4AGGA

Structure of a tetrameric galectin from cinachyrella sp. (ball sponge)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
144
structure length
144
Chain Sequence
PIQSIKVDPMKSGGLGVVYRSPDKGRVSLYLYNDGEDILLVVDARFDWRGEQNVLVLNSKFAGGEWGPEVRPEGFPFPCCGYVTTITVRVEIGADGFTLSANGIEIVKYPYRDGLPPPVTKFQYVFQDQGASETAQLESLSAYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALECTIN
publication title Structure of a Tetrameric Galectin from Cinachyrella Sp. (Ball Sponge).
pubmed doi rcsb
molecule tags Carbohydrate-binding protein
total genus 23
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4aggA00
1J1TA 2AUYA 2OUHA 1G9DA 5DZGA 4AGRA 3POYA 3RMYA 1VLNA 1SLTA 2WT2A 3NWKA 3O0VA 1FYUA 2ES3A 4K1YA 1SBFA 1OKQA 5FREA 4PBOA 1S0BA 3HN1A 3N7KA 4YM1A 1BQPA 1GANA 2HYKA 3SISA 2EIGA 2V5YA 1WD4A 3LSDA 2GNMA 4YZ1A 1NLSA 2GMEA 3WDXA 1LHOA 3M3QA 3RSJA 2GALA 5DZFA 2E7TA 3OY8B 1JYIA 2VW2A 1JXNA 4M01A 3VKOA 1C1LA 5JDBA 2DVAA 1V6NA 4YW4A 1AJOA 1I3HA 2PELA 2WT1A 4AGVA 4DQAA 2EXIA 5DUWA 1R1ZA 4Z8BA 2DURA 2RHPA 1DHKB 3ZPYA 1DZQA 4XHXA 5F9TA 3R4SA 1H9WA 1ULFA 3OY8A 3W58A 4FPEA 1AF9A 5T54A 4Q1PA 1SACA 1AXKA 2YMZA 2YZ4A 1DYKA 2D3PA 3WCSA 3AP6A 4YZ2A 2VW0A 4FPJA 5JVVA 2NP0A 1F5FA 2ZA9A 3ASIA 3A4UA 2EF6A 3M3EA 1X50A 2FHRA 2ZACA 1FX5A 4XIOA 3WDYA 1N1YA 1DYPA 1MZ5A 1SLCA 1QNYA 1UN1A 2ZHKA 5T5JA 5AVAA 4YGBA 4AVSA 1CPMA 1GZCA 4XTPA 2P3JA 2PHXA 4Y22B 4Q2FA 4XJWA 2A6YA 1H30A 4FVVA 1SLBA 1V6JA 1Y7BA 5EXOA 2CY6A 1FATA 1G9BA 4FPCA 3WOGA 2DVFA 3O0XA 2VY0A 5L73A 1DQ5A 1JOJA 1F9KA 3SITA 4Y22A 1SFYA 5DG2A 2SLIA 4BLJA 1MS3A 1GSLA 1W0PA 2PHWA 4BPZA 2DVDA 1KRIA 4UW3A 3I8TA 1ENQA 1A3KA 3FUQA 1JUIA 4HL0A 3BOPA 3C2UA 2P2KA 2ZMKA 2D3SA 4Y26A 3RG0A 3W59A 4YLZA 2ZZJA 4XJ8A 4YFZA 4ZKTB 4M00A 2GNBA 3WDWA 4Q27A 3VKLA 3OGGA 3WDUA 4GXLA 2W08A 4ZXKA 4M3CB 1DFQA 1S0EA 3WUDA 1LOAA 5T55A 2ZGKA 1MVQA 1MS0A 2V73A 4FOWA 3LCPA 3IPVB 1C1FA 1NXD1 1OQ1A 1G86A 3AP9A 4FOVA 1WW7A 4XTMA 3D4KA 5FRAA 2C9AA 2E51A 2E6VA 5IK5A 1MS1A 3TAYA 2YROA 1DQ4A 4P9WA 2ZMNA 4JRAA 2NZ9A 4LBLA 3RS6A 3IPVA 2VXRA 1UL9A 1JYCA 1GNZA 2D6KA 2DU0A 1O4ZA 4BQ1A 1V6IA 4R9CA 3PJQA 1S0JA 5JOZA 5JOXA 1IKQA 1V6LA 2NYYA 5H9QA 3Q9OA 1GYKA 1U0AA 4Y1VA 4BMBA 5EYYA 1LESA 1CQ9A 1CONA 2ZGRA 3A0KA 4Q1RA 5HCBA 1PZ9A 4LBQB 5GZEA 3V0BB 1Z0HA 2NN8A 3VKMA 2A3YA 3KM5A 5H9RA 1QDOA 2D6MA 4R9AA 2GDFA 2D7FA 3RRDA 1V6OA 2ZHNA 3FLPA 4F83A 4AVVA 1MACA 2JE7A 2UURA 4YZ4A 1N3PA 4Q8LA 5DG1A 5GZGA 1JBCA 1C57A 3ZYRA 1XQNA 4WZFA 2CNAA 3V0BA 2W68A 4PBPA 3T2TA 4Q26A 5GALA 1QGLA 2OW4A 3AYEA 1CR7A 2W52A 4YZ3A 4YGDA 4Q8KA 1HKDA 1Q8SA 2AREA 1DBNA 2ZAAA 1W6OB 5KXEA 1BJQA 1EPWA 4YG6A 3HMYA 4YW3A 2H0BA 4ATEA 3SNMA 3ENRA 4FPKA 2D6PA 5HCFA 1ULCA 2DTYA 1DQ1A 2A75A 4MYEA 4NOTA 2D6OX 1QU0A 1AXYA 2B7YA 2ZGPA 1W6OA 2A5ZA 5JOWA 4RL7A 1WLCA 2A6ZA 3VKNA 4H55A 5SV8A 2Z42A 3JUUA 1GBGA 1IS6A 4GKXA 1HQLA 4FPGA 2CWMA 3AZZA 4DFSA 2JJ6A 3MEPA 3SH3A 4GWMA 1WW5A 1F31A 1LHVA 1N47A 2WSVA 1MS4A 4FOQA 2BQPA 4FQZA 1QMJA 2SBAA 4AYUA 4ISQA 4BOWA 4WVVA 4WVWA 1CIWA 1QKQA 3FUOA 4ATFA 1SLLA 2ENRA 3WHUA 4LBOA 1CPNA 1FV2A 3GALA 4L8QA 3WG3A 1SCSA 2ZGNA 1LENA 1N3OA 2YV8A 4FPLA 3WZ1A 2WLQA 3INAA 2ZABA 1G9FA 1YYNA 3AYAA 4XIKA 3HR9A 1W6PB 1LOFA 1QOOA 2R1DA 5IUQA 5KXCA 4GWNA 1IS3A 1LCLA 2WQZC 4YW1A 5IK8A 5DUUA 1JHNA 2ZGQA 1BKZA 1HLCA 1IS5A 5DUVA 3LSEA 4XJUA 1LOFC 4FP2A 1UAIA 1JN2P 1CJPA 1W6PA 5EYXA 1FNYA 4CZSA 3U4XA 4LBJA 4M3CF 5GLUA 1S0GA 1TEIA 5GZFA 1FNZA 1MS9A 4JC1A 4NO4A 5KXDA 4Y1ZA 1LOCA 4Y20B 1MVEA 4XBLA 1N3QA 1V6MA 2VW1A 4ASMB 2D6LX 1V00A 1LU1A 4Y1XA 1WLDA 1WCSA 3AJYA 4LBNA 2JDZA 1MS8A 1QNWA 3AZWA 5HCAA 1IOAA 1G8WA 1LEDA 1DQ0A 3AZXA 3IN9A 1RINA 1OFSA 4Y20A 2A6XA 3O0WA 1GZWB 3WCRA 1DQ6A 1SLAA 1CVNA 4XE9A 2DTWA 1MS5A 5GLZA 1Q8VA 3M2MA 4U2AA 4K21A 1BZWA 1I1EA 2OVUA 4XILA 4TYSA 2EXHA 3FLRA 2W39A 2WT0A 4FP3A 1S1AA 1GZWA 2Q5TA 1WD3A 2A7AA 2WJSA 4D69A 4I30A 5T5LA 4M3CA 2AYHA 2PHRA 5GLWA 3WG2A 4XOGA 2CTVA 2R0FA 3N3HA 1GICA 1KDKA 1UZZA 2E7QA 5CNAA 4FOYA 3AP5A 3ATGA 1Q8OA 3N7MA 1CESA 1UX6A 5T5OA 5CA6A 2A3WA 4XXPA 3NV2A 3RMXA 1W6MB 2JE9A 5LK5A 4XJZA 2YY1A 2LTNA 3CNAA 1GKBA 2NMOA 2ZHMA 3VKFC 3I4IA 3AXDA 1W6QB 2PHTA 3B01A 1N1SA 1ONAA 1ULEA 4P14A 2NMNA 4XBQA 2PHFA 4LBKA 1B09A 3RQ0A 1WLWA 3B3QE 1W6MA 5T5PA 4YM2A 3IM0A 1W0OA 5E8AA 3B69A 5T52A 4DPNA 1W6QA 1S0CA 3N7JA 3WLUA 1ZM1A 4FPOB 2D43A 1LGNA 2VH9A 3WV6A 2DWRA 4YW2A 4IQPA 1IKPA 5BYNA 4U36A 1G9CA 3VUOA 3L2YA 5H9PA 1N1VA 1Q8QA 4LBQA 1AX2A 3BODA 1GZ9A 4FQ4A 5JOYA 5DXDA 1HQWA 1WBFA 1AXZA 1LU2A 1MR5A 2D3RA 3B9CA 5IK7A 4LBQD 4KBBA 2D6NA 2EALA 3ZSKA 3AZYA 4XHBA 3OJBA 4PQ9A 2XG3A 1W6NB 3AP4A 1C4RA 2ZMLA 3ZXEA 1LJ7A 3FLTA 2XB6C 3KQRA 4C1XA 4DRVA 5CAZA 1ULDA 2ZHLA 2ZGSA 4UW6A 3FFZA 3POWA 3MW4A 5H9SA 2DYCA 4YZ5A 1W6NA 3ZXKA 2ZGLA 1O4YA 2R0HA 4P9YA 4Y1YA 3OYWB 2D44A 3PVEA 1QOTA 1URXA 5IK4A 2C5DA 4TZDA 1UMZA 1DLLA 1LULA 1WW4A 2R16A 1KJRA 1LEMA 5GM0A 1AZDA 3WNXA 4XXAA 4CTEA 2AH2A 5JMCA 3AFKA 3BIWE 1HDKA 2AR6A 2ZKNA 3M3CA 1BYHA 3FBYA 1DQ2A 3AXEA 1LHNA 1WW6A 3OYWA 4ISRA 3M3OA 4AWDA 3WG1A 4GALA 4XMAA 2PHUA 2NM1A 2A6WA 2YXSA 2JD4A 3AZVA 4XDQA 1ZA4A 1YRZA 2JKBA 5GZDA 3MPPG 5F5QA 3T1MA 1VAMA 3WUCA 1S0FA 2DU1A 1VAVA 3DGTA 1Q8PA 3PVOA 2A70A 4XJ9A 1AX0A 3ZXFA 1CN1A 2EAKA 3ZVXA 4BM8A 4JCKA 2ZGMA 3ZXLA 4BLIA 1FV3A 3WDVA 4XYXA 2GN7A 2CWSA 2FMDA 2KM2A 2GMPA 2UWBA 4LBMA 1LOBA 3UK9A 3NV1A 3V64A 3WDTA 4FPFA 1LGCA 4YGEA 3UJOA 1GV9A 5CBLA 1D0HA 3NV4A 3AP7A 1H9PA 2DVBA 3UJQA 1YI7A 1N1TA 3APBA 1ULGA 2DUPA 2ZGOA 1D2SA 4UW4A 4XZPA 2DUOA 1FAYA 3N35A 4PCRA 4BMEA 4CRQA 3ZSLA 1AVBA 3QCWA 2A71A 3PVNA 2VU9A 4WV8A 3WHTA 2WKKA 1VALA 2JECA 5DZEA 4GKYA 1KITA 3V0AB 5GZCA 2GNTA 3D5OA 1UZYA 1QDCA 2GMMA 3ZYPA 3GNEA 4YG0A 2UWCA 3R4UA 1G9AA 3SLIA 1GNHA 2DVGA 1AJKA 2A6VA 2ZBJA 1JW6A 4R9BA 1PZ7A 5GLTA 2ERFA 5DUXA 4SLIA 3N36A 1AX1A 3V0AA 2EXJA 4DRRA 4R9DA 3VV1A 4HANA 4PF5A 5E88A 1G7YA 3OBTA 3ZXJA 3AJZA 3R05A 2ZGUA 2LALA 3M1HA 1APNA 3ILNA 4YG3A 3ZSJA 3QLQA 5JLVA 1DIWA 4RA0A 4P9XA 1S0DA 2CYFA 4K1ZA 1KDMA 1Z78A 3B00A 4FPHA 2I2SA 3MW2A 3PMEA 1UPSA 3WVJA 3D6EA 1IS4A 3JU9A 3NV3A 1MZ6A 2EXKA 3O5SA 2WNEA 3AK0A 1A78A 4YM3A 1QOSA 4XMIA 1SBDA 1KQRA 3N7LA 3ILFA 4XBNA 1SCRA 3V65A 1LHWA 5T50A 4AGGA 2DUQA 4XJAA 1ENSA 2AGSA 3POSA 4DS0A 5KXBA 2A3XA 2P3KA 2GN3A 4YW5A 2AENA 5GJ6A 3WG4A 2ZGTA 4FPYA 4YFWA 3UL2A 1LHUA 1YO8A 5EWSA 1LODA 3AX4A 2UU8A 4C1WA 5IT6A 2ARBA 4Y1UA 2P37A 1KJLA 1LOGA 2P3IA 4ITCA 2VUAA 3USUB 2WSUA 1BXHA 2OUJA 2R49A 3SH5A 1SBEA 1ENRA 3IKWA 4YGCA 1SLIA 4GA9A 4M3CE 1YIFA 4Y24A 3A0NA 1YXWA 3ZSMA 1LECA 1VIWB 3SH4A 2UWAA 1WUVA 2GNDA 1LGBA 3USUA 1DGLA 2CL2A 1LTEA 1RITA 1S0IA 1Q56A 4UW5A 5CB7A 3O12A 4OZXA 3OBRA 1QF3A 3T1LA 2P34A 3ILRA 3TB0A 1GLHA 1PZ8A 2DV9A 3OPZA 3DUIA 2TEPA 2R1BA 1RIRA 4W65A 1WBLA 3BTAA 1A8DA 3AYCA 4YM0A 3MW3A 1UKGA 5GLVA 4AVTA 3H0OA 1LOEA 1V6KA 5E89A 4K20A 3IMNA 2G4IA 2E53A 2ARXA 3AYDA
chains in the Genus database with same CATH superfamily
1J1TA 1GP4A 3WW3A 5FZBA 4AGRA 4EZ4A 3POYA 1UCXA 3BVCA 4QDSA 4QX3A 3BUCA 3ZFFC 3O0VA 5FY1A 1S2KA 4XEZA 5FXVA 1DF0A 5EPAA 1YQ8A 1OKQA 4PBOA 2VMHA 3A7QA 5FZAA 1PVC1 1BQPA 4AEJA 5F37A 5A7OA 5FPVA 1TG7A 1NLSA 3ZKYA 3H7YA 1LHOA 4NJ4A 1ZZ6A 3RSJA 4BA6A 4AFBA 2VG9A 2MEV1 3OY8B 4S2FA 1JYIA 1RMU1 2DCKA 3HVDA 1JXNA 2X10A 3PUIA 3MBWA 5JDBA 5ISLA 2BDRA 3NAPB 1AJOA 3LZZA 4Z8BA 2LROA 3MFAA 5AC92 2PLV3 4XFBA 3KV9A 3RI8A 1W04A 1C28A 2VMCA 3W58A 4FPEA 3IDCB 2D5FA 1H6XA 3GJAA 2F17A 2RR11 4EN7B 3VB9A 4A44A 1O8SA 2YMZA 1DYKA 2JDYA 4UAPA 1CAXA 4BQ5A 1IHMA 4IV3A 3WF3A 2ZA9A 2ARAA 2QQKA 3MYXA 4HG6B 1W2AX 2XJRA 2EICA 3M3EA 4QQLA 2FHRA 3DXUA 4S2HA 2ZACA 4P08A 3VZJA 4EJRA 3VD3A 2WFF3 3WDYA 1Z7S2 3DEMA 1JZ3A 1QNYA 4LUMA 1FMD1 4YGBA 3ZYBA 4AVSA 2VD7A 4XTPA 1SG3A 1PIV2 1NCRA 4XJWA 3PUQA 1V6JA 4JGYC 2WO1A 4ET7A 1HQNA 1ASJ3 1FATA 1E5RA 1RUNA 1G9BA 4JGZC 2VY0A 5L73A 2PFWA 2WS92 2JDHA 3KT7A 3VHRA 3ZFEC 2Y38A 4Y22A 2UYBA 2FMYA 1W0PA 5C7GA 2OT7A 4UFMA 3CO2A 4UW3A 4CDUC 1JZ2A 4EROA 4LULA 3FUQA 1A3KA 4LO7A 3EJKA 3BOPA 4WZCA 4UFKA 4QMAA 5FY9A 4S2DA 4TLGA 4CPBD 1NXMA 1BK0A 3OBZA 4Q4Y2 5LA2A 4ZKTB 4M00A 2X05A 5C9AB 1UMIA 3OGGA 4LHLA 3K4AA 2X5IB 5FKBA 2ZEXA 3L2HA 2XJTA 2YC0A 4DEVA 2VMDA 3E5QA 1OLRA 1S0EA 1F35A 2VBBA 3HNMA 4EN0A 2ZGKA 4QQOA 1BEV2 1NXD1 4AEDC 3ZXDA 1Y9GA 1G86A 4FOVA 1ZZ9A 1WW7A 4V1PA 2DCJA 2C9AA 4PQQA 3VBSB 3S5AA 3WQ1A 5FMDA 4OCTA 3TAYA 3O1VA 4FSJA 3D0JA 1GOHA 5FZDA 5L9VA 2XR4A 2XXZA 3RZKA 1DQ4A 1QXPA 5I0DA 4JRAA 2NZ9A 1J59A 3RS6A 1JYCA 1DLCA 5FY4A 1OOPC 3KHCA 3OGVA 1QJY3 4LHNA 4RD7A 1JZ6A 1QH7A 4XABA 5CFDB 4KWUA 3KCCA 2WFF2 2DF7A 3FL7A 1WCUA 1S0JA 2G9FA 1NX9A 4M4PA 1OC1A 2NYYA 5H9QA 1GYKA 1B35A 1U0AA 3ZO0B 1LESA 4JHZA 1RUF3 1RVF2 2ZGRA 5FZHA 5FWJA 4O9GA 3LA7A 5TSWA 4A42A 1PZ9A 1OBNA 3VKMA 1ASJ2 3TRSB 5H9RA 2Q1ZB 1QDOA 3MUY1 4LA2A 4AFMA 3IMMA 4MGIE 1IGOA 1NQJA 2QZ3A 3ETPA 4IEWA 4RFRB 3DPRA 3FE5A 4WBBA 1N3PA 4Q8LA 1ZBA3 2P1BA 1COV3 2GP5A 1JU4A 4M0HA 4WZFA 4AEKA 3V0BA 3B94A 3CBNA 1ZREA 1MZFA 3PIJA 3OGJA 2LS6A 5B4XA 1HKDA 3UGFA 1SHWB 2R071 4CUAA 4DIQA 4EYUA 1BJQA 2YFZA 1Y3TA 4ATEA 2H0BA 4WVZA 2YFUA 3SNMA 5HV4A 1RUG3 2GU9A 2D6PA 1RUD3 1WMXA 2DTYA 4ZZ8A 5BNPC 2QZ2A 4WM8B 5A7SA 3O1TA 3TEXA 5LA9A 1W6OA 3LE0A 2GAUA 4QB2A 4XFIA 2A6ZA 3JXSA 5EHDA 5FPBA 5C71A 2Z42A 1GBGA 1HQLA 5FYSA 2HWE3 2ILMA 4DFSA 4MADA 3THPA 2OZJA 1DG6A 1R091 3MEPA 2E32A 4LA3A 5KXEA 2BQPA 4QU1A 2NQYA 2PAKA 2C6SA 1ODNA 4IESA 4AHZA 3MLKA 5FK8A 3T08A 1CIWA 5T3NA 1QJY2 1SLLA 4FFGA 2XQXA 4OZOA 1SCSA 4NWVA 2RE9A 1L7LA 4META 1TMF3 1N3OA 1V70A 2YV8A 4PLMA 1R081 3K4ZA 1C3HA 3INAA 1BVVA 3MDPA 1VRH3 4KG0A 3U14A 4URAA 3AYAA 1H6YA 3HR9A 3KGZA 4UWDA 3FHQA 5FY8A 1AR91 4DZGA 3NNLA 2AEYA 2XH6A 1VE0A 1V0AA 3FN9A 3KF3A 4D0QA 4ONUA 2WNUB 4CEYA 1IS5A 3M70A 5F2WA 1IPSA 1NG0A 2I07B 1BVP1 4ZHNA 1COV2 5EYXA 5JXIA 3AKRA 4RR3A 1FNYA 4CZSA 4NRPA 1EAH1 4AAPA 1P8JA 4DB5A 2ADEA 4LOSA 1TEIA 2C9KA 1WLTA 1FNZA 4FFHA 4JC1A 3VBHC 5FP4A 4D7YA 2BVVA 4KWKA 5KXDA 3ETQA 2QQPA 1LOCA 1MVEA 1J58A 2VOXA 1RUD2 2VW1A 1SPPA 3U11A 4E8CA 5FJKA 1MQTB 1LU1A 4UOJA 2OQ7A 1WCSA 4LBNA 5LATA 5L7OC 4XACA 5FZ6A 2XWBB 3JZVA 3SCGA 2V09A 4EWEA 4OYUA 1LEDA 1UXXX 2Y8KA 5C4WB 1H2NA 1UY0A 3LPFA 2A6XA 4CCEA 5C70A 2HWE2 2CGNA 4PIZA 1SLAA 3KMHA 4YW7A 3S30A 3CU7A 3O1OA 4U2AA 2GP3A 1I1EA 5J1XA 1BZWA 4XILA 2XVGA 4J1WA 1RUJ1 4P9JA 5FQ0B 4OI1A 1VP6A 3TBDA 2ID4A 4LLOA 5FPLA 1EUTA 1XXNA 5FO7B 3H42B 1F5JA 1RYYA 3H1WA 4XURA 3DV8A 2Q5TA 3O1UA 3WNOA 4GULA 3LOBA 1WMDA 2AYHA 1UU4A 4WM7B 4ASKA 2XBO3 4LIUA 1GICA 1X8MA 2E7QA 2GSYA 2Q0AA 4E2GA 5LEJA 4FOYA 1H8TC 1VRH2 3I3DA 5IVBA 4YRDA 4C0HA 4CU6A 2HWD3 1H1AA 1W6MB 2JE9A 1GFF2 4NE9A 4AVBA 5C3PA 2Y6KA 1GKBA 2YUEA 4CCMA 1LR5A 4OLLA 1J3RA 5AC91 1O4TA 5FLIA 3AXDA 3VGIA 1W6QB 2JDMA 1RXGA 4P14A 3BB6A 2X29A 3OF1A 2Y6FA 1B09A 3BYWA 3GGLA 1JHJA 1JI6A 1YI9A 2R30A 3OPTA 4PDWB 1WA6X 5T5PA 2VZPA 1RUI3 3EBRA 3D8CA 3I2HA 5E8AA 4DPNA 3M3IA 1A34A 3N7JA 1OFNA 1U5YA 1ZM1A 2QQMA 2ZXQA 4FPOB 3BN6A 1LGNA 2JX9A 2MNGA 3GZEA 4QPGA 1IKPA 4B29A 4L99A 1ZBE3 1Z7S1 3VUOA 5KHHA 1GZTA 4LHKA 3KLSA 5D21A 5F7UA 2W2IA 1GP5A 2D3RA 5E1RA 4LBQD 4XUQA 4NRMA 2EALA 5EJ1B 4QXCA 4XHBA 3WP3A 3W20A 4D8MA 1NYWA 5A7NA 3AP4A 1C4RA 2ZMLA 2JG8A 1LJ7A 2IUWA 4Q4V3 3VBUC 1PM4A 4C1XA 3KV6A 2WA4A 4BQ3A 1DGWA 1VAKA 4HOOA 4QQPA 2FDKA 3TEYA 3S7IA 5C3OA 4MH0E 2QDRA 3LFMA 5F32A 1VMHA 1W6NA 3ZXKA 3B9IA 2ZGLA 2P17A 4P9YA 3PVEA 2D44A 1CAUA 1QOTA 2FDIA 2C5DA 2BV4A 3LIGA 1DLLA 1LULA 5ACA3 2WWSA 1KJRA 1LEMA 4Q4Y1 1NY71 2XBO2 4NHKA 1VBE3 3VHNA 1ZRDA 1D2QA 2XUMA 5ANNA 2AR6A 1DGRA 1G6NA 3SQOA 3M3CA 1JZ4A 4QKFA 4W6YA 1WMEA 1RMU3 2HWD2 5E6HA 4Z2AA 4Q4X3 4CE8A 1T6GC 4E2SA 4KL1A 1NA1A 2PHUA 3NQHA 3TEWA 4XUTA 2QJVA 1ZA4A 1YRZA 2XVKA 1XBFA 3LEKA 1W9WA 1VAMA 3WUCA 4BB3A 1KS5A 2WWJA 1ZRIA 3KCXA 1Q8PA 5FXZA 1RUI2 4CCJA 4QXHA 4YVSA 5L36A 1PK6C 4CDWB 1Q43A 2EAKA 3ZVXA 1EYBA 4HKWA 4IW3A 2ZGMA 4LOTA 2QKDA 1LRHA 3SCFA 1AL0G 4XYXA 3WDVA 4BLIA 1VBC3 5HPOA 3RJRA 4J25A 2WFF1 1ZBE2 5FZKA 2AZ5A 3I59A 1EV13 1W2OA 1D0HA 2JICA 3KGLA 4N8MA 3MI8A 4KGQA 5CFCA 5C8CA 3LKJA 1YI7A 4UW4A 1KFXL 1RGSA 1ULGA 3APBA 5GLTA 1RVF1 3ACLA 3N35A 2JEMA 3ZYIB 4CRQA 3ZSLA 1AVBA 2VQUA 1FT9A 3PVNA 1OA4A 2VU9A 5FJHA 2WKKA 1QIQA 3H9AA 1ASJ1 3T09A 4Q4V2 2VCCA 4FI9A 2GNTA 5CKNA 1X82A 5GZCA 1RL3A 1UZYA 3ZYPA 3U4SA 2VOTA 2JE8A 4LMFA 1CGPA 1OT5A 2YU2A 2VNOA 1AJKA 5JR2A 1W8TA 1PMHX 5F39A 4P02B 1JW6A 4MGKE 2FD8A 4NRQA 3V0AA 3N4MA 1AX1A 2DDUA 3H8UA 2VC9A 1UY1A 3C8XA 4PIYA 3S6PA 2JIJA 4HPKA 3W5NA 3DL3A 4CP2A 2V4AA 1UOJA 1VBE2 4CYDA 3NJYA 4YG3A 3ZSJA 4AFAA 1I9RA 4IEQA 1VRBA 1E5IA 1OVPA 2CYFA 2BBAA 2VUCA 2CSGA 4Q4X2 5JAXA 2IWGB 3HT2A 1UPSA 3TN93 4MG2A 4QX0A 1IS4A 4AW7A 2BVBA 2VO5A 4Z2WA 4AQ2A 3VDDA 1MPXA 1XE0A 2YPDA 2VZ1A 5K9YA 4X6QB 3E6DA 5FYTA 1OXCA 5DN2A 4CVUA 5L19A 4IV1C 1ND3C 1VBD2 3BPZA 4D6QA 4M0NA 3ZM8A 3V65A 1QHDA 4RHV3 3UKNA 1NLQA 3URFA 1LHWA 5A7WB 2WNVB 4CSWA 5I8YA 3KF5A 4K40A 1ENSA 3WX5A 5FY5A 4QPIB 4Z1VA 3WXPA 2QDNA 4CU9A 1QJY1 1AR83 4YW5A 1RHI3 1MEC3 5ABJA 3CJIB 4FPYA 1EV12 3KS7A 3VBRA 1W99A 4LE3A 2XGXA 1CZVA 3GCWA 3VBFA 1X33A 5FBZA 1OVSA 2WBKA 1RUF1 1KJLA 2IXCA 3I7DA 2CU5A 2MHFA 3QACA 4ITCA 3KZ4C 1JH5A 1BXHA 1KXGA 1E57A 1REFA 4I3PA 5FR3A 1SBEA 5CZKA 3POJA 3ZN4A 2RV9A 2VZTA 4YGCA 5JI7A 4Y24A 3ZN6B 2WN2A 4GH4A 2W46A 3DPRB 5DPNA 4BE3A 1ZBA1 5IVYA 1UZVA 5BNOC 1WGPA 2CL2A 1COV1 1U5XA 4HN1A 4OZXA 4WVMA 3UESA 3FZ3A 3J26N 4E4ZA 2DV9A 2Z5WA 3DUIA 4XPVA 2TEPA 3S0MA 5JPNB 1Q3EA 1A8DA 4JX0A 2W9XA 2JWPA 5GLVA 3ZFFA 1UKGA 4X8PA 2QE3A 2QUOA 2RJ2A 1LOEA 1V6KA 4YVWC 1UYXA 1JS9A 1RUD1 3GZTB 4IDZA 4QM9A 2HJIA 2Y6JA 5A80A 1PM7A 1YUDA 2OUHA 1G9DA 3T2PA 1OUSA 1VLNA 3WF2A 1C5HA 4IEVA 3WF0A 1FYUA 3PDQA 3TN92 3Q8CA 3AKSA 1NZIA 2E63A 1S0BA 3N7KA 4YM1A 4UXAA 1FOD2 2HWE1 4DUWA 2QQVA 4LKEA 5FP7A 4AEMA 3LSDA 4UFIA 2GNMA 4H7MA 1CD3G 4RHV2 3WDXA 2F6BA 1PNGA 5BY5A 1YWKA 4M01A 4K8RB 1RHI2 1MEC2 1JZ7A 1V6NA 2ARCA 1QXRA 1Y4WA 2PELA 3LA3A 4L92A 4XFAA 1X7NA 1TMF1 4DQAA 5IHRA 2DURA 4RYDA 1X8EA 5C5UA 5I8TA 4OI2A 3C3VA 3E5XA 1VRH1 4Q0VA 4XHXA 2Y0IA 3DYMA 3R4SA 3VDCA 1ULFA 2R6QA 4JVAA 3THTA 3PMSA 2XWJB 3OGSA 4ZY9A 2VTXA 4YVSC 5D8AC 2YZ4A 1XYOA 5FZOA 2IVIB 3WCSA 4ZONA 5JXJA 3LA2A 3E97A 2JD9A 3GYDA 4XUPA 3DF0A 4OQ9A 2NP0A 1I6XA 3Q8AA 5DDJ3 3ASIA 3NAPC 2QQIA 4RR3B 3WW4A 4CEWC 1FX5A 3J7MA 4JGYA 4XIOA 5JXHA 1DYPA 4OHVA 3P3PA 5FV3A 1GZCA 5SV5A 3H8OA 4JGZA 3AKQA 3CKHA 2PN5A 3ZFEA 3FHAA 2IC1A 2WWUA 4JRLA 2CY6A 1REDA 2VBPA 4N53A 2K46A 4CDUA 2WABA 1D4M2 4HMZA 1Y43B 4FTSA 1F9KA 4GJYA 4AHXA 4CUGA 4BLJA 1MS3A 1GSLA 2IXKA 2WUHA 1KRIA 4N43C 5KBFA 4HT1T 4QX8A 4XFHA 5FZIA 3VZLA 2PTMA 4CDXB 1SMVA 2VTXJ 2D3SA 3OUIA 3RG0A 2WR9A 1M4WA 1UWWA 1F4AA 3TNPB 5FYHA 1EY2A 4YFZA 3WW1A 2GNBA 3ROUA 4Q27A 3MZHA 3VKLA 4AEDA 4XQWA 3ZXAC 4IEXA 2Y6HA 4XZUG 5FYIA 4NHLA 2V5DA 2XBO1 2YBSA 4JDOA 1MS0A 4FOWA 5A6ZA 3LCPA 3E5UA 4G4FA 4QB1A 1C1FA 4YPJA 4P9LA 5IATA 4HK8A 2HWD1 5J09A 3D4KA 3O14A 1PO22 5F3CA 3JCIA 1OOPA 2GC3A 4TSVA 4BCUA 4IEZA 4MOAA 5DABA 1OD5A 2WL1A 2JG9B 1O59A 3MV11 3OG2A 5M0TA 2QQOA 2ZMNA 4LBLA 4UFLA 2X09A 5FZFA 5C9AC 3IPVA 4F3JA 3FWEA 4N9IA 4LKFA 5DDJ2 1QJX2 1O4ZA 2PHLA 4R9CA 3PJQA 1RUI1 5IVJA 4IERA 5LBBA 3NNMA 3CJXA 2RDQA 4LITA 4S2GA 1IQAA 1UU6A 1IKQA 1V6LA 4OHWA 1GNYA 3WY6A 5FCCA 2AC1A 4BMBA 3KCYA 3RWNA 3VBSC 1CONA 5K4LA 3UETA 4LHSA 1ZBE1 4QQ2A 4OFGA 2Q4SA 3U75A 5LW9A 2OIIA 2A3YA 2JDAA 4Q4W3 4PF1A 5KWRA 2D6MA 2GDFA 1WA4A 1TE1B 5FTTC 2ZHNA 4HKOA 3RRDA 3V56A 4Y5SA 4L9BA 4F83A 5HXMA 4YZ4A 5CFDC 1PIV3 2W3JA 2BBVA 1JBCA 2DBNA 2BU9A 2IZWA 4Q4V1 1XQNA 2CNAA 2W68A 3T2TA 3ZR6A 2BFUS 1CR7A 2MPFA 4Z07A 4Q8KA 1Q8SA 2WS93 5BNPA 2AREA 5A32A 3CDZB 2B45X 4YWAA 5EV7A 3ENRA 5FZGA 3VLBB 2V4VA 5HCFA 1YFXA 3D0SA 1ULCA 3N9QA 4FFFA 1WWYA 2ZX4A 1DQ1A 5ACA1 5IVEA 4Y5Z0 2WO7A 1ZYBA 4MYEA 2HWC3 3MICA 1SQ4A 3MUZ1 1QU0A 3U07A 1VBE1 2AEZA 1H1IA 4PIXA 2ZGPA 5LBEA 2RM23 4W6WA 2RMU2 4MUVA 3VKNA 5A3OA 4Q4Y3 2GZWA 4ASLA 2H0VA 3AFGA 4ZU7A 4FT8A 1HRV2 2YB7A 4Q4X1 3WEZA 2LUWA 4A6SA 5D1IA 1CAVB 1NA1B 4DINB 1YHFA 3SH3A 2RG4A 1WW5A 4A7ZA 3BU0A 1N47A 2VOWA 1MS4A 3D82A 3WP4A 4CP9A 1QMJA 1BEV3 4IETA 5BNNB 2W0XA 4BOWA 1UW8A 2CGOA 2LM3A 2OPWA 4WVVA 4LK7A 3KV5A 3FC0A 4WM8C 3WHUA 1BMV2 1OUXA 2J1SA 2ZJCA 3P5BA 3F2ZA 2D5HA 3WZ1A 4FTBA 2PXJA 1UY2A 4KWLA 4QX5A 1VBC1 3DKQA 3PVBB 2Y0OA 4DEQA 4XIKA 4D7TA 1JYWA 3NKGA 1EV11 1QOOA 3CHXA 2W94A 2Y34A 2XDVA 4X6RB 4Q4W2 1GOGA 4YSFA 5CFCB 1IS3A 5JZGC 1SEFA 1ZA7A 3VN4A 5C33A 2PAMA 5DUVA 3OEAA 4XJUA 2Q1FA 1RVF3 2FDJA 1H2MA 3RVHA 3BTZA 4RFT0 1ZZ8A 1W6PA 1CJPA 2ETEA 4GJZA 3JQXA 1QXJA 4LKSA 3VBHA 2BGCA 2JENA 4MSVA 1TVGA 5GLUA 3VBOB 3JB4C 1S0GA 3TWIA 1BHGA 3ZMOA 5L7OA 2CDOA 2RDSA 1W03A 4N53C 4FFIA 1N3QA 4ASMB 2WNUC 1V00A 1UU5A 1X9TA 4Y1XA 4DUXA 3QD6A 2HWC2 3AJYA 3O1RA 4I0BA 3WD5A 1MS8A 5HCAA 4Q0SA 1IOAA 5FXXA 2RM22 4UI9L 5FYVA 3IN9A 4AAXA 1RINA 3KWVA 4ZXEA 1UYYA 1OFSA 5J3UA 4Y20A 2Z69A 1XNCA 4PT6A 4XAEA 3O0WA 3SMHA 2JKXA 1GOFA 4H2AA 5FLHA 3TN91 4XE9A 2DTWA 1MS5A 2BEOA 1Q8VA 5HCHA 4K21A 2OVUA 2EIDA 1RXFA 2EIEA 3ZX7A 3OPWA 3FBMA 5FZ0A 2WINB 2E26A 2EXHA 3FLRA 2QVSB 4MGQA 2UY8A 1MQTC 3RZGA 2WT0A 1H8TA 1JMUB 1CZSA 1GZWA 1S1AA 3BGAA 4RHV1 2A7AA 2WJSA 5FZ7A 3J8F2 1WCDJ 1W3VA 4I30A 4N9HA 5T5LA 4D69A 2CGPA 2PHRA 3LDBA 4N90A 1NLRA 3RZLA 4Y3OA 1UZZA 1AR81 3OSDA 3UKTA 1NCQB 1RHI1 1MEC1 1Q8OA 1UX6A 5FYBA 2A3WA 2YGLA 3SC7X 3QH6A 4GQ7A 5LK5A 5BNQA 1XNBA 2XLAA 4Q29A 2B5HA 4OHZA 1H2KA 4ARXA 5I0SA 1YCIA 1RB8G 1W8ZA 3VZOA 3B01A 1ONAA 1CAWB 4FXKB 4XBQA 2VNGA 4K3UA 1QWRA 4LBKA 5CKMA 4CCOA 2BGOA 3U10A 2VPVA 3IM0A 1W0OA 2CV6A 5JIUA 2VMFA 3B69A 5BUVA 3RZJA 3VL9A 1S0CA 4BH9A 3WLUA 2C4XA 2BWCA 3ZMNA 3WV6A 4MZUA 2VAUA 4YW2A 4U36A 3RI9A 1G9CA 2BYVE 4LBQA 4JHTA 5FK7A 1GZ9A 4FQ4A 5FYYA 3VBUA 1WBFA 5IK7A 1AXZA 3B93A 1IQDC 5C6CA 4W50A 3PU8A 4KBBA 5J48A 4LORA 2B8MA 2VECA 4PDWC 4QGLA 4RSUA 4KWJA 1PVXA 4V2WA 4FTEA 4PHZA 2G1MA 2BPA2 3GCXA 3LQCA 1D4M1 4A45A 1XNDA 2Y6GA 3IAQA 1RJ8A 3MHZA 1UIKA 3POWA 5FP9A 5H9SA 1TNFA 3BU7A 4YNIA 1REEA 5FUPA 2P3YA 1HB1A 2PMWB 2WA3A 2VZVA 5IYYA 1URXA 4AI1A 5IK4A 1XNAA 4O9EA 4TZDA 1UMZA 4NAMA 3A23A 1TME3 2ORZA 5A3UA 2R16A 5GM0A 4Q0QA 2BNMA 1W9FA 5FMOS 3AXEA 1UD1A 1LHNA 1AYM2 3NKTA 3VHOA 4MXWA 4CP0A 5CKQA 3PIGA 1NOVA 3OYWA 1R1A2 5AVPA 3ZOIA 5IFPA 2OZ6A 3T0AA 3EYPA 3W21A 1K5MC 4QM8A 2YXSA 4HVRA 5JR7B 4XDQA 1PK6A 4RQPC 2JKBA 3PUAA 4LJHA 4SBVA 5APAA 1K12A 4RGKA 5GZDA 1PNFA 3TYJA 4W6XA 4C90A 3T0DA 4NIGA 2DU1A 4RS5B 3K77A 3A21A 4XJ9A 1GQPA 1UF2C 4BHPA 4J1XA 4E4DX 3ORJA 4JCKA 5FYZA 4AHYA 4BM8A 4LPLA 5DDJ1 2KM2A 2FMDA 2UWBA 4L11A 2DFCA 2GMPA 3UK9A 3POGA 3V64A 3WDTA 4FPFA 1LGCA 2H6BA 3K51A 4OQ8A 3WNMA 1C8M3 5K0UB 1GV9A 3WP5A 1W8WA 5CBLA 4B4QA 5FLJA 2OKXA 2DVBA 3KD4A 1OQEA 4IE0A 4XZPA 2DUPA 2JB4A 3C7GA 4KBZA 3S7EA 4JGZB 1FAYA 5I8SA 1HN0A 2DCTA 4FBFA 4WV8A 2B9VA 2J1UA 2JECA 2ZCWA 5DZEA 4GKYA 1KITA 4CDWC 3O7OA 1PGL2 4HETA 4AZZA 1VMJA 3R4UA 1JODA 1GNHA 3GBWA 4DY5A 5LRSA 4KQ7A 2A6VA 2BGPA 2QQJA 2TBVA 2XKOA 3LGRA 4COYA 2VTFA 2WAOA 4CXWA 5A70A 2ERFA 2OYZA 1WMFA 2EXJA 2CAVA 4DRRA 3LPGA 3MIBA 4R9DA 5A6QA 3OBTA 1TME2 3AJZA 1DCSA 1YFUA 1APNA 3T2QA 3GXUA 2JXAA 3QLQA 2Q8DA 2XPJA 1S0DA 2W92A 3WNLA 1NAEA 1Z78A 4FAGA 3PMEA 3FX3A 2VUJA 4IV1A 1ND3A 3D6EA 1QEXA 3HIFA 1HB4A 4AQSA 1A78A 1QOSA 4KH9A 4B3NA 1PO12 1UNBA 1XE7A 1L7RA 3I2GA 4XMIA 2RS33 3R0RA 1KQRA 4BIFA 4XBNA 5FPZA 1M06G 2BOIA 1UYZA 4JKLA 1S4CA 3H3LA 4AGGA 4MGSA 4UYBA 2AGSA 2HWF3 4MGZE 2DBIA 1YFWA 2XJQA 2P3KA 2VCBA 2IFRA 1JYTA 4R8HA 1BMV1 5GJ6A 1H4HA 1GU3A 4LK6A 3DKWA 1O3SA 1C8M2 1LHUA 5A33A 1UOFA 3MPBA 3ACHA 1FPN3 1LOGA 2P3IA 4GWIA 4XF3A 4ZS2A 2HEYF 4P00B 2RJKA 4EN6B 2OUJA 2EA7A 2ADDA 5BNOA 3SH5A 4Q4W1 3EQEA 4M3CE 1YIFA 3FFQA 4EN8B 1W90A 4LO5B 3A0NA 4QPIC 1YXWA 4QPYA 3VD7A 3SH4A 3ZYJB 1PIV1 2GNDA 2VZ3A 3OCPA 4H14A 3USUA 5BV6A 1FI2A 1RITA 1S0IA 2NPIA 3VZNA 5BXXA 3T1LA 2OA2A 3AVRA 2ATFA 1DGRN 1O7FA 2W87A 3H3UA 1L3JA 1PZ8A 4QAWA 4YVWA 3ZSEA 4BJ0A 4D94A 1YQCA 4GZ9A 5CG9A 1WKYA 2BW8A 4QXKA 2WS91 2XHKA 5JCTA 3U0ZA 5BNPB 2UY9A 3MLLA 1W2TA 4ARYA 3KT1A 1SDWA 2E53A 3AYDA 3ZYFA 3ON7A 2XJPA 1RUH3 2AUYA 3FHIB 4IE5A 1GQGA 5DZGA 3RMYA 5FZ1A 2BP6A 3P1IA 2HWC1 2WT2A 5J98B 3P3NA 4UFJA 2ES3A 2RM21 4CDQA 4A7KA 3JD73 3KHBA 4DOUA 4GMP3 4COWA 1OA2A 1O8PA 1K3IA 2HYKA 3SISA 2EIGA 3LAGA 5FOBB 1GMMA 2V5YA 2RS32 4BZ4A 5F2SA 1WD4A 4UF0A 4YZ1A 1GWMA 2GMEA 3E6BA 3M3QA 5FWEA 4Z82A 1BEV1 2GALA 3RZHA 5FO9B 5J37A 2HWF2 3VL8A 3J7NA 2VOKA 3LF7A 4ZZ5A 2ZS6B 3BCWA 3VKOA 1C1LA 2DVAA 3UGGA 5I91A 4QKBA 4YW4A 1VBD3 1I3HA 1OA3A 4G3YC 4V2VA 5A3TA 2EXIA 2VMGA 2WIIB 1KFUL 2RHPA 5D8AA 1HN1A 3GZAA 1CAXB 4BQYA 3ZPYA 1DZQA 1FPN2 3MIDA 4IV3B 5B4NA 1H9WA 3OY8A 1KD7A 1K5JA 2EVXA 3JBG2 1AF9A 1XJAA 2VMIA 4Q1PA 2F4PA 1AYN3 1R64A 1SACA 2QCSB 3NAPA 1IPJA 5CEHA 3WSOA 3AP6A 4CEWA 4YZ2A 3AMQA 4FPJA 5JVVA 1NCRB 2EF6A 4AFCA 3VBHB 1X9PA 3WQ7A 3OUJA 4JQRA 4Y5TA 4NHYA 1MZ5A 2Q8OA 3F95A 1TQ5A 2FCVA 5FKCA 2RDRA 2PHXA 4OMDA 4Y22B 1V9U2 4Q2FA 4QPWA 4R4XA 4CCLA 5A3MA 5K8SA 5L7OB 3AM2A 2WLPA 3I49A 1NUKA 4FVVA 3J4UH 1Y7BA 1XNTA 5HXVA 3EHKA 1RUH2 4HSLA 2BUKA 2KA3A 5EXOA 5G05L 4FPCA 2DVFA 4IUGA 1BBT3 4N43A 1DQ5A 1JOJA 2HBTA 3WT3A 3JD72 1JU3A 2SLIA 3GZUC 2PHWA 4LLFA 1E5HA 1ENQA 4HSJA 2PYTA 4INDA 3C2UA 1SDDB 2Y26A 3W59A 4YLZA 2ZZJA 4XJ8A 5KHGA 3ACGA 1FOD3 4OI4A 2RS53 3WDUA 4GXLA 3AMMA 1QJU3 1DFQA 3H1MA 2VVDA 1LOAA 5T55A 2O0OA 1YNAA 4K6BA 5FZ8A 3EO6A 4MVTA 1AYM1 2MEV2 4M4RA 1W2UA 5C9AA 4R52A 4CDXC 2E51A 2E6VA 1AYN2 1UOBA 2WN3A 3VD5A 5IK5A 1MS1A 2O8QA 2EIBA 2W95A 3B7MA 3K48A 5F1RA 1B35B 2JDNA 5J36A 1UIJA 1ND2C 1UO9A 2DU0A 4BQ1A 1V6IA 4QX1A 3RDIA 3VBSA 4IE4A 1XPWA 4FXGB 2IXHA 4KMQA 3HQXA 2PHDA 4UBHA 5JOZA 5JOXA 1OPMA 4B4RA 2WO3A 5EP9A 3Q9OA 4Y1VA 5EYYA 1CQ9A 3A0KA 1S55A 3W9AA 3ZR5A 1YJLA 5F5CA 5HCBA 5CFDA 2ZTNA 1HB2A 4LBQB 4B7KA 3V0BB 2B4KA 2BFUL 3KM5A 1RC6A 3RGBA 4XVHA 4IEOA 3VBUB 4QHBA 1BBT2 2D7FA 3DCQA 5JSPA 1LAJA 1RUOA 5F3GA 1FMD2 2HLEA 1AUYA 3CMGA 4D7SA 2JE7A 3PTYA 3LB9A 1RUE3 1YQ2A 2RDNA 4K7JA 4N7IA 3RYKA 3ZYRA 3KV4A 1PGL1 1W2NA 2VZRA 4I09A 5GALA 2OW4A 4MO3M 1D4M3 2W52A 1JUHA 5A3LA 4AE2A 1W6OB 3ZFGC 4YG6A 3WNKA 2PAEA 1O5LA 2C26A 4FPKA 1W28A 2BRTA 2RS52 2A75A 1HB3A 3MF6A 1TME1 4CDQC 4AVCA 2A1XA 1QJU2 4QQHA 2D6OX 3GDBA 4MHUA 5JOWA 2A5ZA 1WLCA 4H55A 5SV8A 3HQRA 3JUUA 1A8MA 1OF4A 5KHIA 4C8DA 1H0BA 3IAPA 1IPKA 3AZZA 1DZRA 4A2UA 5LA1A 3ZYHA 4AI2A 2JJ6A 3P6BA 1OSGA 4WM8A 4GWMA 5FO8B 1LHVA 4DMIA 4YW6A 2WSVA 5A3NA 3WP6A 2GH8A 5A3WA 3RPQA 2ZOEB 4AI9A 2NLRA 4JTNA 1QKQA 1PO23 4LBOA 4OI0A 1CPNA 3WG3A 1O3TA 3UKVA 2K0GA 1LENA 2ZGNA 4FPLA 1JYNA 5JI9A 2YU1A 3H7JA 2XL7A 4CEYB 2ZABA 5JZGA 1YFYA 3AMNA 3WNPA 1G9FA 1ULOA 1YYNA 1QJX3 1UOGA 1UY3A 2VUDA 1C8M1 1CIYA 5LEKA 1UX7A 5IUQA 5CISA 4QU2A 2FZ1A 1DGWX 2Q8CA 2J1VA 5BNNC 2WQZC 3OEBA 1OLME 2ZGQA 4B1MA 3LSEA 4BQWA 1LOFC 4FAHA 2C1FA 4FP2A 1RUE2 4IEPA 3RYPA 1JN2P 4IGPA 1SPPB 2J22A 2YC4A 4LBJA 3RZMA 1XRUA 2VGDA 3LEIA 4ES8A 3N9PA 2Y64A 3PTRB 2WNUA 2WZR3 3S5QA 4KI5M 3VZMA 1MS9A 1YIPA 2XOMA 4L97A 4NO4A 4CUCA 1OI6A 4Y1ZA 2Q8EA 2JB8A 4XBLA 1V6MA 2ZPXA 1RJ7A 4A6OA 2XHNA 5FZMA 3X29B 4DNYA 3BKZA 2FDGA 2WYSA 5LWBA 2JDZA 2VNVA 1QNWA 3AZWA 3IWZA 2TUNA 1DQ0A 2ZX3A 3I2OA 4LEJA 2B9UA 2JDPA 4CUBA 5JXGA 3OD4A 5LY2A 3N9OA 3THDA 3VBOC 3WCRA 3O1PA 1DQ6A 2HYXA 3NSTA 1CVNA 1MQTA 4IV1B 3M2MA 3K75B 2Q1MA 2HWB3 4TYSA 2RMU3 4BWOA 3SHRA 5LB6A 5C4WA 5IVCA 2RS31 1UKRA 1HRV3 5IVVA 2BERA 4FP3A 2ZX2A 3FMGA 1JYVA 3S57A 5F3EA 5A1LA 4XCBA 4M3CA 5FZ4A 3WG2A 4XOGA 1OURA 2CTVA 2HWF1 2R0FA 1KDKA 4NMIA 4AF9A 4F7ZA 5FQ0A 2XJUA 3IDAA 3ATGA 2X5IC 5FBJA 1CESA 5T5OA 4CU7A 5CA6A 4E4HA 4XXPA 4D3WA 3NV2A 3ECQA 4EE2A 1RTVA 4HVOA 5I0UA 5LBCA 3AKPA 1VBB3 2YY1A 3NJZA 4W4ZA 1HX6A 1JOPA 2LTNA 1HV0A 2NMOA 2WRAA 1FPN1 3GHNA 3I4IA 4XFFA 4ZPIA 4BYYA 3NO8A 3ITQA 3J7HA 2PHTA 5JIAA 3J7LA 2NMNA 4DXTA 2E31A 2PHFA 4QPGB 3RQ0A 1WLWA 3B3QE 1W6MA 2BTVC 4YM2A 2W5FA 3BI3A 1US2A 5A1FA 2QBXA 1J3PA 1NCQC 1PGSA 1W6QA 2WZR2 3ZKUA 5AFBA 2D43A 4XCAA 2VH9A 5JSRA 3NJXA 4QKDA 1QJEA 2DWRA 5BYNA 2VJXA 4PDWA 2JG8B 5LRRA 5H9PA 1N1VA 1EPZA 1Q8QA 1AX2A 3BODA 4P9IA 2EAAA 1RUC3 1V9U1 4AQ6A 3I54A 1WZXA 4RN5A 5A6XA 3AZYA 5ERLA 1PHMA 1RUH1 2ZEYA 4PQ9A 2P5BA 1W6NB 4TLFA 3ZPOA 5FP8A 5LZ6A 1XOYA 3FLTA 2XB6C 3KQRA 1CAUB 4EWDA 3DXTA 5FY0A 4AI0A 1ULDA 2ZHLA 2ZGSA 1AL23 2LRPA 3NNGA 2J1AA 3JD71 4UW6A 4AOCA 4CCNA 5J96B 4GMP1 3FFZA 2HWB2 1VR3A 4FO9A 4Y33A 5FMOL 5JSOA 3HOBA 1LKNA 3LEGA 4YZ5A 1JZ5A 4Y1YA 1H4GA 1W9TA 4UF0B 3E1F1 1WW4A 2XUEA 3CQOA 5A7QA 3KB5A 5F6LB 1AZDA 3UYJA 2VNRA 3WNXA 4XXAA 4CTEA 1W05A 2VZQA 3AFKA 3BIWE 1RUJ2 5GKAC 1ODMA 2ZKNA 1K5MA 1BYHA 2WQ8A 1DQ2A 3FBYA 3OD0A 5FZ9A 4RQPA 3KSCA 1VBD1 1WW6A 1KEXA 1YLLA 4ISRA 3M3OA 4AWDA 3NJVA 1DP0A 1VBB2 3J8F3 4DXSA 4TTGA 4YVSB 1QJZA 5D8AB 3UT0A 2NM1A 4CCCA 2A6WA 1NE4A 2G9ZA 2JD4A 4COVA 3ALQA 3OOXA 1DDLA 3T1MA 3MPPG 4GB33 2IXIA 5DAWA 1AYN1 1AR72 1D0GA 2DCZA 1WCQA 1S0FA 4JDMA 1VAVA 3T0BA 1D4VB 1OHFA 3I59B 1BK1A 1J3QA 2XJVA 3PVOA 2A70A 4JKMA 1AX0A 1O3RA 2YHJA 4CEWB 5C8CB 2WZ8A 1DU3D 4Z92B 5HBAA 3ZXLA 3EXUA 2GN7A 2CWSA 3PHMA 3ZXGA 3H8RA 1LOBA 3ZYGA 1W8FA 4CXYA 3B02A 3HAGA 5KC5A 1Y9MA 4AI8A 4YGEA 1OF3A 3AP7A 1RUC2 4JV4A 4LR4A 3UJQA 4CDWA 2V72A 4LIVA 1OH3A 1HW5A 2WO2A 3KVBA 4BMEA 5I0TA 5C5TA 3U37A 5I93A 4QB6A 4RS5C 3QCWA 2A71A 2VVEA 3V0AB 1ZNPA 1NZCA 1BBT1 2XLFA 1AR63 4N43B 1QDCA 2GMMA 4HPKB 4HVQA 1AL22 5IVFA 1G9AA 4JQTA 1ENXA 2DVGA 4CA9A 2J1EA 1XU2A 4MLOA 3IIIA 4XQ4A 5K0UC 3UV9A 2ZBJA 4HFSA 2XL9A 3NVCA 4XF0A 5DUXA 1S2EA 4SLIA 3M7AA 3N36A 2D93A 2K9ZA 4QHZA 5FMCA 3VV1A 4PF5A 1GQHA 3ZXJA 3BTYA 2R063 3R05A 3ME2A 2ZGUA 2LALA 3M1HA 2A73B 4I0AA 3ILNA 1OKOA 4O65A 3T30A 1FOD1 3VDDB 3WNNA 3HBKA 4GD4A 2RS51 3I2JA 4RA0A 4GAZA 5F3IA 3I3MA 2L9LA 4K1ZA 5J7MA 3HNBM 1QJU1 3PUSA 2I2SA 3MW2A 4FPHA 2QTWB 1XYPA 1YEWA 3NV3A 1MZ6A 2GC1A 4ZU5A 5C4WC 3N9NA 4GIQA 3PNAA 1NY72 4MHRA 3NNFA 4HK9A 4GB32 3C7OA 1SBDA 1AYM3 2QNKA 5ABJB 4LNVA 3N7LA 3PUHA 1R1A3 2E9QA 1SCRA 3ZDSA 4HONA 3VBRB 4NIHA 2YDEA 3HD8B 4QGNA 4QX2A 3VBFB 2VZOA 2VQAA 2PLV2 3CZJA 1W8OA 5FP3A 4ES9A 2VM9A 5FXWA 3WF4A 4AQTA 2ZX1A 3RJ2X 3WG4A 4YFWA 3UL2A 3K3NA 1XNKA 1YO8A 4DY3A 4WM7C 3T4HB 5EWSA 1LODA 5D2AA 2HEWF 4NWWA 5A7WA 5FAXA 2WNVA 4NIDA 5IT6A 1JYXA 4DXZA 4GH4B 2ARBA 2YC2A 4QPIA 2VUAA 2R043 2WAAA 4WVMB 3CJIA 4QX7A 3AKTA 4I02A 1GUIA 5FIXA 2GC0A 4Y4RA 5C3SA 1POV0 5LASA 1AR62 3BALA 2IVJA 3ZSMA 3OGRA 1LECA 4BIOA 2CDPA 3H50A 1WUVA 3ZFFB 1LGBA 2WDBA 1RUE1 1DGLA 1ACCA 1LTEA 5LBFA 5CB7A 1Q56A 1OLQA 3OBRA 1QF3A 3LDRA 3NMBA 1GLHA 4MGTA 4C0BA 4XC9A 1RIRA 4W65A 1WBLA 3U1XA 3ZN6A 1ZRCA 3AYCA 2R062 3I2FA 4CP1A 4YM0A 3MW3A 4X8NA 4AVTA 3ZN5A 4K20A 3MV01 2ARXA 4BQXA 3DN7A 2YGMA 1US3A 1F4HA 1W0NA 3LFIA 3T4VA 5K7PA 1SLTA 3NWKA 4Y4YA 4K1YA 1SBFA 5EJ3A 4A3XA 1HRI3 2ZX0A 3HN1A 4LO4B 4PLOA 4QDQA 5FREA 1GANA 1H8VA 1QQP3 3WQ0A 1DZTA 3CL1A 4ZS3A 2DCYA 5KC6A 3QH7A 5FFOC 5JWPA 5HI0A 4NIIA 5F5AA 1OLMA 4IGQA 5DZFA 3SEPA 2E7TA 4OHXA 3N9MA 2QQNA 3AVSA 4RGAA 4D6RA 2VW2A 1PO13 1PO21 4NHMA 4EN9B 2HKXA 4URTA 1UZWA 2WT1A 4AGVA 5DUWA 1R1ZA 2VQ0A 1YQ5A 5FZOB 2YBKA 4CCDA 1DHKB 4H3WA 3ZIXA 1W3XA 4GMP0 5F9TA 5JZGB 5AFEA 1QJX1 2CAUA 1OD3A 2I45A 4BQ2A 2R042 4L2NA 1HV1A 4P5YA 5T54A 1ZX5A 1GWKA 3MIEA 1CZTA 4JGYB 1ALYA 1AXKA 2F4LA 4OVEA 4QT6A 2D3PA 3VD4A 2VW0A 4XDPA 1F5FA 1RUF2 4Q5OA 4E9KA 3R4DB 4H7LA 3ZFEB 3A4UA 4B4PA 1X50A 5EFUA 2R32A 1I5ZA 3A22A 5DAQA 4N53B 1N1YA 1SLCA 3CLPA 4IV3C 4CDUB 2VULA 1UN1A 2ZHKA 2WZR1 2YBPA 4OMCA 5AVAA 5T5JA 3T2OA 3VDAA 1CPMA 3IDEA 3IBMA 4LE4A 5FOJB 2P3JA 4LT5A 4A7YA 3WINE 1ZBA2 2A6YA 1H30A 1W9SA 1SLBA 3MFCA 3VD9A 2W1WA 1T2XA 5IAXA 4G9SB 5LCWL 3WOGA 4AK3A 3O0XA 2QQWA 2ZAHA 3CEWA 2ZEWA 1NCRC 1VB4A 4I01A 3SITA 4NHXA 5DG2A 1SFYA 1J83A 1HRI2 2XJSA 4K9SA 1RUG2 4BPZA 2DVDA 1GP6A 1QQP2 3IDBB 3I8TA 4AEDB 1S2BA 1JUIA 1O91A 3JB8A 4HL0A 4A41A 3Q8BA 2D98A 1YC61 2P2KA 2ZMKA 3NL1A 3N9LA 3RFRA 2HWB1 1VB2A 2FDFA 4Y26A 2RMU1 3E6CC 2VE1A 3KVAA 3AMPA 3CIHA 1HRV1 4BK4A 3WDWA 1HJGA 4PI2A 4BXSV 1DYOA 1OOPB 3CF6E 5FMBA 2W08A 4ZXKA 4YARA 4M3CB 4CDXA 5B2GB 3WUDA 1POV3 1MVQA 2V73A 2VZUA 3K2OA 5DAVA 3C7HA 3B5LB 3C7EA 3IPVB 4LO6B 1OQ1A 3AP9A 2Z4FA 5KHJA 4XTMA 1WCKA 3POFA 2O8OA 5FRAA 1VBB1 1ND2A 4LXLA 2JIGA 2LW8A 4RGGA 3GF6A 2YG0A 2YROA 1OPOA 1HXS3 1TMF2 2RS13 4P9WA 4W8JA 3NNJA 1GWLA 2WFPA 2IXLA 2VXRA 1UL9A 1EUUA 4FCAA 1AR71 1GNZA 1XSRA 2D6KA 3JBG3 2GH2A 1KS4A 3MIHA 5FY7A 3T3YA 2WNVC 5A1AA 4UFHA 1O3QA 1W8UA 4NPMA 1FXZA 4XUOA 4AI3A 1CX1A 2JG9A 2XMLA 1VBA3 4O7XA 2XQRA 4ZU4A 1W06A 3WQBA 4Q1RA 3CJIC 3K3OA 5F5IA 5FZLA 3LEMA 2KD7A 2HH9A 5GZEA 1Z0HA 2NN8A 1RUC1 5C3QA 1B35C 3H3ZA 4XF9A 4R9AA 2B46X 5IAVA 2W1SA 1V6OA 2VR4A 3FLPA 5EZWA 4QWNA 5A32B 4IEYA 1MACA 2WZPP 1ZZBA 1V9U3 4AVVA 2UURA 4BXFA 5DG1A 1XC6A 4AR2A 5GZGA 3ZFGA 1C57A 3PL0A 5LK7B 2AACA 3BTXA 4PBPA 1PMJX 4Q26A 1AL21 1QGLA 2Q30A 2ZZQA 3AYEA 3DPRC 1J1LA 2CHHA 2XKPA 4YZ3A 2ZEZA 4YGDA 4F8AA 1DBNA 2ZAAA 5E16A 3LDKA 4YW3A 1EPWA 5EIYB 2WQ4A 3HMYA 3LIHA 1HIXA 3VDBA 4NVPA 4TN7A 4A4AA 2R7EB 4AHWA 2C0ZA 3IB3A 3TEZA 3WR0A 3GBGA 1X36A 2E7AA 4LQRA 4XFCA 1BLZA 2WNOA 3DYOA 4NOTA 2J7MA 1AXYA 2B7YA 2ZKLA 4BDVB 4CP9B 4RL7A 4Q0PA 1K5MB 4GKXA 1IS6A 1JTZX 4FPGA 1PVC3 4RQPB 2TNFA 2CWMA 3HWJA 2HEVF 3OB8A 3J8F1 3ZIWA 3IIAA 2G19A 3QBQA 2IFWA 4NROA 3I2KA 4E8DA 2KXLA 5DAPA 1HXS2 1F31A 3KQ4B 2RS12 1O5UA 4FOQA 4FQZA 2SBAA 1VMFA 4AYUA 3HEIA 3I97A 4GB31 4ISQA 1XU1A 4IEUA 2MEV3 4WVWA 3FUOA 4XW3A 3H1YA 4ATFA 2H6CA 2ENRA 1FV2A 1CAVA 3GALA 4L8QA 5HV0A 5CYYA 1POQA 4PJYA 1LNSA 4IGOA 1W39A 2PLV1 2WLQA 1VBA2 5BNNA 5DAXA 1OQDA 1IG0A 2E33A 2QQLA 4HKLA 2XLGA 4XFGA 2B39A 1W6PB 2KR2A 4NUBA 1LOFA 2R1DA 2P6HA 4GWNA 5KXCA 2RR13 4XAAA 4JDNA 1LCLA 1PGW2 3VZKA 4YW1A 5IK8A 5DUUA 1JHNA 1BKZA 1HLCA 2RVAA 5DMYA 2GC2A 4XQDA 1UAIA 1J84A 2Y60A 3U4XA 2Y33A 1AR61 2VXJA 2FCUA 4CEYC 4M3CF 4TWTA 2O14A 1U5ZA 3J9SA 4NPRA 1U5IA 2BNOA 3M4FA 3SKVA 2HBUA 5GZFA 1FMD3 3ELNA 1W8HA 1W8NA 1UMHA 1K45A 3AMHA 3M8LA 4RR3C 3HNYM 1ST8A 5BPXA 4Y20B 5I0RA 3Q8EA 4LO8A 2YYOA 2D6LX 3GBFA 4OUSA 2I74A 2R061 4PLNA 1C5IA 1WLDA 3VBOA 1XSQA 2P6CA 2OS2A 1G8WA 4JTOA 4OULA 3AZXA 4LUKA 2WC2A 5LY1A 1PVC2 1H8TB 3VHPA 1GZWB 2Z2SB 3DECA 5FYMA 5GLZA 5ACA2 1O6UA 1SZBA 2D40A 2OQ6A 4CCKA 1HJFA 3HT1A 3ACIA 1Y9QA 3GM8A 4OHYA 2OX0A 2C24A 2W39A 1TNRA 1A6CA 1RMU2 1KGYA 1CX4A 1R1A1 4JZRA 2ET1A 1WD3A 2X5IA 1IZ3A 3ABZA 2BZDA 5GLWA 2J1TA 4I2OA 3L9JT 3N3HA 4E2QA 2VL4A 2Z79A 1LB2A 5CNAA 3AP5A 3AB0A 3N7MA 4KU7A 1ZZ7A 1U12A 3RMXA 2VVFA 3POEA 4BU2A 5FZ3A 1UYPA 4QGMA 5CIRA 3IT8A 4NAOA 4LTAA 2RR12 4XJZA 4I0WB 1NQDA 3CNAA 2X8KA 2ZHMA 4MX3A 3VKFC 1F15A 1QJFA 4JKKA 1T6BX 1N1SA 1ULEA 2R041 3ES1A 3IZOA 4NN0A 4NR1A 1NCQA 1VBC2 1ULPA 2BOJA 2JDKA 1JZ8A 1VPHA 2FQPA 4P9GA 4QDRA 5FPXA 1OMIA 3ES4A 2JG9C 3PURA 2PQSA 1XE8A 2XONA 4A3ZA 1I5PA 5T52A 1UZ0A 1YQ6A 4KU8A 4QD2A 4R4ZA 4XF1A 1CAWA 1BCXA 3C7FA 4B1LA 4IQPA 3L2YA 4EV0A 2FZ2A 4UT5A 5JOYA 5DXDA 1HQWA 1D7PM 1MR5A 1LU2A 3HQUA 3R6SA 3B9CA 5FPAA 3I2IA 4HN0A 2D6NA 3OUHA 4QPGC 3ZSKA 1NE6A 3OJBA 2WZEA 4NIAA 2OXBA 2X53S 4BISA 5C3RA 2IXJA 2XG3A 3PJYA 5FZEA 2K2SA 3ZXEA 4CU8A 4DRVA 5CAZA 1PMIA 2VCAA 5C8WA 1ZRFA 5FYCA 3AL6A 3POBA 2ET7A 3UGHA 4B7EA 2Y6LA 2W1QA 4D6SA 1ZVFA 1HRI1 3D3AA 4I3GA 5IWFA 2R073 3SCHA 1RUG1 4K8FA 1QQP1 3MW4A 2JG8C 1L7QA 3G6JB 3HPNA 2VBDA 3HN3A 2DYCA 4COUA 2FCTA 4O61A 5CU1A 3TOJA 4MXWB 1O4YA 3USSA 2R0HA 3UNPA 3OYWB 3I3BA 3EB7A 3MIFA 3RNSA 1UPIA 4C91A 2W47A 3WF1A 2W91A 2AH2A 5JMCA 3O1MA 1PK6B 3MO4A 1HDKA 1PO11 2D97A 2JDUA 4OUMA 4AL9A 1EP0A 3OTFA 3CZUA 3LWCA 2YPJA 3MF9A 5FYUA 4GWJA 5FZCA 3WG1A 2BNNA 4GALA 4COZA 4XMAA 3K4DA 1YJKA 1R093 3GJBA 3I2DA 3AZVA 1QH6A 5IFTA 5F5QA 5G04L 1AR82 4PI0A 5CG8A 5A3PA 2PA7A 2PQQA 1NA1C 1W9YA 2P4EA 4EWAA 3LD8A 3DGTA 3ZXFA 3ZDVA 1CN1A 1E5SA 4MV2A 1C8NA 3KT4A 4IXLA 4KNCA 1FV3A 1R083 4LBMA 5KR7A 3RZZA 3RWKX 3MGUA 3NV1A 2FBEA 1TZOA 5F6KA 1XYNA 4RS5A 3LOIA 1AR93 3AL5A 4Q0UA 2O1QA 3UJOA 3NV4A 1H9PA 1N1TA 3THCA 2WYFA 2ZGOA 1D2SA 1JOBA 2DUOA 2N7GA 1IG3A 4PCRA 3DYPA 4P5HA 1H2LA 4TXWA 4XETA 1ZRRA 3WHTA 3RYRA 4JAAA 1VALA 5A7PA 5CFCC 5C8CC 5K0UA 4KGGA 1VJ2A 3ZLIA 3I3QA 2VQTA 3D5OA 4L0PA 1EAH3 3GNEA 4YG0A 2UWCA 4IE7A 3WW2A 3SLIA 4LKDA 4IE6A 3ST7A 4CXXA 4E27A 5IW0A 4B8EA 2R072 2J42A 3MLJA 2RJLA 4QKNA 5DQ0A 4R9BA 1PZ7A 3AC0A 4E4SA 4MGYE 4AVAA 4NPLA 3TNQA 5JPMB 1ZZCA 4YYOA 1GR3A 2ORXA 4HANA 1ND3B 1G7YA 4HBNA 5E88A 3Q8FA 5IJRA 2W1UA 3SXWA 3PU3A 5JLVA 1H1MA 1DIWA 2VZSA 5FUIA 3NW4A 4P9XA 5L9RA 4N7UA 3SKJE 5A6YA 5LA0A 1PX3A 5EJZB 1KDMA 3B00A 4CPBA 1CWPA 4AXOA 3WVJA 4EQVA 3EMRA 1POV1 3JU9A 4HLTA 5ANQA 2EXKA 1R092 2WNEA 2J1RA 3AK0A 3O5SA 1Q5OA 2G9GA 3U78A 5JMOA 4YM3A 3MIGA 1RUJ3 3OBAA 4BK5A 3BIEA 2DFBA 1ND2B 4OUEA 3ILFA 5L9BA 5A33B 1K42A 1HXS1 1QY4A 2RS11 1AHSA 4J6GA 5T50A 4QXBA 3VDDC 4WM7A 2DUQA 1UY4A 4XJAA 5CADA 2BJSA 3BPSA 4UBGA 1R082 3JBG1 3POSA 4DS0A 5KXBA 2A3XA 4ORFA 3O1SA 2UYAA 2GN3A 3QOPA 3PLQA 1AR73 3H8XA 5BNOB 2AENA 2VCMA 2VOVA 2ZGTA 4DO0A 4BQ4A 3HJRA 1AR92 2OPKA 4XUNA 2B42B 2QQUA 4EZHA 3AX4A 2UU8A 4C1WA 1VBA1 3NRUA 4QHOA 4DXRA 5FPUA 5AC93 4Y1UA 4AFDA 2P37A 3GHMA 1NT0A 3USUB 5ABJC 2BWAA 2WSUA 3FJSA 5FDBA 3W5MA 2R49A 3VBRC 4YVWB 3VBFC 4XF4A 1ENRA 1XB9A 3IKWA 4AG4A 1SLIA 5KHKA 1PGW1 4GA9A 5JUVA 4MXVA 1NKGA 1EAH2 1F8VA 1OH4A 1VIWB 2VMEA 3ACFA 2UWAA 3G7DA 4XDOA 5F8PA 3POIA 1STMA 1UXZA 1CJDA 1MZEA 5FUNA 4DUVA 4UW5A 3ZFGB 3O12A 4KG8A 1PX4A 2P34A 3ILRA 3I3EA 3BOWA 4HZFA 3K46A 3TB0A 1UQXA 2FDHA 3OPZA 1Z7S3 1SFPA 4GH4C 4HXCA 2R1BA 1F2NA 3BTAA 4CDQB 2QFEA 5CVRA 1SFNA 3H0OA 4IL7A 5E89A 5EQUA 3IMNA 2G4IA 3SEEA 3JQWA 2XVLA 3HBZA
chains in the Genus database with same CATH topology
1J1TA 3WW3A 4AGRA 3POYA 1UCXA 3ZFFC 3O0VA 1S2KA 4XEZA 1DF0A 1OKQA 4PBOA 2VMHA 1PVC1 1BQPA 4AEJA 1NLSA 3H7YA 1LHOA 1ZZ6A 3RSJA 4BA6A 4AFBA 2VG9A 2MEV1 3OY8B 4S2FA 1JYIA 1RMU1 2DCKA 1JXNA 5JDBA 3NAPB 1AJOA 3LZZA 4Z8BA 3MFAA 5AC92 2PLV3 4XFBA 3RI8A 3W58A 1C28A 4FPEA 3IDCB 2D5FA 2RR11 4EN7B 2YMZA 1DYKA 1CAXA 1IHMA 4IV3A 2ZA9A 3MYXA 4QQLA 2XJRA 3M3EA 5LRSA 2FHRA 4S2HA 3VZJA 2ZACA 4EJRA 2WFF3 3WDYA 1Z7S2 1QNYA 4LUMA 1FMD1 4YGBA 4AVSA 4XTPA 1PIV2 1NCRA 4XJWA 4JGYC 1V6JA 1HQNA 1ASJ3 1FATA 1RUNA 1G9BA 4JGZC 2VY0A 5L73A 2PFWA 2WS92 3KT7A 3VHRA 3ZFEC 2Y38A 4Y22A 2UYBA 2FMYA 1W0PA 3CO2A 4UW3A 4CDUC 4EROA 4LULA 3FUQA 1A3KA 4LO7A 3EJKA 3BOPA 4WZCA 4QMAA 4S2DA 1NXMA 4Q4Y2 4ZKTB 4M00A 5C9AB 3OGGA 4LHLA 2X5IB 3L2HA 2XJTA 2YC0A 3E5QA 1OLRA 1S0EA 4EN0A 2ZGKA 4QQOA 1BEV2 1NXD1 4AEDC 3ZXDA 1G86A 4FOVA 1ZZ9A 1WW7A 4V1PA 2DCJA 2C9AA 3VBSB 3WQ1A 3TAYA 4FSJA 3D0JA 1DQ4A 1QXPA 4JRAA 2NZ9A 1J59A 3RS6A 1JYCA 1OOPC 1QJY3 4LHNA 4RD7A 1QH7A 5CFDB 3KCCA 2WFF2 2DF7A 1S0JA 2G9FA 2NYYA 5H9QA 1GYKA 1B35A 1U0AA 3ZO0B 1LESA 1RUF3 1RVF2 2ZGRA 4O9GA 3LA7A 5TSWA 1PZ9A 3VKMA 1ASJ2 3TRSB 5H9RA 2Q1ZB 1QDOA 4LA2A 4AFMA 4MGIE 1IGOA 1NQJA 2QZ3A 4IEWA 3DPRA 3FE5A 4WBBA 1N3PA 4Q8LA 1ZBA3 1COV3 4M0HA 4WZFA 4AEKA 3V0BA 3B94A 1ZREA 1MZFA 3OGJA 1HKDA 2R071 1BJQA 1Y3TA 4ATEA 2H0BA 4WVZA 3SNMA 1RUG3 2GU9A 2D6PA 1RUD3 2DTYA 5BNPC 2QZ2A 4WM8B 1W6OA 4XFIA 2GAUA 2A6ZA 2Z42A 1GBGA 1HQLA 2HWE3 2ILMA 4DFSA 3THPA 2OZJA 1DG6A 1R091 3MEPA 4LA3A 2BQPA 2NQYA 2PAKA 4IESA 4AHZA 3MLKA 1CIWA 5T3NA 1QJY2 1SLLA 1SCSA 4NWVA 2RE9A 4META 1TMF3 1N3OA 1V70A 2YV8A 4PLMA 1R081 1C3HA 3INAA 1BVVA 3MDPA 1VRH3 4KG0A 3AYAA 3HR9A 3KGZA 1AR91 4DZGA 2XH6A 4ONUA 2WNUB 4CEYA 1IS5A 3M70A 1NG0A 2I07B 1BVP1 1COV2 5EYXA 3AKRA 4RR3A 1FNYA 4CZSA 1EAH1 4DB5A 1TEIA 1WLTA 1FNZA 4JC1A 3VBHC 4D7YA 2BVVA 4KWKA 5KXDA 3ETQA 2QQPA 1LOCA 1MVEA 1J58A 2VOXA 1RUD2 2VW1A 3U11A 1MQTB 1LU1A 1WCSA 4LBNA 5L7OC 2XWBB 3JZVA 3SCGA 2V09A 4EWEA 1LEDA 5C4WB 1H2NA 2A6XA 2HWE2 2CGNA 4PIZA 1SLAA 3KMHA 3S30A 3CU7A 4U2AA 1I1EA 1BZWA 4XILA 2XVGA 4J1WA 1RUJ1 4P9JA 5FQ0B 4OI1A 1VP6A 3TBDA 4LLOA 1XXNA 5FO7B 1F5JA 3H1WA 3DV8A 2Q5TA 3LOBA 4GULA 1WMDA 2AYHA 1UU4A 4WM7B 2XBO3 1GICA 1X8MA 2E7QA 2GSYA 2Q0AA 4E2GA 4FOYA 1H8TC 1VRH2 4YRDA 4C0HA 2HWD3 1H1AA 1W6MB 2JE9A 1GFF2 4AVBA 1GKBA 2YUEA 1LR5A 4OLLA 1J3RA 5AC91 1O4TA 5FLIA 3AXDA 3VGIA 1W6QB 4P14A 3BB6A 2X29A 3OF1A 1B09A 2R30A 1YI9A 4PDWB 5T5PA 1RUI3 3EBRA 3D8CA 5E8AA 4DPNA 3M3IA 3N7JA 1OFNA 1U5YA 1ZM1A 4FPOB 1LGNA 2JX9A 2MNGA 4QPGA 4B29A 1IKPA 4L99A 1ZBE3 1Z7S1 3VUOA 5KHHA 4LHKA 3KLSA 2D3RA 5E1RA 4LBQD 2EALA 4XHBA 3WP3A 1NYWA 5LEJA 3AP4A 1C4RA 2ZMLA 2JG8A 1LJ7A 4Q4V3 3VBUC 4C1XA 2WA4A 1DGWA 1VAKA 4QQPA 3S7IA 4MH0E 2QDRA 1W6NA 3ZXKA 3B9IA 2ZGLA 2P17A 4P9YA 3PVEA 2D44A 1CAUA 1QOTA 2C5DA 1DLLA 1LULA 5ACA3 2WWSA 1KJRA 1LEMA 4Q4Y1 1NY71 2XBO2 4NHKA 1VBE3 3VHNA 1ZRDA 1D2QA 2XUMA 2AR6A 1DGRA 1G6NA 3M3CA 4W6YA 1WMEA 1RMU3 2HWD2 4Q4X3 1T6GC 4E2SA 4KL1A 1NA1A 2PHUA 2QJVA 1ZA4A 1YRZA 2XVKA 1VAMA 3WUCA 1KS5A 3KCXA 1Q8PA 1RUI2 4YVSA 5L36A 1PK6C 4CDWB 1Q43A 2EAKA 3ZVXA 1EYBA 4HKWA 2ZGMA 4BLIA 2QKDA 1LRHA 3SCFA 1AL0G 4XYXA 3WDVA 1VBC3 3RJRA 2WFF1 1ZBE2 2AZ5A 3I59A 1EV13 2JICA 1D0HA 3KGLA 3MI8A 4KGQA 5CFCA 5C8CA 3LKJA 1YI7A 4UW4A 1KFXL 1RGSA 1ULGA 3APBA 5GLTA 1RVF1 3ACLA 3N35A 2JEMA 3ZYIB 4CRQA 3ZSLA 1AVBA 1FT9A 3PVNA 1OA4A 2VU9A 2WKKA 3H9AA 1ASJ1 4Q4V2 5GZCA 2GNTA 1X82A 1RL3A 1UZYA 3ZYPA 2VNOA 1AJKA 1JW6A 4MGKE 3V0AA 3N4MA 1AX1A 3H8UA 3S6PA 4PIYA 4HPKA 3DL3A 4CP2A 1VBE2 4CYDA 4YG3A 3ZSJA 4AFAA 1I9RA 4IEQA 2CYFA 4Q4X2 5JAXA 2IWGB 3HT2A 1UPSA 3TN93 1IS4A 4AW7A 2BVBA 4Z2WA 4AQ2A 3VDDA 5K9YA 4X6QB 3E6DA 5L19A 4IV1C 1ND3C 1VBD2 3BPZA 4M0NA 3V65A 1QHDA 4RHV3 3UKNA 3URFA 5I8YA 1LHWA 2WNVB 4K40A 1ENSA 3WX5A 4QPIB 4Z1VA 3WXPA 2QDNA 1QJY1 1AR83 4YW5A 1RHI3 1MEC3 5ABJA 3CJIB 4FPYA 1EV12 3KS7A 3VBRA 4LE3A 2XGXA 3VBFA 1X33A 5FBZA 1RUF1 1KJLA 2IXCA 3I7DA 3QACA 2MHFA 4ITCA 3KZ4C 1JH5A 1BXHA 1KXGA 1E57A 1REFA 4I3PA 1SBEA 3ZN4A 4YGCA 5JI7A 4Y24A 3ZN6B 4GH4A 3DPRB 4BE3A 1ZBA1 5BNOC 1WGPA 2CL2A 1COV1 1U5XA 4HN1A 4OZXA 4WVMA 3FZ3A 3J26N 4E4ZA 2DV9A 2Z5WA 3DUIA 4XPVA 2TEPA 3S0MA 5JPNB 1Q3EA 1A8DA 5GLVA 3ZFFA 1UKGA 4X8PA 2QE3A 2QUOA 1LOEA 1V6KA 4YVWC 1RUD1 3GZTB 4QM9A 2HJIA 1PM7A 1YUDA 2OUHA 1G9DA 1VLNA 1C5HA 4IEVA 1FYUA 3TN92 3AKSA 2E63A 1S0BA 3N7KA 4YM1A 4UXAA 1FOD2 2HWE1 4AEMA 3LSDA 2GNMA 4H7MA 1CD3G 4RHV2 3WDXA 2F6BA 1PNGA 5BY5A 1YWKA 4M01A 1RHI2 1MEC2 1V6NA 1QXRA 2PELA 3LA3A 4L92A 4XFAA 4DQAA 1X7NA 1TMF1 2DURA 1X8EA 5I8TA 4OI2A 3C3VA 3E5XA 1VRH1 4Q0VA 4XHXA 2Y0IA 3R4SA 1ULFA 2R6QA 4JVAA 3THTA 3PMSA 2XWJB 4YVSC 5D8AC 2YZ4A 1XYOA 3WCSA 3LA2A 3E97A 3GYDA 3DF0A 2NP0A 1I6XA 5DDJ3 3ASIA 3NAPC 4RR3B 3WW4A 4CEWC 1FX5A 4XIOA 4JGYA 1DYPA 4OHVA 3P3PA 1GZCA 5SV5A 4JGZA 3AKQA 2PN5A 3ZFEA 2IC1A 4JRLA 2CY6A 1REDA 4N53A 4CDUA 1D4M2 4HMZA 1Y43B 4FTSA 1F9KA 4AHXA 4BLJA 1MS3A 1GSLA 2IXKA 1KRIA 4N43C 5KBFA 4HT1T 4XFHA 3VZLA 2PTMA 4CDXB 1SMVA 2D3SA 3RG0A 3TNPB 1M4WA 1EY2A 4YFZA 3WW1A 2GNBA 3ROUA 4Q27A 3MZHA 3VKLA 4AEDA 4XQWA 3ZXAC 4IEXA 4NHLA 2XBO1 4JDOA 1MS0A 4FOWA 3LCPA 3E5UA 4G4FA 1C1FA 4P9LA 4HK8A 2HWD1 5J09A 3D4KA 3O14A 1PO22 3JCIA 1OOPA 2GC3A 4TSVA 4BCUA 4IEZA 1OD5A 2WL1A 2JG9B 2ZMNA 4LBLA 5C9AC 3IPVA 4F3JA 3FWEA 4N9IA 5DDJ2 1QJX2 1O4ZA 2PHLA 4R9CA 3PJQA 1RUI1 4IERA 3CJXA 4S2GA 1IQAA 1UU6A 1IKQA 1V6LA 4OHWA 3WY6A 5FCCA 4BMBA 3KCYA 3RWNA 3VBSC 1CONA 1ZBE1 4QQ2A 4OFGA 2Q4SA 2OIIA 2A3YA 4Q4W3 5KWRA 2D6MA 2GDFA 1WA4A 1TE1B 5FTTC 2ZHNA 4HKOA 3RRDA 3V56A 4F83A 4L9BA 4YZ4A 5CFDC 1PIV3 2BBVA 1JBCA 2IZWA 4Q4V1 1XQNA 2CNAA 2W68A 3T2TA 2BFUS 1CR7A 2MPFA 4Z07A 4Q8KA 1Q8SA 2WS93 5BNPA 2AREA 5A32A 2B45X 5EV7A 3ENRA 3VLBB 5HCFA 1YFXA 3D0SA 1ULCA 2ZX4A 1DQ1A 5ACA1 4Y5Z0 1ZYBA 4MYEA 2HWC3 3MICA 1SQ4A 3U07A 1QU0A 1VBE1 1H1IA 4PIXA 2ZGPA 2RM23 4W6WA 2RMU2 4MUVA 3VKNA 4ASLA 4Q4Y3 2GZWA 2H0VA 3AFGA 4ZU7A 4FT8A 1HRV2 4Q4X1 2LUWA 5D1IA 1CAVB 1NA1B 4DINB 1YHFA 3SH3A 1WW5A 4A7ZA 1N47A 2VOWA 1MS4A 3D82A 3WP4A 1QMJA 1BEV3 4IETA 5BNNB 2W0XA 4BOWA 1UW8A 2CGOA 2LM3A 4WVVA 3FC0A 4WM8C 3WHUA 1BMV2 2ZJCA 2D5HA 3WZ1A 4FTBA 4KWLA 4QX5A 1VBC1 3PVBB 2Y0OA 4XIKA 4D7TA 3NKGA 1EV11 1QOOA 4X6RB 4Q4W2 4YSFA 5CFCB 1IS3A 5JZGC 1SEFA 3VN4A 5C33A 2PAMA 5DUVA 4XJUA 1RVF3 1H2MA 4RFT0 1ZZ8A 1W6PA 1CJPA 2ETEA 3VBHA 3JQXA 1QXJA 2BGCA 2JENA 4MSVA 5GLUA 3VBOB 3JB4C 1S0GA 3TWIA 3ZMOA 5L7OA 4N53C 1N3QA 4ASMB 2WNUC 1V00A 1UU5A 4Y1XA 3QD6A 2HWC2 3AJYA 4I0BA 3WD5A 1MS8A 5HCAA 4Q0SA 1IOAA 2RM22 3IN9A 1RINA 5J3UA 1OFSA 4Y20A 2Z69A 1XNCA 3O0WA 3SMHA 5FLHA 3TN91 4XE9A 2DTWA 1MS5A 2BEOA 1Q8VA 4K21A 2OVUA 3ZX7A 3FBMA 2WINB 2EXHA 3FLRA 2QVSB 2UY8A 1MQTC 2WT0A 1H8TA 1S1AA 1GZWA 4RHV1 2A7AA 2WJSA 4D69A 3J8F2 1WCDJ 4I30A 4N9HA 2CGPA 5T5LA 2PHRA 4N90A 1NLRA 1UZZA 1AR81 3UKTA 1NCQB 1RHI1 1MEC1 1Q8OA 1UX6A 2A3WA 2YGLA 3QH6A 4GQ7A 5LK5A 5BNQA 1XNBA 2XLAA 4Q29A 2B5HA 4OHZA 1H2KA 5I0SA 1YCIA 1RB8G 3VZOA 3B01A 1ONAA 1CAWB 4FXKB 4XBQA 2VNGA 4K3UA 1QWRA 4LBKA 3U10A 2VPVA 3IM0A 1W0OA 2CV6A 5JIUA 3B69A 5BUVA 3VL9A 1S0CA 4BH9A 3WLUA 2BWCA 3ZMNA 3WV6A 4MZUA 4YW2A 4U36A 3RI9A 1G9CA 2BYVE 4LBQA 1GZ9A 4FQ4A 3VBUA 1WBFA 5IK7A 1AXZA 3B93A 5C6CA 4KBBA 5J48A 2B8MA 2VECA 4PDWC 4QGLA 4RSUA 4KWJA 1PVXA 4FTEA 2BPA2 1D4M1 1XNDA 1RJ8A 1UIKA 3POWA 5H9SA 1TNFA 3BU7A 4YNIA 1REEA 2WA3A 4TZDA 1URXA 4AI1A 5IK4A 4O9EA 1UMZA 1TME3 2R16A 5GM0A 4Q0QA 2BNMA 5FMOS 3AXEA 1UD1A 1LHNA 1AYM2 3NKTA 3VHOA 4MXWA 4CP0A 1NOVA 3OYWA 1R1A2 5AVPA 2OZ6A 1K5MC 4QM8A 2YXSA 4HVRA 5JR7B 4XDQA 1PK6A 4RQPC 2JKBA 5GZDA 4SBVA 3TYJA 1PNFA 4W6XA 4C90A 2DU1A 4RS5B 4XJ9A 1UF2C 4BHPA 4J1XA 4E4DX 4BM8A 4JCKA 4AHYA 5DDJ1 2KM2A 2FMDA 2UWBA 4L11A 2DFCA 2GMPA 3UK9A 3V64A 3WDTA 4FPFA 1LGCA 2H6BA 3K51A 5K0UB 1C8M3 1GV9A 3WP5A 5CBLA 4B4QA 5FLJA