4AGGA

Structure of a tetrameric galectin from cinachyrella sp. (ball sponge)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
144
structure length
144
Chain Sequence
PIQSIKVDPMKSGGLGVVYRSPDKGRVSLYLYNDGEDILLVVDARFDWRGEQNVLVLNSKFAGGEWGPEVRPEGFPFPCCGYVTTITVRVEIGADGFTLSANGIEIVKYPYRDGLPPPVTKFQYVFQDQGASETAQLESLSAYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Tetrameric Galectin from Cinachyrella Sp. (Ball Sponge).
pubmed doi rcsb
molecule tags Carbohydrate-binding protein
molecule keywords GALECTIN
total genus 23
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4aggA00
2D3PA 3AX4A 4BMBA 3IPVB 1IKQA 5GLUA 1YIFA 2W08A 1CONA 2AYHA 3ZYPA 2ZHKA 2P34A 2UWCA 4XMIA 3AP6A 4R9BA 1LOEA 4MYEA 2DYCA 1C4RA 2PHXA 2D6LX 5AVAA 1KJLA 4LBOA 5T50A 4K1YA 1AVBA 1QNYA 3AYAA 3WUCA 5JLVA 1JW6A 1G86A 1HQLA 1AJOA 1C57A 3AZYA 3WV6A 1AZDA 1N3QA 1BQPA 3POSA 1LU2A 1LHOA 2DVDA 3C2UA 4FP3A 2XB6C 5IK7A 2JKBA 4UW4A 3NV2A 3MPPG 4YW2A 2EXKA 1O4YA 4LBQB 1KQRA 2NMOA 4DRRA 3UJQA 1MS4A 4U36A 4Y22B 1AF9A 1GNHA 1BYHA 1UZYA 5T55A 1SCSA 1MVQA 3SITA 1H9WA 2H0BA 5GLZA 1WBFA 5HCBA 1QMJA 4YFZA 2ZGTA 4Q2FA 1VIWB 4FPLA 1LECA 1SBEA 4ASMB 3AZZA 3N7KA 4Q8KA 5T52A 2DTWA 4Y20B 5JOWA 4WV8A 3AP4A 4Y1UA 5L73A 1SBDA 2A75A 4RA0A 1S1AA 2E6VA 2R1BA 1R1ZA 4BOWA 2DUQA 1JUIA 1CR7A 1NXD1 4NO4A 2KM2A 3OPZA 2XG3A 4XYXA 5DZFA 4YW4A 2A6YA 4XJAA 2GDFA 1Q8SA 2EXIA 2NMNA 4W65A 5CNAA 4ITCA 3N35A 4FPKA 1S0BA 1AXZA 2A71A 3AJZA 2EIGA 3MEPA 5KXDA 1U0AA 3FUQA 4M00A 1YO8A 2E7TA 1BXHA 1AX2A 1XQNA 2D43A 2YZ4A 1CVNA 2GNBA 4R9DA 3SH5A 1LU1A 4GXLA 4L8QA 4ATEA 2ZGNA 3SLIA 3FLPA 2VXRA 5JMCA 5SV8A 3M3EA 3RMXA 5DG2A 2CTVA 5GLVA 3SISA 5IK8A 4XXPA 2NM1A 1GICA 1SACA 5DXDA 1SBFA 1IOAA 2D6MA 1JYIA 2VUAA 2PELA 4DS0A 2ZHLA 1VAVA 2AR6A 2DVAA 4XTPA 2EXHA 5CBLA 1G8WA 4FPFA 1MS9A 1VALA 1WD3A 2GN3A 2P3IA 2V5YA 4R9AA 3VKMA 4BLIA 2CY6A 4YGCA 2WKKA 1GNZA 5H9RA 1IKPA 2I2SA 4FOVA 4XTMA 1QF3A 2VY0A 1DBNA 2ENRA 3ZVXA 3WDXA 4DRVA 4YZ3A 3ZSJA 3BODA 2ZMNA 4YW5A 5IUQA 3B69A 1AJKA 3ZXLA 4D69A 2AUYA 3WG3A 3VKOA 3AFKA 4CZSA 4FPHA 1VLNA 3CNAA 3LCPA 3M3CA 2A5ZA 4Q8LA 4R9CA 2DU1A 3ZYRA 5FRAA 3N36A 1WD4A 3R05A 3KM5A 1LOBA 1W6MA 2WT2A 4YW1A 1Q8OA 4XIKA 1SLAA 1N3PA 2WNEA 1GLHA 2D3RA 3VKNA 4AWDA 1LULA 4DFSA 3D4KA 1B09A 1CESA 1YRZA 3AYCA 1V6IA 3PVNA 5LK5A 2Z42A 1G9BA 1LJ7A 1QKQA 4LBMA 1LHVA 4BPZA 5T5OA 2P3KA 2ZMKA 4NOTA 3VKLA 1W6MB 1S0CA 5DG1A 1W0OA 4BLJA 1HQWA 1ENSA 1DZQA 1FYUA 2A7AA 3IMNA 1O4ZA 1SLCA 4WVWA 4YG3A 1LHWA 5GZFA 5KXBA 4AGRA 2ZGQA 3UL2A 2LALA 5DZEA 2E51A 1G9CA 3MW2A 4M3CB 1UZZA 3FLRA 4LBQA 1DYKA 4XE9A 1G9FA 1UPSA 1WW7A 1YI7A 2AGSA 2LTNA 1S0FA 3B01A 2GALA 1LGCA 2EAKA 2NYYA 4JC1A 3WG2A 4FOYA 1CIWA 2R49A 3MW3A 4YZ4A 1G7YA 1GBGA 4WZFA 2ZGUA 3M2MA 1A78A 1WW6A 4K20A 4M3CA 3RS6A 1HLCA 3O0XA 1Q56A 3POWA 3TAYA 1LODA 1GZWB 1OQ1A 2A6XA 2DVBA 3I8TA 3JUUA 3R4UA 5EYYA 4Q1RA 1DLLA 1Q8PA 5T5JA 4K21A 3UK9A 1MZ5A 2ZGSA 3PVEA 4XBNA 3V65A 5JOYA 1UN1A 3ATGA 3V0AA 4YGEA 2HYKA 3NV1A 2B7YA 2ZAAA 1DQ4A 2AREA 3QCWA 4FPCA 1FV2A 4YZ5A 2P2KA 1ZM1A 2GMMA 2YV8A 4Q27A 4XHBA 4XIOA 4DQAA 1F5FA 3OYWB 1W6NB 4GWNA 1KRIA 1UKGA 3TB0A 3I4IA 1ENRA 5IT6A 1LOFC 4YM0A 2VU9A 1KJRA 5GZGA 1JN2P 5GALA 2D7FA 4WVVA 1ULEA 3B3QE 4Q1PA 2UWAA 4F83A 2CYFA 3WUDA 2DUOA 3OBRA 4U2AA 1QOTA 2GMPA 1W6PB 2NN8A 4XZPA 1WLDA 1YXWA 4LBQD 4TZDA 2NP0A 2CWMA 1D0HA 3GNEA 1LENA 1WBLA 2FHRA 1SLBA 1LCLA 4YM2A 1V6LA 1WLWA 5GJ6A 2R1DA 1C1FA 3AZXA 4XJ9A 2PHTA 2FMDA 4XXAA 4AVSA 4M01A 1A3KA 1KDKA 5CA6A 1LGBA 4FPGA 5E89A 1N3OA 1UX6A 1DYPA 1W6QA 2YY1A 3LSEA 4Q26A 1LOGA 5CB7A 2R0FA 1DQ2A 2ZHNA 1UMZA 1ENQA 2ZGPA 4FP2A 4XBQA 1S0IA 2UWBA 1HDKA 1LOAA 1V6JA 1GV9A 3T1MA 3OY8B 5GZCA 1I3HA 1RITA 3NV4A 2P37A 1AXYA 3VV1A 5GZEA 1AX0A 2A3XA 3HN1A 2CL2A 1IS3A 1A8DA 4XJUA 2WT0A 4AGGA 1SCRA 2W39A 4AGVA 4C1XA 3WHTA 2GMEA 4JRAA 2RHPA 4FVVA 3ENRA 4PBOA 1DGLA 3HR9A 4GALA 3RQ0A 3VUOA 4YZ1A 3AP7A 1Z78A 3FLTA 1WW4A 5EYXA 1ULCA 1DHKB 1JXNA 2E53A 1S0DA 3AYDA 1V6MA 3O12A 5T54A 2VW1A 2JD4A 3POYA 3Q9OA 4ISRA 4GKYA 2WLQA 4Y1XA 1SFYA 4C1WA 3V64A 2JE7A 4BMEA 1PZ7A 3AP5A 4RL7A 5GZDA 1BZWA 3LSDA 2TEPA 2P3JA 3O0WA 4LBLA 3V0AB 3APBA 1ZA4A 1QGLA 4Y1VA 2GN7A 4CTEA 1MVEA 2WT1A 1MS5A 1J1TA 1N1SA 1CN1A 1MS0A 3BIWE 5JVVA 3VKFC 2ZGLA 3USUA 3D5OA 3W59A 1MR5A 2EXJA 1V00A 3QLQA 1C1LA 1IS6A 4GA9A 4HANA 3OJBA 5DUXA 3T2TA 3ZSMA 1FAYA 3WG4A 5DUVA 5HCAA 4FPOB 1GANA 4OZXA 1YYNA 1FNZA 1S0EA 2ES3A 4XBLA 3WDWA 3D6EA 1MS1A 1PZ8A 2ZACA 1UL9A 2A70A 1IS5A 2ARBA 3BTAA 1UAIA 1Z0HA 2DURA 1HKDA 5FREA 2GNDA 1LHNA 1ULDA 2OVUA 2VW0A 4I30A 1V6OA 1LOFA 4GWMA 5GLWA 1F9KA 4JCKA 2BQPA 2D6KA 1S0JA 4PQ9A 3IM0A 3A0NA 4LBNA 2ZGOA 3B00A 1GZ9A 1G9DA 4ISQA 4LBJA 3PVOA 2ERFA 4ZXKA 4ATFA 3L2YA 4TYSA 4P9YA 4Y22A 5DZGA 1X50A 1SLLA 4LBKA 5IK5A 4YG6A 2ZGKA 3A4UA 1QNWA 3M3OA 1W6QB 4Y1ZA 1CQ9A 2G4IA 3ASIA 2JDZA 4YM3A 1WW5A 1W6NA 1CPMA 1MS3A 2ZZJA 3FBYA 4KBBA 5CAZA 2YROA 5F5QA 3ZXEA 3N7LA 3ZSKA 3N7MA 3SH4A 3RG0A 1DQ0A 1DQ5A 1JHNA 2OUJA 2WSVA 1VAMA 2JECA 3IKWA 3FUOA 4YGBA 3O5SA 3RRDA 2JJ6A 2D6PA 2ZABA 1N1TA 3M3QA 3W58A 4FPYA 2E7QA 3WNXA 1I1EA 2D3SA 2A6WA 2A6VA 2PHRA 5IK4A 2YXSA 2WQZC 2WSUA 4Y26A 1LEDA 1N1YA 1QOSA 1N1VA 4K1ZA 2A6ZA 2CNAA 1V6KA 3ILNA 1LGNA 3AXEA 3R4SA 1H30A 2EF6A 4YGDA 2UU8A 5E88A 1JOJA 1GZCA 2V73A 4SLIA 1D2SA 2PHUA 2D6NA 4XJ8A 1W6OB 1Q8QA 1CJPA 3BOPA 5KXEA 1FX5A 4XMAA 3IN9A 1F31A 3IPVA 1QDOA 2ZBJA 4AYUA 1BKZA 2AENA 2A3YA 2UURA 3SNMA 3WCRA 3RSJA 1FV3A 3WDVA 2VW2A 3UJOA 5EWSA 1GYKA 2YMZA 4YZ2A 2EALA 3MW4A 2D44A 2GNTA 1CPNA 2Q5TA 1BJQA 3WDYA 3USUB 2GNMA 2PHWA 4Y1YA 5T5LA 3AP9A 1GZWA 3PJQA 5DUWA 3WHUA 1QOOA 2DV9A 4UW3A 4PF5A 3NWKA 1APNA 2SLIA 2ZA9A 5JOXA 4Z8BA 2ZMLA 3AJYA 3JU9A 3B9CA 4XJWA 2DVGA 1ULFA 4XHXA 3DGTA 1AXKA 4XILA 3AXDA 2DWRA 2W68A 2DUPA 4XDQA 1G9AA 3M1HA 4YM1A 2ARXA 5HCFA 2C9AA 3OYWA 3RMYA 2ZGRA 4FPEA 1LHUA 4FOWA 4Y20A 5EXOA 2DVFA 4CRQA 3FFZA 4M3CE 1IS4A 3OBTA 5BYNA 2R16A 2AH2A 1SLIA 2A3WA 2PHFA 5JDBA 1WUVA 2ZKNA 1WLCA 5DUUA 4UW6A 1W6PA 3ILRA 4FPJA 3AK0A 1ONAA 3AYEA 3O0VA 5H9SA 5F9TA 3WZ1A 1GKBA 3WVJA 3ZSLA 4AVTA 3WG1A 4FQZA 2OUHA 5H9QA 1RIRA 1DQ1A 3SH3A 3U4XA 1AX1A 1FNYA 4P9WA 3WDUA 4BQ1A 1LESA 2D6OX 2C5DA 4Y24A 4P9XA 1QDCA 1KITA 1FATA 4IQPA 1JYCA 1PZ9A 3OGGA 4YLZA 1WCSA 2ZGMA 2WJSA 3ZXKA 1OFSA 2DU0A 3ILFA 3V0BB 1H9PA 3DUIA 3OY8A 4GKXA 1GSLA 1MS8A 1NLSA 1W6OA 1MACA 1LEMA 2NZ9A 1N47A 1RINA 2VH9A 3AZVA 2OW4A 1LTEA 1TEIA 3AZWA 4YG0A 4ZKTB 1JBCA 1V6NA 3N7JA 1MZ6A 5T5PA 2W52A 4H55A 4HL0A 1URXA 4XOGA 3T1LA 3V0BA 3N3HA 3WOGA 5GM0A 1QU0A 1LOCA 4PCRA 3ZXFA 1DQ6A 5GLTA 1DFQA 4YW3A 3PMEA 3GALA 5KXCA 2ZHMA 2SBAA 3NV3A 4P14A 4PBPA 4XJZA 1EPWA 1KDMA 1W0PA 3ZXJA 2DTYA 1Y7BA 5E8AA 5H9PA 1ULGA 3H0OA 4YFWA 1SLTA 5JOZA 4FOQA 4FQ4A 1Q8VA 3HMYA 3WCSA 4AVVA 4DPNA 3ZPYA 3A0KA 3WDTA 3WLUA 2CWSA 1DIWA 4UW5A 1OKQA 3INAA 2JE9A 4BM8A 4M3CF 1S0GA 2R0HA 3KQRA
chains in the Genus database with same CATH superfamily
2D3PA 3AKTA 5GLUA 4FT8A 1CONA 1UD1A 4DXRA 2WS93 1JYTA 3ABZA 5CFCC 4E8CA 4R9BA 4HKOA 2W91A 3DYPA 4XFIA 2PHXA 4AI8A 3IDCB 3GBFA 1RMU3 2YFUA 4IGPA 4K1YA 1AVBA 3R6SA 1JW6A 1CGPA 1G86A 2H6BA 3BU7A 3AZYA 4NRMA 1F4AA 1W8FA 2BOJA 5LATA 3SKVA 4JKLA 2WQ4A 3CJIC 1OUSA 3OBAA 3FHIB 5A33A 3RYKA 4IE5A 2EIEA 3OCPA 2OZJA 2JKBA 4UW4A 4CEYC 2VTXJ 1W3VA 1O4YA 2EXKA 2XUEA 4DRRA 5JIUA 2BZDA 5A7SA 3UJQA 1VRH2 2JKXA 2XKOA 1UZYA 1BYHA 1SCSA 4PT6A 5CFCB 1H9WA 2YBSA 2H0BA 3PUIA 1WBFA 2XDVA 2RM21 4GJYA 5FKCA 1PO13 3AVRA 1VIWB 2VXJA 1SBEA 1Q43A 3N7KA 1HW5A 1O4TA 4QT6A 4LXLA 5L73A 4E8DA 1O8PA 1BBT1 5A6YA 4MGQA 1NXD1 1CR7A 4CEWB 3HOBA 4E27A 2KM2A 2JG8A 4CU8A 4CDWA 5FY0A 1E5IA 4Q0PA 1U5YA 4XJAA 4AEDC 4D6SA 4CU9A 5FLIA 2GP3A 2GDFA 2EXIA 4XF9A 1VBC3 5I93A 3G7DA 4PIYA 4BZ4A 4ITCA 4JQTA 4FPKA 4LUMA 1S0BA 2A71A 5F6KA 5C3OA 4O9EA 2EIGA 4N53C 3WEZA 4B4QA 2FMYA 1YO8A 2E7TA 3KCCA 1BXHA 3HT1A 2YZ4A 5J98B 3UGHA 1LU1A 1R1A3 3QH7A 3E5XA 1K5MC 5JMCA 3T2QA 4CXYA 2R072 4EE2A 4LHSA 3ZO0B 2WNVC 4AFAA 1VR3A 1GICA 3GHNA 2DCJA 1PM4A 5LB6A 2GP5A 1SBFA 1IOAA 2WS91 1JYIA 2FDHA 4M0HA 4MGYE 2VUAA 4HN1A 4COZA 1NLRA 1VAVA 2C24A 2CDOA 2DVAA 4QPIC 1NXMA 1G8WA 4XTPA 5FZAA 5CEHA 5LA1A 1O7FA 4JRLA 1HN1A 1K5JA 5I8SA 3NAPB 2V5YA 3NKGA 4R9AA 1PX3A 4BLIA 1J59A 3RI8A 4BQYA 5LY1A 4WZCA 3BYWA 5H9RA 3I2KA 4N9HA 4QPGB 2VZSA 1QJY2 1ZBE3 4JVAA 1YHFA 2Z5WA 3FN9A 1QJY1 2B5HA 4QX8A 3I59A 1RUE3 3ZSJA 1EAH1 4CSWA 2FCUA 2QQLA 2VCAA 5IUQA 2K2SA 2JENA 3VD4A 4Z2WA 4A41A 5FYHA 2PAKA 2A73B 3C7GA 2QQVA 1AR91 1RL3A 1ZRIA 2OPWA 2YG0A 3AFKA 4FPHA 2YGLA 4A7ZA 1HXS3 2WAOA 4EJRA 2A5ZA 2Q1MA 4MGIE 3ZFFA 4HVRA 3BB6A 4XAEA 4N7IA 5FYMA 3KM5A 1SHWB 3ACGA 2GC1A 3AMPA 2P1BA 1SLAA 5C9AA 1GLHA 1NA1A 1JU3A 3THCA 3OSDA 3LEKA 2UYBA 4KG0A 2RG4A 2Q0AA 1YRZA 3ZN5A 1HRI2 3PUSA 1EAH3 1LJ7A 4KQ7A 5JSPA 1LHVA 1W8HA 4BPZA 1AL22 1H8TC 4MXWB 4E2GA 5T5OA 2P3KA 3MIGA 1W3XA 5DG1A 5FQ0A 2W46A 1D2QA 3TBDA 3UYJA 3WF0A 1RJ8A 4WVWA 1U5IA 2ZGQA 5FZ9A 2CGPA 5DZEA 2E51A 1G9CA 1ZX5A 4LIVA 4TN7A 2JDMA 1UZZA 1NCQA 1NYWA 3DEMA 2MEV3 5CADA 2H6CA 5BNOB 4XE9A 4M4PA 1UU4A 3ZFGA 4DO0A 1HN0A 1S0FA 5A3OA 1QJZA 2EAKA 2K46A 1Y4WA 2CGOA 3MIFA 3VD7A 1J3RA 5CZKA 2ID4A 1NG0A 3H1YA 2ZXQA 4OULA 1RUG1 4YZ4A 1VB2A 1Z7S2 2ZGUA 4X8PA 1JS9A 4LULA 3POWA 1YQ5A 1Q56A 3IBMA 4JHZA 2Y60A 2WZEA 2DVBA 3R4UA 4Q1RA 3UT0A 3ORJA 1UY4A 2BEOA 3WQ0A 4CDWB 4CXWA 4CXXA 2MPFA 5JOYA 1UN1A 3VBRC 5AFEA 1O5LA 2BGPA 2E26A 2JG9C 3NV1A 4ZZ8A 2OT7A 1DQ4A 4FPCA 2VMFA 4LTAA 1WMEA 2P2KA 5LEKA 1RUNA 5C3PA 1UY2A 2DCZA 2YV8A 4KWLA 5F39A 3SHRA 4IV3B 3LEGA 2D5HA 4OHWA 5FZ7A 3OYWB 3WNNA 2KA3A 1ENRA 3BPZA 3FL7A 4HSJA 1RUI1 3DKQA 1KJRA 1JH5A 1VE0A 4GWIA 2D7FA 4XF0A 1ULEA 2G9ZA 3KWVA 2QQPA 1UIJA 2CYFA 4MSVA 1B35A 1X9PA 1GWKA 4RSUA 1QXPA 4Y3OA 2GMPA 2NN8A 1W6PB 4XZUG 1WLDA 2ZEWA 4EN9B 4XFFA 2JD9A 2RS52 4XUOA 4ORFA 4IL7A 3KGLA 4AEDB 3IDEA 4YM2A 4CDUA 1CAXA 5JUVA 4XJ9A 4XXAA 5AC91 1UZ0A 4I09A 3VD5A 5C3SA 1VMFA 1A3KA 1KDKA 1CIYA 4FPGA 3L2HA 4UBHA 1N3OA 2UY9A 1W9FA 4KI5M 3TNPB 2OPKA 5K4LA 4K8FA 2P6CA 1LOGA 3NNMA 4XETA 5CB7A 5JPMB 2RS31 4GH4B 4CEYA 1US3A 1H1MA 1S0IA 2E33A 4LORA 4XEZA 5A3MA 1NUKA 2J1UA 1GV9A 1UY1A 1DLCA 1VBB1 5C7GA 3NV4A 4XUPA 5FKBA 1AXYA 3VV1A 3CL1A 2I07B 3OGJA 5FY1A 3RJRA 1A8DA 3U37A 1XSQA 2E9QA 1OMIA 1PO22 1SCRA 3PVBB 2RV9A 1VPHA 3W20A 3ROUA 3M3IA 4CCKA 3U07A 1BMV2 1VBE1 4LQRA 2Q8DA 1NA1B 1DGLA 1PO21 5A3TA 3B5LB 3RQ0A 4YZ1A 3AP7A 4RGGA 3CLPA 2Q1FA 5F3IA 4ZZ5A 1JXNA 4IEPA 5FZOB 3MLKA 1ZZBA 3JBG1 4BA6A 2RS12 4ISRA 2VMEA 2ZS6B 5JAXA 4ZU4A 4Y1XA 1SFYA 3C7HA 4C1WA 3V64A 1FMD1 2JE7A 4OHXA 1PZ7A 1FI2A 4COVA 1M06G 1WCQA 3DPRC 4Q5OA 2TEPA 1WLTA 2W1WA 2P3JA 3ZKYA 4HZFA 2RR12 5LBCA 1ZA4A 1V9U2 4UOJA 3UGGA 1MVEA 4LA3A 3RDIA 3UESA 1W9SA 4GAZA 3VHPA 1J1TA 5BNPB 1CN1A 2DF7A 1TZOA 3W59A 4NJ4A 3D5OA 5DABA 4E9KA 2JE8A 2EXJA 4AI0A 4CCLA 3A23A 4HANA 1AL23 4CUBA 1NY71 3ZMNA 5BNNA 3SXWA 4ONUA 1IPSA 5DUVA 4Z07A 5HCAA 2LM3A 4XBLA 4PI2A 4M4RA 3ZN6B 2HH9A 3TN92 3LOIA 2ZACA 1HRV3 4ZHNA 5G04L 3BTAA 2DURA 3HEIA 2N7GA 5FY7A 1HKDA 2VBBA 3MZHA 1C8M1 1PK6B 1ULDA 5CKNA 1LOFA 1W03A 2WR9A 1RUI2 1AR81 2BQPA 4CPBA 1S0JA 3IM0A 1O6UA 1MZFA 4QB2A 2B8MA 1IZ3A 3B00A 4N43C 3RZGA 3AL5A 1R093 3KLSA 2VOKA 1XNAA 5FBJA 3PVOA 3PMSA 2ERFA 2BFUL 1RUH1 3L2YA 4OUMA 1FPN1 4Y22A 1GOGA 5F7UA 5B4NA 1QEXA 5JCTA 1T6BX 2ZGKA 1QNWA 3CMGA 1W6QB 4RN5A 1CQ9A 2VZOA 3ASIA 2JDZA 2V09A 4UFJA 1IQDC 1YFYA 2ARCA 2BRTA 5FZGA 3TEWA 2ZZJA 3FBYA 5BXXA 5CVRA 2JDHA 3MHZA 5KBFA 1ZRRA 3CZUA 3N7LA 1MPXA 1STMA 3POGA 4HVQA 2HWE3 3WX5A 3H7JA 2ZPXA 1HJFA 1DQ5A 1UXZA 1COV3 1Z7S1 2WSVA 3GBWA 4WM8C 3FUOA 3VDDA 3LFIA 3WQBA 1TE1B 4DUWA 2QE3A 3M3QA 4FPYA 1MQTC 1R091 3HD8B 3T4VA 2YUEA 3GCXA 2WL1A 2WSUA 3B02A 1QOSA 3OUHA 1CAWA 4K1ZA 2A6ZA 3VZJA 1XU1A 2WO7A 1VP6A 2XKPA 2XLAA 3AXEA 1H30A 3R4SA 5DAPA 5FXZA 3LB9A 1D4VB 1ST8A 1UCXA 2UU8A 5E88A 1JOJA 4SLIA 2V73A 3ACFA 4QXCA 5FZOA 2D6NA 3MIHA 4W50A 3S7EA 1GP6A 1CJDA 2EICA 1W6OB 1AYM3 3QH6A 3B9IA 3I2OA 5FIXA 3ITQA 1FX5A 4QWNA 5LBFA 1F31A 3OTFA 5L7OB 5ABJA 1XRUA 3AVSA 4JAAA 4Q4V3 2YU1A 2AENA 1FV3A 1U12A 2ORXA 5DQ0A 3UJOA 1GYKA 2YMZA 1RUOA 1J3QA 2D44A 3D8CA 5BNPA 1RUF2 3USUB 3SMHA 2VCMA 3PU8A 2PHWA 3MF6A 5F1RA 3NAPA 1GZWA 4W8JA 3S30A 2DDUA 1HX6A 1XNCA 3A7QA 3KGZA 3VBFA 4XAAA 2ZEXA 5CU1A 3ZX7A 1QJU2 1Y3TA 3AJYA 3B9CA 4JDMA 4LA2A 4M0NA 2DVGA 4COWA 1ULFA 2CGNA 2XLFA 2KR2A 4XILA 5HXMA 1UWWA 1SDDB 5J09A 2YPJA 1UOGA 5HCFA 3KHCA 4KU8A 4COYA 3RMYA 2WFF3 2ZGRA 4FPEA 2WFF2 4FXGB 5FMOL 4GWJA 3MFAA 1WMXA 4XPVA 1OLQA 2GU9A 1IS4A 3OBTA 5BYNA 3ZM8A 3RVHA 2R16A 1XU2A 5JIAA 3ZYGA 3KV9A 4FFIA 3CF6E 2ZKNA 5JDBA 1XJAA 4LO4B 1M4WA 1OSGA 4OI2A 5BV6A 4XURA 5DAVA 1CX1A 2RS13 1OD5A 3ETPA 5E6HA 2HJIA 4N9IA 4XF4A 1JMUB 3O0VA 4WVZA 4FXKB 4JGZC 4L2NA 4LHKA 3NAPC 4Q4X2 4DZGA 1GKBA 2LW8A 4NUBA 5KC5A 4AVTA 3WG1A 3R4DB 5H9QA 1RIRA 1TMF3 1POQA 1ULPA 4GZ9A 1RUH3 2XUMA 4BQ3A 2AEZA 3WDUA 3OBZA 3JQXA 4CCNA 1WCDJ 2D6OX 3R0RA 4QM9A 2C0ZA 3VBHB 2P3YA 2R30A 4WM7A 1KITA 4WVMB 4XQ4A 1I5ZA 3ZYFA 3MUZ1 1PZ9A 2Y6JA 3DN7A 3OGGA 3QACA 4IGOA 2VUDA 2WJSA 4YLZA 1JZ6A 3S0MA 3CIHA 3H9AA 3V0BB 3H8UA 2FDIA 1H9PA 3OPWA 4A45A 3DUIA 1UMIA 4RGKA 3TN93 4NHKA 1XNBA 3PDQA 2VMCA 4N53B 5D8AA 5DDJ1 1W6OA 4FAHA 1LEMA 5F37A 4PQQA 1RINA 2VH9A 3AZVA 3MDPA 2DCTA 4Q4X1 1LTEA 1J84A 3HN3A 5T5PA 3VGIA 4FAGA 1ZYBA 1URXA 3J7NA 5F2WA 4RQPA 1BK1A 1SMVA 5GM0A 2W3JA 1RUD3 3NVCA 3VDDB 4HPKA 4AHYA 4IEUA 4YW3A 5IVBA 3EQEA 1DGRN 2X53S 3NV3A 2CHHA 3DECA 2Y6LA 2CU5A 2Y6GA 1UX7A 4H2AA 3DKWA 4CDQC 1OOPC 4GH4C 5D1IA 3H0OA 1SLTA 2D5FA 1NY72 2XHNA 1Q8VA 4NRPA 4PDWC 2EA7A 1VBD1 3ZPYA 3WDTA 4EWEA 5J96B 3B94A 5A3UA 4AFMA 1EV12 4KG8A 2JE9A 2IFWA 1S0GA 2IVIB 1SPPA 1F5JA 2PTMA 4KWUA 1HXS1 4P9GA 3GXUA 2NQYA 5ABJB 1IKQA 1YIFA 2W08A 1AR93 5CYYA 1WZXA 4XFHA 4ZS2A 2UWCA 5FP9A 3OB8A 1HJGA 4IE0A 1C4RA 1YFUA 3N9QA 5AVAA 4AEDA 2G9FA 2HWF1 3GGLA 4LBOA 5T50A 3AYAA 3GZAA 5JLVA 1JYXA 1HQLA 3RGBA 3WV6A 2BGOA 4E2SA 1XNKA 2E32A 2EIBA 1RHI1 3POSA 2XQRA 2VJXA 2WINB 3OD0A 3LEMA 4RHV3 4ZPIA 4BH9A 5IK7A 3NV2A 1JOPA 4CDQA 2VD7A 3MPPG 4UWDA 4YVWB 4LBQB 1TME1 3WNLA 4FSJA 1NA1C 2JDYA 4TXWA 2FCVA 5T55A 4Q4Y3 3UKTA 2OKXA 1MVQA 4DEVA 3E6CC 5DDJ3 3KCXA 5GLZA 2CV6A 1AR61 1VBB2 5HCBA 3WNKA 2ZGTA 1ALYA 5JOWA 2DTWA 2OIIA 2BW8A 2JDUA 3K3NA 4WV8A 4Y20B 2VCBA 4IEQA 1NE6A 2WZR1 1GQHA 1D0GA 2R1BA 1JUIA 1UYZA 2XG3A 1U5ZA 5JXGA 1COV2 2PLV3 2YYOA 1NCRC 3WW4A 1RUG3 3N9MA 1K45A 4HONA 1D4M2 1YLLA 1IGOA 5C6CA 2IC1A 2GC2A 2ZEZA 4MGZE 5A3PA 3VZNA 3MEPA 1U0AA 3ZFGC 4M00A 4FTEA 4UXAA 1AX2A 1XQNA 3MLJA 4R9DA 5AC93 3POJA 1HB3A 2QDRA 1D7PM 4XABA 5AVPA 4NMIA 4Z2AA 4QKFA 3VBUA 1UW8A 1OUXA 3LFMA 2QNKA 1AYM2 4GB32 5GLVA 4ASLA 1I6XA 4AHWA 4Q4X3 5A3NA 1SACA 5DXDA 5ANQA 4ASKA 2VBPA 1EV11 2D6MA 5FPVA 5FZ1A 1RUD1 5FTTC 5FZKA 1VB4A 2PLV1 4LEJA 2ADDA 5JMOA 5KHIA 1UU5A 5FP4A 1CAVB 5A6QA 5A3WA 2PELA 1OQEA 4NROA 3F95A 4DS0A 1K12A 4N53A 5CBLA 4IE4A 3PLQA 3WSOA 2XJQA 3NNGA 2GN3A 2Y64A 2P3IA 3LA2A 2Y38A 4YGCA 1L7LA 4UFMA 2HWD2 4J1WA 3H7YA 2XJSA 1IKPA 5LEJA 4DUXA 2QZ3A 2VG9A 1BHGA 1V9U1 1K3IA 2ZX3A 3BODA 1WGPA 3K4AA 2RR11 4XC9A 4YW5A 3DPRA 3POIA 4MXVA 1YQCA 4QHBA 4OUSA 3ZXLA 4D69A 3WG3A 3H1MA 1R081 5SV5A 5IATA 4Y4RA 1GR3A 2WAAA 3M3CA 4CUAA 2RS11 3ZYIB 5K0UB 1S4CA 3JBG2 2Z69A 2I74A 3MV01 2GSYA 4NPRA 4XUTA 3OGVA 1UIKA 4META 4YVWA 3VZLA 1W0NA 1WD4A 1JYNA 3UETA 1W06A 1Q8OA 4XIKA 4P5HA 2WNEA 2XBO2 1ND3C 2WWSA 2R063 3VKNA 4GB31 1LULA 4AWDA 3K77A 4DFSA 5CIRA 1ULOA 1QQP3 1ENXA 1EUUA 1GWMA 2VNOA 1CESA 3AYCA 2ZKLA 2Z42A 3KT4A 5IVFA 1QKQA 1JZ8A 4LBMA 1O3SA 1O59A 3U10A 4IV1B 5DPNA 2ZMKA 1WCUA 3VD9A 1H4GA 2F17A 1W6MB 2XL9A 2C26A 1HQWA 2Y0IA 3IMNA 4PHZA 1RXGA 1GUIA 4BB3A 1SQ4A 5KXBA 3MICA 4R8HA 3DXUA 3UL2A 5CFDB 1PO12 4GMP0 4V2VA 4RGAA 4CP9B 5J7MA 1I5PA 3FX3A 3FLRA 5C5UA 4LBQA 1G9FA 2AGSA 5C9AC 3W21A 2XONA 4JC1A 3ZOIA 2XL7A 4BHPA 1W90A 2DFBA 2L9LA 4B8EA 2G19A 2RDRA 3ELNA 2R49A 4B29A 3MW3A 1LAJA 4E2QA 4WZFA 3AMHA 4KGGA 3RI9A 1ZZ7A 3M2MA 4IXLA 4NE9A 5FLHA 4E4ZA 1H1AA 3RS6A 1L7QA 4S2FA 4WBBA 4W6YA 2V4VA 3MI8A 4MGKE 5FYUA 3I8TA 5EYYA 1A6CA 3PURA 2PYTA 4KGQA 4K21A 1CAVA 1MZ5A 2ARAA 4XUQA 3ZFGB 2YPDA 3D0SA 2R6QA 3ATGA 3E97A 2WZ8A 4EN7B 2W87A 4YGEA 2V72A 2B7YA 2RM23 2ZX2A 2XVKA 4RFRB 2PA7A 1QY4A 2IVJA 2V5DA 3QCWA 4BK5A 1IG0A 2XJTA 4F8AA 2KXLA 2PMWB 1EV13 1WCKA 2ADEA 3POFA 5FZEA 2GMMA 2BPA2 3J4UH 5A3LA 4DQAA 4HETA 1W6NB 4GWNA 3LE0A 1UKGA 2WS92 3S6PA 5GZGA 1JN2P 1ND2A 5GALA 2ZCWA 1UZVA 3B3QE 5F8PA 2UWAA 4INDA 5KWRA 4F83A 4UF0B 3WUDA 2DUOA 3DF0A 3NNLA 1S2KA 5FWJA 1U5XA 2QQJA 5C5TA 1QOTA 2BVVA 4HT1T 5FMDA 4IV3A 5A6XA 1CZTA 1QH6A 1YXWA 5LRSA 1QJY3 4AQTA 4TZDA 2NP0A 1LENA 3WP4A 5A32A 1JZ7A 4CCMA 3AM2A 5A6ZA 4QU2A 2VZ1A 1SLBA 2AEYA 1E57A 4QM8A 1RVF3 2QFEA 2QQNA 3JCIA 4MH0E 5GJ6A 1L3JA 2RR13 4D7YA 1QXJA 3F2ZA 1YCIA 5C71A 4M01A 5HI0A 3IWZA 3LGRA 1J3PA 1DYPA 3LA3A 1AYN2 4PI0A 4TSVA 5IVCA 2VTXA 4Q26A 2XHKA 4ES9A 5DMYA 2QQOA 4IEZA 1WKYA 1WWYA 4MVTA 3WP6A 4A4AA 4E4DX 3ZFEA 2FDKA 2UWBA 4NHLA 1HV1A 1LOAA 1V6JA 4X6QB 5FCCA 5FZ6A 1OHFA 3T1MA 1RUF3 4LPLA 4NHXA 2W1SA 2A3XA 1NCRB 2XXZA 2Z79A 3U14A 3GZEA 3HAGA 3THPA 2WT0A 3H42B 4NPLA 4JRAA 1ZA7A 4QB6A 5FZ0A 3IAQA 2V4AA 4PBOA 2DBNA 2D40A 1ZBA2 2IZWA 3FLTA 2HBTA 4Q4V1 5EYXA 4NIIA 1KGYA 1ULCA 3LKJA 3O12A 2OYZA 1OA2A 4RYDA 3AB0A 2VW1A 1OVSA 2ORZA 5FZLA 2WLQA 3L9JT 1J83A 5JR7B 5F5AA 1NZCA 1W9YA 4N8MA 2RJKA 2VQAA 3THTA 4YVWC 5IYYA 1KS4A 1UYXA 4FI9A 4L97A 3I97A 2XVGA 5F32A 3T4HB 4Y1VA 1FOD3 2GN7A 2IXHA 4CTEA 1MS5A 3SCGA 5EZWA 4FBFA 1N1SA 4IV1C 5JVVA 2W2IA 4AFCA 1KEXA 4QGLA 1MR5A 3VBRB 3VL9A 1IS6A 3HPNA 5K8SA 1O5UA 2BOIA 1FAYA 2DBIA 1S0EA 1FNZA 1YYNA 5I0UA 1MS1A 1PZ8A 3BKZA 1UL9A 2A70A 2JX9A 4DINB 3FE5A 4RQPC 4XCBA 2FDJA 5FREA 3HNBM 4UFHA 1LHNA 5GLWA 4K9SA 4KBZA 4Q0UA 4PQ9A 2R32A 3A21A 4OI4A 1SDWA 2R071 4LIUA 2WZPP 4QPYA 3EB7A 1CAUB 5J1XA 4Q4V2 4CDQB 1H2KA 3EJKA 3I2HA 4TYSA 5DZGA 1X50A 3NJVA 1SLLA 3WNOA 4AVAA 4FTSA 1RUC3 4Y1ZA 5C8CC 2ZX1A 5IFTA 3I3EA 3LIHA 1H8TB 5FPZA 3OG2A 1YWKA 4FTBA 2X05A 1BMV1 3M7AA 1RUH2 2BUKA 2IFRA 3I54A 1ND2B 1AR73 2B46X 3CBNA 2GAUA 4L99A 2VGDA 1YI9A 3N7MA 5FP7A 3VBOA 5L9VA 2XPJA 1LR5A 1X8EA 1DU3D 3BOWA 1OLMA 4LMFA 1VAMA 1Y9QA 3RRDA 4A42A 4L9BA 1VBD3 2ZABA 1N1TA 3WNXA 3C8XA 1D4M3 4KU7A 1UYYA 2A6WA 4RFT0 2YXSA 4DY5A 3OD4A 4D8MA 1N1YA 4MLOA 4B4PA 1MZEA 1N1VA 4BJ0A 1V6KA 2HWF3 4BISA 2VZ3A 1LGNA 1PIV1 1DCSA 2EF6A 5F6LB 3T30A 3BCWA 3O1SA 4LLFA 4BK4A 4GD4A 1D2SA 2PHUA 3MO4A 4ZXEA 4GULA 1DP0A 2CSGA 2Q8OA 4A3ZA 4RS5B 1Q8QA 1OQDA 3BOPA 4HN0A 4OHZA 4JTNA 1OA4A 2HWD1 5KXEA 3IN9A 5BNOA 4AVBA 1W8NA 2ZBJA 4AYUA 4B7EA 4COUA 3PL0A 2JB4A 1C5IA 1BKZA 2A3YA 3SNMA 3WF2A 3J7LA 4AI1A 3S57A 3MIEA 3U0ZA 2VW2A 5EWSA 2KD7A 5KHKA 1NKGA 2EALA 4XVHA 2GNTA 1NCQC 2VAUA 1OOPB 1RB8G 1PGSA 1DGWX 1FPN2 2WZR3 3PIGA 4OI0A 4Y1YA 5T5LA 1XC6A 3AP9A 3PJQA 3M4FA 3ZDSA 4AOCA 5LRRA 1QOOA 1DGRA 4PF5A 1JODA 3AKQA 5FY9A 4TTGA 1ZBE2 4OHYA 5JOXA 2VMGA 1SFNA 1FOD1 4FO9A 4C91A 3HVDA 3JU9A 2RS33 5CA6A 2J7MA 3ZFFC 1LRHA 1OLRA 3ES1A 3J7MA 3PUHA 3HWJA 2HEVF 2HBUA 4IEWA 5FMOS 2W92A 2W68A 4XDQA 1G9AA 4QQ2A 2C9AA 2Q30A 3C3VA 3U75A 3NL1A 4OI1A 5T3NA 4LLOA 4CRQA 5JXHA 3FFZA 4M3CE 4Q29A 2I45A 2VTFA 4CEWA 3E1F1 4EQVA 2G9GA 3KZ4C 5BY5A 3O1MA 2WC2A 1B35B 1W99A 1NQJA 1WLCA 2WUHA 5D2AA 4KWKA 4AZZA 1Q3EA 3ILRA 3Q8FA 4FPJA 1FMD3 3VBHA 4CP1A 3AK0A 3EXUA 3ZYHA 3AYEA 4AHZA 5KR7A 1OC1A 3ZSLA 2ZOEB 5LW9A 3C7OA 3P6BA 1RUD2 2OUHA 3WF4A 3CJIA 3SH3A 1DQ1A 4QDRA 4IV1A 3U4XA 4P9WA 5C4WB 5L7OC 2F6BA 4PJYA 2IWGB 3UKNA 4YW7A 1GP5A 5JXIA 1OI6A 2YC2A 5KHGA 1ZZ6A 4BIOA 1ZREA 1CZVA 4CEYB 3JQWA 1AL21 1OFSA 1KXGA 2XQXA 4A44A 4Y5Z0 4XACA 4GKXA 1C28A 3AKSA 1MS8A 5C33A 5EV7A 1MQTB 3NO8A 1D4M1 2W94A 4AG4A 5CG9A 1NLSA 1CZSA 3N9LA 4I02A 3U11A 2OZ6A 1N47A 2OW4A 4LOTA 1HXS2 4WM8B 1V6NA 4MGTA 1MZ6A 4MHRA 1ASJ1 4H55A 4O7XA 4HL0A 5FBZA 2G1MA 3N3HA 3VBOB 3M70A 1JYWA 1LOCA 2B9UA 2P6HA 1VRH3 2WO3A 3LAGA 5GLTA 3WNPA 2CAUA 4HKWA 2JB8A 1H4HA 3B7MA 3GALA 3BU0A 1RUC1 5D8AB 3URFA 4P14A 4PBPA 1W28A 4XJZA 3ZKUA 4CU7A 3C7EA 3H8RA 4UAPA 2HWB2 1EPWA 4LUKA 2HWD3 3ST7A 3ZXJA 2DTYA 3JD71 2ZEYA 4Z92B 3WW1A 3MFCA 1W2TA 4N43B 4FOQA 2RMU1 4FQ4A 4HPKB 4AEMA 4AVVA 1AHSA 1HB4A 1UU6A 1RHI2 2ILMA 1OH4A 3VBSA 3A0KA 1FOD2 2CWSA 4QKBA 4UW5A 1PK6C 1RC6A 5FZHA 4M3CF 2R0HA 2WO1A 3BN6A 3KQRA 3JXSA 3KT1A 4BMBA 3G6JB 4N90A 4NIHA 2J1SA 2AYHA 4MOAA 2ZHKA 3I2JA 2FBEA 3UGFA 1PGL2 3WW3A 4GMP3 4CA9A 4HVOA 4MYEA 2DYCA 4Z1VA 2J1TA 3KV5A 1V70A 1NE4A 2YBPA 1OOPA 1KJLA 3CHXA 3HT2A 2WWUA 4LO8A 5LBBA 5LWBA 3WUCA 1W2AX 4DUVA 1MEC2 4Q0QA 1AJOA 1BLZA 4MG2A 2WNUC 1AZDA 4BCUA 5FZ8A 1LU2A 4FP3A 3C2UA 1ZBA1 5DAQA 1QWRA 5I0TA 3NJXA 2LROA 1JZ2A 4YW2A 4EN6B 4NAOA 2NMOA 4C0HA 4OCTA 3J8F2 3I3DA 4Y22B 4CDXC 2X5IA 3DYOA 5I8YA 3K51A 2WZR2 3SITA 1AYN3 3RYPA 4XCAA 2YGMA 1QMJA 4Q2FA 4Q8KA 3OUJA 1LECA 3GHMA 1V0AA 2HWC2 3AZZA 4FPLA 4Q4W1 1PVXA 3LIGA 3AMNA 1TMF1 5HXVA 4YVSC 3ACIA 5T52A 4PLOA 4Y1UA 4C0BA 1QJFA 2A75A 1H6XA 5ACA2 4EWDA 2E6VA 4LKDA 4MXWA 1R1ZA 1TMF2 4BOWA 1WA4A 4X6RB 2P4EA 4OMCA 2Q8CA 1RHI3 1F2NA 5DZFA 2A6YA 4AEJA 4P08A 4QDQA 3GZUC 3IB3A 1IPKA 1L7RA 5CNAA 3VBUB 5C8CA 1DDLA 3J8F1 5FP8A 2VOXA 4D7SA 3N35A 4JGYC 2E31A 3CQOA 5FOBB 2VOWA 3BVCA 1W39A 3GYDA 2ET1A 2J22A 2HLEA 3IZOA 3ZIXA 1NAEA 2VOVA 2D43A 4TLGA 3ZYJB 2GNBA 2NPIA 4XFGA 1ND3B 4GXLA 5FZ3A 3SH5A 4AI9A 4BQWA 2FZ2A 3SLIA 5I0SA 5HPOA 3FLPA 2X5IC 3RMXA 3CZJA 1UQXA 3SISA 1ASJ3 1A34A 2B45X 4XXPA 1O3RA 3LPGA 2WYFA 2C4XA 3VHRA 2YU2A 2VM9A 3VBRA 4A2UA 2RDNA 1EUTA 5BNOC 2BV4A 4K6BA 1T2XA 4YWAA 3ZDVA 1QJX3 3CU7A 4P5YA 1PHMA 1KFUL 2CDPA 5J3UA 4BQ2A 3J8F3 2AR6A 3OGSA 5EPAA 3H3ZA 3DPRB 4FPFA 4ZU5A 1OF4A 2UY8A 2VZUA 2XLGA 1ZZCA 1PM7A 3VKMA 3K46A 4PIXA 5F5IA 2WKKA 4AQSA 4JTOA 3CKHA 2I2SA 2RMU3 4XTMA 1QF3A 2VY0A 1YC61 1DBNA 5FXXA 2BNOA 3VBFC 3ZVXA 1X33A 5IVEA 1REFA 3SEPA 2WFF1 1VMHA 4QKDA 4S2GA 2Y6KA 1K5MA 1ND2C 3LZZA 1CAUA 1VAKA 3DXTA 1UMHA 4NIAA 3I2IA 3O1RA 2Y26A 1AJKA 3IAPA 4V2WA 4DB5A 2JWPA 1W8WA 4FCAA 4KMQA 1VLNA 3CNAA 3LCPA 5A33B 2HWC1 4Q4W2 4R52A 5JWPA 3LPFA 1W8ZA 3AMMA 4Q8LA 2DU1A 3EHKA 4R9CA 3ZYRA 1YNAA 1UO9A 2R042 3HNMA 3KV4A 4KWJA 5FYSA 1LOBA 1W6MA 4IW3A 2J1RA 4NWVA 5GKAC 3W9AA 2TNFA 2JDKA 3D4KA 4HLTA 4Q4Y2 3UV9A 1UKRA 5F3GA 1W2UA 3H3UA 2VZVA 4LE3A 3T08A 3PVNA 3W5NA 2FCTA 1ZZ9A 5LK5A 2W0XA 1TME3 3VL8A 4Q0VA 2A1XA 4AHXA 2DFCA 1AR72 3VKLA 4NOTA 1QJX2 1J58A 1W0OA 3GCWA 4EV0A 1FYUA 1QJU3 2XVLA 2HKXA 1SLCA 3PTRB 2E63A 1LHWA 3N9PA 4YG3A 4AGRA 3MF9A 4BDVB 2VNGA 4L11A 3LA7A 3MBWA 3MW2A 4Y4YA 1K42A 2QCSB 3ALQA 4M3CB 5FUIA 2O0OA 2W47A 2TBVA 2VZQA 3FBMA 1C8M2 1DYKA 2MHFA 2PFWA 2LTNA 1YI7A 4JX0A 2GALA 1ND3A 1XXNA 2WA3A 3AFGA 1F8VA 3WG2A 5CKMA 3ZN6A 4LHNA 4QAWA 5CFDC 1CIWA 1PVC3 3T09A 2J1AA 4C8DA 4JQRA 1G7YA 1GBGA 5IJRA 1BVVA 3JD72 5D8AC 1A78A 3FWEA 1WW6A 4NHYA 4CP9A 4BE3A 4K20A 4KH9A 1HLCA 2XOMA 3GM8A 4HFSA 2HWB1 4NIDA 4HSLA 1OQ1A 3OEAA 3CJXA 1DLLA 1Q8PA 1UF2C 4UYBA 3O1OA 5FXWA 4R4ZA 5A1LA 1RUJ1 5A70A 4NRQA 3CO2A 1EY2A 2HYKA 5F3EA 1JZ3A 4A3XA 1POV0 3NJYA 2AREA 1DYOA 3THDA 1FV2A 4UFKA 1ZM1A 5IWFA 1YQ6A 4Q27A 3H3LA 1F5FA 3KS7A 1EYBA 2ZX0A 3ZXDA 2PAMA 1KRIA 4DMIA 5K0UC 3I4IA 4YNIA 5IT6A 3N9NA 2BWAA 4QPGC 2VU9A 5HV4A 1UOBA 2XMLA 4JGYA 4WVVA 4Q1PA 4D6RA 5A1FA 5FWEA 2GC3A 4AF9A 3OBRA 3PUAA 4U2AA 1FXZA 2JXAA 2LS6A 5FPLA 3WR0A 4LBQD 1GU3A 1XOYA 2JG8C 1D0HA 2ZJCA 1WBLA 3GNEA 1HB2A 4G4FA 4D94A 1TG7A 5I0RA 5IVVA 5JPNB 5A7WA 4BQ4A 2FHRA 2CAVA 1XNDA 3CJIB 3AZXA 2PHTA 1T6GC 5HCHA 4J1XA 5FP3A 1DZTA 1JI6A 1LB2A 5E89A 1UX6A 1Z7S3 1SFPA 3VLBB 5J37A 2Q4SA 4QD2A 5CISA 1PIV2 1W6QA 3LSEA 4HK9A 2C9KA 5FPAA 1PO11 1J1LA 3I2FA 1HV0A 3D0JA 4QHOA 3MUY1 5EJZB 2ZHNA 3USSA 1UMZA 4FP2A 2OX0A 4XBQA 5FQ0B 4XFBA 1HRV2 2HWE2 2VQTA 5FZIA 5FZFA 5A7OA 5APAA 1YFWA 1I3HA 1RITA 1CWPA 2WNUA 4CP0A 1TNRA 3WINE 2WABA 2J1VA 3HJRA 2CL2A 1IS3A 1F15A 4XJUA 3X29B 3ZFFB 4H14A 4IDZA 4AGGA 4C1XA 5J48A 3WHTA 2VQ0A 5A7QA 4CEWC 3VBHC 3I3MA 3AL6A 2PN5A 4BXSV 4NN0A 3JB8A 4B3NA 2LUWA 2WDBA 3VUOA 3O7OA 3RJ2X 4QB1A 1WW4A 2BJSA 1PVC2 2IXJA 5FO9B 1DHKB 4QX0A 2NLRA 1S0DA 1ZBE1 3PNAA 2JD4A 3ME2A 1HRV1 4GKYA 4NVPA 1AR82 2VQUA 5LBEA 3TYJA 2WIIB 4HMZA 4P9JA 4BMEA 3C7FA 2GH2A 4RL7A 1UY0A 2XJRA 3ZFEC 3O0WA 4LBLA 1O3QA 4OFGA 1ZRFA 1ZNPA 3Q8CA 5BNQA 2WT1A 4QXBA 2QZ2A 3E5QA 3VBSB 3VKFC 1PNFA 1W9TA 5DAXA 3USUA 1GP4A 3SCHA 2W95A 4QX1A 2QQMA 1TVGA 3KD4A 1C1LA 1S55A 4GA9A 1OF3A 3OJBA 1JU4A 4HOOA 5DUXA 3T2TA 3ZSMA 4B1MA 1E5HA 2RJ2A 3ETQA 3VBFB 1GANA 4OZXA 3WDWA 3WP3A 1DG6A 3NW4A 3VN4A 2ARBA 2GNDA 4XW3A 5ANNA 3TEXA 3P5BA 2VW0A 2W1UA 4GWMA 1FMD2 4QX5A 2OQ6A 2BU9A 4DIQA 1OPMA 4WM7B 2Y6FA 1SEFA 2D6KA 2VPVA 3A0NA 4P9LA 4UFIA 4LO7A 3WW2A 2RDSA 2BGCA 1PNGA 1GZ9A 2MEV1 1XSRA 4MV2A 1G9DA 4LKEA 3T3YA 3FFQA 4LBJA 2VE1A 3ACLA 4W6WA 3VZKA 3D3AA 4ATFA 4P9YA 3PU3A 2OQ7A 5IK5A 4LBKA 3PIJA 4YG6A 3A4UA 1OVPA 3T2OA 2VUCA 4CUGA 4K8RB 1MS3A 1O8SA 4HK8A 5A80A 2YROA 5F5QA 2Y0OA 3GJBA 4J6GA 4QGMA 4QX7A 1ODNA 3ZSKA 1W04A 2VVDA 1HQNA 1DQ0A 1RUJ3 1JHNA 2OUJA 5FDBA 2RS32 3IKWA 4LKFA 3NJZA 3O5SA 4XF3A 4XDPA 2OXBA 3VD3A 2D6PA 3W58A 3CDZB 1I1EA 1CD3G 1VBC2 2D3SA 3QD6A 1VJ2A 1AR92 2WQZC 5IAXA 1H8TA 4LK6A 4Y26A 5KHJA 2WO2A 2YHJA 4AVCA 3EMRA 3QOPA 1ZRDA 2D98A 5LCWL 3O1TA 4QQPA 1ZBA3 4XF1A 5L36A 3VHNA 3AC0A 4L92A 1ODMA 2RS51 4AW7A 2VR4A 3P3NA 2QDNA 4B1LA 5A1AA 2BDRA 1C3HA 1RUI3 2YFZA 2VZPA 3IPVA 4DEQA 1X7NA 1QDOA 2QTWB 1NOVA 3P3PA 2WLPA 2UURA 3WCRA 3VDCA 3SKJE 5F5CA 2AZ5A 2VCCA 4MADA 4Y5SA 4YZ2A 2WNUB 5FXVA 1PMIA 2W1QA 3WF3A 4ARXA 3KF5A 3VHOA 4YVSA 3POBA 4AL9A 4LO5B 1LNSA 2B4KA 3KF3A 2QVSB 1PIV3 2DV9A 5BNNB 4UW3A 3NWKA 4NHMA 1APNA 4LT5A 5KC6A 2SLIA 3WXPA 4Z8BA 3E6BA 3VB9A 2ZMLA 2JDAA 1W9WA 3RZLA 3I59B 1RUJ2 4XJWA 3DGTA 5I0DA 3K75B 1MEC3 3VDBA 1RYYA 4HBNA 2DUPA 3M1HA 4YM1A 5JSOA 2ARXA 3J9SA 2GZWA 4YW6A 3MPBA 5B4XA 3TNQA 1VBE3 3ECQA 4Y20A 5EXOA 4CCOA 3B93A 2XH6A 1W05A 1QXRA 1SLIA 2C1FA 2XBO3 1PGW2 4PIZA 1PMHX 2X09A 5DUUA 5ACA1 4UW6A 1X8MA 2ZAHA 1GQPA 4Q4W3 1ONAA 5CG8A 5A32B 3FHQA 1BEV3 1AYN1 2Y34A 1XNTA 1YQ8A 2XJPA 3VBOC 2VO5A 1UPIA 3T0BA 4N7UA 4ET7A 1HB1A 1Q5OA 1AX1A 1FNYA 4QXHA 1LESA 2O14A 2VBDA 5BUVA 5LA0A 4MUVA 2LRPA 1QJX1 3IDBB 5FMBA 2C5DA 4Y24A 4P9XA 4OLLA 3H8XA 1JHJA 3U1XA 3NRUA 4AI2A 4IQPA 3WNMA 1JYCA 1JZ5A 2FDGA 1IPJA 4WM8A 2EIDA 1ZVFA 1HRI1 1I9RA 2X8KA 1WCSA 2ZGMA 2K0GA 1Y9GA 2VC9A 3GZTB 4P9IA 3ZXKA 1YUDA 3ZFEB 3ILFA 4QDSA 3BIEA 3OY8A 1GSLA 1S2BA 2QQUA 2JDPA 1OURA 1PGL1 3WF1A 4AE2A 3O1UA 3LQCA 2BYVE 4EN0A 1MACA 2NZ9A 1UYPA 3OUIA 4FFFA 4AQ6A 3WP5A 3AZWA 1TEIA 4YG0A 4DXZA 4ZKTB 1JBCA 4LE4A 3N7JA 5FUNA 4EWAA 3O1VA 1FT9A 1BBT2 1C8M3 3K4DA 3ZR6A 2WYSA 3WOGA 1H1IA 1PGW1 1H2NA 2Z4FA 3KCYA 1R1A2 1DQ6A 2C6SA 2WFPA 4NWWA 4PCRA 4CP2A 1DFQA 2OS2A 1E5SA 4BWOA 2VOTA 4YVSB 2ZHMA 5FY5A 3OOXA 4K3UA 3I3BA 1FPN3 3W5MA 3IIIA 4LKSA 1KDMA 1SG3A 1W0PA 3Q8BA 5IVYA 1F35A 4I0BA 1Y7BA 5LY2A 5H9PA 4CPBD 1ULGA 3KB5A 4YFWA 1OFNA 5JOZA 4CDXB 5FPUA 3O14A 3LF7A 4Q0SA 1X82A 4DPNA 5FJHA 1E5RA 4PF1A 1JOBA 3WLUA 4DXTA 1OKQA 4KL1A 4BM8A 3AP4A 2BNNA 3AX4A 2HWC3 4FFGA 1H2LA 3IPVB 4DY3A 2R7EB 3POEA 1O91A 4XFAA 3FMGA 4XQDA 4EYUA 2P34A 1GFF2 2ZTNA 1GNYA 3AP6A 3EO6A 4XMIA 1LOEA 4LR4A 2PQSA 4SBVA 1LKNA 2D6LX 1W8TA 1AYM1 2FDFA 4LNVA 4CDWC 1QNYA 2JIJA 3Q8AA 1QQP1 1GOFA 1C57A 5IFPA 4JDNA 1EPZA 2R061 3LDKA 1N3QA 1BQPA 4TWTA 2DVDA 1LHOA 4AFBA 2XB6C 2D97A 2OA2A 5EIYB 4S2HA 1REEA 1NZIA 3DL3A 1W8OA 4J25A 4PDWA 4AR2A 2F4LA 1KQRA 4QQLA 5FK8A 3S5QA 1MS4A 4U36A 4OQ9A 1AF9A 1GNHA 4IUGA 1RUC2 4B7KA 1COV1 4YFZA 3I7DA 2PXJA 4ASMB 1UNBA 4UI9L 4A6SA 5JI7A 1NQDA 2H0VA 3IDAA 4JZRA 4D7TA 1SBDA 4RA0A 4V1PA 5A7NA 3U78A 1S1AA 2DUQA 4NO4A 4A7KA 3OPZA 3WQ7A 1VRH1 5F3CA 1KFXL 4QQOA 4XYXA 4YW4A 1XE0A 1Q8SA 2NMNA 3K3OA 4OYUA 4W65A 4XQWA 3BTYA 1GMMA 4F3JA 1REDA 2EAAA 1NT0A 1AXZA 1QH7A 2Z2SB 3AJZA 3KVAA 5LASA 4QX2A 2WA4A 4QPIA 5KXDA 3FUQA 4G9SB 4IERA 2Y8KA 3O1PA 4CVUA 1CVNA 5FO8B 4ATEA 1R64A 4L8QA 2ZGNA 3GJAA 4EZHA 3ZYBA 1WA6X 2VXRA 5SV8A 3M3EA 4WVMA 5DG2A 2CTVA 1OKOA 3ZR5A 5IK8A 1O3TA 2NM1A 3VDAA 5F2SA 3ZMOA 5JXJA 3ON7A 4I3GA 5ACA3 1WMDA 5BNNC 4BIFA 1UXXX 2ZHLA 1DZRA 2Y6HA 2EXHA 4LITA 1MS9A 1VALA 1WD3A 4JGZA 3S7IA 5FZ4A 2IXKA 1HRI3 1SPPB 4IEYA 1VBD2 1GZTA 2CY6A 3H1WA 1GNZA 4FOVA 1OA3A 5IAVA 2YDEA 4YSFA 2ENRA 3ZXAC 2QKDA 1OLME 3WDXA 4DRVA 5KHHA 3RZKA 1TQ5A 2FQPA 4QPWA 4YZ3A 1XE8A 2W9XA 2ZMNA 3I3QA 1GWLA 5FPXA 5C9AB 3B69A 4RR3B 1RUG2 5FJKA 2AUYA 4MX3A 1H8VA 4UF0A 3VKOA 1ASJ2 4C90A 3VZOA 4CZSA 3RWKX 3T0DA 3JB4C 1XYNA 4S2DA 4A7YA 3JBG3 3LDBA 4GMP1 4H3WA 4I3PA 5C8WA 3MIBA 4CDXA 5FRAA 3LDRA 1BBT3 3N36A 4O65A 4D3WA 5E1RA 1IQAA 1QHDA 3JZVA 3R05A 4G3YC 4IV3C 5FZBA 1K5MB 4YW1A 2WT2A 2Q1ZB 4DOUA 1N3PA 5BPXA 4FFHA 4IEOA 2D3RA 3HQXA 3OF1A 5DDJ2 3GDBA 1US2A 2QUOA 3MIDA 3JD73 1B09A 4CCEA 2E7AA 3LWCA 1V6IA 1G9BA 2BBAA 3EYPA 5AFBA 3RPQA 1NCQB 4DNYA 5HV0A 2GH8A 5C4WA 2BTVC 3VZMA 2WWJA 5K7PA 1BVP1 1S0CA 4BLJA 1ENSA 1DZQA 4LK7A 2A7AA 2J1EA 2DCKA 2IXLA 3GBGA 4BQXA 5ABJC 1O4ZA 1OT5A 1XB9A 5GZFA 1H0BA 4EN8B 2J42A 3E6DA 3T0AA 2LALA 2PAEA 2QQWA 3BI3A 2VUJA 5BNPC 3K48A 2R041 4PDWB 3MV11 3V56A 3QBQA 3KV6A 1OBNA 1RUE2 1UPSA 1WW7A 3K4ZA 3B01A 5AC92 1LGCA 1C5HA 2ETEA 3PTYA 4WM7C 2NYYA 3WQ1A 3BGAA 4FOYA 3ZSEA 4CCCA 3GF6A 1BCXA 3BALA 1OH3A 2D93A 2HEWF 3VBUC 1XBFA 4RD7A 4ARYA 2XJUA 5FPBA 3IT8A 3HBKA 3S5AA 4M3CA 3O0XA 4MO3M 2XR4A 5FYVA 3TAYA 1LODA 5C70A 1GZWB 1TME2 2A6XA 3JUUA 5T5JA 3ZYPA 4AAPA 5FFOC 3UK9A 2ZGSA 1W2NA 3PVEA 4XBNA 5D21A 5FK7A 5FMCA 2HYXA 4OUEA 3SCFA 1V9U3 3P1IA 3SEEA 3V65A 4ZS3A 3V0AA 2VVFA 3NSTA 1TNFA 2O8QA 2R062 2ZAAA 4QGNA 5EJ3A 2X10A 5FR3A 3HQRA 4OZOA 4YZ5A 4LHLA 4CUCA 4QQHA 2WN2A 4XHBA 4XIOA 4UBGA 3I2DA 4AFDA 3HIFA 5A7WB 4XUNA 3KT7A 3TB0A 1LOFC 4YM0A 3I49A 4K40A 3TRSB 2B9VA 1VBA3 5M0TA 2BP6A 1G6NA 4XZPA 2WQ8A 3I2GA 5HBAA 5JR2A 4ZONA 5FUPA 2CWMA 2IUWA 4H7MA 5IVJA 1GOHA 4CCDA 4D0QA 3D82A 4OHVA 2JDNA 4Y5TA 5K9YA 4PLNA 1LCLA 4HKLA 1V6LA 1WLWA 2R1DA 4JGZB 1C1FA 4YYOA 1AUYA 1NLQA 2FMDA 2VNVA 3NQHA 2B42B 5A7PA 4AVSA 5ISLA 3A22A 3LOBA 1LGBA 1UOJA 1UY3A 4URTA 5L9BA 4AK3A 2VVEA 1AR83 2YY1A 1R1A1 2VMIA 2O1QA 4OQ8A 4UT5A 2WNVA 2R0FA 1DQ2A 3BTXA 1JZ4A 1ENQA 2ZGPA 4A6OA 3J26N 1XYOA 1CAXB 1HDKA 4F7ZA 4AI3A 3OY8B 1EP0A 2RM22 5G05L 4AQ2A 3FJSA 3OPTA 4XFCA 4EROA 2P37A 5GZCA 3BTZA 4YARA 5GZEA 1AX0A 2DCYA 2RDQA 2RJLA 3HN1A 5FYIA 4GQ7A 2W39A 4AGVA 1P8JA 1X9TA 2GMEA 3DCQA 2WBKA 4NIGA 4RR3C 2RHPA 4FVVA 4ES8A 2JG9B 2JG8B 3ENRA 4GH4A 3CEWA 4P00B 4W6XA 3UKVA 3HR9A 4B4RA 4GALA 4ZU7A 1Z78A 4Z82A 4JKKA 2E53A 4YRDA 4D6QA 3AYDA 1V6MA 3RZJA 2Q8EA 4QKNA 5T54A 1UOFA 5FY4A 4TLFA 3POYA 3Q9OA 4JHTA 4AXOA 3K2OA 4AAXA 3Q8EA 4UFLA 1RGSA 5EJ1B 3WD5A 2BVBA 2MEV2 1VMJA 3AP5A 5GZDA 5LA9A 1BZWA 5FYCA 1RUF1 3LSDA 4QHZA 2QQKA 3AKRA 5LZ6A 1YQ2A 3V0AB 3APBA 5FYZA 1RVF2 1QGLA 5FZDA 2WNOA 3ACHA 1DF0A 1Y43B 4I01A 5EHDA 3EBRA 2VULA 5B2GB 2FZ1A 3HBZA 2XWJB 3BIWE 1MS0A 2XJVA 3SC7X 2IXCA 2HEYF 2ZGLA 1PK6A 4GB33 2UYAA 4CCJA 4GIQA 4QMAA 1V00A 1PO23 2JEMA 2VZTA 3QLQA 3TN91 3RZMA 3T2PA 2RMU2 4R4XA 1UZWA 2QQIA 3WG4A 4IEXA 3ZLIA 1NX9A 4FPOB 1YFXA 2ES3A 3D6EA 1RVF1 4H7LA 1RJ7A 1IS5A 3DV8A 5ERLA 1UAIA 1Z0HA 1RUE1 5I8TA 4DXSA 4Y33A 2OVUA 3E5UA 4I30A 1V6OA 3MGUA 4JKMA 1B35C 1F9KA 4QPGA 4XDOA 4LJHA 2GC0A 4JCKA 5I91A 1XE7A 1QJU1 4IESA 4L0PA 1R083 4LBNA 4IE7A 4E4HA 5L19A 2ZGOA 1QIQA 5C3RA 4P02B 1BEV1 2R043 2K9ZA 3ZN4A 3TEZA 4ISQA 3NKTA 4BQ5A 1GQGA 4ZXKA 5TSWA 2TUNA 1MQTA 1VBA1 1PVC1 1DGWA 2HWB3 3FHAA 3KVBA 5FLJA 1ACCA 3M3OA 5IW0A 4YM3A 2G4IA 1WW5A 1W6NA 1CPMA 3M8LA 3OGRA 3ZXGA 3TOJA 2RS53 3DYMA 1YJKA 4KBBA 3U4SA 1OXCA 5CAZA 3ZXEA 2XGXA 1CAWB 1YIPA 3SH4A 4ZY9A 3RG0A 2JECA 4YGBA 2JJ6A 1NCRA 2B39A 1JYVA 2E7QA 3NNJA 1POV1 2A6VA 2PHRA 1S2EA 5IK4A 5FYTA 1H2MA 4I2OA 4BXFA 5L7OA 1LEDA 2PHLA 2JG9A 3ES4A 2JICA 2BWCA 2IXIA 4QPIB 2CNAA 2F4PA 3ILNA 4LOSA 3TWIA 4N43A 5C4WC 2P17A 4BYYA 2ZZQA 1R092 1VBC1 4YGDA 3OEBA 5EQUA 1GZCA 1BK0A 5LK7B 4YPJA 2PHDA 5E16A 4XJ8A 1RMU1 5FV3A 2VL4A 1CJPA 4IE6A 4K7JA 2WNVB 3MYXA 4XMAA 2ZX4A 5DN2A 1W2OA 3RYRA 1MEC1 1WMFA 3MLLA 5JZGA 4CE8A 3N9OA 3RSJA 5CKQA 3WDVA 5FYBA 2ET7A 5IHRA 2YC0A 3J7HA 1AR63 2YC4A 2VNRA 1CPNA 2Q5TA 1BJQA 3MW4A 4O61A 3WDYA 2Y33A 3SQOA 5JSRA 2GNMA 3HNYM 2XBO1 5DUWA 3WHUA 3KMHA 2W5FA 2WRAA 4CDUC 3LEIA 2ZA9A 5L9RA 1XPWA 4HXCA 2VECA 3PUQA 2AACA 4MGSA 5C3QA 3FZ3A 1IG3A 4HG6B 4NR1A 2MNGA 4IEVA 4W4ZA 4XHXA 2X5IB 2RVAA 1AXKA 1VBB3 2DWRA 3AXDA 2WN3A 3LD8A 4JDOA 4RR3A 3ZPOA 5CFCA 4RHV1 5LA2A 4AEKA 2YBKA 3OYWA 4NAMA 3H50A 4IETA 1LHUA 5FYYA 4FOWA 1JTZX 5K0UA 2BNMA 2DVFA 3PJYA 4X8NA 4OVEA 5FAXA 5FZMA 5JZGC 3NNFA 4JGYB 5J36A 3KQ4B 2HWE1 2AH2A 2PHFA 2A3WA 4I0WB 5JI9A 1WUVA 2FD8A 3RFRA 3N4MA 1PMJX 1RMU2 2RE9A 1W6PA 2X29A 4O9GA 4IGQA 3RNSA 3KHBA 3VDDC 1AL0G 5H9SA 5F9TA 3RZHA 3WZ1A 2XWBB 1SZBA 3WVJA 2YB7A 5FZCA 3WY6A 1CX4A 2VMHA 4FQZA 5EFUA 4CDUB 1JUHA 2QJVA 4BQ1A 3UNPA 3IMMA 3FC0A 3KSCA 1QDCA 4CU6A 1FATA 4PLMA 3AMQA 1KS5A 2PQQA 3ZIWA 5CFDA 1IHMA 2VMDA 4NPMA 4OMDA 4EZ4A 1A8MA 1AR71 1OPOA 1VBE2 4JV4A 1X36A 1PX4A 2DU0A 1RTVA 1RXFA 3HQUA 2HWF2 1QJEA 3IIAA 1YEWA 5FOJB 3NMBA 1HIXA 2QBXA 4I0AA 3H8OA 1XYPA 4Q4Y1 1POV3 1VBA2 1F4HA 3VBSC 4RS5A 2O8OA 2ATFA 4MHUA 5C8CB 3BUCA 1C8NA 1W8UA 1R082 2W52A 4XOGA 3T1LA 1BEV2 5JZGB 4GJZA 1ZZ8A 3AKPA 5DAWA 3V0BA 3BPSA 1QU0A 5FY8A 3ZXFA 3RZZA 4KNCA 1AR62 4CYDA 3PMEA 2BFUS 1ZRCA 5KXCA 2R073 4QXKA 2SBAA 3TEYA 5FO7B 1EAH2 2P5BA 4RHV2 4BU2A 2VZRA 3PHMA 1KD7A 4QX3A 5E8AA 2AC1A 4RS5C 3RWNA 3WT3A 2JIGA 4QU1A 4RQPB 2EVXA 3HMYA 2BBVA 1OD3A 3WCSA 4LO6B 1H6YA 4MZUA 4URAA 1DIWA 1YJLA 1QQP2 5EP9A 1Y9MA 3INAA 2PLV2 4E4SA 1VRBA 2BERA
chains in the Genus database with same CATH topology
2D3PA 3AKTA 5GLUA 4FT8A 1CONA 1UD1A 2WS93 4R9BA 4HKOA 4XFIA 2PHXA 4AI8A 3IDCB 3GBFA 1RMU3 4K1YA 1AVBA 3R6SA 1JW6A 1CGPA 1G86A 2H6BA 3BU7A 3AZYA 2WQ4A 3CJIC 3RYKA 3FHIB 5A33A 3OCPA 2OZJA 2JKBA 4UW4A 4CEYC 2EXKA 1O4YA 4DRRA 3UJQA 1VRH2 2XKOA 1UZYA 1BYHA 1SCSA 5CFCB 1H9WA 2H0BA 5JIUA 1WBFA 2RM21 1PO13 1VIWB 1SBEA 1Q43A 3N7KA 1HW5A 1O4TA 4QT6A 5L73A 1BBT1 1NXD1 1CR7A 4CEWB 4E27A 2KM2A 2JG8A 4CDWA 4Q0PA 1U5YA 4XJAA 4AEDC 5FLIA 2GDFA 2EXIA 4XF9A 1VBC3 5I93A 3G7DA 4PIYA 4BZ4A 4ITCA 4FPKA 4LUMA 1S0BA 2A71A 5F6KA 4O9EA 2EIGA 4N53C 4B4QA 2FMYA 1YO8A 2E7TA 3KCCA 1BXHA 3HT1A 2YZ4A 5J98B 1LU1A 1R1A3 3QH7A 3E5XA 1K5MC 5JMCA 2R072 3ZO0B 2WNVC 4AFAA 1VR3A 1GICA 3GHNA 2DCJA 1SBFA 1IOAA 2WS91 1JYIA 4M0HA 4MGYE 2VUAA 4HN1A 4COZA 1NLRA 1VAVA 4QPIC 2DVAA 4XTPA 1NXMA 1G8WA 1O7FA 4JRLA 5I8SA 3NAPB 2V5YA 3NKGA 4R9AA 4BLIA 1J59A 3RI8A 4WZCA 5H9RA 4N9HA 4QPGB 1QJY2 1ZBE3 4JVAA 1YHFA 2Z5WA 1QJY1 2B5HA 3I59A 1RUE3 3ZSJA 1EAH1 5IUQA 2K2SA 2JENA 4Z2WA 2PAKA 2A73B 1AR91 1RL3A 3AFKA 4FPHA 2YGLA 4A7ZA 1HXS3 4EJRA 2A5ZA 2Q1MA 4MGIE 3ZFFA 4HVRA 3BB6A 4N7IA 3KM5A 2GC1A 3AMPA 1SLAA 5C9AA 1GLHA 1NA1A 2UYBA 4KG0A 2Q0AA 1YRZA 3ZN5A 1HRI2 1EAH3 1LJ7A 4KQ7A 5JSPA 1LHVA 4BPZA 1AL22 1H8TC 4MXWB 4E2GA 5T5OA 2P3KA 3MIGA 5DG1A 5FQ0A 3TBDA 1D2QA 1RJ8A 4WVWA 1U5IA 2ZGQA 2CGPA 5DZEA 2E51A 1G9CA 1ZX5A 1UZZA 1NCQA 1NYWA 5CADA 2MEV3 2H6CA 5BNOB 4XE9A 1UU4A 3ZFGA 1S0FA 1QJZA 2EAKA 2CGOA 3MIFA 1J3RA 1NG0A 3H1YA 4OULA 1RUG1 4YZ4A 1VB2A 1Z7S2 2ZGUA 4X8PA 4LULA 3POWA 1Q56A 3IBMA 2DVBA 3R4UA 4Q1RA 3WQ0A 2BEOA 4CDWB 2MPFA 5JOYA 1UN1A 3VBRC 5AFEA 1O5LA 2JG9C 3NV1A 1DQ4A 4FPCA 4LTAA 1WMEA 2P2KA 5LEKA 1RUNA 2DCZA 2YV8A 4KWLA 3SHRA 4IV3B 2D5HA 4OHWA 3OYWB 2KA3A 1ENRA 3BPZA 4HSJA 1RUI1 1KJRA 1JH5A 4XF0A 2D7FA 1ULEA 2QQPA 1UIJA 2CYFA 4MSVA 1B35A 4RSUA 1QXPA 2GMPA 2NN8A 1W6PB 1WLDA 4EN9B 4XFFA 2RS52 4ORFA 4IL7A 3KGLA 4AEDB 3IDEA 4YM2A 4CDUA 1CAXA 4XJ9A 4XXAA 5AC91 4I09A 4UBHA 1A3KA 1KDKA 4AF9A 4FPGA 3L2HA 3TNPB 1N3OA 2UY9A 5CA6A 2OPKA 4K8FA 1LOGA 4XETA 5CB7A 5JPMB 2RS31 4GH4B 4CEYA 5A3MA 1H1MA 1S0IA 4XEZA 1GV9A 1VBB1 3NV4A 1AXYA 3VV1A 3CL1A 2I07B 3OGJA 3RJRA 1A8DA 2E9QA 1OMIA 1PO22 1SCRA 3PVBB 3ROUA 3M3IA 1BMV2 3U07A 1VBE1 1NA1B 1DGLA 1PO21 3B5LB 3RQ0A 4YZ1A 3AP7A 4RGGA 3CLPA 1JXNA 4IEPA 3MLKA 1ZZBA 3JBG1 4BA6A 2RS12 4ISRA 2ZS6B 5JAXA 4ZU4A 4Y1XA 1SFYA 4C1WA 3V64A 1FMD1 2JE7A 4OHXA 1PZ7A 1FI2A 4COVA 1M06G 3DPRC 2TEPA 1WLTA 2P3JA 4HZFA 2RR12 1ZA4A 1V9U2 1MVEA 4LA3A 3RDIA 3VHPA 1J1TA 5BNPB 1CN1A 2DF7A 3W59A 3D5OA 4E9KA 2EXJA 4AI0A 4HANA 1AL23 1NY71 3ZMNA 5BNNA 3SXWA 4ONUA 5DUVA 4Z07A 5HCAA 2LM3A 4XBLA 3ZN6B 3TN92 3LOIA 2ZACA 1HRV3 3BTAA 2DURA 2N7GA 1HKDA 3MZHA 1C8M1 1PK6B 1ULDA 1LOFA 1RUI2 1AR81 2BQPA 1S0JA 3IM0A 1MZFA 2B8MA 1IZ3A 3B00A 4N43C 1R093 3KLSA 2VOKA 3PVOA 3PMSA 2ERFA 2BFUL 1RUH1 3L2YA 4OUMA 1FPN1 4Y22A 5JCTA 2ZGKA 1QNWA 1W6QB 1CQ9A 3ASIA 2JDZA 2V09A 1YFYA 2ZZJA 3FBYA 5BXXA 5CVRA 5KBFA 1ZRRA 3N7LA 4HVQA 2HWE3 3WX5A 3H7JA 2ZPXA 1DQ5A 1Z7S1 1COV3 2WSVA 4WM8C 3GBWA 3VDDA 3FUOA 1TE1B 2QE3A 3M3QA 4FPYA 1MQTC 1R091 3HD8B 2YUEA 2WL1A 2WSUA 3B02A 1QOSA 4K1ZA 1CAWA 2A6ZA 3VZJA 2XLAA 1XU1A 1VP6A 3AXEA 2XKPA 3R4SA 1H30A 3LB9A 1D4VB 1UCXA 2UU8A 5E88A 1JOJA 4SLIA 2V73A 3S7EA 3ZN4A 5CFCC 2D6NA 3MIHA 1CJDA 1W6OB 1AYM3 3QH6A 3B9IA 1FX5A 1F31A 3OTFA 5L7OB 5ABJA 1XRUA 4JAAA 4Q4V3 2AENA 1FV3A 1U12A 3UJOA 2YMZA 1GYKA 1RUOA 1J3QA 3D8CA 2D44A 5BNPA 1RUF2 3USUB 3SMHA 2PHWA 3MF6A 5F1RA 3NAPA 1GZWA 3S30A 1HX6A 1XNCA 3KGZA 3VBFA 5CU1A 3ZX7A 1QJU2 1Y3TA 3AJYA 3B9CA 4JDMA 4LA2A 4M0NA 2DVGA 4COWA 1ULFA 2CGNA 2XLFA 4XILA 5J09A 2YPJA 5HCFA 4KU8A 4COYA 3RMYA 2WFF3 2ZGRA 4FPEA 2WFF2 4FXGB 5FMOL 3MFAA 4XPVA 1OLQA 2GU9A 1IS4A 3OBTA 5BYNA 2R16A 1XU2A 5JIAA 3ZYGA 5JDBA 3CF6E 2ZKNA 4LO4B 1M4WA 1OSGA 4OI2A 5BV6A 2RS13 1OD5A 2HJIA 4N9IA 4XF4A 3O0VA 4WVZA 4FXKB 4JGZC 4L2NA 4LHKA 3NAPC 4Q4X2 4DZGA 1GKBA 5KC5A 4AVTA 3WG1A 3R4DB 5H9QA 1RIRA 1TMF3 1RUH3 2XUMA 3WDUA 3JQXA 1WCDJ 2D6OX 3R0RA 4QM9A 2C0ZA 3VBHB 2R30A 4WM7A 1KITA 4WVMB 4XQ4A 1I5ZA 1PZ9A 3DN7A 3OGGA 4YLZA 3QACA 2WJSA 3S0MA 3H9AA 3V0BB 3H8UA 1H9PA 3DUIA 3TN93 4NHKA 1XNBA 4N53B 5D8AA 5DDJ1 1W6OA 4FAHA 1LEMA 1RINA 2VH9A 3AZVA 3MDPA 2DCTA 4Q4X1 1LTEA 4FAGA 5T5PA 3VGIA 1ZYBA 1URXA 4RQPA 1BK1A 1SMVA 5GM0A 3NVCA 1RUD3 3VDDB 4HPKA 4AHYA 4IEUA 4YW3A 3EQEA 1DGRN 2X53S 3NV3A 3DKWA 4CDQC 1OOPC 4GH4C 5D1IA 3H0OA 1SLTA 2D5FA 1NY72 1Q8VA 4PDWC 2EA7A 1VBD1 3ZPYA 3WDTA 4EWEA 5J96B 3B94A 4AFMA 4KG8A 2JE9A 2IFWA 1S0GA 2PTMA 1F5JA 1HXS1 4P9GA 2NQYA 5ABJB 1IKQA 1YIFA 2W08A 1AR93 4XFHA 2UWCA 1C4RA 1YFUA 5AVAA 4AEDA 2G9FA 2HWF1 4LBOA 5T50A 3AYAA 3GZAA 5JLVA 1HQLA 3WV6A 4E2SA 1XNKA 3POSA 1RHI1 3OD0A 2WINB 4RHV3 4BH9A 5IK7A 3NV2A 4CDQA 3MPPG 4YVWB 4LBQB 1TME1 4FSJA 1NA1C 5T55A 3UKTA 4Q4Y3 3E6CC 1MVQA 5DDJ3 3KCXA 5GLZA 2CV6A 1AR61 1VBB2 5HCBA 2ZGTA 1ALYA 5JOWA 2DTWA 2OIIA 2BW8A 4WV8A 4Y20B 4IEQA 1NE6A 2WZR1 1GQHA 1D0GA 2R1BA 1JUIA 2XG3A 1U5ZA 1COV2 2PLV3 2YYOA 1NCRC 3WW4A 1RUG3 1D4M2 1YLLA 1IGOA 5C6CA 2IC1A 2GC2A 4MGZE 3VZNA 3MEPA 1U0AA 3ZFGC 4M00A 4FTEA 4UXAA 1AX2A 1XQNA 3MLJA 4R9DA 5AC93 2QDRA 5AVPA 3VBUA 1UW8A 2QNKA 1AYM2 4GB32 5GLVA 4ASLA 1I6XA 4AHWA 4Q4X3 1SACA 5DXDA 1EV11 2D6MA 1RUD1 5FTTC 1VB4A 2PLV1 4LEJA 5KHIA 1UU5A 1CAVB 2PELA 1OQEA 4DS0A 4N53A 5CBLA 3PLQA 2XJQA 2GN3A 2P3IA 3LA2A 2Y38A 4YGCA 2HWD2 4J1WA 3H7YA 2XJSA 1IKPA 5LEJA 2QZ3A 2VG9A 1V9U1 2ZX3A 3BODA 1WGPA 2RR11 4YW5A 3DPRA 4MXVA 4QHBA 4OUSA 3ZXLA 4D69A 3WG3A 3H1MA 1R081 5SV5A 1GR3A 3M3CA 2RS11 3ZYIB 5K0UB 3JBG2 2Z69A 2I74A 4NPRA 2GSYA 3VZLA 1UIKA 4META 4YVWA 1WD4A 1Q8OA 4XIKA 4P5HA 2WNEA 2XBO2 1ND3C 2WWSA 2R063 3VKNA 4GB31 1LULA 4AWDA 4DFSA 5CIRA 1QQP3 1ENXA 2VNOA 1CESA 3AYCA 2ZKLA 2Z42A 3KT4A 1QKQA 4LBMA 1O3SA 3U10A 4IV1B 2ZMKA 1H4GA 1W6MB 2XL9A 1HQWA 2Y0IA 3IMNA 1SQ4A 5KXBA 3MICA 4R8HA 3UL2A 5CFDB 1PO12 4GMP0 4RGAA 5J7MA 3FX3A 3FLRA 4LBQA 1G9FA 2AGSA 5C9AC 4JC1A 2XL7A 4BHPA 2DFBA 4B8EA 3ELNA 4B29A 2R49A 3MW3A 4E2QA 4WZFA 3AMHA 4KGGA 3RI9A 1ZZ7A 3M2MA 4IXLA 5FLHA 4E4ZA 1H1AA 3RS6A 4S2FA 4WBBA 4W6YA 3MI8A 4MGKE 3I8TA 5EYYA 1A6CA 2PYTA 4KGQA 4K21A 1CAVA 1MZ5A 3ZFGB 3D0SA 2R6QA 3ATGA 3E97A 4EN7B 4YGEA 2B7YA 2ZX2A 2RM23 2XVKA 2PA7A 1QY4A 3QCWA 4F8AA 2XJTA 2KXLA 1EV13 1WCKA 2GMMA 2BPA2 3J4UH 5A3LA 4DQAA 4HETA 1W6NB 4GWNA 1UKGA 2WS92 3S6PA 5GZGA 1JN2P 1ND2A 5GALA 2ZCWA 3B3QE 2UWAA 4INDA 5KWRA 4F83A 3WUDA 2DUOA 3DF0A 1S2KA 1U5XA 1QOTA 2BVVA 4HT1T 4TZDA 4IV3A 2NP0A 1QH6A 1YXWA 5LRSA 1QJY3 4AQTA 1LENA 3WP4A 5A32A 3AM2A 4QU2A 1SLBA 1E57A 4QM8A 1RVF3 2QFEA 3JCIA 5GJ6A 4MH0E 4D7YA 1L3JA 2RR13 1QXJA 1YCIA 4M01A 5HI0A 3IWZA 3LGRA 1J3PA 1DYPA 3LA3A 1AYN2 4TSVA 4Q26A 2XHKA 4ES9A 4IEZA 4MVTA 3WP6A 4E4DX 3ZFEA 2UWBA 4NHLA 1HV1A 1LOAA 1V6JA 4X6QB 5FCCA 1OHFA 3T1MA 1RUF3 2A3XA 1NCRB 2Z79A 3HAGA 3THPA 2WT0A 4JRAA 4PBOA 2D40A 1ZBA2 2IZWA 3FLTA 4Q4V1 5EYXA 1ULCA 3LKJA 3O12A 2OYZA 1OA2A 3AB0A 2VW1A 2WLQA 3L9JT 5JR7B 1NZCA 2RJKA 2VQAA 3THTA 4YVWC 1KS4A 4L97A 2XVGA 4Y1VA 1FOD3 2GN7A 2IXHA 4CTEA 1MS5A 3SCGA 5EZWA 4FBFA 1N1SA 4IV1C 5JVVA 4AFCA 4QGLA 1MR5A 3VBRB 3VL9A 1IS6A 5K8SA 1O5UA 1FAYA 1S0EA 1FNZA 1YYNA 5I0UA 1MS1A 1PZ8A 1UL9A 2A70A 2JX9A 4DINB 3FE5A 4RQPC 5FREA 1LHNA 5GLWA 4K9SA 4Q0UA 4PQ9A 2R32A 4OI4A 1SDWA 2R071 2WZPP 4QPYA 1CAUB 4Q4V2 4CDQB 1H2KA 3EJKA 4TYSA 5DZGA 1X50A 1SLLA 4AVAA 4FTSA 1RUC3 4Y1ZA 5C8CC 2ZX1A 1H8TB 5FPZA 1YWKA 4FTBA 1BMV1 3M7AA 1RUH2 2BUKA 2IFRA 3I54A 1ND2B 1AR73 2B46X 4L99A 2GAUA 3VBOA 2VGDA 1YI9A 3N7MA 2XPJA 1LR5A 1X8EA 1DU3D 3BOWA 1VAMA 1Y9QA 3RRDA 4L9BA 1VBD3 2ZABA 1N1TA 3WNXA 1D4M3 4KU7A 2A6WA 4RFT0 2YXSA 4DY5A 3OD4A 1N1YA 4MLOA 4B4PA 1MZEA 1N1VA 1V6KA 2HWF3 1LGNA 1PIV1 2EF6A 5F6LB 3BCWA 4LLFA 2Q8OA 1D2SA 2PHUA 4GULA 4RS5B 1Q8QA 1OQDA 3BOPA 4HN0A 4OHZA 4JTNA 1OA4A 2HWD1 5KXEA