5A3OA 4XZUG 5FZ0A 1S0CA 1AHSA 4P08A 2WZPP 1W8HA 4CDUB 1LHWA 4CUBA 2UY8A 3C7OA 3MLLA 5EZWA 1ZNPA 1SDWA 3KVBA 2HLEA 2I07B 2X5IA 1QXRA 4A3ZA 2J1UA 4QQOA 4XCBA 3T30A 1ULGA 4M3CB 2OW4A 1JOJA 2WT0A 3OY8A 1QXJA 1LHOA 3I2JA 4R9CA 4XUPA 5ABJB 3J7LA 5D1IA 3DKWA 1MQTB 5JSRA 5IVJA 4WVWA 5FCCA 1YI7A 1N3OA 3RZKA 4PIZA 5E1RA 2ETEA 2OVUA 1OD3A 2YU1A 4RGKA 5B4NA 1UYXA 3IIIA 4XETA 3RWNA 2HWE3 3NAPA 3H0OA 3USUA 5IATA 5JOXA 2G19A 5FJHA 1R1ZA 3OJBA 1AR61 4WBBA 3UJOA 1Y9MA 2RS51 1ZBE3 2A73B 3J8F2 5FPUA 5KHKA 1BJQA 2WL1A 3IWZA 3ASIA 1O3RA 4XF0A 4LOTA 4YG0A 2VOKA 5FZ4A 5LA1A 3IAPA 4LK7A 2GALA 5F39A 2WS91 1GZ9A 1W6OB 5LBFA 5LB6A 4CDUA 3OPZA 2XQRA 1CWPA 1IS5A 3ZYHA 2JE8A 5CG8A 4LBQB 5A6XA 1GYKA 3WDTA 4HK9A 4MLOA 2WS92 1POV1 4M3CA 1JBCA 4P9IA 1FMD3 1K5MC 1FAYA 2A3WA 2V73A 4IESA 5FMDA 1OVSA 1SZBA 5BPXA 4DO0A 2FQPA 3U4SA 1UU6A 1KD7A 3GBWA 3JB8A 3AKSA 4ES8A 3MF9A 4KWKA 1HXS1 1KXGA 1RL3A 5LBEA 4PCRA 1AR72 1YQ8A 3ZN6B 3M70A 2D6MA 2QQIA 3NJVA 3ACGA 3C7HA 4XMAA 3TEWA 1JYVA 5J37A 1GNHA 2RG4A 1C8M1 1VBB2 2V4AA 2WZR1 1AL0G 4Y24A 2W1SA 3IDEA 2J1VA 5H9SA 4XAAA 1FMD1 3RZJA 3GDBA 2UY9A 4EE2A 5GZCA 5IVBA 1RJ8A 3T2OA 1NE6A 3DF0A 1E5RA 4Q0SA 3VBRB 5BNQA 4Y5TA 3JU9A 1BCXA 2DCTA 3NW4A 3GZAA 5EQUA 2ZGMA 1F8VA 2BGOA 3F95A 4Y1VA 4DNYA 2YFZA 1OF3A 4ARXA 1Q8OA 2GP5A 2WT2A 1Y7BA 5IJRA 1U5YA 3CF6E 1ZBE1 3WG4A 5JXHA 2IVJA 1WCDJ 3DCQA 1YIPA 2ID4A 1WW5A 1E57A 1CJPA 5FMOS 3WXPA 2ZGOA 3KV9A 4YW4A 2ZTNA 1OMIA 2B45X 1OH4A 5K7PA 2RM22 1M06G 3RJRA 2GP3A 4J25A 1PGW2 3ZIXA 1FNZA 2XVLA 1NXD1 3OGSA 3LEIA 3ZKUA 1FV2A 1O4ZA 4JGZA 2WWJA 4RS5B 3SISA 5A3NA 3EXUA 4QU2A 1EAH3 3BPZA 4JDMA 4O65A 5IW0A 5LCWL 2RS32 3AKTA 4OFGA 4BH9A 1V0AA 1G86A 4LHLA 4EJRA 1HRV3 3HPNA 3WNMA 4CXXA 4XILA 1NT0A 1EV11 3OPWA 5A80A 2EA7A 3HNBM 4NE9A 1LRHA 2F4LA 2G1MA 4UWDA 4ZXEA 1HQLA 5GLWA 4BA6A 3EBRA 5CB7A 3AL6A 1AX1A 1H2MA 1PM7A 2VE1A 3CJXA 3P3PA 2D3PA 4LKEA 5FREA 5T52A 5JR7B 1FNYA 1GOHA 4YNIA 1W8NA 4BIFA 1I9RA 1EUTA 2BJSA 3VBHC 4P9GA 5JIUA 1ENQA 4R52A 1VMFA 3OOXA 1W8WA 2NZ9A 2QQMA 2WAOA 4XTPA 3KVAA 5I0UA 1PIV1 1IPJA 3KD4A 1IG0A 4GAZA 5FOBB 1POV3 2DTWA 4E4SA 1NXMA 5F32A 3R4UA 4Y20B 2A6VA 2RM23 1FPN2 2DBNA 4IUGA 4QKFA 5JPMB 4R4ZA 5KC6A 2FDJA 1W9SA 3LB9A 4AI8A 1PVC2 2PELA 2RM21 2R6QA 4PLNA 5I0RA 4MX3A 2XLFA 3OB8A 1LNSA 4JDOA 4MSVA 3RVHA 1WD4A 1C1LA 3AP7A 3RZMA 1WD3A 1XU1A 1HX6A 1OQDA 2WNEA 1UD1A 1PNFA 3AYEA 2DVAA 3JB4C 4XFHA 4CTEA 4DQAA 2GU9A 3J26N 5AC93 1JHNA 2CV6A 3VBRC 3ROUA 3X29B 2AUYA 4YRDA 4A6SA 2WWSA 2BBAA 2ZABA 3A22A 2W91A 2XJPA 2ZGQA 3KCXA 1X9PA 3D4KA 4XC9A 3VDAA 5IK7A 4LIUA 5GKAC 4DMIA 3H3LA 4QXKA 1H0BA 3VBHB 3LDKA 1CAUB 5F7UA 2XLGA 1VP6A 3FMGA 3ILFA 5IAXA 5KXDA 2WUHA 3L2YA 1J3RA 5FIXA 3HNYM 3B5LB 3EMRA 4FFHA 4FQ4A 2VR4A 1NY72 1SLBA 4FBFA 2TUNA 2CSGA 1V6NA 1VRBA 1RUJ3 4MXVA 1SBEA 4CEWA 4FXKB 5I8SA 4XW3A 1DQ2A 1IZ3A 2P3KA 2W52A 4Q27A 5A7QA 3SEEA 3ZFEA 4A41A 1CJDA 1NCRB 2QJVA 2VW1A 5IK8A 1DDLA 1CR7A 4WM7A 2ZMLA 4XJ9A 2ZOEB 1PMIA 3K4ZA 5T5PA 4YSFA 2JD4A 5FZHA 4YVSC 2XL9A 3EO6A 3KB5A 1H6XA 3AP5A 5C3OA 1LTEA 1PGW1 2HWE2 1FPN1 1COV2 1Q43A 4Q0PA 4LNVA 4B4RA 5IK4A 1V6IA 1CVNA 2A75A 2Z42A 3HIFA 2YY1A 4XDPA 5TSWA 1HKDA 1NCRC 3CIHA 5H9QA 5FZ9A 4HL0A 3I3BA 5B4XA 3WX5A 2NPIA 3B00A 3LDRA 1VAMA 3FLPA 3CDZB 4LKDA 1AXZA 4MVTA 1UYYA 1HJFA 2GMMA 4LMFA 1UZZA 4LEJA 1X8MA 5M0TA 3AZWA 1IQDC 1VALA 2B4KA 4GB33 3WCRA 3PMSA 4W50A 5DPNA 1QJX3 3ZN4A 2CNAA 3ZFGA 1OKOA 4IXLA 2MEV2 2BGCA 5ABJC 1UPSA 2VW0A 4EQVA 1R083 4AVBA 4EYUA 3RPQA 3USSA 4CP9A 3O1PA 3TEZA 2YPDA 4MGYE 5FBJA 4P5YA 2MHFA 1LGBA 5CVRA 3LKJA 5C3PA 1AJKA 1OHFA 2VZ1A 2NQYA 1DQ6A 4RYDA 4PDWB 1E5SA 1OFSA 3TB0A 5C8CA 1RUE1 4FPGA 3PUIA 5C8CC 4Y5Z0 1BVVA 2R043 4NHXA 4DUWA 4QQHA 5BNOB 1I1EA 1JH5A 4WVZA 2BBVA 1WWYA 4LORA 2XJUA 2H6CA 2HJIA 3W9AA 1NYWA 4MHRA 3ZMOA 2WFPA 3KT1A 1D0HA 3QCWA 1I3HA 1AYM1 2GH8A 4Y1YA 3WQBA 1W6MA 3SHRA 2XDVA 4GH4A 3WNNA 1F15A 4DY3A 5JSPA 1H6YA 4HZFA 4XBQA 3PU8A 4XUTA 2EXKA 3HQRA 4PLOA 1PO21 3FHIB 1LGCA 3AB0A 1YC61 1W0OA 3G6JB 1JZ2A 1UZWA 5DQ0A 2D43A 3I2HA 5IFPA 2HWE1 1PVXA 4TN7A 2ZKLA 4FCAA 2ZZJA 4V2VA 4MO3M 2W3JA 1VRH2 2K2SA 3INAA 1DGRN 4CCNA 2SLIA 3QD6A 4QM9A 1QGLA 2JJ6A 4CDQB 4PDWA 2C24A 2E9QA 4TXWA 1WA4A 3KLSA 2D5FA 4XJAA 3B93A 2JD9A 3BYWA 2JICA 3OGJA 4Q4X1 1AZDA 2E26A 5E16A 2VMEA 1D7PM 2PAMA 4P02B 4UT5A 1O91A 1X36A 4QX8A 1JZ4A 3W5NA 2LALA 3WVJA 5EJZB 1JOBA 3NV3A 3OY8B 4NR1A 2Y8KA 4Y1XA 3TN91 3U75A 1IKQA 5ABJA 3QH7A 3VDDC 3EHKA 5JXGA 5FUPA 2HWD3 4GKXA 3ALQA 4XFIA 4YVWB 5A3WA 5GALA 3ZSEA 4YZ1A 3RGBA 2JIJA 3ETPA 3MI8A 4NJ4A 2AR6A 5K8SA 5BNPC 4LLFA 2O14A 5BNNA 2NM1A 4Y26A 4YWAA 2NLRA 1CESA 2KXLA 3IM0A 5D8AA 4SBVA 2DFBA 4NN0A 1GQHA 2JE7A 2RR13 3NAPB 3CJIB 4PQ9A 1W04A 2W5FA 5FZBA 1JODA 1W3VA 3KT4A 4YW2A 5FZKA 1MR5A 4A44A 3RYPA 3NNMA 1JS9A 4LBMA 2W1WA 5DZFA 1RUI1 2AENA 4PF1A 2UWBA 4YVWC 4BLJA 1BBT2 2IFRA 3PVNA 4DINB 1JYXA 1KDMA 1W6OA 1GANA 2E53A 3VD4A 2GAUA 1QWRA 1LGNA 1UMIA 3GHMA 2AEZA 1N1SA 2X10A 4M00A 5BUVA 2RS12 4HVRA 5DG2A 2FDKA 3O14A 1LHVA 4NHYA 5CFDC 3K48A 1YJLA 2QVSB 5CFDA 2DF7A 3SEPA 2Z2SB 3ACHA 4AK3A 4NOTA 4QPIA 4MXWB 4FFFA 4S2GA 3LDBA 1C8M2 2WZR2 1D2QA 5IVFA 2ATFA 2YC0A 2CAUA 3C2UA 1HQNA 5DXDA 5FYTA 2VXRA 3VZJA 4BPZA 4JRLA 4L9BA 1GU3A 4ISRA 3LSEA 4Y3OA 4C8DA 4XE9A 3FZ3A 3K46A 1Y9GA 4I09A 5CAZA 4D6SA 1STMA 1XNDA 4BOWA 3WDVA 2X09A 4PDWC 3M4FA 1F4HA 1PO13 4I02A 3BALA 4LBNA 4B1MA 2C0ZA 5GM0A 3ZDVA 2YBKA 4XF4A 4A4AA 1LKNA 3RDIA 1LOCA 4W8JA 3RWKX 1EAH1 1W6QB 1IQAA 5FY7A 4KBBA 1UXZA 2A6ZA 3GGLA 3NAPC 1D0GA 1RHI3 3RI9A 1VRH3 3DV8A 4GWJA 1QH7A 2QE3A 2WAAA 4QX7A 3THDA 3LPFA 4JKKA 3ZR6A 1QJU1 4XQWA 3WNPA 4S2FA 5L19A 4WZCA 1K5JA 4DIQA 3MUY1 1X9TA 4XBLA 4Y4RA 5IUQA 4NHKA 2HWF1 2PLV3 5LEKA 4CXYA 3ZPYA 2XLAA 2Y6JA 4JX0A 1DBNA 2R1DA 4JGZC 4AFAA 4Q4V3 2GN3A 3ZN6A 2PMWB 2IXCA 1UN1A 4BJ0A 4URTA 5DAWA 4K3UA 3POYA 4AAPA 3RMXA 1ZM1A 4IEOA 4KU7A 4IEPA 3VB9A 3RMYA 4ZPIA 3ZSJA 2BOJA 2G9GA 3IPVA 2WNOA 2G9FA 1FI2A 4IGQA 3TBDA 4TYSA 5FDBA 3KCYA 4AEDB 1UY4A 1DGWX 3SKJE 2J1RA 2PQSA 2R0HA 2Z79A 4YGBA 3POJA 1Q56A 2XUMA 5FUIA 2OQ6A 2ORZA 4FO9A 2ZZQA 3O1OA 1MZ5A 1UY1A 2QQVA 3C7FA 1CAVA 4BQ3A 1FOD3 2OUHA 1SEFA 2GNMA 2BU9A 4JHZA 2ZGSA 4IE7A 4AVCA 3ZYRA 4HLTA 4XURA 2YUEA 5E89A 1MS0A 4FPLA 2VVDA 1W6MB 5FY1A 1QQP2 3AP9A 4NPLA 4ARYA 4CUGA 4JGYC 3OGVA 1QMJA 3GJBA 4Q4W2 4YM3A 4UYBA 1POQA 3CEWA 3PUHA 2RJKA 1MEC2 3NNJA 4IDZA 3B69A 5FFOC 4RFRB 3USUB 1RHI2 1UIJA 3LEGA 1H2NA 2R7EB 3FX3A 4BK5A 3BU0A 1G7YA 3MZHA 1ZRRA 1Y4WA 3N9QA 4XCAA 3AKPA 4XXPA 5FZ1A 4R9DA 3O1VA 1JYTA 3VDCA 4YW3A 1BBT1 3HMYA 4IGOA 5A1FA 3SCGA 3IT8A 5A32B 1ZRFA 3DYOA 4YZ2A 3AFGA 4EN6B 4ZU7A 1PNGA 5JWPA 2YDEA 4HKLA 3I2IA 4ZZ8A 3IBMA 5FPLA 1Z7S3 1SFNA 1CAWA 3ORJA 2WIIB 2VUJA 2AC1A 4ZS2A 3WLUA 5K0UB 3AL5A 4OI1A 3H42B 3OYWB 3U10A 5FZMA 3DECA 3B9IA 1OPOA 4OI0A 1YO8A 2V4VA 3NSTA 2PHLA 4O9GA 1LESA 1RMU3 2VOXA 2ERFA 4RFT0 4LUKA 1NQJA 3S57A 2EIEA 4XYXA 1LJ7A 4CCCA 1KDKA 2DVGA 2GNTA 4DUVA 1ASJ3 4M0HA 2CU5A 4AZZA 2DFCA 4AQSA 5FWEA 3VHRA 4RQPB 5ISLA 3V0AB 4YVSB 3MIGA 2PHTA 1QJY3 4EWDA 4RA0A 1YJKA 5JZGB 3GZTB 2I2SA 2EIGA 2VH9A 4GJZA 4M4PA 4FP2A 4Q1RA 1REEA 1W2NA 1BMV1 4DEQA 5F9TA 4XMIA 4WVMB 1KJRA 1I5PA 4C91A 4DUXA 3ZPOA 3BPSA 3OCPA 3I3MA 2Y6LA 1RUI3 3DYMA 3WG3A 1CZVA 4F83A 5A1AA 3KM5A 2R062 1VBE1 5FY8A 3ZXEA 1DLCA 2I74A 3C3VA 3BIWE 2D97A 2WR9A 3RQ0A 1ACCA 4H7MA 3PIJA 5APAA 1K5MA 2QDRA 4UBHA 4ZU5A 2ZGNA 2VOVA 3JXSA 1XE8A 5A7SA 3U1XA 3NMBA 1WW7A 3PL0A 4QGLA 5K4LA 3BCWA 3MFAA 3VN4A 1GICA 1RUE3 1ST8A 2X8KA 2ZEZA 2VNGA 2ZHKA 4QX2A 2D40A 1AL21 2CTVA 1HLCA 1R64A 1S1AA 1PO12 3ACFA 1YFXA 4CU8A 1DF0A 3VZKA 1OQEA 4KBZA 2RVAA 4CCOA 1NX9A 2GSYA 4QAWA 3ZSKA 1TME3 5CU1A 2D3SA 3IDBB 1WLWA 4L92A 3I2OA 5IK5A 2NYYA 3AMHA 2MNGA 2Y6HA 3HT1A 5FLJA 3GBFA 2WZEA 3CBNA 3LA7A 1SBFA 4D7SA 1WLCA 3AFKA 4W6WA 1PGL2 1W03A 3I2DA 3T09A 5DDJ2 1L3JA 4MG2A 3DKQA 1VBC2 1MZFA 4GWNA 1ZBA1 1N1TA 3R4SA 4FXGB 1QU0A 3DPRC 4JHTA 4NRPA 4I3GA 2Y6GA 1GNYA 3M1HA 5HPOA 3OUHA 1B09A 2W1UA 4A7YA 3VBUA 1FATA 1CN1A 2JWPA 4HN0A 4SLIA 5T55A 1OKQA 3I97A 4FPYA 2EIDA 2OZJA 3JQWA 4RGGA 5JIAA 4IETA 2CWSA 3JD73 3O0VA 1BEV3 3UESA 2RDSA 4C0HA 1G8WA 2DWRA 2VBDA 4MADA 5GLUA 1PK6B 3J4UH 2ZPXA 2VQAA 3AZVA 4AW7A 1V6OA 4QB6A 1ZBA3 2IXJA 3MLKA 4XDOA 5A7WA 1R091 4FFIA 1X7NA 5FP7A 3IZOA 1IS3A 4HVQA 1G9BA 1DZQA 2OT7A 1VLNA 4P9XA 4QMAA 4MHUA 5CKMA 2WWUA 1RUJ1 2W95A 1V70A 2VMHA 3PDQA 5EYXA 4QX5A 1NCRA 1VBA1 3LFIA 4RHV2 2W94A 1J84A 3RG0A 3H8OA 1YWKA 5FXVA 4CP1A 3F2ZA 4BHPA 5CEHA 4QX0A 1LODA 2VCAA 4OLLA 3MIEA 4CEWC 2WNUB 4QM8A 5BY5A 3JQXA 3HJRA 1OVPA 4LBOA 3ZFFB 2DVBA 4D6QA 1S0IA 2QCSB 2W39A 3HBKA 4P9LA 5L7OB 1CAUA 2Y26A 3WQ1A 4C1XA 4H14A 4ZONA 1V9U1 1D4M3 2PAEA 2JDHA 1KEXA 1SFYA 4AEDA 5JXJA 1D2SA 1W6QA 3OG2A 1S0FA 1IHMA 4NWWA 5DAVA 5H9PA 5BNPA 4J6GA 1TME1 5LWBA 3WP4A 4OMCA 3CZJA 2WNVA 1LU1A 1RUD1 1PZ9A 5KHGA 3LAGA 3RZZA 4LE3A 4K9SA 4ZZ5A 5K9YA 1MS8A 5DZGA 2A7AA 2JKBA 1Q8PA 1RUI2 5CZKA 3D82A 3GYDA 5E88A 5CA6A 4EZ4A 1I5ZA 1X8EA 4NIGA 3HN1A 2X53S 3WNXA 2CGPA 1AR83 2WA3A 3NV2A 5LA2A 1DG6A 3ZXGA 5J98B 5FYSA 4IV1A 3AZYA 5FRAA 5FYBA 1NUKA 2PLV1 2WQ4A 3VBFC 1JUIA 2YB7A 2PFWA 4YFZA 1W2UA 2B7YA 4A6OA 1BVP1 2EXIA 2OPWA 4LHNA 3ZVXA 4U36A 1K42A 1H8TB 4CU7A 2ADDA 5I91A 3K3OA 4CA9A 5JAXA 2DYCA 3U37A 1HB1A 3AJZA 2VTFA 2ARAA 1M4WA 1W90A 4BU2A 4A42A 5G04L 2Y0OA 4COWA 2V5DA 1CAVB 2WFF1 5FO7B 4OHVA 1LOFA 3MEPA 5F3IA 3VZLA 4BMEA 4KQ7A 1T2XA 2OKXA 3JUUA 2OPKA 3MIFA 1R1A2 4GIQA 3UGFA 2JG8C 2YXSA 3KQRA 3H7YA 1NZIA 4TSVA 5J36A 5JR2A 1C28A 4QDRA 2GDFA 4MXWA 1UAIA 4XABA 1XE7A 4XBNA 2XBO1 5DN2A 1DGLA 1VBB1 4BXSV 5HCAA 2TBVA 3FBMA 4JKLA 4P9YA 1RUNA 1Q3EA 1RMU2 4QXCA 4HVOA 2BRTA 3MBWA 4URAA 3WW1A 2A6WA 2ZX3A 5BNOA 2Y0IA 4IV1B 5KHHA 4JGZB 4QGNA 1GNZA 5FMBA 3ELNA 2D6KA 4XDQA 1FV3A 2A5ZA 3WZ1A 3V0AA 1QJU2 3U4XA 3B02A 5JI7A 1NOVA 4E8CA 4Q8LA 1YQ5A 4Y1UA 2DBIA 2LW8A 1S0BA 5FYIA 3S5QA 2VJXA 2EICA 5EYYA 4LITA 5FTTC 1OOPA 5EJ1B 1ZYBA 3RZHA 1JUHA 2RDQA 1W06A 2D93A 3THTA 4L99A 2XONA 4P9WA 2V72A 3WP3A 1POV0 4PF5A 3WD5A 4QHOA 3NJYA 5FYUA 2XJVA 3OYWA 4YVWA 3UV9A 3BTXA 5CG9A 4G4FA 4B4PA 1NA1B 4KU8A 5A6ZA 3A0KA 1V9U3 1VBA3 4IE0A 5BXXA 2XQXA 2LM3A 1K5MB 2OUJA 1QJFA 4IEXA 3FFZA 3PVEA 4E9KA 5ACA2 1OPMA 4NO4A 2NMOA 5IT6A 2YHJA 3D0SA 4TTGA 1W8UA 1S4CA 5AVPA 4YPJA 1UPIA 2HYKA 1QJX2 2UWAA 1AR92 3KHCA 5DZEA 1VMHA 2CAVA 2VMCA 1SBDA 1WW4A 1SG3A 3P5BA 2VZTA 4OZXA 2JB8A 4B4QA 1GWLA 1R1A1 2VMFA 5JMCA 5KC5A 5T54A 1G6NA 4AVSA 1WCSA 4N8MA 2IC1A 4HG6B 5I0TA 3U0ZA 4J1XA 3JZVA 3DXTA 3K2OA 5A7WB 2FD8A 3H1WA 1COV3 4UW5A 5J09A 3CL1A 3H8UA 3POGA 1G9FA 2CL2A 4HT1T 3VZOA 4NHLA 1F2NA 1QJU3 2F6BA 4I0WB 1GFF2 3LOBA 5IFTA 5F5QA 1DHKB 3NRUA 3RS6A 1A78A 3THPA 1REDA 3OEAA 3T1LA 1BBT3 3ZX7A 1ODMA 1XB9A 5FO8B 5IVYA 4PI0A 3WUDA 3FBYA 5JPNB 4UXAA 3I3QA 2GMPA 1DZRA 3OGGA 2MPFA 4LHSA 4EROA 2Q8CA 2ES3A 2DU0A 4GWIA 5CBLA 2HWF2 5F5CA 4CCJA 1YHFA 4QHBA 1WMXA 3C7GA 1SLCA 1OUSA 3OSDA 2DUQA 4LK6A 2X05A 5EP9A 4KGQA 4R9AA 1QDOA 2IVIB 3E5QA 3I49A 1BHGA 1OC1A 3GNEA 3POSA 1OI6A 1H9PA 2A70A 2D6PA 2HWD2 4ORFA 2JDNA 4UW3A 4BZ4A 1MVQA 4FPFA 3KCCA 1H8VA 5BV6A 4CP9B 3WF1A 2HH9A 1DFQA 1MQTA 4Q2FA 1PO11 4YZ3A 2YZ4A 3SITA 2XL7A 4AFDA 4AHYA 4BDVB 1JU4A 3PNAA 3U78A 4QDQA 4W4ZA 1RVF3 3LE0A 4M4RA 4HETA 4QPGC 1OLME 3K4AA 3DPRB 3T0DA 2WSUA 5JOWA 4AI3A 2GH2A 1ND2C 3BU7A 3LZZA 2DCKA 3LEMA 4A7KA 3OBAA 2WNVC 1VIWB 2C5DA 4KWLA 3AKQA 5DUWA 4CCKA 2AGSA 2UYBA 5IYYA 3LGRA 4AHZA 4FP3A 3GCXA 2ILMA 2O8QA 4LKSA 3M3OA 4GH4B 3WP6A 3AMPA 3PMEA 3T2TA 2F17A 4UF0A 4Q4Y1 4ET7A 4HSLA 3H3UA 5A33B 1PX4A 2W9XA 3EJKA 2RJ2A 4O7XA 5FY4A 4A7ZA 1GP4A 1AYM2 1ONAA 2BEOA 5F3CA 1W0PA 4IV3B 3RZLA 1LHUA 5FBZA 1BQPA 2AZ5A 4BQXA 2ZGUA 2E33A 4XF3A 3RRDA 4CEYA 1XRUA 4B7KA 4LKFA 4RR3B 1TG7A 2AREA 2XMLA 5FZGA 2VY0A 5C8CB 1SLLA 5LY2A 1IOAA 3AP6A 1OURA 2DU1A 2VMIA 3I2FA 2HWC1 2HWB1 2WNUC 3JCIA 4OHZA 1LENA 2YROA 1V6MA 4JKMA 4Y33A 1HDKA 1BYHA 2XWJB 1VBB3 5L9RA 2XHKA 1JZ3A 4KG0A 2ARBA 3V56A 3BODA 2MEV1 2W47A 4GMP1 4OHXA 1HXS3 2PN5A 5FYZA 4XUNA 3NO8A 3AMMA 1EY2A 2DCZA 1XSQA 1EPWA 2RS13 4L0PA 3MUZ1 3WEZA 4DY5A 5BNPB 4L2NA 5FZAA 5J1XA 2HEYF 3N4MA 3NKGA 2R073 1ND3A 2JDKA 5C3SA 2VOWA 3THCA 1Z7S1 4NWVA 3W21A 1QJEA 2IXHA 2VCMA 1OOPB 2ET7A 3I4IA 3RSJA 4WM7C 5KXEA 2IXLA 3MW2A 1UNBA 4CDWB 3OBZA 1UL9A 3LCPA 5HV4A 1ND2B 1YLLA 2ZMNA 1G9DA 1X82A 4ES9A 5T50A 5FLHA 5CISA 3BGAA 5L36A 1U5IA 3DXUA 2X5IC 3Q8BA 4OZOA 3UKNA 3HD8B 1BLZA 1ENXA 1ND2A 1MPXA 4BQWA 1KFXL 4TZDA 4Y22A 3VBFB 4N53C 2BERA 4PBPA 1SFPA 1ZBE2 2EAKA 2P3YA 1WKYA 2ET1A 4IEVA 5EWSA 4AE2A 5DUUA 3GXUA 2V5YA 4UBGA 3WINE 4QX1A 1J83A 3GM8A 2H0VA 1PK6C 3NNFA 5EFUA 3LIGA 3VDDB 4DXTA 3AYAA 2QQOA 3G7DA 1E5IA 2VNVA 1R081 1YQ6A 2E32A 5E8AA 1YNAA 3ZYFA 3KHBA 2CY6A 2PHFA 3VL8A 2D44A 2FMYA 2R042 4QKBA 2JKXA 2Q1ZB 4YM1A 4CEYC 2A6XA 2JG9C 1AYN3 1GWMA 4I3PA 2JG9A 4GULA 4XIOA 5D8AB 2QQNA 2QQLA 2WFF3 3MPBA 1OXCA 2WQ8A 1OA2A 4LA3A 1OA3A 1PM4A 1Q8QA 2PHDA 5GZEA 2R32A 3ZIWA 2OZ6A 2WNUA 2XG3A 4QT6A 1NCQA 4A45A 1B35C 4DXZA 5KR7A 4P9JA 3D3AA 5DAXA 1LHNA 1EV12 2BW8A 5EHDA 1XJAA 3ZDSA 5JZGA 5AFBA 1RYYA 1UZYA 1LOEA 3HWJA 3I7DA 4LA2A 5KHIA 3ACIA 4Y22B 2D7FA 3P1IA 4LPLA 4CDXC 2ZMKA 1AYN1 1FYUA 5HBAA 1RVF2 4LO4B 5FV3A 4FPEA 4Q4V2 4DPNA 1ZRIA 2WQZC 4UFMA 2E51A 1VMJA 3SLIA 1UY3A 1QH6A 2QZ2A 1W05A 2WN2A 5JOZA 1TQ5A 1X33A 5H9RA 1PMHX 4UFJA 1UW8A 5C9AB 4XF9A 2FHRA 1UXXX 1ULEA 1W6NB 1NA1A 2VECA 4XZPA 5EXOA 1YQCA 3CKHA 3CO2A 2KM2A 4UAPA 3WQ7A 5CFDB 5GZGA 1VPHA 5HCFA 1AR62 1F5JA 1W2OA 1UU5A 2WJSA 1FOD2 1RGSA 5FZOA 3O1SA 4H3WA 5A3MA 1QQP3 3PHMA 4NAMA 5JLVA 4IGPA 2Y6KA 5FP4A 1QY4A 1SPPA 1W8TA 3I3EA 1PK6A 1KS5A 2VGDA 1GUIA 1SCRA 2E7QA 1J58A 3PTRB 3WSOA 5FP9A 5CADA 4XFGA 1Q5OA 3VBOC 1UQXA 1UWWA 3PURA 4D8MA 1Y9QA 3N9NA 1AF9A 5DUXA 3OBTA 1IKPA 5T3NA 1V6JA 1W39A 4ITCA 2B8MA 3VBSC 2YV8A 2PYTA 4EN7B 2XHNA 4R9BA 5FJKA 3PVBB 1HRI3 1HB2A 1B35B 4Q1PA 4JAAA 3VD3A 3M3CA 3APBA 2DCYA 2VAUA 3RJ2X 1WBLA 2D5HA 5LBBA 5EIYB 5C9AA 3I3DA 4NIHA 1S0GA 1W0NA 4A3XA 4PI2A 1UOBA 3UKTA 1TME2 3VZMA 1VBE2 4CP0A 1XXNA 2GMEA 5JZGC 4E27A 4Q26A 3A23A 5FZFA 2R1BA 1AR63 5A1LA 3H9AA 1SDDB 4FPCA 3AZZA 4EN0A 4N43B 4UW4A 3BN6A 5J96B 5ANQA 2ZEWA 5GLVA 4GMP3 1OLRA 1GSLA 2FZ1A 3FHAA 4NIIA 3WY6A 5FWJA 1IS4A 3FHQA 3TWIA 4AFMA 4D94A 3S7EA 3JBG2 4Z8BA 2VZRA 1A3KA 4HANA 4O61A 1TNFA 2P34A 4XQDA 3WF2A 2PHRA 2R072 1RUD3 1H30A 2UU8A 5B2GB 5I0DA 3ES1A 1O59A 1RUC1 2HKXA 1VBC3 1WW6A 2OIIA 1H2KA 5FZEA 3SH5A 1G9AA 2RS11 2GC2A 3WDYA 3I59A 1C3HA 4F8AA 5DAQA 2OA2A 1ZZCA 2VTXA 4RL7A 2Q8EA 3MYXA 2C9AA 3J7NA 4CDWA 1HB3A 1YFWA 3ZSLA 2ZX2A 1MS1A 1WLDA 5FYYA 1UIKA 5L9VA 5LW9A 3A7QA 5CFCA 3ATGA 3MICA 2XKOA 1GBGA 5CKNA 3ZXFA 1OLQA 1AR93 1CX1A 2ARXA 1SLTA 1W8OA 2IXKA 5EV7A 4C1WA 3HBZA 1JXNA 2W87A 5F1RA 2CYFA 2WC2A 4B3NA 3LA3A 1WCKA 3N7LA 3TNPB 2CGOA 4AI2A 5I0SA 4I01A 3UNPA 4CYDA 5BNOC 3CU7A 4IL7A 2YYOA 3VHPA 1VAVA 3NWKA 5D21A 1XNTA 2ZEYA 4J1WA 4AG4A 5I8YA 3SC7X 5KXCA 4I30A 4GQ7A 1RXFA 3BIEA 2BPA2 1RUE2 4XJWA 3WF0A 5IAVA 4RR3A 4Q4Y2 5FK7A 5AC92 3AXDA 4RR3C 3V0BA 1DQ1A 1LCLA 3WF4A 1O8PA 2VNOA 1CZTA 5HCBA 1H4HA 4OMDA 5ANNA 4X8NA 1DIWA 3VHNA 4IE6A 2QQKA 2Y6FA 1UU4A 2J1TA 2JG8B 3IB3A 1C8M3 2WZR3 3NJZA 2DURA 4LBJA 3OUJA 1XBFA 2D6NA 1OQ1A 4BCUA 1UKRA 2WT1A 3MHZA 1Y43B 3VBUB 3O1MA 4YFWA 4Q0VA 5FY5A 1LECA 2O0OA 2P3JA 4META 4BMBA 4JVAA 4D7TA 3VDDA 1YEWA 3GBGA 2JDUA 1PO22 1TNRA 4LXLA 4ONUA 4XJ8A 3POWA 1RXGA 3VD9A 4QPWA 3UJQA 4CCDA 1UZ0A 4YG3A 5BNNC 4WVMA 3TOJA 1RINA 4MH0E 4MZUA 1JOPA 3Q8EA 1VBD3 1J1LA 3AJYA 4FOQA 4RN5A 4A2UA 5F3GA 4FTBA 1GWKA 1H2LA 3E6DA 5F6LB 2E31A 5F2WA 4AHXA 3NJXA 3LEKA 1QJZA 4GWMA 2XPJA 4AOCA 1BXHA 2PHXA 3FN9A 4XJZA 2JE9A 4H2AA 2BDRA 2ZX4A 3VBUC 1XSRA 1QXPA 4YZ4A 3ZLIA 2CDOA 1BK0A 5FZOB 4B8EA 3ZYPA 5CKQA 2O8OA 3O1UA 1EAH2 1VB2A 2QQUA 5C7GA 1EUUA 2P2KA 2XB6C 1BZWA 2DUPA 4IEQA 5FR3A 2LRPA 4KWJA 1ZA4A 4N7UA 4BISA 3AMNA 4CPBA 4HN1A 3ACLA 3N9PA 1XPWA 4GA9A 2QFEA 2R061 3GCWA 2J42A 3DEMA 4CCEA 3NNLA 3KMHA 4Q8KA 4QHZA 2QDNA 1HRI1 1PGSA 3RI8A 2EALA 2EF6A 2Q30A 4LO8A 1R082 1DGWA 1LOFC 2BNOA 3AM2A 3VBSB 1AXYA 1ULPA 2C4XA 2WBKA 5FKCA 2WFF2 3GF6A 4DXRA 1GR3A 3UYJA 1O4TA 3JBG3 3ZXDA 2V09A 4AVTA 1ALYA 1HV0A 2G4IA 4M0NA 3AYCA 1MEC3 1GV9A 5FLIA 3T3YA 1RUH2 5IVVA 5L9BA 2Q5TA 1N3PA 3KF3A 3KS7A 2P6HA 4XUOA 2R063 2ZX1A 3ZFEC 3Q8CA 1VJ2A 2GC0A 1CIWA 1WMFA 4JQRA 4JZRA 3I8TA 1AX2A 5C4WA 5KXBA 1UY2A 4LBKA 4RGAA 2FBEA 3OTFA 4FVVA 1O3SA 1TMF2 1JHJA 4XFBA 4DRRA 3FUOA 4UF0B 3LQCA 5LY1A 1H1MA 1GZTA 4IW3A 1RIRA 4QPYA 4E2GA 2A71A 4ZXKA 4Z07A 1MS5A 4BIOA 4UFKA 3IMNA 2RE9A 4IEYA 4FOWA 4E4ZA 2Q4SA 4H7LA 4AEMA 2XBO3 4XFCA 1RUF3 4YW6A 2GC1A 2BZDA 4NPRA 3MIDA 2JIGA 5FYVA 2E7TA 1NQDA 3TEXA 3UT0A 3WNLA 1DQ0A 1F31A 4AI0A 4QQ2A 1J3PA 2RR11 1TEIA 3D0JA 3HAGA 4PHZA 2EAAA 3J8F1 4MGIE 3BUCA 4Q4V1 3WDUA 2ZEXA 3SCFA 3ZKYA 2D6OX 1XC6A 1VB4A 1OT5A 2P3IA 3J7MA 3VBFA 1VAKA 2HWF3 3Q9OA 1UMZA 2QNKA 2QTWB 2VZVA 1UYZA 1YCIA 1Q8SA 4IEZA 5A7PA 1S2BA 1SPPB 3GJAA 1UZVA 3LSDA 3VBRA 4BWOA 5A3TA 2Y33A 3KSCA 3TN93 1GZWB 5J7MA 1DP0A 1MS4A 1VBA2 4RHV1 2CWMA 4CUAA 1JYIA 1S2EA 2VZ3A 4HKOA 3ZYIB 1AR71 3J8F3 4BYYA 2JX9A 2FMDA 4M01A 5JOYA 3ZFGB 1PO23 4TLFA 5F5IA 1S0EA 2ZCWA 4PJYA 3PTYA 4CEYB 3UETA 4JRAA 3WCSA 3MIBA 2W68A 3R4DB 2W0XA 4D0QA 1WBFA 2IUWA 1QHDA 5DABA 5FAXA 3HOBA 5FKBA 5T5JA 3B9CA 2IZWA 3ABZA 4RSUA 3SH4A 4PT6A 4LULA 3LFMA 5F6KA 5J3UA 2D6LX 1XNKA 2RS33 3H8RA 4AGRA 1N1YA 1A8MA 4RD7A 4KNCA 3WHTA 5F5AA 3L2HA 1OA4A 2XOMA 4ASKA 3M7AA 2W08A 4JCKA 3ZYBA 3E1F1 5FZIA 1ZZ8A 2A6YA 2D98A 1DLLA 1LOAA 2Q1MA 4NIAA 2XJQA 3MIHA 2VPVA 2J1AA 2FDGA 1NA1C 3POFA 4K40A 2ZHMA 1ULOA 4UW6A 4DRVA 1H8TA 2Q1FA 3IIAA 1H8TC 4IQPA 3WW3A 3K75B 4OCTA 3FLRA 1ZRDA 2XGXA 3AVSA 3PUSA 3A4UA 3IN9A 4COYA 4JTOA 5A70A 2KD7A 2PXJA 3DUIA 4BQ1A 3ZXAC 2DVFA 1RTVA 1LB2A 4NMIA 3N7KA 3GALA 4EN9B 1AVBA 4OUMA 4EWEA 4FPOB 3TNQA 4OHWA 1YIFA 2BFUL 4PQQA 5IWFA 1D4VB 4MOAA 3KT7A 5FZ8A 3BKZA 2VW2A 3CJIA 3J9SA 4Q5OA 5FXZA 2B9VA 3ECQA 1OUXA 5ACA1 1KS4A 4Y20A 4KL1A 4XTMA 4UOJA 1VBD1 1IG3A 1AUYA 4R8HA 3NKTA 4YG6A 4LIVA 2Y60A 1IPSA 4WV8A 2BNNA 2Z4FA 1ASJ2 4FAGA 1HRV1 4L8QA 4K1YA 4MGQA 2DV9A 2P5BA 3IDCB 4L11A 1PX3A 2YFUA 3MV01 3B01A 3RNSA 5FXWA 2HYXA 4HPKB 3NV4A 1VR3A 4CDXA 3T2QA 4B29A 1CPNA 2BVVA 3ETQA 4BQ5A 4COZA 1EP0A 4ASLA 4EWAA 2L9LA 1FT9A 2WYFA 1W8FA 1TZOA 1RVF1 4XUQA 1ULDA 2WYSA 3SKVA 4CDQA 3WP5A 3D8CA 5FZLA 2P1BA 2TEPA 5FPVA 2WO7A 3T1MA 4C90A 1QEXA 5C3QA 2CHHA 1Y3TA 4AI1A 2QBXA 2VNRA 1K3IA 3KV4A 1OLMA 3NV1A 1UY0A 3WNKA 1XQNA 1O7FA 3L9JT 5IVEA 4ZHNA 4LBQD 1C1FA 4B1LA 1C57A 1F4AA 2N7GA 1W9FA 3N9MA 1SLAA 4FPJA 2IFWA 4GMP0 1A34A 3V65A 1TMF3 4HONA 2W1QA 1AYM3 4AFCA 4EN8B 4QXHA 3B7MA 3FFQA 4OHYA 1NLQA 2A1XA 4Z1VA 1AL23 4K20A 2GNDA 1VE0A 4GKYA 4AXOA 5ERLA 1BK1A 3BOWA 2ZACA 4QPIB 2H6BA 3O1RA 4AF9A 1LAJA 1APNA 2VZQA 5JVVA 4AGVA 4CPBD 3AP4A 4YM0A 1MACA 1KITA 1CPMA 3E6BA 3EB7A 1VBE3 2VBPA 4XVHA 4Z2WA 1UOGA 2XWBB 1O4YA 4NRQA 2ZX0A 2ZGRA 1F5FA 4ZU4A 3V64A 5FQ0A 4QPGA 3VL9A 1O3QA 1VRH1 2VVFA 3SNMA 3MW4A 4V2WA 4OQ8A 3I2KA 1HXS2 5C9AC 1UYPA 2WDBA 3S30A 1AYN2 5FQ0B 4CVUA 4S2HA 3JD71 4LO6B 2X29A 4Q4X3 4AL9A 4N53A 3T0AA 4W6XA 1OOPC 3CHXA 4I0BA 4LLOA 2DDUA 4CUCA 4EV0A 1UOFA 2DUOA 3WOGA 1RUD2 4BK4A 2FDIA 1CAWB 4HBNA 4LBLA 3J7HA 3BTZA 5K0UA 4AEKA 2AH2A 4AR2A 3W5MA 2PHWA 1W6NA 3PIGA 3WT3A 3TN92 1W6PA 1URXA 4NRMA 3S6PA 2VZUA 2B5HA 3K51A 1RUG3 2VCCA 1HIXA 5GJ6A 2RR12 3WDXA 4WM8B 5FY9A 4HKWA 2R041 3FWEA 3GHNA 4NUBA 3SQOA 1DYOA 4CSWA 3ZFFA 5FYMA 4AHWA 3W58A 3B3QE 1IGOA 1H9WA 5FZ6A 1RUG1 5FOJB 3AKRA 2DTYA 3M2MA 4AQ6A 4MGTA 1ENSA 3SCHA 3WNOA 4AQ2A 2RMU2 2LUWA 4JGYA 5C4WB 2UYAA 1LOGA 1RUJ2 3CLPA 5GZDA 5LEJA 4QQLA 3WQ0A 4IV3A 3HR9A 5LA0A 3MV11 3N7JA 2C6SA 1GZCA 4CCMA 4LR4A 4NVPA 3R6SA 5L73A 3RYKA 3HQXA 2YGMA 3O12A 4GALA 3ZMNA 1SQ4A 2JB4A 3H50A 2ZAAA 4GH4C 5A33A 1LU2A 5T5OA 3FJSA 1UOJA 1ODNA 3POIA 3PUAA 4FI9A 3D5OA 2KR2A 4MV2A 4Q4W1 1SCSA 3B94A 2RJLA 1W6PB 4QKNA 4IE4A 1WMEA 3LPGA 3HT2A 3S0MA 1J59A 2RHPA 3EYPA 3QBQA 4Q29A 4W6YA 4FSJA 1ZZ6A 4LHKA 3IPVB 5FZCA 1EYBA 3ON7A 1CD3G 1HQWA 3O0XA 4N43A 4QQPA 5F3EA 3ZN5A 2JDZA 2W2IA 4XJUA 2OS2A 4GB31 2SBAA 4U2AA 5A32A 1BEV2 1VBC1 4O9EA 4G3YC 4CU9A 1HB4A 1ZREA 2RS52 4AGGA 1GOFA 2RMU3 4X6QB 1GZWA 1ZA7A 1NAEA 3CQOA 3ENRA 1QDCA 3LWCA 4FFGA 1L7QA 5HXMA 1RB8G 4YM2A 4QX3A 1GKBA 1KQRA 1UX6A 3EQEA 3VBOA 5CIRA 5FXXA 1BEV1 3JBG1 4K21A 1CGPA 1FOD1 3PJYA 4QKDA 2R071 3VKLA 2FZ2A 2JDPA 1PIV3 4KI5M 5SV8A 4LE4A 1QOTA 2XVKA 2B42B 1PVC1 1NE4A 2GN7A 3H8XA 3P3NA 1T6GC 1W3XA 3OEBA 4DFSA 4OYUA 1LEMA 1MS3A 1YQ2A 3M8LA 3ME2A 3IKWA 2BTVC 2IWGB 4K8FA 4LTAA 4N9HA 2VZPA 1UX7A 2QKDA 4G9SB 4JC1A 4NPMA 1OFNA 3QACA 3VHOA 1S0DA 2PA7A 2ZGLA 4FT8A 1GQGA 5FZ3A 5FO9B 4KMQA 2JEMA 3QLQA 5FK8A 3VV1A 4YW7A 4DOUA 1KJLA 1SMVA 3AZXA 5FMCA 1LULA 2WLQA 4D6RA 4TWTA 5HV0A 2YU2A 3JD72 3H7JA 2E63A 2J22A 1WMDA 3DYPA 1YFYA 3PLQA 2XVGA 1PGL1 1NLSA 5FUNA 1L7LA 4UFHA 2W46A 1S2KA 2FDFA 4M3CF 1YFUA 2P4EA 3OBRA 4HXCA 5A3PA 1LR5A 3A0NA 1RJ7A 3POBA 2WS93 2ZXQA 1YYNA 4X8PA 3WDWA 3R05A 2VZOA 3ZXLA 5LATA 3HEIA 3MGUA 4BQYA 2GZWA 1W9WA 3VGIA 2WO1A 3MLJA 5FY0A 4KG8A 2JG9B 1CIYA 3H1YA 4XIKA 1SLIA 1XE0A 2CGNA 4N43C 1NCQC 1RC6A 2K9ZA 5C6CA 1HJGA 3QH6A 4K8RB 4FAHA 1G9CA 3D6EA 2BWCA 2VUDA 2A3XA 1DQ4A 1UO9A 5FP8A 2IXIA 3DGTA 1S0JA 1H4GA 2ARCA 2O1QA 5JCTA 3H1MA 1BKZA 5A7NA 1H1AA 4Q4W3 3ZFEB 2X5IB 4CE8A 4COUA 5SV5A 1C8NA 3OUIA 2Q0AA 2ZBJA 5JSOA 2ZGKA 1EV13 2VUAA 2PLV2 4N53B 2WA4A 4D69A 5I93A 4D3WA 5C5TA 4Z2AA 1GQPA 3ZR5A 1C5HA 4JDNA 1HN1A 2AYHA 2UWCA 3N35A 1LEDA 2ZA9A 1DZTA 1VBD2 2P17A 2VO5A 1BMV2 1TMF1 1YXWA 2ENRA 2R49A 3SXWA 3S5AA 2OQ7A 4NAOA 4WM7B 2WRAA 3KWVA 4ATFA 3VDBA 2VOTA 5JXIA 5ACA3 2YMZA 1MEC1 1A6CA 1QNWA 1HN0A 4Y1ZA 4FOYA 1F9KA 4LO5B 2QZ3A 2EVXA 5KBFA 2VULA 2YBPA 1A8DA 4KH9A 4NHMA 4BQ2A 1J3QA 1QKQA 1PMJX 2LTNA 3K77A 4CU6A 3KGZA 5GZFA 4AWDA 5A6QA 4XAEA 1W2AX 4JGYB 2D3RA 2F4PA 3DN7A 3I54A 1IS6A 1KFUL 4AI9A 5AVAA 4PLMA 4P14A 1W9TA 5BYNA 3E5UA 4IEUA 2JDMA 4XF1A 1W99A 4LBQA 3OD4A 3LA2A 3M3QA 4OUEA 4TLGA 5LK5A 1Z78A 3SH3A 2BFUS 3KV5A 1FPN3 2B9UA 3VBSA 2CDPA 2VXJA 1JZ8A 2WO3A 2I45A 3Q8AA 1GOGA 4AVAA 4FPHA 4AEDC 4E4DX 3BOPA 1XYOA 1E5HA 2C26A 2XXZA 3MO4A 4Q0UA 4W65A 2RS53 5CNAA 3HN3A 5E6HA 4COVA 4HSJA 5FPAA 4KWUA 5CFCB 4I2OA 1B35A 2VD7A 3IDAA 2VQTA 2BQPA 3NL1A 2VVEA 5LBCA 3AXEA 3N36A 3NNGA 5C70A 3BI3A 3FE5A 5LRSA 1OH3A 1RUC2 2ADEA 4IV3C 4CXWA 5FZ7A 4NROA 1TE1B 4BLIA 2RS31 3R0RA 3ZXKA 1US3A 2WO2A 5JMOA 1JZ7A 1V6KA 3T0BA 2XJTA 2RDRA 4YW1A 3ZXJA 5F37A 1JYWA 4FTEA 4GXLA 4XHXA 1Z0HA 4YGCA 1JW6A 2VM9A 3ILRA 4D7YA 2Z69A 4L97A 2J7MA 4K7JA 4OI2A 5DMYA 5LASA 2WNVB 3VKMA 2G9ZA 5J48A 1JZ6A 5F8PA 2HBUA 2YC4A 2TNFA 5DDJ3 2FCTA 3PUQA 3VUOA 2WLPA 3KZ4C 3ZOIA 4AQTA 1ND3B 5KHJA 1NG0A 4YGDA 2WKKA 5A7OA 3ITQA 4INDA 4IE5A 4AYUA 2E6VA 5JDBA 3FLTA 1WLTA 5GLZA 4LUMA 5DDJ1 1PIV2 4QGMA 3UL2A 1DYPA 1PVC3 1PZ7A 1UKGA 1OSGA 1WA6X 3FL7A 1QOSA 4WM8A 2JDAA 1EPZA 3OGRA 4F7ZA 5L7OC 4WM8C 5L7OA 3URFA 1JYCA 2ZHNA 4S2DA 2NP0A 4Z92B 1O5UA 1ULFA 1W2TA 2A3YA 2JG8A 1DCSA 3GZUC 4F3JA 2ZGPA 3AMQA 2Y38A 3CZUA 1L7RA 4LO7A 4QWNA 1NZCA 1QF3A 5FP3A 2EXJA 3E97A 2WN3A 1ZZBA 3KQ4B 3ILNA 3ZYJB 4IERA 3M3IA 3S7IA 1RUF2 1JTZX 3T4VA 3C8XA 2HWD1 2JECA 1COV1 1MQTC 3AC0A 1WUVA 2OXBA 1K45A 3AYDA 3I2GA 1FXZA 1XU2A 2HWC3 2HWB3 1AL22 2C1FA 4UI9L 4RS5C 2YPJA 1IPKA 4WZFA 1DU3D 2BV4A 4RQPC 3VBOB 4Y4YA 4CDXB 2DCJA 1W9YA 1K12A 1MS9A 2JENA 2W92A 4NIDA 4BE3A 1TVGA 3VKOA 1N47A 2YC2A 3VLBB 1QJY2 2JXAA 5JUVA 1YI9A 1CONA 2NMNA 3O1TA 2QQWA 4QD2A 1ASJ1 4Z82A 1U5XA 2RV9A 2YGLA 1CX4A 4UFIA 3KGLA 4XFFA 3WHUA 5C8WA 4LOSA 3UGGA 5LRRA 2HEWF 3WG2A 3HVDA 3LIHA 3QOPA 1ZX5A 2PQQA 5K0UC 1ENRA 3WF3A 4N9IA 5LZ6A 3NQHA 3LOIA 2H0BA 3E5XA 4PBOA 3U07A 3MFCA 4HOOA 3ZFGC 4X6RB 4BB3A 2VUCA 1JI6A 3BB6A 2VMGA 1QOOA 2XKPA 1T6BX 4ISQA 2J1SA 4QU1A 2VTXJ 4I0AA 3MDPA 4CCLA 3UKVA 1ZZ9A 2VG9A 1WGPA 5FZDA 1S55A 2B39A 4AFBA 2P37A 5LA9A 1J1TA 1O8SA 4OUSA 2GC3A 2RMU1 4E4HA 5AC91 3BTAA 5G05L 4QB1A 4XHBA 1RUG2 3M3EA 2XH6A 3MF6A 4GB32 1HV1A 2VQUA 4XXAA 1R092 3N9LA 5CFCC 5BNNB 4ATEA 1OF4A 3CMGA 4MYEA 4DS0A 2Q8OA 1NCQB 1KGYA 2ZAHA 3IMMA 2BP6A 4FPKA 3WW2A 4DXSA 1P8JA 4UFLA 1HRI2 2PHUA 2Z5WA 4YW5A 3WUCA 2VMDA 5JI9A 4JV4A 4ZS3A 1ULCA 2VQ0A 4FOVA 5LK7B 1X50A 3FUQA 4IV1C 4AVVA 3RFRA 2ZS6B 5IHRA 2BYVE 3U11A 2HEVF 1V9U2 2VL4A 1R1A3 1AR82 2AEYA 5EPAA 3U14A 1CAXA 3FC0A 1AR73 2BWAA 3MW3A 4BM8A 3K4DA 1QJY1 1I6XA 2FCVA 4EZHA 1WCQA 3LF7A 1NKGA 1WZXA 1XOYA 3T2PA 2MEV3 1MVEA 1C5IA 4DEVA 2ZJCA 5HXVA 1V6LA 5DAPA 2GNBA 3WW4A 1RHI1 1YRZA 1GLHA 1O6UA 3TRSB 1ZZ7A 1AX0A 2XR4A 1RMU1 2P6CA 4E2QA 5DUVA 2JDYA 3ST7A 1OD5A 5KWRA 3OD0A 3OF1A 2KA3A 3PJQA 3CJIC 3N3HA 3PU3A 1MZEA 1U5ZA 4RHV3 3UGHA 5FYHA 4V1PA 2C9KA 2HBTA 3N9OA 2QQPA 1PZ8A 3WV6A 1R093 2VZSA 3PVOA 3ZO0B 1XNAA 4QDSA 3ZFFC 3NVCA 4PIYA 2UURA 4ZKTB 1UCXA 2QUOA 3W20A 1DQ5A 2ZKNA 4MGZE 2E7AA 4N7IA 4ASMB 3P6BA 3TEYA 1CAXB 2HWB2 2HWC2 5C5UA 2R0FA 4HFSA 4OULA 2BOIA 5D8AC 2R16A 4IEWA 3Q8FA 3AX4A 4CRQA 1W28A 4BXFA 4XFAA 4XOGA 5D2AA 1D4M2 1XNBA 4BQ4A 4DB5A 3POEA 5A3UA 3I59B 5F2SA 4QPGB 4AEJA 1RITA 4YGEA 4CP2A 3KF5A 1AXKA 2WINB 4YLZA 1GP6A 1N3QA 4CDQC 4E2SA 5AFEA 2B46X 2BGPA 4K1ZA 3OPTA 4P5HA 3W59A 4LT5A 2AACA 3VD5A 1FMD2 2XBO2 2VCBA 1ZRCA 1QJX1 4Q4X2 2XUEA 4DZGA 4LJHA 2RDNA 4QPIC
chains in the Genus database with same CATH topology
1PHMA 4CEWB 4OVEA 4OI4A 4CZSA 4K6BA 4XPVA 5HI0A 2NN8A 2OYZA 1N1VA 1XYNA 4MUVA 1NY71 2EXHA 3WG1A 1CQ9A 5FPXA 1U12A 4N90A 3ZYGA 1REFA 4CDWC 1SACA 4Q0QA 1FX5A 3AK0A 1O5LA 2XJRA 3DPRA 3MPPG 2WSVA 1JN2P 5A3LA 3V0BB 1NLRA 1RUC3 2DVDA 5C4WC 4WVVA 3VZNA 1Q8VA 4RS5A 3TAYA 4RQPA 5EJ3A 4YVSA 1YUDA 3N7MA 2BVBA 4CDUC 3VKFC 1DYKA 3H3ZA 5I8TA 1XNCA 5T5LA 3VKNA 3ZSMA 2PTMA 1AR81 1Z7S2 1AR91 3ES4A 1D4M1 4XQ4A 5DG1A 4YZ5A 1LOBA 3O5SA 2K0GA 4C0BA 4H55A 3WR0A 4JTNA 1C4RA 1DGRA 1ZBA2 1QNYA 1QQP1 3TYJA 4Q4Y3 1HW5A 4YARA 5FMOL 3O7OA 4MGKE 5FPZA 3VBHA 2BUKA 3O0WA 2R30A 3UK9A 2XJSA 3DL3A 1UF2C 2ZGTA 1RUOA 4XEZA 1RUH3 1O3TA 4R4XA 4PIXA 1V00A 1MZ6A 3CNAA 1AJOA 1U0AA 1KRIA 2ZHLA 2VU9A 4B7EA 4KGGA 3RYRA 4FTSA 1XYPA 1ZVFA 2BNMA 4M3CE 4HK8A 4YYOA 4HPKA 2PAKA 1H1IA 1ND3C 4HMZA 3E6CC 1RUF1 1HRV2 5GLTA 5C33A 1RUH1 3SMHA 4FQZA 1S0CA 1AHSA 2WZPP 4CDUB 1LHWA 2UY8A 3MLLA 5EZWA 1ZNPA 1SDWA 2I07B 2X5IA 1QXRA 4QQOA 1ULGA 4M3CB 2OW4A 1JOJA 2WT0A 3OY8A 1QXJA 1LHOA 4R9CA 5ABJB 5D1IA 3DKWA 1MQTB 5JSRA 4WVWA 5FCCA 1YI7A 1N3OA 4PIZA 5E1RA 2ETEA 2OVUA 4XETA 3RWNA 2HWE3 3NAPA 3H0OA 3USUA 5JOXA 1R1ZA 3OJBA 1AR61 4WBBA 3UJOA 2RS51 1ZBE3 2A73B 3J8F2 5KHKA 1BJQA 2WL1A 3IWZA 3ASIA 1O3RA 4XF0A 4YG0A 2VOKA 2GALA 2WS91 1GZ9A 1W6OB 4CDUA 3OPZA 1IS5A 5CG8A 4LBQB 1GYKA 3WDTA 4HK9A 4MLOA 2WS92 1POV1 4M3CA 1JBCA 4P9IA 1FMD3 1K5MC 1FAYA 2A3WA 2V73A 4IESA 5BPXA 2FQPA 1UU6A 1KD7A 3GBWA 3JB8A 3AKSA 4ES8A 3MF9A 4KWKA 1HXS1 1KXGA 1RL3A 4PCRA 1AR72 3ZN6B 3M70A 2D6MA 4XMAA 5J37A 1GNHA 1C8M1 1VBB2 2WZR1 1AL0G 4Y24A 3IDEA 5H9SA 1FMD1 2UY9A 5GZCA 1RJ8A 1NE6A 3DF0A 4Q0SA 3VBRB 5BNQA 3JU9A 1BCXA 2DCTA 3NW4A 3GZAA 2ZGMA 1F8VA 4Y1VA 4DNYA 1Q8OA 2WT2A 1Y7BA 1U5YA 3CF6E 1ZBE1 3WG4A 1WCDJ 1YIPA 1WW5A 1E57A 1CJPA 5FMOS 3WXPA 2ZGOA 4YW4A 2ZTNA 1OMIA 2B45X 5K7PA 2RM22 1M06G 3RJRA 1PGW2 3ZIXA 1FNZA 2XVLA 1NXD1 1FV2A 1O4ZA 4JGZA 4RS5B 3SISA 3EXUA 4QU2A 1EAH3 3BPZA 4JDMA 2RS32 3AKTA 4OFGA 4BH9A 4EJRA 1G86A 4LHLA 1HRV3 4XILA 1EV11 2EA7A 1LRHA 1HQLA 5GLWA 4BA6A 3EBRA 5CB7A 1AX1A 3CJXA 1H2MA 1PM7A 3P3PA 5T52A 2D3PA 5FREA 5JR7B 1FNYA 4YNIA 4BIFA 1I9RA 3VBHC 4P9GA 5JIUA 1ENQA 4R52A 2NZ9A 4XTPA 5I0UA 1PIV1 1IPJA 3KD4A 5FOBB 1POV3 2DTWA 4E4SA 1NXMA 3R4UA 4Y20B 2A6VA 2RM23 1FPN2 5JPMB 4R4ZA 5KC6A 3LB9A 4AI8A 1PVC2 2PELA 2RM21 2R6QA 4PLNA 5I0RA 4MX3A 2XLFA 4JDOA 4MSVA 1WD4A 1C1LA 3AP7A 1WD3A 1XU1A 1HX6A 1OQDA 2WNEA 1UD1A 1PNFA 3AYEA 2DVAA 3JB4C 4XFHA 4CTEA 4DQAA 2GU9A 3J26N 5AC93 1JHNA 2CV6A 3VBRC 3ROUA 3X29B 2AUYA 4YRDA 2WWSA 2ZABA 2XJPA 2ZGQA 3KCXA 3D4KA 5IK7A 5GKAC 4DMIA 4QXKA 1H0BA 3VBHB 1CAUB 2XLGA 1VP6A 3FMGA 3ILFA 5KXDA 3L2YA 1J3RA 3B5LB 4FQ4A 4FBFA 1NY72 1SLBA 2TUNA 1V6NA 1RUJ3 4MXVA 1SBEA 4CEWA 4FXKB 5I8SA 4XW3A 1DQ2A 1IZ3A 2P3KA 2W52A 4Q27A 3ZFEA 1CJDA 1NCRB 2QJVA 2VW1A 5IK8A 1DDLA 1CR7A 4WM7A 2ZMLA 4XJ9A 2ZOEB 1PMIA 5T5PA 4YSFA 2JD4A 4YVSC 2XL9A 3EO6A 3KB5A 3AP5A 1LTEA 1PGW1 2HWE2 1FPN1 1COV2 1Q43A 4Q0PA 4LNVA 4B4RA 5IK4A 1V6IA 1CVNA 2A75A 2Z42A 3HIFA 2YY1A 5TSWA 1HKDA 1NCRC 5H9QA 4HL0A 3WX5A 3B00A 2NPIA 4MVTA 1VAMA 3FLPA 1AXZA 2GMMA 1UZZA 4LEJA 1X8MA 3AZWA 1VALA 3WCRA 4GB33 3PMSA 1QJX3 3ZN4A 2CNAA 3ZFGA 4IXLA 2MEV2 2BGCA 5ABJC 1UPSA 2VW0A 1R083 4AVBA 3RPQA 3USSA 4MGYE 2MHFA 1LGBA 5CVRA 3LKJA 1AJKA 1OHFA 2NQYA 1DQ6A 4PDWB 1OFSA 3TB0A 5C8CA 1RUE1 4FPGA 5C8CC 4Y5Z0 1BVVA 2R043 5BNOB 4QQHA 1I1EA 1JH5A 4WVZA 2BBVA 2XJUA 2H6CA 2HJIA 3W9AA 1NYWA 3ZMOA 2WFPA 3KT1A 1D0HA 3QCWA 1I3HA 1AYM1 2GH8A 4Y1YA 1W6MA 3SHRA 4GH4A 4DY3A 5JSPA 4HZFA 4XBQA 2EXKA 4PLOA 1PO21 3FHIB 1LGCA 3AB0A 1W0OA 3G6JB 2D43A 2HWE1 1PVXA 2ZKLA 4FCAA 2ZZJA 1VRH2 2K2SA 3INAA 1DGRN 2SLIA 3QD6A 4QM9A 1QGLA 2JJ6A 4CDQB 4PDWA 2E9QA 1WA4A 3KLSA 2D5FA 4XJAA 3B93A 2JICA 3OGJA 4Q4X1 1AZDA 5E16A 2PAMA 1O91A 1X36A 2LALA 3WVJA 3OY8B 3NV3A 4NR1A 4Y1XA 3TN91 1IKQA 5ABJA 3QH7A 3VDDC 3EHKA 2HWD3 4GKXA 3ALQA 4XFIA 4YVWB 5GALA 3ZSEA 4YZ1A 3MI8A 2AR6A 5K8SA 5BNPC 4LLFA 5BNNA 2NM1A 4Y26A 2NLRA 1CESA 2KXLA 3IM0A 5D8AA 4SBVA 2DFBA 4NN0A 1GQHA 2JE7A 2RR13 3NAPB 3CJIB 4PQ9A 3KT4A 4YW2A 1MR5A 3RYPA 4LBMA 5DZFA 1RUI1 2AENA 4YVWC 2UWBA 4BLJA 1BBT2 2IFRA 3PVNA 4DINB 1KDMA 1W6OA 1GANA 2E53A 2GAUA 1QWRA 1LGNA 3GHMA 1N1SA 4M00A 5BUVA 2RS12 4HVRA 5DG2A 3O14A 1LHVA 5CFDC 3K48A 1YJLA 2QVSB 5CFDA 2DF7A 2Z2SB 4AK3A 4NOTA 4QPIA 4MXWB 4S2GA 1C8M2 2WZR2 1D2QA 2ATFA 2YC0A 2CAUA 3C2UA 1HQNA 5DXDA 4BPZA 2VXRA 3VZJA 4JRLA 4L9BA 4ISRA 3LSEA 4XE9A 3FZ3A 4I09A 5CAZA 1XNDA 4BOWA 3WDVA 4PDWC 3M4FA 1PO13 4I02A 3BALA 4LBNA 2C0ZA 5GM0A 4XF4A 1LKNA 3RDIA 1LOCA 1EAH1 1W6QB 1IQAA 4KBBA 2A6ZA 3NAPC 1D0GA 1RHI3 3RI9A 1VRH3 3DV8A 1QH7A 2QE3A 1QJU1 4XQWA 4S2FA 5L19A 4WZCA 4XBLA 5IUQA 4NHKA 2HWF1 2PLV3 5LEKA 3ZPYA 2XLAA 1DBNA 2R1DA 4JGZC 4AFAA 4Q4V3 2GN3A 3ZN6A 2IXCA 1UN1A 4URTA 4K3UA 3POYA 3RMXA 1ZM1A 4IEOA 4KU7A 4IEPA 3RMYA 3ZSJA 2G9GA 3IPVA 2G9FA 1FI2A 5FDBA 3TBDA 4TYSA 3KCYA 4AEDB 1DGWX 2Z79A 2R0HA 4YGBA 1Q56A 2XUMA 4FO9A 2ZZQA 1MZ5A 1CAVA 1FOD3 2OUHA 1SEFA 2GNMA 2ZGSA 4AVCA 3ZYRA 4HLTA 5E89A 2YUEA 1MS0A 4FPLA 2VVDA 1W6MB 1QQP2 3AP9A 4JGYC 1QMJA 4Q4W2 4YM3A 3CEWA 2RJKA 1MEC2 5FFOC 3B69A 3USUB 1RHI2 1UIJA 3MZHA 1H2NA 3FX3A 1G7YA 1ZRRA 4XXPA 3AKPA 4R9DA 4YW3A 1BBT1 3HMYA 3SCGA 3IT8A 5A32B 1ZRFA 4YZ2A 3AFGA 4EN6B 4ZU7A 1PNGA 5JWPA 2YDEA 4HKLA 3IBMA 1Z7S3 1SFNA 1CAWA 2WIIB 2VUJA 3WLUA 5K0UB 4OI1A 3OYWB 3U10A 3B9IA 1OPOA 4OI0A 1YO8A 3NSTA 4O9GA 2PHLA 1LESA 1RMU3 2VOXA 2ERFA 4RFT0 4LUKA 1NQJA 4XYXA 1LJ7A 1KDKA 2DVGA 2GNTA 1ASJ3 4M0HA 2DFCA 4AQSA 3VHRA 4RQPB 3V0AB 4YVSB 3MIGA 2PHTA 1QJY3 4EWDA 4RA0A 1YJKA 5JZGB 3GZTB 2I2SA 2EIGA 2VH9A 4FP2A 4Q1RA 1REEA 1BMV1 5F9TA 4XMIA 4WVMB 1KJRA 4C91A 3OCPA 1RUI3 3WG3A 4F83A 3KM5A 2R062 1VBE1 3ZXEA 2I74A 3C3VA 3BIWE 2D97A 3RQ0A 4H7MA 1K5MA 2QDRA 4UBHA 4ZU5A 2ZGNA 2VOVA 3VBUB 1XE8A 4QGLA 1WW7A 3VN4A 3BCWA 3MFAA 1GICA 1RUE3 2X8KA 2VNGA 2ZHKA 2D40A 1AL21 2CTVA 1HLCA 1S1AA 1PO12 1YFXA 1DF0A 3VZKA 1OQEA 2GSYA 3ZSKA 1TME3 5CU1A 2D3SA 3IDBB 1WLWA 4L92A 5IK5A 2NYYA 3AMHA 2MNGA 3HT1A 5FLJA 3GBFA 3LA7A 1SBFA 4D7SA 1WLCA 3AFKA 4W6WA 1PGL2 3I2DA 5DDJ2 1L3JA 1VBC2 1MZFA 4GWNA 1ZBA1 1N1TA 3R4SA 4FXGB 1QU0A 3DPRC 4I3GA 3M1HA 1B09A 4A7YA 3VBUA 1FATA 1CN1A 5T55A 4HN0A 4SLIA 1OKQA 4FPYA 2OZJA 3JQWA 4RGGA 5JIAA 4IETA 2CWSA 3JD73 3O0VA 1BEV3 4C0HA 1G8WA 2DWRA 5GLUA 1PK6B 3J4UH 2ZPXA 2VQAA 3AZVA 4AW7A 1V6OA 1ZBA3 2IXJA 3MLKA 1R091 1X7NA 4HVQA 1IS3A 1G9BA 1DZQA 4QMAA 1VLNA 4P9XA 1RUJ1 1V70A 2VMHA 5EYXA 4QX5A 1NCRA 1VBA1 4RHV2 3RG0A 1YWKA 4CP1A 4BHPA 1LODA 4OLLA 3MIEA 4CEWC 2WNUB 4QM8A 5BY5A 3JQXA 4LBOA 3ZFFB 2DVBA 1S0IA 2QCSB 2W39A 4P9LA 5L7OB 1CAUA 2Y26A 3WQ1A 4C1XA 4H14A 1V9U1 1D4M3 2PAEA 1SFYA 4AEDA 1D2SA 1W6QA 1S0FA 1IHMA 4NWWA 5H9PA 5BNPA 4J6GA 1TME1 3WP4A 2WNVA 1LU1A 1RUD1 1PZ9A 5KHGA 3LAGA 3RZZA 4LE3A 4K9SA 5K9YA 1MS8A 5DZGA 2A7AA 2JKBA 1Q8PA 1RUI2 3D82A 3GYDA 5E88A 5CA6A 1I5ZA 1X8EA 3HN1A 2X53S 3WNXA 2CGPA 1AR83 2WA3A 3NV2A 3ZXGA 1DG6A 5J98B 4IV1A 3AZYA 5FRAA 3VBFC 2PLV1 2WQ4A 1JUIA 4YFZA 2PFWA 1W2UA 2B7YA 1BVP1 2EXIA 4LHNA 3ZVXA 4U36A 1H8TB 5JAXA 5I91A 2DYCA 3AJZA 1M4WA 2Y0OA 4COWA 1CAVB 2WFF1 5FO7B 4OHVA 1LOFA 3MEPA 3VZLA 4BMEA 4KQ7A 1RUNA 3JUUA 2OPKA 3MIFA 1R1A2 4GIQA 2JG8C 2YXSA 3KQRA 3H7YA 4TSVA 5J36A 1C28A 2GDFA 4MXWA 1UAIA 4XBNA 1XE7A 2XBO1 5HCAA 1DGLA 1VBB1 2TBVA 3FBMA 4P9YA 1Q3EA 1RMU2 4HVOA 3WW1A 2A6WA 2ZX3A 5BNOA 2Y0IA 4IV1B 5KHHA 4JGZB 4QGNA 1GNZA 3ELNA 2D6KA 4XDQA 1FV3A 2A5ZA 3WZ1A 3V0AA 1QJU2 3U4XA 3B02A 5JI7A 1NOVA 4Q8LA 4Y1UA 1S0BA 5EYYA 5FTTC 1OOPA 1ZYBA 1JUHA 3THTA 2D93A 4L99A 4P9WA 3WP3A 1POV0 4PF5A 3WD5A 3UV9A 2XJVA 3OYWA 4YVWA 5CG9A 4G4FA 4B4PA 1NA1B 4KU8A 3A0KA 1V9U3 1VBA3 5BXXA 2LM3A 1K5MB 2OUJA 4IEXA 3FFZA 3PVEA 4E9KA 5ACA2 1OPMA 4NO4A 2NMOA 5IT6A 2YHJA 3D0SA 5AVPA 1UPIA 2HYKA 2UWAA 1QJX2 1AR92 5DZEA 2CAVA 1SBDA 1WW4A