4AGGA

Structure of a tetrameric galectin from cinachyrella sp. (ball sponge)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
144
structure length
144
Chain Sequence
PIQSIKVDPMKSGGLGVVYRSPDKGRVSLYLYNDGEDILLVVDARFDWRGEQNVLVLNSKFAGGEWGPEVRPEGFPFPCCGYVTTITVRVEIGADGFTLSANGIEIVKYPYRDGLPPPVTKFQYVFQDQGASETAQLESLSAYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALECTIN
publication title Structure of a Tetrameric Galectin from Cinachyrella Sp. (Ball Sponge).
pubmed doi rcsb
molecule tags Carbohydrate-binding protein
total genus 23
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4aggA00
2CWMA 1ULGA 2ZMLA 2D44A 2GNBA 2GN3A 2VW2A 2KM2A 2UU8A 1AJOA 2DVFA 3RRDA 2TEPA 2A70A 4GKYA 4YGDA 4ZXKA 2R0HA 3SH5A 2A6WA 4LBNA 1KDMA 3PVOA 4YZ5A 2WT2A 2ZGUA 1V00A 1WBLA 3WCRA 3WLUA 1C4RA 5T54A 4AGVA 1NXD1 2VW0A 3WDYA 3ZXLA 1OQ1A 3FFZA 4JCKA 1N1YA 1V6NA 2GNTA 4GWNA 2R0FA 3QLQA 3NV4A 3RQ0A 1DYPA 1LGNA 1LHWA 4LBQD 4NO4A 1QU0A 1SLIA 5LK5A 4AYUA 1CR7A 1JOJA 5E8AA 3SH3A 2I2SA 1VAVA 5SV8A 3AZWA 3M3OA 5GZCA 2DVGA 2A75A 2YY1A 1ULCA 2ZGSA 3D6EA 4R9BA 3WNXA 2ZMKA 2NN8A 3ASIA 4BPZA 3CNAA 4GWMA 2E7TA 2WKKA 2V5YA 4GKXA 4XIOA 4BQ1A 5DZEA 1VIWB 4YW3A 1MS3A 2OW4A 2A3WA 4WVWA 4LBQB 1ZA4A 3NV2A 1KITA 2EIGA 3AP7A 1CONA 1SACA 2EXIA 1W6NA 1CPNA 1C1LA 3FBYA 4Y20B 1R1ZA 4FQ4A 4L8QA 4LBMA 4WVVA 4Y22A 1GBGA 3ILNA 1G9CA 4KBBA 5F5QA 1UN1A 5FREA 4PCRA 1A78A 3FLRA 4YM3A 4I30A 2D43A 3N7JA 4PBOA 3M1HA 2P3IA 2ZA9A 4FP2A 4XDQA 4YM0A 2NP0A 5JOWA 4YZ3A 2A6VA 5GLTA 5KXBA 1WLDA 3V65A 1LHNA 4Y26A 2DURA 3SLIA 1W6MA 1OFSA 4FOVA 4FVVA 1JBCA 2DUPA 2WSVA 3AZVA 5GJ6A 1Y7BA 3WHTA 4W65A 3D5OA 5KXEA 5F9TA 5DUVA 3BODA 4YM2A 1SBEA 2D6LX 1UZZA 3LCPA 4PQ9A 1XQNA 3T2TA 2LALA 5GZGA 1VALA 4IQPA 1URXA 4K21A 5DG1A 2CWSA 1Z0HA 2EXJA 2ZKNA 3AYDA 5CB7A 1DFQA 3AZZA 2ZMNA 2A71A 3I8TA 3L2YA 2HYKA 1MVQA 4XJUA 1KDKA 5H9PA 1GZ9A 3V0AB 1KRIA 4M00A 1IS5A 1W0OA 1N1VA 1GLHA 1H30A 3JUUA 4YW2A 1AXZA 1W0PA 2YMZA 1A3KA 1LJ7A 3O12A 2P37A 2OVUA 3WG3A 1W6PA 5JVVA 1DQ2A 2A3YA 3V0BA 2JE7A 3IKWA 1LESA 5CNAA 2GALA 3DGTA 2ARXA 4LBLA 4XMIA 4BLIA 1I3HA 1EPWA 1O4YA 3KM5A 5KXCA 2DYCA 5IK8A 1WW6A 5T5LA 1AF9A 1UL9A 5HCFA 2BQPA 2ZGMA 2AR6A 3ENRA 3VV1A 1PZ9A 1LHUA 4ISQA 3WV6A 3ZVXA 5GLUA 1JW6A 1YXWA 2R1BA 2W52A 1GZCA 2AUYA 2ZGQA 1GANA 1YIFA 5E88A 4AGGA 1DLLA 2C9AA 1GICA 1ULEA 4ITCA 3ZXEA 5IK5A 2EF6A 4XE9A 4H55A 2CY6A 2UWCA 4YM1A 4DQAA 3IPVA 2WLQA 4BOWA 3B9CA 1LOBA 3SISA 4DRRA 3INAA 1WLWA 5JMCA 5JOYA 1DQ0A 1LU2A 3AJZA 4YG0A 3OBRA 1UAIA 3HMYA 4PBPA 1LEMA 2ES3A 2Q5TA 3USUA 3I4IA 4XMAA 1N3QA 3ZPYA 4FPLA 2GMEA 1W6OB 4GALA 4Q27A 5IK7A 2ZZJA 3KQRA 2RHPA 1CESA 3ZXJA 1MS9A 3AYAA 2CTVA 4HL0A 4XBQA 1Q8PA 1UZYA 4C1WA 3OPZA 4FPYA 2R16A 1BJQA 4K1ZA 1S1AA 4XBNA 1W6NB 2H0BA 4FPHA 4U2AA 4YW1A 3VKLA 1LTEA 3A4UA 3WG2A 5CA6A 2VUAA 1ZM1A 2SLIA 2JD4A 3ZSMA 2NZ9A 1DQ4A 1BZWA 3M3CA 4Y1ZA 1LODA 1G9AA 5JDBA 2W08A 4F83A 3MW4A 3IMNA 2PHTA 5IK4A 2PHUA 1MACA 1BYHA 3NV3A 4XJAA 4C1XA 1JYIA 4HANA 2UURA 1S0CA 2ZGRA 3FLPA 4YGEA 1SLAA 4YFZA 3RMXA 2XB6C 4K20A 1LOAA 2B7YA 1SFYA 3B00A 3ILRA 4XJZA 4XYXA 2DVBA 2DTWA 2ERFA 4CTEA 3B69A 4FPEA 3N36A 4JRAA 4K1YA 1SBDA 1G8WA 2E7QA 3N7KA 4ISRA 2VXRA 4Q26A 1U0AA 3N7MA 4TZDA 1FX5A 1V6LA 1IS4A 1GV9A 2JJ6A 1AX1A 3JU9A 4U36A 3D4KA 1Q56A 1SBFA 2D6NA 3MW3A 2A7AA 2W39A 1S0BA 3V0BB 1QGLA 1SCSA 4CZSA 1G7YA 3POYA 5E89A 5GLVA 3ATGA 1SCRA 4WZFA 3QCWA 2OUJA 5CBLA 1UPSA 2E53A 1S0DA 2PHRA 2P2KA 1CQ9A 1RITA 3B3QE 3AX4A 4XILA 5GZDA 5AVAA 1W6QB 3LSEA 3W59A 1WW7A 1JUIA 3M2MA 2DTYA 4Y1UA 1LCLA 1UKGA 3WCSA 1YRZA 1RINA 3O5SA 4BLJA 4XJ8A 3WDUA 2D3RA 1UMZA 5BYNA 4R9AA 1C57A 1D2SA 2EXHA 2NM1A 1GZWB 3PVEA 1GSLA 3A0NA 4Q1RA 2ZHKA 3WDXA 3WZ1A 1AVBA 1FATA 1VLNA 1WD3A 5DUUA 2W68A 5IUQA 3SH4A 4FPFA 1RIRA 1AX2A 3POSA 2JECA 3R05A 2ZHNA 3O0WA 3OYWA 1HLCA 3NV1A 4XXAA 3USUB 2VW1A 2GMMA 5JOXA 4XIKA 4FOWA 1SLBA 4FPOB 1MS4A 1BQPA 1FYUA 5HCBA 1APNA 1B09A 1CJPA 1N3PA 4YZ2A 1CIWA 1Q8QA 1AXKA 4XTPA 1GNHA 5L73A 3VUOA 1SLCA 3ZSLA 4M3CE 3N7LA 4M3CA 1DIWA 1BXHA 3BOPA 4XBLA 1HKDA 4YW4A 4XZPA 1IOAA 1QMJA 1N1TA 4LBJA 4Y20A 1DQ1A 4Q2FA 3WHUA 1X50A 4P9YA 1OKQA 5DUWA 1DYKA 4BMBA 3SNMA 1LOGA 3V64A 2WT0A 5GLWA 4ATEA 2CNAA 3UK9A 3WOGA 1QOSA 1WW5A 2E6VA 1IKQA 1MVEA 2DUQA 3OGGA 1V6KA 3HR9A 1DZQA 2R49A 2WQZC 2C5DA 1TEIA 1D0HA 1QNWA 2D3SA 1KJLA 1YO8A 2PHWA 4R9DA 1N47A 1CN1A 3RSJA 1FNYA 3H0OA 4YGCA 4ZKTB 1Q8VA 3T1LA 3PJQA 1H9PA 2FHRA 2V73A 2DVDA 2ZGNA 3DUIA 4ASMB 3WVJA 5GLZA 2YZ4A 3HN1A 5DG2A 1YI7A 3AP5A 3IN9A 1FV3A 1LECA 1LULA 3PVNA 3OY8A 3WUCA 4M01A 1QNYA 2ARBA 1YYNA 2DV9A 4XOGA 3ILFA 1PZ7A 1DBNA 2JKBA 5GZEA 4AWDA 4AVVA 2NMNA 3ZYPA 1ONAA 1QOTA 4Y22B 1J1TA 3RG0A 2GMPA 4DS0A 1S0FA 1I1EA 2VY0A 1NLSA 1N3OA 1LU1A 1WUVA 2YROA 3FUOA 3GALA 2DVAA 4RL7A 5IT6A 2D3PA 4BMEA 3VKMA 5DXDA 1ENRA 5H9SA 1F9KA 3GNEA 1QDOA 2WNEA 2D6MA 3WG1A 2UWAA 1PZ8A 1CVNA 1W6MB 3WG4A 3V0AA 2ZGPA 3WDTA 2CYFA 2GDFA 4MYEA 3O0VA 5KXDA 3VKNA 3ZSJA 5EYXA 1S0GA 2CL2A 2ZBJA 5T52A 5HCAA 1KQRA 1F5FA 1Q8SA 2EAKA 2XG3A 4JC1A 3RS6A 4DRVA 1ENQA 3AJYA 3M3QA 3RMYA 5GM0A 1O4ZA 2GN7A 2D6OX 1AZDA 1MS0A 2ZGOA 1LEDA 2LTNA 1AX0A 1HQWA 1DGLA 1Q8OA 2FMDA 1MZ6A 4FPCA 3AYEA 2ENRA 5JOZA 4YFWA 1LENA 3WUDA 5EYYA 4AVSA 2WT1A 3OYWB 2D6KA 1LOCA 3BIWE 4YG6A 3TAYA 4DFSA 5H9RA 4UW4A 3MEPA 1W6PB 2AREA 3C2UA 3R4UA 5EXOA 1V6JA 1JHNA 4P14A 1H9WA 1F31A 3W58A 1W6OA 4FOYA 2D7FA 2DU0A 5GALA 1S0EA 4Q8LA 2GNMA 1N1SA 1Z78A 2D6PA 2OUHA 4YLZA 5FRAA 3UJQA 4M3CB 3ZXKA 1FV2A 2A6XA 4LBOA 3AK0A 1JYCA 4FPJA 1LOFC 4XJWA 4P9WA 2NMOA 1V6IA 3O0XA 3ZXFA 2Z42A 1V6OA 2PHFA 3FUQA 4RA0A 4XXPA 3WDWA 2DWRA 2YV8A 2YXSA 4UW6A 4YZ4A 3IPVB 3BTAA 3UJOA 3VKOA 1WW4A 3Q9OA 2ZGTA 2EALA 4SLIA 1LOFA 3M3EA 2ZHLA 4BM8A 3T1MA 1QKQA 3U4XA 4GA9A 1UX6A 4M3CF 1LOEA 4FOQA 1WBFA 3ZSKA 3AP6A 4Y1VA 4YG3A 3AXEA 4AVTA 1FAYA 1ULDA 4LBKA 2A6ZA 3VKFC 1JXNA 2A5ZA 2ZACA 1LGBA 1HDKA 4DPNA 2AYHA 1CPMA 1FNZA 3R4SA 3OY8B 4PF5A 4ATFA 4NOTA 5H9QA 5T50A 2P3KA 1QF3A 3NWKA 5T5PA 4LBQA 4P9XA 5DUXA 3OBTA 1MZ5A 2R1DA 1S0JA 2WJSA 3N3HA 3PMEA 4FQZA 1WD4A 2GNDA 4WV8A 2P3JA 1ULFA 1IS6A 4XTMA 3POWA 4R9CA 4Y1YA 2AH2A 3N35A 2ZGKA 1HQLA 1QOOA 3WDVA 2UWBA 3LSDA 4YW5A 2AGSA 3AFKA 2ZABA 3A0KA 3AYCA 3AZYA 1GNZA 4UW5A 4D69A 3AP9A 1S0IA 1SLLA 2E51A 3APBA 1LGCA 1AJKA 2NYYA 3AP4A 3MW2A 4XHXA 1DHKB 1AXYA 1VAMA 5DZFA 3UL2A 1LHOA 2VH9A 4AGRA 4Z8BA 1WCSA 4TYSA 2SBAA 3B01A 4Y1XA 1DQ5A 5EWSA 2A3XA 1W6QA 1G9DA 3OJBA 1DQ6A 1IS3A 1GKBA 1KJRA 4XHBA 1ENSA 2DU1A 3ZYRA 4XJ9A 1QDCA 3AZXA 5T5OA 1G86A 1GYKA 2A6YA 2DUOA 4Q8KA 5CAZA 4UW3A 3IM0A 2JDZA 1MS1A 4FPKA 2AENA 3FLTA 1G9FA 1GZWA 4YGBA 2EXKA 5T5JA 3TB0A 2PELA 2ZGLA 5JLVA 1G9BA 1WLCA 3AXDA 1V6MA 4Y24A 5T55A 4FP3A 1MS8A 2WSUA 4OZXA 2P34A 4CRQA 1JN2P 2JE9A 1SLTA 1MR5A 1IKPA 4GXLA 2VU9A 2ZHMA 2ZAAA 1MS5A 5DZGA 4Q1PA 2PHXA 1LHVA 1BKZA 2G4IA 5GZFA 4YZ1A 4FPGA 1A8DA 1C1FA 3MPPG 3SITA
chains in the Genus database with same CATH superfamily
1XNAA 2PAMA 5FYHA 2J1UA 2ZMLA 1HB4A 1ZRFA 2D44A 1YQ2A 2Y6FA 2VW2A 2ZEYA 2UU8A 2GSYA 5FQ0A 1AJOA 1SEFA 2DVFA 1CAWA 2JG8B 3OEBA 4ZXKA 4YGDA 2ZJCA 4JGYA 5I8SA 5FKCA 4IW3A 3CBNA 3ZXGA 3VHOA 1C4RA 4AGVA 2VW0A 2VZVA 1OQ1A 3FFZA 4QHOA 3NO8A 1N1YA 1V6NA 4GWNA 3WF0A 3I59B 4L92A 3NV4A 4XUTA 3A7QA 1LHWA 1MEC2 1SLIA 2EIEA 5C71A 2R6QA 5A7WB 5EIYB 1JOJA 5J48A 3SH3A 4CCCA 3ABZA 3GHNA 2BERA 2QBXA 4R4ZA 4MV2A 3K77A 3I2KA 4R9BA 2YY1A 1ULCA 3D6EA 4AFMA 5CEHA 4YARA 4HBNA 5CKNA 4S2HA 1PK6B 4IV3C 4JQRA 5EV7A 4A6SA 1LAJA 4N53C 2Y6KA 5FO7B 1XE8A 4XIOA 1F2NA 3POFA 2OW4A 4A45A 4CU9A 5FPLA 1C5IA 2WIIB 1KITA 2EXIA 1HIXA 3FBYA 3LIGA 2X09A 4Y20B 4C91A 5IAXA 3QH7A 2QTWB 4LBMA 4Y22A 1POV3 3GCXA 5FJKA 4KWJA 4JGZA 5L9BA 4COUA 1UN1A 4EJRA 1KXGA 4HONA 1QJY3 1A78A 4PCRA 3MF9A 1NE6A 3IB3A 2D43A 3OOXA 1RUG3 5LZ6A 3NKTA 4HVOA 5FY9A 3B9IA 4GD4A 1R092 2VGDA 4DO0A 1X33A 5L9RA 5JOWA 2GZWA 4ES9A 2VNVA 3JBG3 1J83A 1JYWA 3V65A 1IHMA 2HWC1 3J7LA 3VBUC 3H3ZA 3SLIA 1POV1 4FVVA 2WNOA 3WHTA 1Y7BA 3S5QA 4TTGA 1J59A 5J3UA 1QJY1 5F9TA 5CIRA 4Q0UA 3BODA 2D6LX 3JXSA 3OF1A 4RSUA 1RXFA 1JZ5A 4UYBA 1URXA 2HBTA 1RJ7A 2XJPA 5DG1A 2CWSA 3ZIWA 4AFBA 4DXZA 5A32A 3AYDA 3NNFA 1DFQA 4LJHA 1VAKA 5K9YA 5I0TA 4PLNA 1NOVA 3PVBB 4AEDB 1KDKA 1O7FA 1GZ9A 5H9PA 4JVAA 1TNRA 1AL23 3LE0A 1QWRA 5FYMA 5I8YA 4ZONA 3LGRA 4PHZA 3ECQA 3JUUA 3JD73 2OPWA 1FOD3 3SKVA 1Z7S1 5FUPA 3WG3A 2GH8A 3IIIA 1DQ2A 3IKWA 4M4PA 1OOPB 4EWDA 3DGTA 3BOWA 2R072 3BALA 2VBDA 1I3HA 5KXCA 2WNVB 3RJ2X 1FPN2 3W5MA 5LBFA 1GQHA 1D7PM 4BJ0A 4PQQA 2BQPA 4E8DA 4MSVA 1PVC2 3ENRA 3R4DB 2B8MA 5A3MA 1REDA 1H8TC 2VUDA 3MF6A 4MGIE 2W52A 1RVF2 1T2XA 2AUYA 3BIEA 2GC2A 3H1MA 2Q8CA 1YUDA 3MDPA 3KT1A 2PHDA 5IK5A 1ULEA 2B4KA 4XE9A 1HRI2 5LRSA 4DQAA 1MQTA 4XAAA 4NN0A 4QWNA 1U5ZA 4ZU5A 4HK9A 3N9NA 1QJU1 2R043 4IERA 3VZOA 1W9WA 2JD9A 2Z79A 1ASJ3 4YG0A 4QX1A 3HMYA 2ADEA 1LEMA 5IFPA 4HOOA 2Z2SB 3DYOA 2JWPA 3USUA 4YVSB 4CUCA 2D97A 1VR3A 4QDRA 1N3QA 3VZKA 4V1PA 5JXIA 3S7EA 5CVRA 5FYYA 4V2WA 3UETA 2PLV2 4YVWB 1PVXA 4J6GA 3AYAA 4COZA 3NNLA 5IVYA 1ZRRA 2R16A 4AL9A 4M4RA 2FDHA 1W6NB 3MHZA 4YW6A 3VBSC 5J1XA 2H0BA 4L9BA 1OH3A 4U2AA 3WNLA 1WCDJ 5EJ3A 2BNOA 1YQ8A 5CFCB 2VQUA 2NZ9A 1DQ4A 1NKGA 4QGNA 4QQLA 4Y1ZA 3H7JA 1LODA 1UY2A 2QKDA 2QJVA 4BDVB 4CXXA 3SCFA 3BB6A 2PHTA 3OUJA 5E6HA 4TN7A 3NV3A 5BNOB 5FPUA 4HN1A 1O3TA 4IEPA 3HOBA 5FZFA 5A70A 1JYIA 2UURA 1SFPA 2VE1A 4DUWA 2JG9C 1XJAA 4LHNA 5FPXA 2BUKA 1ZYBA 5IHRA 4BK4A 1SLAA 4YRDA 2YFUA 2OKXA 1IPSA 4IXLA 2DVBA 2DTWA 2ERFA 4RGGA 3B69A 4F7ZA 5K8SA 1C3HA 2VMHA 1UOGA 4GH4A 5I91A 4HFSA 4K1YA 5FZAA 4X6RB 3ORJA 2QQUA 2WZ8A 2XJSA 3D3AA 4IE7A 4ZS3A 2VZOA 5FY5A 3N7MA 3ZFFC 4XCAA 2XONA 3KSCA 1SDWA 1V6LA 1W2TA 4WBBA 3ZSEA 2JJ6A 2VTXA 4U36A 5D8AC 3AMMA 4YWAA 2O0OA 2D6NA 1UPIA 2YG0A 2A7AA 3DPRC 5AFBA 1QJY2 1BVP1 3LDKA 3O1PA 4UF0A 5FY7A 3MUZ1 4ONUA 5G05L 2IVJA 3ZMOA 4AOCA 5FPAA 4CDUB 4MOAA 3MV01 4KNCA 4XF9A 5CBLA 1ND2C 1UPSA 3O14A 4H7LA 2JIJA 2Q1MA 2XBO3 3EQEA 4P08A 3SKJE 2VXJA 1K5MC 5GZDA 2F4PA 2N7GA 3LSEA 3W59A 1I9RA 5F2SA 1UKGA 3WCSA 4HKLA 5DABA 1CJDA 1Z7S2 1T6GC 5C3PA 5FDBA 1STMA 1I5ZA 1M4WA 1GSLA 4M0NA 4OHXA 2XBO1 4OHVA 4X8NA 5ANNA 4YPJA 4GJYA 3VD3A 1AVBA 2G19A 2W68A 3LA3A 4FAGA 4FPFA 4UXAA 1AX2A 3I3DA 2WWUA 4RQPB 2ZHNA 3ZFGB 2ORXA 3NV1A 1RMU3 5LEJA 4G3YC 4FOWA 1SLBA 4L2NA 1MS4A 2BOJA 1BQPA 4LULA 1APNA 1N3PA 3Q8EA 4MGKE 1XU2A 1JZ4A 3E6BA 4M3CE 2ZEWA 3WNPA 1BXHA 1POQA 4LEJA 4XBLA 5FQ0B 2QUOA 4XZPA 1QJU2 5CKMA 2ORZA 1AR91 1AR83 3HT1A 2HEWF 1TMF3 4MHRA 1DQ1A 3WQBA 4Q2FA 3VL9A 1JU4A 1X50A 4P9YA 4W8JA 5KC5A 1OKQA 1A8MA 1UU5A 4JX0A 3E5QA 2WT0A 1NG0A 2XLFA 1AYN3 4ATEA 2CNAA 4I02A 5FUIA 4I0BA 5ISLA 1DZQA 3OTFA 5KHGA 2FDGA 3AKRA 1TMF1 2WQZC 2VOVA 5FZEA 3DF0A 2YBKA 2Y64A 2PFWA 1N47A 1CN1A 4GMP0 1FNYA 2NPIA 3ALQA 3H0OA 4IEZA 4B7EA 3BUCA 5K0UA 4O9EA 1H9PA 2FHRA 4PIYA 2Q1ZB 5FP9A 2Y26A 5BNNB 1AYN1 4QX5A 2XWJB 1DG6A 2YFZA 1OQDA 2GU9A 1YI7A 1OMIA 4XF0A 1FV3A 5FZKA 3ES4A 1JOPA 1YFWA 3OY8A 3AM2A 4M01A 5IAVA 2Q8OA 3ZFEB 3KV5A 2ARCA 1PZ7A 2F6BA 3LIHA 1HN1A 2NMNA 2OQ7A 4ZPIA 2VUCA 3VZJA 4Y22B 3RYPA 1J1TA 4OI2A 3RG0A 3EBRA 2UY8A 3VBHB 3IBMA 4JGZB 4E4ZA 1R1A3 4ASKA 1K45A 4NWVA 2VG9A 1WUVA 3GALA 4NPRA 4D3WA 3BTYA 4AEJA 3DEMA 5EZWA 2GC1A 2QQOA 3HD8B 4CU8A 1UY3A 4LE3A 4E2QA 1MZEA 2D6MA 3ACIA 1H8VA 2ZTNA 1H0BA 3V0AA 2BJSA 1R1A1 5KXDA 3VKNA 2EA7A 1SPPA 5C6CA 1GU3A 4WVMA 1KQRA 4KU8A 4JC1A 2VM9A 3PUSA 1ENQA 1X9PA 1O4ZA 2E9QA 3PL0A 3V56A 2D6OX 3OGSA 2CAVA 4J1WA 1MS0A 2BTVC 2VZQA 2ZGOA 4DUXA 4CUAA 3O1TA 1NAEA 3MICA 1XSRA 1DGLA 5FZGA 4AF9A 1Q8OA 2FMDA 4JTNA 3KT4A 3AYEA 2LM3A 3OEAA 4ZXEA 5LA2A 3SCHA 4ASLA 3WUDA 4LKFA 2DCKA 3OYWB 4YG6A 5LBBA 4AFCA 5ACA3 1RUC1 1OF3A 3IDAA 1DCSA 2ZX4A 3R4UA 5EXOA 4OHYA 5CISA 5LA0A 4P14A 2W3JA 1Y9MA 1J84A 3ZXAC 4AHZA 1W6OA 5C8CC 5JSRA 1QY4A 2E33A 1JS9A 4Q8LA 1N1SA 1Z78A 4RGAA 4CA9A 5L19A 2OZJA 3H50A 1QH7A 1H6XA 4LHKA 1SDDB 5LASA 4AK3A 2W1UA 3E5XA 2XLGA 4EN6B 3ZXKA 2XBO2 1FV2A 1WCUA 2ZX3A 5LB6A 4XFIA 5C5TA 3AK0A 4FPJA 1ZZ7A 4EZ4A 2VVDA 1FMD3 3AKPA 5A6ZA 3N9PA 3O0XA 1FXZA 4RYDA 1DGRA 4CXWA 5IYYA 1ACCA 1CZSA 1V6OA 4JRLA 1W8ZA 1BCXA 2DWRA 2VMFA 4UW6A 4OHZA 1K42A 4XF1A 1OPOA 3AL5A 1H2LA 3D8CA 5EP9A 1XNCA 3CU7A 3WY6A 4BM8A 4FTEA 2XPJA 2ATFA 5FYTA 5A7WA 4MGZE 2VQTA 4P02B 1UX6A 3KLSA 4QU1A 4BIFA 5I0SA 1WLTA 3QBQA 4M3CF 3ZSKA 1WBFA 1AR92 2BGOA 2W92A 2YC4A 4AVTA 1HRV1 4MHUA 3K51A 4LBKA 4QB6A 5IVCA 3PUQA 4QX8A 1ZRIA 4MO3M 1L7LA 2Y6LA 4GAZA 1YI9A 4XCBA 2W1SA 1NCRC 2QQLA 2W1WA 3EO6A 3OSDA 4Q29A 5FZ0A 2XXZA 5H9QA 2DCZA 1UZ0A 2P3KA 3POIA 4P9XA 3OB8A 1MZ5A 4NJ4A 3ZO0B 3HQUA 4FQZA 3PMEA 1UXXX 1DGWA 2QCSB 2P3JA 1TMF2 1IS6A 1O4TA 1ULFA 2V72A 2WS91 3POWA 2AH2A 4XTMA 5TSWA 4AI1A 4CDQA 3H7YA 1A34A 2UWBA 3M8LA 5HCHA 2C0ZA 2VMEA 5FK8A 2XOMA 1GNZA 1AYN2 3AP9A 3H3UA 4K8RB 4DXRA 5FZ6A 3I7DA 5FYBA 1XNKA 1AJKA 1J3QA 4EN0A 3SMHA 1VAMA 5FV3A 1MQTC 3TNQA 2VH9A 2CDPA 5BNQA 1BLZA 1DQ5A 4IV1A 5EWSA 1W6QA 1G9DA 3I2OA 1GKBA 4OQ9A 5FPBA 3DCQA 4B7KA 4Z92B 3ZYRA 4KL1A 4JTOA 2HEVF 3AZXA 3ZX7A 3OUHA 3UKNA 5L36A 3LF7A 4MGTA 4WM8B 5A3UA 4GH4B 3VDDC 4URTA 3FLTA 1G9FA 2VO5A 2Y6GA 2GC0A 1GFF2 1SG3A 4OUSA 5FR3A 4MGYE 2G9FA 2PELA 2ZGLA 3HJRA 4LE4A 4ZU4A 4AEDA 1G9BA 2FZ2A 3S30A 1RUJ3 5T55A 1CAUA 2Z5WA 4OI4A 1XE7A 1R1A2 5ANQA 2C6SA 3WNOA 2WSUA 4QQPA 3W20A 5A1FA 4GXLA 1EV13 2J1TA 2ZHMA 4UF0B 5C33A 4GB33 3ZM8A 2QQKA 1BKZA 2XGXA 3ACFA 4EYUA 4Q4Y3 1XXNA 3U0ZA 4YZ1A 4FPGA 4IE5A 1D2QA 2WNVA 2CWMA 5A7QA 4OMDA 1RUJ1 4W6WA 2KM2A 1VMJA 3L2HA 3WNNA 4EWAA 3LOBA 1EV11 2R0HA 3SH5A 1CIYA 1RUD3 3DL3A 1D4M1 3E97A 2VUJA 3GGLA 3PVOA 3A22A 4N43C 4YZ5A 2Y0OA 5SV5A 2WT2A 2VZUA 3GBWA 1RUC2 3FBMA 1WBLA 4Q4Y1 3RZZA 2Z4FA 3WCRA 1WZXA 3WP5A 5FIXA 3WDYA 4H7MA 5G04L 2VAUA 3FHIB 2R0FA 2WZPP 4HPKA 1DYPA 2P5BA 2XJTA 3CDZB 3HNMA 1LGNA 4Y4YA 1VJ2A 1QU0A 4QQ2A 2ETEA 1IZ3A 3KCYA 4AYUA 1CR7A 1RUD1 2MHFA 2J1AA 3NNGA 1VAVA 5SV8A 3WQ7A 5CKQA 4IEQA 3O1VA 1D0GA 3WNXA 2ZMKA 2XUEA 2NN8A 4P5HA 1JZ6A 4BPZA 4GWMA 3THPA 1DLCA 2WKKA 3PURA 3IDBB 1RTVA 4YVWA 1ALYA 1ND3B 4HZFA 2F17A 4S2FA 5DZEA 4WM7C 4QXKA 5A3NA 3S0MA 5FYUA 4WVWA 1ZA4A 2BZDA 2IXIA 3AP7A 4GQ7A 1HN0A 3KF5A 3K48A 1CPNA 1W6NA 1C1LA 4BXSV 4FQ4A 4XFAA 1RHI3 4WVVA 1GBGA 1J58A 1YJKA 2MPFA 2WNUB 1FMD2 4JKLA 5F5QA 4OQ8A 2CGOA 2ZZQA 5A3LA 5FFOC 4AFAA 4B1MA 1YNAA 4YM3A 1QXRA 2WO7A 4I30A 2X5IB 1HRV2 5D21A 4OI1A 2JXAA 1PX3A 4YM0A 1O59A 4LHSA 1RUE3 4Y5SA 5JXGA 4J1XA 5GLTA 4DIQA 1WLDA 3AB0A 2C9KA 1RHI1 1W6MA 2VECA 1F35A 3MLKA 5FJHA 1Y4WA 1U5XA 4ARYA 1VBB3 3D5OA 4M0HA 4AQ2A 5KXEA 3H8XA 1SBEA 2WS92 3RVHA 5L7OC 1RUE1 2KXLA 1V9U1 4K21A 3IIAA 3GBFA 3ZIXA 3I2IA 3I8TA 3IAPA 5FZHA 3UGGA 3RNSA 1VBB1 5F3EA 4R52A 4M00A 4A42A 2GH2A 4EN9B 1W0OA 5FKBA 4AHYA 1GLHA 3RZMA 1OVSA 3VBFB 3ZR5A 1PO11 1W0PA 1VBD3 3ACGA 2JDNA 4CE8A 1A3KA 2P37A 3F2ZA 2VOXA 1XPWA 4LO5B 3THTA 5KHKA 2HWF1 2PN5A 3TEZA 2J7MA 1UWWA 3AMQA 1W0NA 3W9AA 4XMIA 2ARXA 2R073 4BLIA 5LK7B 3ACHA 1FPN3 1H6YA 4CDUA 2DYCA 2JDAA 3NAPB 1AF9A 1UL9A 3ETQA 2I45A 2VOWA 4UOJA 1NA1B 1U5IA 5CFDB 1W2UA 1NY71 4QPGB 2JX9A 5AFEA 4WVMB 3WV6A 1JW6A 1YXWA 1GZCA 1F15A 1PO23 1GNYA 1YIFA 3OPTA 4N7UA 3WT3A 5KC6A 2RVAA 1PGW1 2C9AA 1JMUB 1GICA 2QQJA 3J7HA 1JZ3A 1A6CA 2AACA 4H55A 2CY6A 3HNYM 4Z1VA 3IPVA 1HQNA 3B9CA 5I0UA 1LOBA 1MPXA 3SISA 2VCCA 3INAA 1OD5A 2WO2A 3LB9A 4JDOA 3THDA 5IVBA 1RUJ2 5DN2A 3NVCA 1PO21 4FI9A 3ZFGA 2ES3A 2J1SA 1OLQA 2Q5TA 2RS13 3I4IA 4MX3A 3ZPOA 4BZ4A 1EV12 3B7MA 4F3JA 4Z2WA 1D4M2 2ADDA 4GB32 4Q27A 1W6OB 4GALA 3S6PA 3EMRA 4Q4Y2 5IK7A 1CESA 1MS9A 4HL0A 4CEWB 5JR2A 2QZ2A 1UF2C 2TNFA 1DF0A 3DKQA 4QQOA 3CLPA 1S1AA 4AI8A 5HV4A 4ET7A 5F3IA 4PDWC 2DCYA 2UYBA 2RS11 2G9ZA 4RFRB 3POEA 5CA6A 4JKKA 1YFYA 4Q4X1 1RUD2 2VUAA 5FP3A 2Y34A 3ITQA 4N53B 5AVPA 2SLIA 3NJYA 3H3LA 2ZXQA 3TEWA 1W90A 2PXJA 2QNKA 4Y5TA 5JDBA 5J36A 1REEA 2RDSA 2J1EA 2VMCA 3GJAA 2PHUA 1MACA 1ZBE1 4D7SA 2OXBA 3I2JA 4HANA 3BU0A 4Y3OA 1W39A 4BQ5A 2BP6A 4Q4W3 1S0CA 5IJRA 1CX1A 4EN7B 3PLQA 3FLPA 3LQCA 2W87A 3ZYBA 4YGEA 4NIHA 2XB6C 2JDUA 4N7IA 2B7YA 1SFYA 2BOIA 5BNNA 3B00A 2WL1A 5I93A 3ILRA 4XYXA 5DPNA 1IPKA 1ENXA 2BGPA 5C9AC 1POV0 3QD6A 3VBUB 4JRAA 3POJA 3KCXA 3ZFEA 3N7KA 4ISRA 5BPXA 4OI0A 4QM9A 2VTFA 4Q4W1 3GF6A 4TZDA 3CJIA 2HWC3 2D40A 5BNOC 4CDQB 1RHI2 3RZGA 2ZPXA 1GV9A 2V4AA 3VBHA 3W5NA 3JU9A 1VPHA 4Q0PA 5BUVA 3RDIA 1Q56A 3MW3A 4INDA 1AYM3 2PTMA 2JG8C 3PUIA 4OFGA 4LLOA 1S0BA 2VVEA 3TEYA 2XJRA 3POYA 3LD8A 1RUE2 2ZS6B 3ATGA 1V9U2 5DAXA 2PAEA 5A7PA 2WRAA 2X05A 1E57A 4QXCA 2P6HA 4TSVA 1Y43B 2E53A 2PHRA 1CX4A 4IV1B 3B3QE 2XKOA 1W6QB 1RUF3 1VBB2 3T4VA 1FI2A 5FY4A 1AYM1 1HJGA 3CZUA 2TUNA 1LCLA 4CCKA 4CEYA 1YRZA 1PO12 3DN7A 3NNJA 4DY5A 2CGPA 1W3VA 3O5SA 1Z7S3 4BLJA 4DUVA 4E4DX 2D3RA 1L7RA 3GZAA 1UMZA 2I07B 1D4VB 1C57A 1W8FA 2C26A 2HWF2 2IXKA 1QH6A 3PVEA 4R9AA 4NIAA 1PK6C 2B45X 2ZHKA 2ARAA 1RUF1 3AVSA 1VLNA 1WD3A 2O1QA 1Y3TA 3SH4A 3M7AA 1J1LA 1CAUB 1W05A 3R05A 1XSQA 3OYWA 3HVDA 1HLCA 2LUWA 3U37A 4XQ4A 2W95A 3R0RA 1VBD2 2VW1A 1VE0A 1NY72 3TNPB 4BE3A 4WZCA 4FPOB 1VBC3 2CSGA 5HCBA 1B09A 4QPYA 4BISA 3VUOA 1PGW2 1U5YA 1GNHA 2XVGA 4XTPA 1T6BX 4LR4A 3K2OA 1DIWA 3BOPA 4YW4A 1HKDA 1QJU3 4ZZ8A 1QMJA 2FDKA 4IDZA 3TYJA 2PYTA 3WW2A 4MGSA 1VBC1 5CZKA 4BMBA 5DUWA 1DYKA 1GWKA 1PO22 1Y9QA 2YBSA 1LOGA 4PJYA 2QQNA 3H8OA 2BU9A 3VGIA 3SEPA 2RS33 3U4SA 3UK9A 4CDXA 3WOGA 4HPKB 3RZLA 4KG8A 1O3RA 1WW5A 2E6VA 3NW4A 1WCQA 1IKQA 1MVEA 1WMEA 1JZ7A 3HR9A 3P1IA 3N9QA 4XFHA 5C5UA 2R49A 4W6YA 5A7SA 2JDPA 1D0HA 1OA2A 2PMWB 1KJLA 1VBE3 1YO8A 3VD7A 2J42A 1YLLA 2BEOA 5F3GA 5FZLA 3RSJA 4L0PA 2FCVA 4YGCA 1Q8VA 2W47A 3C7OA 1IG3A 1DU3D 3DUIA 4IE4A 1BEV3 2RS12 4OHWA 1H4HA 4QPWA 2YGMA 3OGVA 4AI9A 3WVJA 2RS31 4Q4X2 4AE2A 4COWA 3AP5A 3FHQA 1LECA 5DDJ1 4O7XA 4E4HA 1O5LA 3DXUA 4IEWA 2JG9B 1VBE1 2ARBA 1OOPC 4XOGA 3ILFA 2ZCWA 4KG0A 4MUVA 5EFUA 3URFA 1UIKA 5LCWL 1QOTA 3MIEA 2WNVC 1BEV1 4XPVA 4AAPA 2GP5A 4KWKA 1OPMA 2W2IA 1I1EA 1Y9GA 3VBOC 1N3OA 1LU1A 2DVAA 4RL7A 3ZYHA 3VBRC 3VKMA 2CGNA 3CO2A 4FO9A 5DXDA 1NLRA 3VDAA 3ZMNA 1W8OA 2Y60A 2WNEA 3WG1A 2UWAA 1CVNA 1TQ5A 2MEV3 3VZLA 1W6MB 1XYOA 3D0JA 3WDTA 1LR5A 4XFGA 2BRTA 3ZSJA 4Q4W2 5JAXA 3DPRB 5IVEA 5EYXA 5T52A 2XG3A 1X9TA 3MIFA 4B1LA 3M3QA 1CWPA 4D6SA 1WCKA 5FXZA 4WM8A 4LXLA 3FMGA 4YVSC 2MEV1 3I2FA 1ND2B 1CZVA 1HQWA 3PU3A 2VBPA 4ORFA 4B4PA 3AMNA 5DMYA 1MZ6A 4D0QA 2NLRA 4IE6A 2EIDA 4HKWA 4XETA 4D7YA 2HWC2 4YFWA 1HB1A 4QGMA 5F3CA 3GZTB 3LAGA 5EYYA 4H3WA 3TAYA 4AVSA 1LOCA 3BIWE 1BHGA 3GYDA 4MLOA 2JDKA 5H9RA 4BHPA 5EHDA 4BCUA 1OUSA 3MEPA 1E5HA 2AREA 3C2UA 1AYM2 1NX9A 1BMV1 1JHNA 4GZ9A 3WW3A 4DB5A 1F31A 3UGFA 4RS5C 3W58A 4UFLA 4Q4V1 5CFCC 2GNMA 2V5DA 2OUHA 5FRAA 5A7NA 2FDFA 4AI0A 5C4WA 1CGPA 3J4UH 4P9JA 3C7GA 1WMXA 2XJUA 3TEXA 1JZ2A 1RUF2 4LBOA 4XJWA 1XRUA 5FAXA 5A6QA 4I2OA 1V6IA 4XUNA 1W3XA 3FE5A 4RA0A 3ZYJB 5JMOA 2YYOA 5CU1A 1QXJA 4HVRA 3UKTA 4H14A 4YZ4A 3IPVB 2FMYA 2JICA 3BTAA 3KV6A 3UJOA 3UV9A 3ROUA 5JXHA 5E16A 2VMGA 1XE0A 1HB3A 4DXTA 1CAVB 1I6XA 2EALA 3SEEA 1AL0G 2CV6A 1LOFA 1NT0A 3M3EA 3OBAA 4AHWA 5JI7A 2IXJA 5JSOA 3U4XA 4GA9A 4NR1A 4QX0A 1OVPA 3VD4A 4O9GA 2A1XA 1AR93 1LOEA 4I0AA 3AP6A 1RXGA 2GAUA 3AXEA 2A6ZA 1VBC2 2A5ZA 2E26A 3CQOA 4CCDA 4AQTA 2CDOA 2Q8EA 2RDQA 5J98B 3H1YA 2RM21 1JHJA 4HSLA 1XNBA 4PF5A 3VB9A 1ND3A 2H0VA 2XMLA 4NOTA 4ATFA 1QF3A 2DDUA 2LS6A 5T5PA 3OBTA 3IWZA 4OLLA 4CDUC 3N3HA 2ET7A 2PA7A 4WV8A 3WDWA 1OXCA 1WD4A 2GNDA 2OS2A 5FWEA 3NRUA 3N35A 2WNUA 1HQLA 2ZGKA 3H9AA 4QB1A 3U10A 2AGSA 2R7EB 2XL7A 2WFF3 2ZABA 3AFKA 3EXUA 3A0KA 3ON7A 3AYCA 3AZYA 2X5IA 3GJBA 4LKSA 5FXVA 2RS32 5EJZB 2HYXA 1ZRCA 1BVVA 1COV3 1S0IA 4K7JA 4RR3A 3APBA 1H1MA 1L3JA 2NYYA 3MW2A 1OFNA 5DDJ2 5DZFA 1AXYA 4CYDA 4Z8BA 1LHOA 2VNOA 3IT8A 4QPIA 1WCSA 4TLGA 1VBE2 2B9VA 3B01A 4AGRA 2J1VA 4LT5A 4NIDA 4UBHA 2QQWA 4NHMA 2WFF1 1IS3A 1KJRA 1BEV2 4XF3A 5LBEA 2WN3A 4RQPC 3T3YA 1G86A 1GYKA 4Q8KA 1PIV3 5K4LA 1JUHA 3MIDA 1COV1 3IM0A 3MV11 4UW3A 1B35A 4CDWB 1RUNA 4FPKA 2BBAA 4TWTA 1GZWA 3QH6A 4YGBA 1OLMA 2EXKA 3G7DA 3TB0A 4CCLA 2F4LA 4IUGA 3CJIB 1US3A 5FZ8A 5A7OA 4AVAA 5JLVA 4IGOA 3FFQA 4KWUA 1UXZA 2XL9A 5C3OA 3K4ZA 4UFMA 4LO8A 3VBFA 1W8NA 1PIV1 3U07A 2Y6JA 1DGRN 2VU9A 4JGYC 2WYFA 2ZAAA 2BW8A 2PHXA 1LHVA 3Q8BA 5JUVA 4JKMA 5JCTA 4ZZ5A 3LEKA 2L9LA 4Y5Z0 3MPPG 3M4FA 3SITA 3NAPA 3BKZA 2JEMA 2MEV2 4LLFA 2QVSB 1U12A 2Y33A 2GNBA 1W8HA 2GN3A 1NA1A 5FO9B 5CFDA 1DGWX 4QPGA 1DZTA 2A70A 2VQAA 4E4SA 1PMIA 2A6WA 1VMFA 3LZZA 4QHZA 4B3NA 4CEYB 1RUC3 4D94A 2ZGUA 4DZGA 3WLUA 2IFRA 2WYSA 1UOJA 3MLJA 1NXD1 3BU7A 4NMIA 3ZXLA 4CPBD 1OI6A 5I0DA 4JCKA 5BNNC 1ZZ8A 2ZEZA 1BMV2 3TOJA 3KQ4B 3WF4A 4Q4V2 1GQPA 1UY4A 4LBQD 3B02A 5J09A 5LK5A 1QHDA 2I2SA 3ZFEC 1UOFA 3GDBA 3AZWA 3M3OA 5I8TA 4BB3A 2VCBA 2DVGA 3ETPA 4C0HA 2ZGSA 3JB4C 2WC2A 2VZTA 1PX4A 2R30A 3N9MA 2W91A 3VBHC 4JGZC 2W94A 2X8KA 1F4HA 4JAAA 5FPVA 1JYNA 2CHHA 3U1XA 1UZWA 4GKXA 4I09A 2BPA2 3KCCA 2KD7A 1QJX3 1MS3A 2GP3A 2W46A 4HMZA 4YW3A 2A3WA 3RWKX 4CEWA 4FFGA 5FO8B 3NV2A 3LDBA 3POBA 1YQ6A 4AFDA 4AI3A 1R1ZA 1YIPA 3P5BA 3ZKYA 1UU4A 1AR71 3ILNA 4EV0A 5HI0A 4IV3A 3FX3A 4TXWA 4N53A 3I49A 5FREA 3LFMA 2IXHA 3ZN6B 1HRV3 2BWCA 3N7JA 4PBOA 4ES8A 1PNGA 3M1HA 2ZA9A 4XDQA 1QJX1 4IETA 4CDXB 3PNAA 5JWPA 1IQAA 5JR7B 1YFUA 1RUH3 2WAAA 4W6XA 3OD0A 4D7TA 2A6VA 5KXBA 1H2NA 2BFUS 5IFTA 1LHNA 2DURA 3E1F1 4META 4FOVA 2DUPA 5GJ6A 3AZVA 5F37A 4W65A 4LKDA 3S5AA 4CCJA 5DUVA 2RR11 4YM2A 2WS93 3T0BA 3GZEA 3MLLA 1UZZA 3LCPA 4QKDA 5AC93 4R8HA 2YU2A 5FK7A 1XQNA 2IWGB 4GULA 3ZLIA 3B93A 4B8EA 1O8SA 1RUH1 1VALA 4QX3A 3JQXA 3VD5A 1PNFA 3VBUA 3KMHA 2EXJA 5CB7A 2ZKNA 4I3GA 4BYYA 1YHFA 1NLQA 3S7IA 2ZMNA 1OURA 4GIQA 2A71A 1VRBA 3O1RA 1O3SA 4FTBA 2HYKA 3L9JT 1WMFA 4LIVA 4AEKA 5AC91 1N1VA 4LHLA 4N90A 5CYYA 4YW2A 1AXZA 4LOTA 2RS51 2YMZA 4AZZA 3LA7A 5F5CA 2OVUA 1W6PA 5JVVA 2WFF2 1W9YA 2A3YA 3P3PA 1LESA 2WWSA 2GALA 5CNAA 4LBLA 3D82A 4JV4A 2VOKA 3KM5A 3KVBA 1COV2 5A33B 1WW6A 5LA9A 4BQXA 4Q0VA 2GC3A 1PMHX 1CZTA 1ODMA 2ZGMA 2AR6A 5JOZA 3I2HA 3VD9A 3VV1A 1PZ9A 1LHUA 1XB9A 4HN0A 4BQ4A 2X53S 3ZVXA 4XZUG 5GLUA 1L7QA 4HETA 4B29A 4J25A 1C8M1 1GANA 5E88A 1H1AA 4DEQA 4AGGA 1DLLA 3LOIA 1PIV2 3ZXEA 2WFPA 4I3PA 1KEXA 1VP6A 5FYVA 2WUHA 1W8WA 2WLQA 4CUBA 3P3NA 4AI2A 1H8TA 4XDOA 3ZDSA 5JOYA 1DQ0A 2VTXJ 3FZ3A 1LU2A 3OUIA 2EICA 1UAIA 2QFEA 5FY8A 4LUKA 4W50A 4XMAA 1GP4A 1D4M3 2RG4A 1UX7A 3W21A 2VR4A 5F6KA 4CU7A 2K2SA 1ZZ6A 2RHPA 2QDRA 4XBQA 5EPAA 5JIUA 2Q8DA 3DYPA 2DBIA 1BJQA 5C4WB 4K1ZA 2ZOEB 3JQWA 4BWOA 1HV1A 2OYZA 4E2SA 1E5IA 4LIUA 2PQSA 1UCXA 2QQIA 2WABA 4A6OA 1Q3EA 1XNDA 2DBNA 1SQ4A 3O1MA 2WN2A 3KHBA 3M3CA 4R4XA 4K6BA 1SHWB 2BWAA 1G9AA 5ABJB 2W08A 4F83A 3MW4A 2ID4A 4PI0A 3IMNA 1RC6A 5IK4A 4XJAA 4AQSA 1BYHA 4GH4C 4C1XA 5BY5A 5JI9A 1EUTA 1XC6A 3GBGA 2ZGRA 5FOBB 3RMXA 1LOAA 5FZOB 3USSA 4H2AA 3NJZA 5DAPA 3VL8A 1JYXA 3Q8AA 2XHKA 1NE4A 3MFCA 5JIAA 1QJEA 3N36A 2VZ1A 2IC1A 3ES1A 2VQ0A 1SBDA 5T3NA 3UT0A 1QJX2 2E7QA 2WZR3 1J3RA 2VXRA 2JG9A 2K46A 4FFHA 4FFIA 4Q26A 4KWLA 2VBBA 4UAPA 1UYPA 3HPNA 2BVBA 1QEXA 1ODNA 1IS4A 2HWE3 3PMSA 4MADA 4FT8A 3PHMA 1QQP3 3V0BB 1HXS1 4UI9L 4Y4RA 1SCSA 1NCQB 4CZSA 2WZR1 3ZFFA 1V9U3 2ZX1A 3AKSA 5GLVA 1ULOA 1RUH2 3FJSA 1SCRA 1XNTA 2XUMA 4RR3B 5EQUA 5FMOS 3D0SA 1VB4A 3Q8CA 4XC9A 3QCWA 5LW9A 4QPIB 3GCWA 3WR0A 3HQRA 2HWE1 1OT5A 4UT5A 5FUNA 1CQ9A 1RITA 5D8AA 3AX4A 4XILA 4Q5OA 4XFCA 5AVAA 3DPRA 5K7PA 5DAWA 5C8WA 3M2MA 2DTYA 3PIGA 4Y1UA 1IQDC 1VBA3 1QQP1 2W9XA 4A44A 4BQ2A 2O8QA 5AC92 1PO13 2RS52 3KGZA 1B35B 5HV0A 4PF1A 2Q4SA 5BYNA 2HWF3 1ND2A 3T2OA 1GZWB 2C24A 2EIBA 2JB4A 4Q1RA 3J7NA 5IATA 4IL7A 5IVJA 5J7MA 4QAWA 3WDXA 3WZ1A 4AVBA 5IUQA 3K75B 1ND3C 1VBA1 2JECA 2HWB1 3C7EA 4LO7A 4NIGA 1RJ8A 2ZX0A 4DMIA 5JOXA 4QXBA 4XIKA 1AUYA 4OZOA 5A6XA 4XABA 4F8AA 4L11A 1W2OA 4CCEA 1W03A 1C8M2 4UFKA 2WNUC 4QDSA 4YSFA 3LDRA 1BK1A 4YZ2A 1Q8QA 5FLHA 5F32A 1DP0A 3ZYGA 2B42B 3MYXA 1SLCA 5FTTC 3N7LA 2OIIA 4MZUA 1R083 4UWDA 5FYIA 4D6RA 4KU7A 1HX6A 4LK7A 1JODA 2RJLA 3B5LB 2WAOA 1TE1B 4G9SB 3MPBA 4IEYA 1S4CA 1GP5A 2ZKLA 5JZGB 2RDNA 4P9LA 4A41A 2W0XA 3T09A 3AMHA 5K0UC 3V64A 3AFGA 3PTYA 1XOYA 3RWNA 3A21A 4K3UA 1QOSA 1R081 1O91A 3K46A 4LOSA 2DUQA 4QXHA 1V6KA 1CAVA 2WO1A 1ST8A 2QZ3A 2C5DA 3IDCB 1QNWA 4A7KA 2PHWA 1V0AA 4XEZA 4R9DA 5FY1A 1BBT3 4BXFA 4ZKTB 3DYMA 3PJQA 4GWJA 2V73A 2DVDA 2YPDA 4Q4X3 1YCIA 1O8PA 1OBNA 2VMIA 2XQRA 5DG2A 2HBUA 4MXVA 1LULA 1KS5A 3CMGA 2YU1A 1UZVA 3PVNA 2TBVA 3J8F1 3WUCA 5FP4A 2HLEA 1TNFA 4LORA 1PVC1 4NAOA 2JKBA 2OA2A 4BIOA 1BBT1 4AVVA 4OUMA 1ZBE3 3BI3A 3I2DA 4HSJA 4QT6A 2GMPA 3I3EA 4FXGB 4XDPA 5FZ4A 3MIGA 4IV3B 1S0FA 4RN5A 4DS0A 3HT2A 2VY0A 1PGL1 1YC61 2WQ4A 1NA1C 4QX7A 5C9AB 2YROA 1UYXA 5IT6A 4EROA 3GM8A 4CP2A 4BMEA 1C8NA 3ZKUA 1ENRA 3QOPA 5HPOA 4AG4A 2R32A 1HW5A 3RZJA 3GNEA 2DCJA 1QDOA 1UIJA 1UW8A 1PZ8A 1QXPA 4QHBA 4XF4A 2ZGPA 3LWCA 2CYFA 2GDFA 1IPJA 4K8FA 4NHLA 1X8EA 5BXXA 3SC7X 4LKEA 3RGBA 1S0GA 2VZSA 5A6YA 3MZHA 4BK5A 1NXMA 2JE8A 2EAKA 1F5FA 5HCAA 5HXVA 5FP8A 3AJYA 4RHV1 2VNRA 4YNIA 4A3ZA 4ZU7A 2E32A 2XH6A 2PLV1 1OH4A 2Y8KA 1GOFA 1AZDA 1US2A 4FCAA 2LTNA 3CL1A 3J7MA 4CDWA 1AX0A 3AKTA 4ZY9A 1K3IA 1HXS2 4BH9A 4XFBA 4E2GA 4JQTA 4D6QA 2WZR2 1W2NA 1W04A 3ELNA 2ENRA 3MUY1 3GXUA 5LATA 4YW7A 4C0BA 4JDNA 1DYOA 2BV4A 3WD5A 4CEWC 1RYYA 2D6KA 2HWE2 4ZHNA 4UW4A 5D2AA 1PM7A 1EPZA 1W6PB 3TN93 4D8MA 1QQP2 4RGKA 3FHAA 4NHKA 4OVEA 2ZAHA 2D7FA 4OCTA 1O3QA 2X10A 1S0EA 4EE2A 1TZOA 3O1UA 4DY3A 2D6PA 4YLZA 3RJRA 1OKOA 4M3CB 1G6NA 1HJFA 3WQ1A 3CHXA 2AEZA 3TN91 1WA4A 4P9WA 1RUI3 4MH0E 1VBA2 3RPQA 5A3TA 3RYKA 5C8CA 1TVGA 2HWB2 4CCNA 2VZ3A 2Z42A 1DDLA 2PHFA 4KGGA 4NRMA 2WO3A 2IUWA 1OA4A 4NPLA 3T08A 3VKOA 3QACA 1I5PA 5LY2A 1GWMA 3KB5A 1GOHA 1C5HA 1H8TB 5FXWA 1QKQA 3OCPA 1RUI1 2VZRA 4O61A 3OPWA 2C1FA 3OGRA 4FOQA 3KGLA 1H1IA 1CD3G 4COYA 4KI5M 1R64A 4HK8A 1RUG1 1JXNA 3ZYIB 4CDQC 1NQJA 2WWJA 5C3RA 2ZACA 1FT9A 1LGBA 3MO4A 1HDKA 3B94A 3NJVA 3OD4A 1S2BA 3JBG1 2AYHA 1CPMA 1DZRA 3EYPA 1FNZA 1W8UA 3LKJA 3MFAA 3MI8A 1S2EA 2A73B 1R082 1LB2A 5DUXA 1P8JA 3BYWA 2R1DA 3MGUA 3PJYA 1V70A 1QOOA 2VCMA 3K3OA 4IV1C 4EQVA 1NQDA 3LSDA 4FFFA 5LRRA 3MIBA 1NCRA 3ZN6A 2QQPA 4UW5A 3G6JB 3KF3A 5B2GB 1JYTA 3VBSB 2HH9A 2Q0AA 5DQ0A 4L97A 5DDJ3 1TG7A 1SLLA 4CP9B 4CTEA 1VMHA 1AL21 3AP4A 3J8F2 4XHXA 3UL2A 2BDRA 1UOBA 2OQ6A 1JU3A 3VBOB 1NUKA 1GWLA 5BNPA 4TYSA 2SBAA 2YPJA 3JD71 1RL3A 4MXWA 4Y1XA 4CVUA 4C8DA 4X8PA 1BBT2 1FOD1 2FCTA 2YGLA 3I3QA 3OJBA 3VBRB 4AEDC 4PT6A 4DXSA 1ZRDA 2XJQA 4A4AA 3RZKA 5CG9A 4XHBA 3C7HA 4XJ9A 2K9ZA 1EAH3 1PGL2 5T5OA 2FBEA 3RI9A 1JTZX 1WA6X 2XWBB 3RYRA 3LEGA 1PMJX 5F39A 1OLME 3S57A 4LQRA 1AR63 1KD7A 1XYPA 5T5JA 1ZREA 3C7FA 1WLCA 3AXDA 3KVAA 4HXCA 4UFJA 3O1OA 1V6MA 1ZBE2 3KT7A 4RFT0 3PUAA 4Y24A 4FP3A 1MS8A 3KWVA 3PTRB 1EAH1 4OZXA 4ARXA 4V2VA 1IKPA 2P6CA 3VDDA 1MS5A 3BN6A 3H42B 5DZGA 5KHHA 1ZA7A 3ZFFB 2G4IA 2OZ6A 4RHV2 5GZFA 1AR61 3M70A 4AHXA 3NJXA 4NRPA 5FYSA 3T4HB 2R041 1A8DA 2UY9A 1PGSA 5A33A 4O65A 1VRH3 3T2PA 3ZR6A 3VDBA 1ULGA 1ASJ1 1QJFA 1ZNPA 5FBJA 3U11A 3UGHA 3RI8A 4BU2A 5D8AB 3F95A 5LA1A 2XVKA 5JPMB 3BVCA 1GMMA 3RRDA 2TEPA 1CAXA 4GKYA 3K4DA 3J26N 4QKNA 3LPFA 4IEOA 1OD3A 4LBNA 1KDMA 4RS5B 2BFUL 2K0GA 2RV9A 1V00A 4GJZA 5T54A 2DF7A 3ZYFA 1VRH1 3LFIA 4OUEA 2GNTA 3QLQA 4NHYA 1K5MB 4Q4V3 3RQ0A 1WWYA 1EY2A 4SBVA 1UMIA 4NO4A 3WNKA 5FWJA 2PHLA 3ZDVA 4YVWC 2D5FA 2IFWA 1ZBA3 4UBGA 3HAGA 5E8AA 4N43A 2AEYA 3THCA 1W9TA 4LMFA 3CZJA 5GZCA 4XURA 4BQ3A 2A75A 3BTXA 1W28A 3TN92 5FZ9A 3UKVA 3ASIA 1KFUL 2JDHA 3CNAA 2E7TA 1W9FA 1UNBA 2V5YA 3EB7A 4G4FA 4BQ1A 1VIWB 1ZBA1 3BPSA 4K9SA 4AQ6A 3RZHA 1YWKA 2VC9A 4LBQB 4NAMA 2EIGA 2YHJA 1CONA 1SACA 2VZPA 5BV6A 4L8QA 1JI6A 4N8MA 1M06G 3WEZA 1RUI2 2UYAA 1G9CA 4KBBA 3Q8FA 4W4ZA 4NHXA 3FLRA 1W9SA 2R063 5FZCA 4C90A 4TLFA 4XUOA 4WM7A 5FMDA 3IZOA 1RUG2 2P3IA 4FP2A 4NWWA 5ABJA 3IDEA 3M3IA 1TME3 4YZ3A 5C3SA 2NP0A 2Y0IA 2RM23 3JBG2 1WGPA 3AVRA 5FP7A 2BGCA 1ULPA 3EJKA 4Y26A 3I3MA 3TBDA 3HQXA 1OFSA 5FZ7A 1JZ8A 1JBCA 2WSVA 5A3OA 3WXPA 2JIGA 4MGQA 3WP4A 1NZCA 2ZEXA 1REFA 5KWRA 2R061 1J3PA 1UQXA 2LW8A 4P5YA 5FZOA 3TRSB 4XQWA 5A1LA 4PQ9A 3T2TA 4NUBA 2LALA 5GZGA 3BCWA 1TME1 5DAVA 4IQPA 3U75A 3ZN5A 1X8MA 1Z0HA 2P1BA 1W8TA 3AZZA 3X29B 2JDMA 3L2YA 3WP3A 3GHMA 1MVQA 2Y38A 4XJUA 2IZWA 4DINB 1KRIA 1IS5A 1RB8G 1AL22 3VZMA 5L7OA 1EYBA 1H30A 4URAA 2AZ5A 2FQPA 3JD72 2W5FA 3O12A 1LJ7A 1FOD2 1IGOA 3UNPA 1YQ5A 2X29A 1LNSA 3V0BA 4UFHA 2JE7A 3PUHA 4LITA 1NCQA 1OUXA 4FSJA 3IAQA 3P6BA 1EPWA 1O4YA 5IK8A 3H8UA 4Z2AA 4XFFA 1LKNA 5T5LA 5FLJA 4AR2A 5HCFA 4QGLA 5FBZA 1RMU1 1CAWB 1O6UA 3ZN4A 4ISQA 3FL7A 4JGYB 4S2GA 2R1BA 2KA3A 3EHKA 2ZGQA 5FZIA 1E5RA 3ZFGC 1EAH2 3IMMA 4GWIA 2VPVA 4ITCA 2EF6A 1SZBA 2WA4A 2UWCA 4YM1A 5LBCA 3E6CC 2HWD3 3UYJA 4BOWA 1AR62 1NYWA 3WINE 1AR81 4DRRA 2R042 5F2WA 1BK0A 1WLWA 3VHRA 4FAHA 4LA2A 5JMCA 1OF4A 4XUQA 1ASJ2 3AJZA 3OBRA 4PBPA 1YJLA 1UY0A 3RFRA 5C3QA 2DFCA 5FZ3A 3VN4A 4QB2A 3KZ4C 3ZPYA 3CF6E 3NKGA 1X82A 2GMEA 4FPLA 2HWD1 3T0AA 5GKAC 4AEMA 4WVZA 5C7GA 1KS4A 4DEVA 2ZZJA 3KQRA 3ZXJA 1F5JA 4GMP3 2CTVA 4NPMA 1Q8PA 1VRH2 1UZYA 3KD4A 3CKHA 3OPZA 4Z82A 4FPYA 4C1WA 4KGQA 3C8XA 4XBNA 4LNVA 3A23A 3ZOIA 4CP1A 1UD1A 5BNPC 4FPHA 1O5UA 4YW1A 3VKLA 1LTEA 3A4UA 3WG2A 4QMAA 5C8CB 4QM8A 5FMOL 5JZGA 3JZVA 1ZM1A 2JD4A 4JZRA 3ZSMA 1YFXA 3BPZA 1BZWA 4GMP1 4IE0A 1PHMA 4AVCA 5CG8A 2BVVA 2V4VA 4KH9A 3WW1A 2RMU3 1Q43A 3POGA 3WF3A 4PDWA 1AHSA 2P3YA 2LROA 4CDWC 4QQHA 1ZBA2 4HG6B 4QKFA 1OLRA 3PIJA 5FZMA 1GZTA 1XYNA 2EAAA 3LA2A 4LO4B 3CJIC 4I0WB 4K20A 4YFZA 1F4AA 5I0RA 1AR73 2FCUA 3H8RA 1X36A 2G1MA 4XJZA 2RMU1 4HT1T 3NNMA 2WLPA 5A32B 3SCGA 4FPEA 1SMVA 1UYYA 4IEXA 4A3XA 1G8WA 1U0AA 1H2MA 1YEWA 4IGPA 4E8CA 1FX5A 3U78A 2OT7A 4LK6A 4COVA 1E5SA 2D93A 2YUEA 4HKOA 3K4AA 4IEVA 1AX1A 1OC1A 3VLBB 4AW7A 5C9AA 3D4KA 1SBFA 4UFIA 1NCRB 2W39A 2RR13 3R6SA 3O7OA 3KV9A 4L99A 2R062 1QGLA 3BGAA 2OPKA 5KHJA 1WKYA 1ZZBA 3AL6A 1G7YA 5E89A 3ZXDA 4CEYC 1TME2 3N4MA 2RM22 3FWEA 4PIZA 4FBFA 2DFBA 5BNOA 4WZFA 5BNPB 2OUJA 4PLOA 4A7ZA 1S0DA 2B39A 4MXWB 5ACA1 2P2KA 5FPZA 1ZZ9A 2JENA 1H2KA 5F8PA 1WW7A 2JG8A 3I3BA 1JUIA 2BYVE 3CJXA 3VZNA 2MNGA 3HIFA 4HVQA 2RS53 4CUGA 3HWJA 1RINA 2WR9A 2CU5A 3WF2A 4XJ8A 3NQHA 3WDUA 2I74A 1XBFA 1MQTB 2NM1A 1D2SA 2EXHA 3NSTA 2JDYA 3I59A 3A0NA 3ME2A 4ZS2A 2HKXA 5EJ1B 5DUUA 1FATA 5J37A 1KFXL 1RIRA 2Q30A 3POSA 1FMD1 4Q0QA 5KHIA 1EP0A 2JB8A 3O0WA 4I01A 4E27A 2ZX2A 1ZZCA 3PU8A 4P9IA 4XXAA 1RMU2 2GMMA 2HJIA 4Q0SA 5FLIA 3USUB 5FOJB 2FD8A 3VDDB 2E63A 1RUOA 3HEIA 1C8M3 2XKPA 4LPLA 1FYUA 3FC0A 5KR7A 1CJPA 1PK6A 2VNGA 2FZ1A 3FN9A 3N9OA 1CIWA 1AXKA 1MZFA 5L73A 4OYUA 3ZSLA 4LUMA 1VB2A 1HV0A 2V09A 2YBPA 4CDXC 4M3CA 5JSPA 3MIHA 3SQOA 4NRQA 5F5AA 1IOAA 2P4EA 1N1TA 2XQXA 1X7NA 1CAXB 1AR82 4LBJA 3DXTA 1ZX5A 4N9IA 4Y20A 4CCMA 3WHUA 3NMBA 4XQDA 4Z07A 5L9VA 1PM4A 5HBAA 5F5IA 3SNMA 2WBKA 3ACLA 3VDCA 1SFNA 5GLWA 5HXMA 5FMBA 2D5HA 5IWFA 2HWD2 1ZVFA 3WW4A 3JCIA 3OGGA 5J96B 2XHNA 1LRHA 1TEIA 4N43B 3E5UA 2D3SA 3JB8A 2W1QA 4XACA 4IGQA 2VMDA 4IEUA 2PAKA 3T1LA 3LPGA 5FYZA 2ZGNA 2ET1A 4JHZA 1F8VA 1WMDA 4ASMB 2YZ4A 3HN1A 1GUIA 3C3VA 4QDQA 2Z69A 3IN9A 2B5HA 1RGSA 4CCOA 1W06A 4B4QA 1QNYA 2DV9A 1YYNA 4AWDA 5B4XA 1QIQA 5GZEA 1DBNA 1UKRA 4YYOA 3TWIA 1UY1A 1XU1A 3ZYPA 1EUUA 1ONAA 2BBVA 3I97A 3HN3A 4K40A 2EVXA 1NLSA 2QE3A 2DCTA 2RE9A 2RJKA 1QJZA 3FUOA 5C70A 3OG2A 4JHTA 4E9KA 5A3WA 4WM7B 2D3PA 4NE9A 1IG0A 4CSWA 5IVVA 4EWEA 4NVPA 5H9SA 4EN8B 4FTSA 1OOPA 1F9KA 5FZ1A 4AXOA 2RMU2 2VJXA 3VBSA 2QQVA 2E31A 4WM8C 4NIIA 4CP9A 2WA3A 4LO6B 4PIXA 2HEYF 3T30A 3WG4A 5F6LB 2RDRA 4A2UA 3VBOA 4MYEA 2IVIB 3U14A 3O0VA 2BNNA 2H6BA 2CL2A 2ZBJA 5FZBA 3VBRA 1Q8SA 2OX0A 3ST7A 3RS6A 4A7YA 4DRVA 5B4NA 3T0DA 1AR72 2B9UA 4GB31 3RMYA 4BQYA 5GM0A 4P9GA 2GN7A 1GOGA 3KV4A 2Y6HA 1LEDA 2XJVA 1K12A 2XR4A 3T2QA 1HXS3 2XVLA 4QD2A 3OGJA 1OSGA 3DV8A 3NL1A 1MEC3 4FPCA 2RJ2A 4KMQA 2IXCA 2H6CA 5FXXA 2YDEA 1LENA 4PLMA 5L7OB 1JOBA 2WT1A 3HNBM 4KBZA 3WSOA 4DFSA 2E7AA 5ACA2 5C4WC 5F7UA 5LY1A 3WX5A 5A3PA 5FZDA 1C28A 4YVSA 4P00B 1GR3A 1K5JA 1V6JA 2RR12 1H9WA 1S55A 4MG2A 4FOYA 3WF1A 5IW0A 2DU0A 5FCCA 5GALA 1MEC1 3UJQA 2O14A 2B46X 5ABJC 2YC2A 2VVFA 4QU2A 2VL4A 1KGYA 2A6XA 5FY0A 1JYCA 1GQGA 1LOFC 3LEMA 2NMOA 4MVTA 2HWB3 2VOTA 4RS5A 3ZXFA 4EZHA 5LEKA 3KHCA 1S2KA 5CFCA 3VHNA 4BA6A 3FUQA 4XXPA 5KBFA 2WZEA 1W2AX 2YV8A 2YXSA 1R093 2BNMA 5JXJA 1UO9A 1WW4A 3Q9OA 1UYZA 3J9SA 1JYVA 1K5MA 2QQMA 2ZGTA 2VULA 4SLIA 4OULA 5A1AA 2ZHLA 3T1MA 4JDMA 2JKXA 3K3NA 4CXYA 3O1SA 3SXWA 5K0UB 4Y1VA 4YG3A 3H1WA 2D98A 1FAYA 1ULDA 2CAUA 5CADA 3HBZA 3VKFC 4XW3A 2Q1FA 3PDQA 3AKQA 1R091 2KR2A 4XUPA 4Y33A 2WINB 4FXKB 2WDBA 5M0TA 2VCAA 2VD7A 4DPNA 2PQQA 3DKWA 4DNYA 4QX2A 4CPBA 2FDIA 3R4SA 3OY8B 4QKBA 4XAEA 2X5IC 3VHPA 3DECA 5T50A 1NCQC 3NWKA 2ILMA 4LBQA 3SHRA 1GP6A 5FMCA 2AC1A 3UESA 1S0JA 2WJSA 5GLZA 4RR3C 3I54A 3WNMA 5IVFA 4OMCA 4Y1YA 1UU6A 2G9GA 4R9CA 5LWBA 4QPIC 3HBKA 3WDVA 4LTAA 4YW5A 4XVHA 4AAXA 2QDNA 4D69A 1HB2A 4DOUA 4N9HA 2YB7A 5APAA 4NROA 4PDWB 2LRPA 2E51A 3J8F3 1B35C 1LGCA 3MBWA 3V0AB 1DHKB 1W99A 4LA3A 1UMHA 1PVC3 3I2GA 5A80A 3WQ0A 1SPPB 1VBD1 2IXLA 5FYCA 2O8OA 4BQWA 2A3XA 4RD7A 2NQYA 1DQ6A 4CP0A 1RVF3 4X6QB 1ENSA 2DU1A 1QDCA 1NZIA 2YC0A 2FDJA 3AMPA 4HLTA 5DAQA 3VBFC 2R071 2DUOA 2A6YA 5CAZA 2XDVA 4CU6A 2JDZA 1FPN1 1HRI3 1MS1A 3AC0A 2J1RA 1Q5OA 2AENA 3BTZA 4PI2A 5E1RA 5JPNB 1OQEA 5ERLA 1OA3A 2P17A 3KS7A 3E6DA 4S2DA 2J22A 5F1RA 3CEWA 3NAPC 3OBZA 1OHFA 1RVF1 4IESA 3WP6A 3GZUC 4RQPA 4KQ7A 2P34A 2WQ8A 1JN2P 5D1IA 2JE9A 1SLTA 1MR5A 2XLAA 4QPGC 3N9LA 4CRQA 5CFDC 1HRI1 4Q1PA 1H4GA 3LEIA 4RHV3 5JZGC 1YQCA 2PLV3 1JH5A 4B4RA 2C4XA 1C1FA 3CIHA
chains in the Genus database with same CATH topology
2PAMA 2ZMLA 1ZRFA 2D44A 2VW2A 2UU8A 2GSYA 5FQ0A 1AJOA 1SEFA 2DVFA 1CAWA 2JG8B 4ZXKA 4YGDA 2ZJCA 4JGYA 5I8SA 3ZXGA 3VHOA 1C4RA 4AGVA 2VW0A 1OQ1A 3FFZA 3NO8A 1N1YA 1V6NA 4GWNA 3I59B 4L92A 3NV4A 1LHWA 1MEC2 1SLIA 2R6QA 5J48A 1JOJA 3SH3A 3GHNA 4R4ZA 4MV2A 4R9BA 2YY1A 1ULCA 3D6EA 4AFMA 4YARA 4HBNA 4S2HA 1PK6B 4IV3C 4JQRA 5EV7A 4N53C 5FO7B 1XE8A 4XIOA 1F2NA 2OW4A 1C5IA 2WIIB 1KITA 2EXIA 1HIXA 3FBYA 4C91A 4Y20B 3QH7A 4LBMA 4Y22A 1POV3 4KWJA 4JGZA 4COUA 1UN1A 4EJRA 1KXGA 1QJY3 1A78A 4PCRA 3MF9A 1NE6A 2D43A 1RUG3 3NKTA 4HVOA 3B9IA 1R092 2VGDA 1X33A 5JOWA 2GZWA 4ES9A 3JBG3 3V65A 1IHMA 2HWC1 3VBUC 3H3ZA 3SLIA 1POV1 4FVVA 3WHTA 1Y7BA 1J59A 5J3UA 1QJY1 5F9TA 5CIRA 4Q0UA 3BODA 2D6LX 3OF1A 4RSUA 1URXA 5DG1A 1RJ7A 2XJPA 3ZIWA 2CWSA 4AFBA 5A32A 4DXZA 3AYDA 1DFQA 1VAKA 5K9YA 5I0TA 4PLNA 1NOVA 3PVBB 4AEDB 1KDKA 1O7FA 1GZ9A 5H9PA 4JVAA 1TNRA 1AL23 1QWRA 5I8YA 3LGRA 3ECQA 3JUUA 3JD73 1FOD3 1Z7S1 3WG3A 2GH8A 1DQ2A 3IKWA 1OOPB 4EWDA 3DGTA 3BOWA 2R072 3BALA 1I3HA 5KXCA 2WNVB 3RJ2X 1FPN2 1GQHA 2BQPA 4MSVA 1PVC2 3ENRA 3R4DB 2B8MA 5A3MA 1REDA 1H8TC 3MF6A 4MGIE 2W52A 1RVF2 2AUYA 2GC2A 3H1MA 1YUDA 3MDPA 3KT1A 2PHDA 5IK5A 1ULEA 4XE9A 1HRI2 5LRSA 4DQAA 1MQTA 4NN0A 1U5ZA 4ZU5A 4HK9A 1QJU1 2R043 4IERA 3VZOA 2Z79A 1ASJ3 4YG0A 3HMYA 1LEMA 2Z2SB 3USUA 4YVSB 2D97A 1VR3A 1N3QA 3VZKA 4V1PA 3S7EA 5CVRA 2PLV2 4YVWB 1PVXA 4J6GA 3AYAA 4COZA 1ZRRA 2R16A 1W6NB 3VBSC 2H0BA 4L9BA 4U2AA 1WCDJ 5EJ3A 2BNOA 5CFCB 2NZ9A 1DQ4A 4QGNA 4QQLA 4Y1ZA 3H7JA 1LODA 2QKDA 2QJVA 3SCFA 3BB6A 2PHTA 1O3TA 3NV3A 4HN1A 4IEPA 1JYIA 2UURA 2JG9C 4LHNA 5FPXA 2BUKA 1ZYBA 1SLAA 4YRDA 4IXLA 2DVBA 2DTWA 2ERFA 4RGGA 3B69A 4F7ZA 5K8SA 1C3HA 2VMHA 4GH4A 5I91A 4HFSA 4K1YA 4X6RB 2XJSA 3ZFFC 3N7MA 3KSCA 1SDWA 1V6LA 4WBBA 3ZSEA 2JJ6A 4U36A 5D8AC 3AMMA 2O0OA 2D6NA 1UPIA 5AFBA 2A7AA 3DPRC 1QJY2 1BVP1 4ONUA 3ZMOA 4CDUB 4KNCA 4XF9A 5CBLA 1ND2C 1UPSA 3O14A 4H7LA 2Q1MA 2XBO3 3EQEA 1K5MC 5GZDA 2F4PA 2N7GA 3LSEA 3W59A 1I9RA 1UKGA 3WCSA 4HKLA 1CJDA 1Z7S2 1T6GC 5FDBA 1I5ZA 1M4WA 1GSLA 4M0NA 4OHXA 2XBO1 4OHVA 4X8NA 1AVBA 2W68A 3LA3A 4FAGA 4FPFA 4UXAA 1AX2A 3ZFGB 4RQPB 2ZHNA 3NV1A 5LEJA 1RMU3 4G3YC 4FOWA 1SLBA 4L2NA 1MS4A 1BQPA 4LULA 1APNA 1N3PA 4MGKE 1XU2A 3E6BA 4M3CE 1BXHA 5FQ0B 4LEJA 4XBLA 2QUOA 4XZPA 1QJU2 1AR91 1AR83 3HT1A 2HEWF 1TMF3 1DQ1A 5KC5A 4Q2FA 3VL9A 1X50A 4P9YA 1OKQA 1A8MA 1UU5A 3E5QA 2WT0A 1NG0A 2XLFA 1AYN3 4ATEA 2CNAA 4I02A 4I0BA 1DZQA 3OTFA 5KHGA 3AKRA 1TMF1 2WQZC 2VOVA 3DF0A 2PFWA 1N47A 1CN1A 4GMP0 1FNYA 2NPIA 3ALQA 3H0OA 4IEZA 4B7EA 5K0UA 4O9EA 1H9PA 2FHRA 4PIYA 2Q1ZB 5BNNB 2Y26A 1AYN1 4QX5A 2XWJB 1DG6A 1OQDA 2GU9A 1YI7A 1OMIA 4XF0A 1FV3A 3ES4A 1YFWA 3OY8A 3AM2A 4M01A 3ZFEB 2Q8OA 1PZ7A 2F6BA 2NMNA 3VZJA 4Y22B 3RYPA 1J1TA 4OI2A 3RG0A 3EBRA 2UY8A 3VBHB 3IBMA 4JGZB 4E4ZA 1R1A3 4NWVA 2VG9A 1WUVA 3GALA 4NPRA 4D3WA 4AEJA 5EZWA 2GC1A 3HD8B 4LE3A 4E2QA 1MZEA 2D6MA 1H8VA 2ZTNA 1H0BA 3V0AA 1R1A1 5KXDA 3VKNA 2EA7A 5C6CA 4WVMA 1KQRA 4KU8A 4JC1A 1ENQA 1O4ZA 2E9QA 3V56A 2D6OX 2CAVA 4J1WA 1MS0A 2BTVC 2ZGOA 3MICA 1DGLA 4AF9A 1Q8OA 2FMDA 4JTNA 3KT4A 3AYEA 2LM3A 3SCHA 4ASLA 3WUDA 2DCKA 3OYWB 4YG6A 4AFCA 5ACA3 1RUC1 2ZX4A 3R4UA 5EXOA 4OHYA 4P14A 3ZXAC 4AHZA 1W6OA 5C8CC 5JSRA 1QY4A 4Q8LA 4RGAA 1N1SA 1Z78A 5L19A 2OZJA 3H50A 1QH7A 4LHKA 4AK3A 3E5XA 2XLGA 4EN6B 3ZXKA 2XBO2 1FV2A 2ZX3A 4XFIA 3AK0A 4FPJA 1ZZ7A 2VVDA 1FMD3 3AKPA 3O0XA 1FXZA 1DGRA 1V6OA 4JRLA 1BCXA 2DWRA 4UW6A 4OHZA 4XF1A 1OPOA 3D8CA 1H2LA 1XNCA 3CU7A 3WY6A 4BM8A 4FTEA 2XPJA 2ATFA 4MGZE 4BIFA 1UX6A 3KLSA 5I0SA 1WLTA 3QBQA 4M3CF 3ZSKA 1WBFA 1AR92 4AVTA 1HRV1 3K51A 4LBKA 1YI9A 3EO6A 1NCRC 4Q29A 5H9QA 2DCZA 2P3KA 4P9XA 1MZ5A 3ZO0B 4FQZA 3PMEA 1DGWA 2QCSB 2P3JA 1TMF2 1IS6A 1O4TA 1ULFA 2WS91 3POWA 4XTMA 2AH2A 5TSWA 4AI1A 4CDQA 5BNPC 3H7YA 2UWBA 3M8LA 2C0ZA 1GNZA 1AYN2 3AP9A 3H3UA 3I7DA 1XNKA 1AJKA 1J3QA 4EN0A 3SMHA 1VAMA 3TNQA 1MQTC 2VH9A 5BNQA 4IV1A 1DQ5A 5EWSA 1W6QA 1G9DA 1GKBA 4Z92B 4B7KA 3ZYRA 4KL1A 4JTOA 2HEVF 3AZXA 3ZX7A 5L36A 3UKNA 4WM8B 4GH4B 3VDDC 4URTA 3FLTA 1G9FA 2GC0A 1GFF2 4OUSA 4MGYE 2G9FA 2PELA 2ZGLA 4LE4A 4ZU4A 4AEDA 1G9BA 2FZ2A 3S30A 1RUJ3 5T55A 1CAUA 2Z5WA 4OI4A 1XE7A 1R1A2 2WSUA 4QQPA 4GXLA 1EV13 2ZHMA 5C33A 4GB33 1BKZA 2XGXA 4Q4Y3 1XXNA 3U0ZA 4YZ1A 4FPGA 1D2QA 2WNVA 2CWMA 1RUJ1 4W6WA 2KM2A 3L2HA 4EWAA 3LOBA 1EV11 2R0HA 3SH5A 3E97A 1RUD3 3DL3A 1D4M1 2VUJA 3PVOA 4YZ5A 4N43C 2Y0OA 5SV5A 2WT2A 3GBWA 1RUC2 3FBMA 1WBLA 4Q4Y1 3RZZA 3WCRA 3WP5A 3WDYA 4H7MA 3FHIB 2R0FA 2WZPP 4HPKA 1DYPA 2XJTA 4Y4YA 1LGNA 1VJ2A 1QU0A 4QQ2A 2ETEA 1IZ3A 3KCYA 4AYUA 1CR7A 1RUD1 2MHFA 1VAVA 5SV8A 3WQ7A 4IEQA 1D0GA 3WNXA 2ZMKA 2NN8A 4P5HA 4BPZA 4GWMA 3THPA 2WKKA 3IDBB 1RTVA 4YVWA 1ALYA 1ND3B 4HZFA 4S2FA 5DZEA 4WM7C 4QXKA 3S0MA 4WVWA 1ZA4A 2IXIA 3AP7A 4GQ7A 3K48A 1CPNA 1W6NA 1C1LA 4FQ4A 4XFAA 1RHI3 4WVVA 1GBGA 1J58A 1YJKA 2MPFA 2WNUB 1FMD2 5F5QA 2CGOA 2ZZQA 5A3LA 5FFOC 4AFAA 1YNAA 4YM3A 1QXRA 4I30A 2X5IB 1HRV2 4OI1A 2JXAA 4YM0A 1RUE3 4J1XA 5GLTA 1WLDA 3AB0A 1RHI1 1W6MA 2VECA 3MLKA 1U5XA 1VBB3 3D5OA 4M0HA 4AQ2A 5KXEA 1SBEA 2WS92 5L7OC 1RUE1 2KXLA 1V9U1 4K21A 3IIAA 3GBFA 3ZIXA 3I8TA 3RNSA 1VBB1 4R52A 4M00A 2GH2A 4EN9B 1W0OA 4AHYA 1GLHA 3VBFB 1PO11 1W0PA 1VBD3 1A3KA 2P37A 2VOXA 3THTA 4LO5B 5KHKA 2HWF1 2PN5A 3AMQA 3W9AA 4XMIA 2ARXA 2R073 4BLIA 5LK7B 1FPN3 4CDUA 2DYCA 3NAPB 1AF9A 1UL9A 3ETQA 2I45A 2VOWA 1NA1B 1U5IA 5CFDB 1W2UA 1NY71 4QPGB 2JX9A 5AFEA 4WVMB 3WV6A 1JW6A 1YXWA 1GZCA 1PO23 1YIFA 4N7UA 3WT3A 5KC6A 1PGW1 2C9AA 1GICA 1A6CA 4H55A 2CY6A 4Z1VA 3IPVA 1HQNA 3B9CA 5I0UA 1LOBA 3SISA 3INAA 1OD5A 3LB9A 4JDOA 1RUJ2 3NVCA 1PO21 3ZFGA 2ES3A 2Q5TA 1OLQA 2RS13 3I4IA 4MX3A 4BZ4A 1EV12 3B7MA 4F3JA 4Z2WA 1D4M2 4GB32 4Q27A 1W6OB 4GALA 3S6PA 4Q4Y2 5IK7A 1CESA 1MS9A 4HL0A 4CEWB 2QZ2A 1UF2C 2TNFA 1DF0A 4QQOA 3CLPA 1S1AA 4AI8A 4PDWC 2DCYA 2UYBA 2RS11 5CA6A 1YFYA 4Q4X1 1RUD2 2VUAA 4N53B 5AVPA 2SLIA 2QNKA 5JDBA 5J36A 1REEA 2PHUA 1MACA 1ZBE1 4D7SA 4HANA 1W39A 4Q4W3 1S0CA 4EN7B 3PLQA 3FLPA 4YGEA 2XB6C 4N7IA 2B7YA 1SFYA 5BNNA 3B00A 2WL1A 3ILRA 4XYXA 1IPKA 1ENXA 5C9AC 1POV0 3QD6A 3VBUB 4JRAA 3KCXA 3ZFEA 3N7KA 4ISRA 5BPXA 4OI0A 4QM9A 4Q4W1 3GF6A 4TZDA 3CJIA 2HWC3 2D40A 5BNOC 4CDQB 1RHI2 2ZPXA 1GV9A 3VBHA 3JU9A 4Q0PA 5BUVA 3RDIA 1Q56A 3MW3A 4INDA 1AYM3 2PTMA 2JG8C 4OFGA 4LLOA 1S0BA 2VVEA 2XJRA 3POYA 1RUE2 2ZS6B 3ATGA 1V9U2 2PAEA 1E57A 4TSVA 1Y43B 2E53A 2PHRA 1CX4A 4IV1B 3B3QE 2XKOA 1W6QB 1RUF3 1VBB2 1FI2A 1AYM1 2TUNA 1LCLA 4CEYA 1YRZA 1PO12 3DN7A 4DY5A 2CGPA 3O5SA 1Z7S3 4BLJA 4E4DX 2D3RA 3GZAA 1UMZA 2I07B 1D4VB 1C57A 3PVEA 2IXKA 2HWF2 4R9AA 1QH6A 1PK6C 2B45X 2ZHKA 1RUF1 1VLNA 1WD3A 2O1QA 1Y3TA 3SH4A 3M7AA 1J1LA 1CAUB 3R05A 3OYWA 1HLCA 2LUWA 4XQ4A 3R0RA 1VBD2 2VW1A 4BE3A 1NY72 3TNPB 4WZCA 4FPOB 1VBC3 5HCBA 1B09A 4QPYA 3VUOA 1PGW2 1U5YA 1GNHA 2XVGA 4XTPA 4LR4A 1DIWA 3BOPA 4YW4A 1HKDA 1QJU3 1QMJA 3TYJA 2PYTA 3WW2A 1VBC1 4BMBA 5DUWA 1DYKA 1PO22 1Y9QA 1LOGA 4PJYA 3VGIA 2RS33 3UK9A 4CDXA 3WOGA 4HPKB 1O3RA 4KG8A 1WW5A 2E6VA 3NW4A 1IKQA 1MVEA 1WMEA 3HR9A 4XFHA 2R49A 4W6YA 1D0HA 1OA2A 1KJLA 1VBE3 1YO8A 1YLLA 2BEOA 3RSJA 4YGCA 1Q8VA 1DU3D 3DUIA 4OHWA 1BEV3 2RS12 1H4HA 2YGMA 3WVJA 2RS31 4Q4X2 4AE2A 4COWA 3AP5A 1LECA 5DDJ1 1O5LA 4IEWA 2JG9B 1VBE1 2ARBA 1OOPC 4XOGA 3ILFA 2ZCWA 4KG0A 4MUVA 5EFUA 3URFA 1UIKA 1QOTA 3MIEA 2WNVC 1BEV1 4XPVA 4KWKA 1OPMA 1I1EA 3VBOC 1N3OA 1LU1A 2DVAA 4RL7A 3VBRC 3VKMA 2CGNA 3CO2A 4FO9A 5DXDA 1NLRA 3ZMNA 2WNEA 3WG1A 2UWAA 1CVNA 1TQ5A 2MEV3 3VZLA 1W6MB 1XYOA 3D0JA 3WDTA 1LR5A 4XFGA 3ZSJA 4Q4W2 5JAXA 3DPRB 5EYXA 5T52A 2XG3A 3MIFA 3M3QA 1WCKA 4WM8A 3FMGA 4YVSC 2MEV1 1ND2B 1HQWA 4ORFA 4B4PA 3AMNA 1MZ6A 2NLRA 4HKWA 4XETA 4D7YA 2HWC2 4YFWA 5JOZA 4QGMA 3GZTB 3LAGA 5EYYA 4H3WA 3TAYA 4AVSA 1LOCA 3BIWE 3GYDA 4MLOA 4BHPA 5H9RA 4BCUA 3MEPA 2AREA 3C2UA 1AYM2