4AGNA

Structure of the p53 core domain mutant y220c bound to the stabilizing small molecule phikan5116
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
197
structure length
197
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Halogen-Enriched Fragment Libraries as Leads for Drug Rescue of Mutant P53.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 50
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4agnA00
3IGKA 3KMDA 4L0ZA 1CMOA 3Q01A 3QYNA 4GUOA 4AGLA 4IBSA 2H1LM 3WTYA 3QYMA 1TUPA 4G83A 3D0AA 3WTSA 4A63A 2BIQA 2RMNA 3VD0A 3WTTA 2BIMA 5LGYA 1KZYA 4IBYA 2OCJA 3D09A 4G82A 4KVPA 2J1ZA 1H9DA 2X0UA 5AOJA 1EAQA 4IBZA 4AGQA 4IBTA 5ABAA 4QO1B 1IO4C 3KZ8A 2X0WA 1E50A 3VD1A 2IOOA 5AOLA 3D08A 2J1XA 2VUKA 4MZRA 3WTXA 4HJEA 3D06A 1GZHA 2BIPA 2GEQA 2IOMA 1T4WA 2YBGA 1LJMA 3Q06A 2AC0A 4AGOA 2J1YA 3IGLA 2ATAA 1EANA 2MEJB 2XWCA 2J20A 4AGNA 3WTVA 2BINA 3D07A 4AGMA 1EAOA 4MZIA 4IBUA 4IJTA 1HU8A 4LOFA 2ADYA 4GUQA 4L18A 5LAPA 2J1WA 5AOKA 2P52A 1HJBC 3WU1A 4LO9A 5AB9A 3VD2A 2X0VA 4IBWA 1HJCA 2FEJA 4XR8C 5A7BA 5BUAA 3D05A 1YCSA 2PCXA 4LOEA 1CO1A 5AOIA 4L0YA 5AOMA 2J21A 5KBDA 3EXLA 3US1A 2XWRA 4IBQA 2WGXA 3ZMEA 2IOIA 5ECGA 3Q05A 2J6WA 4IBVA 5G4OA 1GZHC 5G4MA 3WTWA 1UOLA 1TSRA 3WTUA 3EXJA 3US0A 2BIOA 4AGPA 5G4NA 2AHIA 3TS8A
chains in the Genus database with same CATH superfamily
1N8OE 3BKCH 1WTLA 4DP4X 3ELAT 4B9ZA 1F4YH 4LGPB 2YN5A 1KTRL 1ZLWH 4L23A 2NXZC 1HNYA 4OZIB 1B90A 4HBCH 3VRIA 4HJUA 5DLML 1YMMD 3BJ91 4P05A 5DHYA 3M46A 3ZE2B 1CPUA 4NXKA 3X17A 1MCEA 3ZGIA 1RMFL 4O5LL 2YD6A 2YMTA 3ROLB 4M3JA 3A6BH 1FNEB 3NZ8A 3O41B 5AVTB 3BQVA 4H25A 2WZ5A 3T3MB 1JJUA 3TNNB 3T71A 3TO4C 4GG6B 1G7JA 5JW3H 2AK4D 2VRQA 1GJWA 1CZ8H 5IG7B 4ZW3A 4E68A 4OAWA 1OT1A 2FHCA 4M62L 5I73C 1FZKB 3NH7H 5DUBB 4NN6B 4HQQL 4GFTB 2R27A 2Z35A 4MAZA 2D8KA 4DSYA 4MYWB 4HH9B 4LFHD 4ES8A 4NWUH 2R1YA 1KJ2B 2YZ8A 5JW4Q 2X4SB 4NCC2 3N6YA 2FO4B 4OZIF 4OCWL 5HI5C 3OSVA 4FQXD 3ZE2F 3NP4A 2GBAA 4PJ5E 1WCBB 1ACYL 3QUMB 4Y4KD 4DQOL 2HA1A 1WISA 1ZY9A 1SJEB 1SRDA 1BQHB 3E7JA 3GDBA 1UYWH 5DD5L 3TBSB 3NRQA 3HG5A 4A66A 1NCTA 4G6JH 2HT2C 3NAAL 5AVWB 2Q3AA 3MRMA 5CEYA 3T3MF 4Z7QE 1A14L 4GG6F 2ZJSL 1D7DA 2MHAB 4R7DA 1N59A 2BSRB 1P2CA 3LN9A 1OPGH 5CJ8A 5E95B 1QSVA 3CFTA 3N0PB 1SEQL 4NO5A 3LTVA 3VXNB 2WM0A 1U8NB 2R83A 1NBZB 4PRIB 3AITA 1LXMA 4XHQA 5C0DB 1GY1A 4D0CB 1I8IB 2F8IA 3MMEB 1LO2L 2XTJD 2FL5A 4GBXB 1HILA 2J25A 4WFEE 3RX7A 3LH2L 4KGLA 4F9LC 3ZL2A 3FFCB 2Y1YA 5EU3A 1DQDH 2VM3A 1SVBA 2WBJB 1ZVSA 1X3DA 4JE0A 3IPEA 5I0YA 4NQCA 3BRDA 2CKBB 2OYMA 5IJVB 3QUHA 2BLFA 2XVBA 1X9LA 2ZUQC 3GM8A 2Y24A 4KPHH 2E9JA 2TRHA 4XH2A 5PAZA 4QAWA 3W9DB 2CK2A 3EBGA 5I1IL 1KBBA 4ONFH 4ADGA 4YHML 1DN0A 4TXVB 3Q1SH 1OAUH 2DOCA 2VDQB 3K0WA 4G7VH 5FX3A 3GTTA 1UACH 1IE4A 3MV8A 1RERA 3JV4A 1E9QA 1A7OL 1ZIBA 4PJXA 3LH9A 4XP6L 1GCFA 1QLRA 2CUAA 1OAQL 4BFGA 1UWGL 2Z1KA 3RAJH 3ZKNC 1HL9A 2VE6A 5B8CC 2OAAA 5CP3A 3WGVB 4BK8A 3O2DH 3E3QE 2BCMA 3SO3B 3DUUA 4ZNCD 3ETTA 1Q9OB 3WMSA 3ISWA 4P4RB 3D87B 3D12B 3KEDA 4BUQA 3II2A 5AWNH 4EOWH 3H2PA 1H5BB 3CIQA 4ELMA 1AC6A 3OG4B 3QXDA 1U8PB 1W8NA 3FPYA 1AY1L 2FUQA 1FVEA 5B39G 4R5TA 4DAGH 3QQDA 5ADPL 4R96A 1N6QH 3HRZA 5DEJA 4ZXBB 2JKSA 3O0RH 5D7JA 3RWJB 4V11A 4BE6A 4FQJH 2FWOB 3PQYB 2ZAHA 3POCA 1UM6L 3DI2B 2P5PA 3BFWA 2EABA 2WHVA 3CVIL 4N26A 1WZKA 4HLEA 5IF0A 3HN5A 1ND0A 4GQZA 4EDXA 3RVXC 1BXVA 2L3BA 1O7SA 2XN9A 4OZHB 1WC7A 1QSED 1HAWA 4J8RA 2X09A 4FD0A 1SY6L 4PV1C 4UT6A 3OD3A 3S3SA 2VN3A 4AC2A 5E6YA 3AUVA 4QHLB 1IE5A 1ZLEA 5E24E 5IMOA 1S46A 4LCYA 2KKQA 4WI6A 3P73A 3M17B 5DJ2A 2L7EA 5DZLA 4PN6A 2ENQA 1TR7A 3KVQA 4PR5A 4U6YA 3IJSA 4JO8A 5ERWA 3NK4A 5LAXB 1UM4H 2ZKWA 4N8CL 1LO3H 1QQDA 2YS4A 4GAAA 1JTPA 2OQJB 3JWNG 2GCYA 1KYOK 3QO0B 4JZOB 3QIBB 4XZUA 2F53E 4R4FH 5JUEL 5ANMA 1KB9K 1RP9A 4G6KL 3RUGB 3S5LA 3SCMD 1OLLA 3V5HA 4R0LB 2NYKA 3RWEB 4EI6B 3M07A 4FFVC 4F37K 5DEZA 3X1FA 4JZJC 4C56D 1HH9A 4M8QA 3GS4A 3NSYA 3P0YH 4RMBA 3DOSA 4F7EB 3GSNH 3VFRB 3S3JA 3EYFA 4RGNB 3LRSB 1BD2B 4S10A 1KV7A 3MYZA 4YEEA 4OZHF 4RMUA 4KJPC 2WAHA 1EWHA 3UADA 3BISA 4XWOC 2BW5A 1BJMA 3OKEB 1GGIH 3LJ3A 1HHGA 2BP5M 2YPVL 2DM2A 3EYOA 2VERN 5DD1L 4YJZL 3WTSA 1TZGH 3H6JA 5GHWL 5I9QB 4QNPF 5I1JH 2W07B 2WLYA 1KGXA 4G70B 3UTQB 2H0EA 4KY2A 1BQLH 5LGYA 3X1BA 2BS9A 4WHDA 1F11A 1U8MA 1HXYA 3AT0A 1C5CL 1IGJB 1QBMH 2IBBA 1XH0A 3RUGF 5E9DB 3R18A 1PZAA 3MLTA 1KXQA 1DVUA 1Y6NR 2HFEA 2F7OA 3IK2A 3UAEA 3QFJE 3PL6C 1FZOA 4YGAB 3UIYA 3BAJA 3FO0H 3GMQB 4UIKL 4CMHB 4B5EA 1IZJA 2Q10A 3OWEA 4FN0A 1RUML 5GS0D 3OGCB 4UQEA 1YYML 2Z8RA 4FCHA 4M5ZL 4M7LH 4BZ2A 3JV0A 4MMZA 3JQOB 1BGXH 1R19A 2BOBB 2VISA 1TJMA 2JELH 1YEFL 5CEZE 1R75A 3NJKA 1KB5H 3MV9B 4P3CL 5E2WH 1M71B 1HEZB 2P7TA 1PD6A 4MMXB 4GSXA 1T4WA 2ZXBA 1RZ7H 1QLEH 3FCBA 5IY5B 2HTLD 3B6SA 2AEIT 4RNRA 4AVIA 3UZVB 4YIQA 1GGUA 2HRHA 2AEPL 3QUKA 4PRBA 4WI3A 4ICXA 2VDNB 3WS6C 4JM4L 1TYJA 1UASA 2OTWB 4JPIA 4A37A 3VFNA 4N2NA 4PJ8D 5EZLA 5K9OB 4RA0C 1QI4A 2F1EA 3RIAK 4X6BB 2BHUA 3F64A 4GP5B 4X7TB 1HU8A 1SOQA 1ZE3C 2ICWJ 3CSBA 3HG4A 3MRFB 4JG0L 1S7XB 4G9FA 4Y19D 3O9WD 5FKPA 2OSWA 5MERB 1QLFB 1T7XA 3NN8A 4U7SA 1P84J 3IDMB 5JW4M 3TA3B 3U4EA 5J6HB 5DUJA 1AQKH 5CHNA 2FVNA 2CO7A 1PLCA 1J0IA 4JM0A 4KGJA 1AR2A 1N3NB 2NXYB 4GUPA 3NOIA 1U8OA 4MQTB 5FAAA 5KSVB 3ENEA 4OF6A 4K07A 2J8UE 5B3NA 2PTTA 2ATPA 3C5ZC 3MAWA 1VEOA 3CZNA 4P4KA 1U8LA 1NCCH 1GZQA 2F7IA 1J5HA 1F0LA 3K4AA 4KNUA 4OJAA 1YAZA 4ODSH 2APSA 2DF3A 4FULA 5KOVC 1KCRL 2JMRA 2OZNA 3IWUA 2I25N 1ZS2A 4JFFB 2XWJA 3QFGA 2YHGA 4G72B 1OSYA 4JDZB 3UTSB 4ODUA 2CZNA 2R69H 3MUUA 1MI5D 3JWNE 1SYSA 3C60D 1M1XA 4B9JA 4PJ9B 3QRBA 2UZIL 5E94A 1V7ML 1QSFD 2COVD 2CWRA 1Y6MR 2WYIA 5LN8A 3HBQA 3UGUA 4KKBC 2WLHA 2C3XA 5FA4B 2R59A 5JIKA 5JPNB 4DJMA 2NY1C 3LD8B 3GI8H 3S4SB 5HDQL 1E2VA 1VF5C 4HKBA 4PS3A 1DBAH 3MJ6A 1J8HA 5C6PB 1OLZA 3COOA 1FFPB 4HPOL 2ZOWA 4ZFQA 4KVPA 5A1AA 2XG4A 4XPBL 5CIPB 2VZVA 2ZSVB 3LQZA 4OM1H 2OMWA 4P5MB 3L5XL 1Y6KR 4I77L 2AEQL 4WY7L 3TT3H 1A7RH 3ULUD 3D85B 1KB3A 3DJSA 3RI5K 2HXAA 1AG0A 5FB8A 3NCYP 5I16B 1QACA 4NPYB 4EQ3A 3DK2A 3OR7A 4JPWL 1MCHA 4QR7A 4BCYA 1KTDB 4KX9A 5DJAA 4GRLA 4ODVH 3ROOA 1OCCB 3HZMB 1OP9A 2BC4B 1OAKL 4GO6B 4F24A 1DBML 5FXCH 2VLJB 3MNZA 5F7FA 1J1XH 3WEXA 4UYQA 4Q9QL 3EDEA 4M9PA 3W9EA 2VITB 3VD4A 4ODTH 3SE4A 1KTJA 1A8ZA 4YC2B 4HIIA 5L2KB 3FB6A 1AHKA 5IV2A 4IQHA 4EIZC 3UO1H 3VB9A 3KS0H 5JQIB 4I2XE 1X9RA 2QSTA 4TQHA 2NZ9C 2O5YH 1LILA 2YAOA 3BH8B 3TESA 2JKXA 4QLWA 4GUQA 2XU9A 4PLJD 2QR0A 2XX0A 3LIZH 4MXWH 1X5AA 1UHVA 3QULA 3ZZ1A 1KCKA 2VR5A 1TMQA 4HCRH 4C4KT 3GBLA 3V4PH 1HHIB 3HC0A 5HYQB 4LF3A 3AT8A 3K5SA 4QKTA 3S37X 4HIHA 2JLLA 1D7BA 1UXWB 1TENA 2YWZA 5D2LA 4L0PB 4LQ1A 4PJ7F 1N0XH 4O4YL 4AV4A 3L6FA 1E4XH 4HDIB 4JDVB 1U8QB 1HKFA 3QC5X 5SV4A 4B6ZA 3SQOL 4MCYB 1PZCA 1XXFC 4W9JC 3U0WH 3FONB 2X4OB 3NJGA 4WW2A 4U1SB 1LVEA 1WT5C 4IRJA 1IQDB 1EEQA 3MFGB 3WKML 3PFUA 2EVJA 1CD1B 4H8UA 5FYKD 3G6DL 4FNTA 3B4NA 4AEHH 5AFAA 3ARWA 3WN5B 4XMXA 1A4AA 3D3VE 4FG2A 5T1KD 3AWEA 3V5KB 1HYSC 2J8HA 3FUFA 5DRZB 2FX7L 4NRYA 2ICES 3IGFA 5D7HA 4QTIL 3MBWA 3OAYH 4ALAC 5BOZG 5JHAA 2Y6SC 3D9AH 4APQC 4PS4H 3GXUB 2LU7A 4Y4FC 1JFHA 1S9YB 1OAXL 3QNYB 1G94A 2BVOB 4U1IA 4TVPH 3VXUA 3ARBD 4ZFOA 3E1F1 5JTWA 3SE6A 3O0LA 4KROB 5C97A 5DJCB 1XGYH 5C6WH 1L7TL 1IKFH 5L8LB 1FVCA 1WFNA 3MV7D 3HN3A 5H35A 3GPEA 3FN9A 5F3HB 3CMGA 3BN9D 4HIJA 1ZV9A 5DMGC 3ZHDA 4F57L 5GIRA 2R0ZL 2G5UA 2Y3NA 5K93A 2R0WL 1MCIA 2ZYRA 12E8L 1VFMA 2BVEA 2H7WA 2P3YA 3L4XA 3MRJA 3QZWG 4IEFA 1PS3A 1W80A 4JGJA 5E8PB 5BJTA 3IAPA 1DUYA 2VR6A 4WKZA 3CD4A 4U6VH 5C0JB 4WUKH 4R90L 2DM4A 1DZBA 4JFUA 5EZPA 3QXTA 3S36X 1OB1B 3DVNA 4OD2A 4JVPA 4NO0B 4E0RB 3GI9H 4NNXA 1ACXA 4X5QA 1RZ8B 1FP5A 1XH3A 2BNRD 1CN4A 3I6GA 4KXCA 4NKOB 5F7NC 2MPVA 4M4PA 3S2CA 3WIIH 3OHXC 1DBBL 1DQTA 1KG0B 1PX4A 1L5GB 5DCCA 3BH9B 1AD9B 4UBDC 1WZMA 4ZX5A 1KIPA 1NFIB 4FHKA 4QOKB 4HEMA 3WLWC 1BJ1H 3L8QA 1Q72L 3MZGB 4M9OA 3FSZA 5ANHA 4DEWA 4ZYKA 1A21A 2VL5A 2IDCA 3I9PA 3HC3L 5C7XH 3MX0A 4DTGH 3VYNA 1RLWA 5EBLA 4CADA 4E41D 1B3IA 3RFRA 3EO9L 4F8PA 1GPOL 1FGVH 4KY1H 1KNOB 1XD1A 2GJPA 2QV4A 3Q8BA 4MCNA 4ZOCA 5HYFA 2I32A 3CZGA 2JNZA 3WFDL 1AIFA 4HSAC 5DVLA 2GUYA 4PGEB 3I6KA 2XKNA 4NQDA 2IOIA 3KWWB 4NUPA 2QELA 3KNBA 1BQUA 2Y07H 1JUFA 5KN5B 5C08E 4L4VB 5DJ0A 5IBLD 4BKLA 1N18A 3CX2A 4PVLA 3B37A 1ID2A 1ZGLP 1FORH 2QHRH 2VAAB 2XTSA 1OF0A 4J3VA 2A6KA 4NZRL 5JPMA 3HR5A 1JDDA 4MNGE 4PYGA 1GXEA 1NBVL 1P7QB 3IFOA 4OSUL 4N2OA 1A9EB 2ZONA 4ZSOB 1Y18A 1SOXA 3ELQA 2Y9RT 3V6FA 4GFXA 1PZBA 4JFHD 4J3BA 1I1RA 1CDIA 2B9AA 3EDDA 1QUNA 4JS7A 4F7TB 1MPAH 1E5CA 5BV7L 3KGTA 5IVOA 3TP4A 4BH8A 4ZNEE 1S7UA 4XGZB 4KRPC 4KTDL 2A73A 3QI9A 5CLTA 1YDPA 1KV3A 2B2XL 1A7PH 1MG3C 3L4ZA 1LK2B 2EDOA 1WUZA 5EULV 3DC0A 1R3HB 1WIUA 3U9WA 3SDDB 4DGYH 4FL4C 3UTPE 3AS3A 1RK1B 4KI5F 3WELA 3DETC 2EDYA 4LKXA 5KG9A 4YGVA 4LP5A 3VI4B 2HKHL 2MQ0A 3NFSL 5DJ8B 1G7QA 2E9WA 1WZ1H 4LSSL 3GSQB 4HW6A 3IAGC 3BUPA 3T8VA 1G7IB 4MQSB 4ABVA 4PVBA 1J18A 1ZV2A 1IGTB 2VW6A 1A6WH 3L2LA 4HOZA 1WS7A 4ZUTB 2EO1A 3CFBA 3O2WH 2A74C 4PRDA 5CCKL 1GZHA 2O30A 2C26A 1BREA 4XPAL 2FX8L 5T5NG 3P3YA 4YHPB 4CVZB 3KAAA 4HUWB 1G6RL 2R29A 4GSDL 1LWHA 4MAUL 1X5MA 3EBAA 4UOW1 5GGRB 2X38A 4H8VA 5TQ2L 2LVEA 4KK5D 4R26H 4R6UA 1RIVL 3ZRSA 3HPLA 4WHTB 1KTLB 4AQ1C 5LG6A 5HHQB 4RZKA 5E2UL 2XFGB 1GAFH 3DWTA 1WAAF 3FFDB 4P5TC 3FTSA 1JZ8A 3EOTL 3ZGHA 4CSZA 4KBPA 3VI4F 4XP1H 3RVWD 5FPIA 5DEGA 2Y5TB 2ZWNA 3QQNA 1IM9B 3WU1A 1PU0A 4JJ5B 5AD0A 4LVEA 4XTRC 5F7MC 1OP5H 3N85L 1H3PL 4B95C 4S1RH 3B2UD 2X1PA 2IH1B 2F19L 4DKFH 1FL5A 4KTYA 3EO1A 4D0DB 2A9NL 3AROA 4NC2B 4PY7A 4HKJB 2F7PA 5GGQH 1L6XA 4WFHD 4HK3J 1JWSB 1KJ2A 1BZ9B 2XACC 4WI9A 1FQ9C 2X4SA 4NUJB 2FO4A 4YSUA 3FNKA 2QVTA 4N0FA 5DHMC 4WO4C 2YPLB 1N5AB 3SE8L 3QUMA 1ASPA 1G4MA 3SGEH 4F2MA 3P2TA 2C9XA 2WLMA 2ZOKB 3GBML 1BQHA 2G4GA 1F41A 3FB7B 3HB3B 4GJTB 2CBMA 1JHLL 2GSIA 2RBLA 4JJHA 5LBSL 5TQ0H 4JY5L 4XP9L 2BXYA 5AAWA 1CFSB 1KCUH 2ZP9A 2Q7YB 3HI5H 2EDKA 3S6CA 2MHAA 4WHYH 4Y2DC 5DSCA 4G83A 3HS8A 3VXNA 1U2CA 5DJZB 1XGQB 4P2RB 1U8NA 1ZAGA 2B5IB 1NBZA 2BIQA 3LHPH 2DQCL 1EEZA 2SODB 3MDJA 1FL3B 1BVKB 2BIMA 2Y69B 4D0CA 1ZS8A 1I8IA 3MV8D 4ABQA 5AYTA 3DX8B 1ZXQA 3D5OF 3TYGH 2EXSA 2H41A 2V5TA 1AGEB 1MFVA 4B5ZA 1HT6A 3D4CA 2B59B 3GXFA 3ARDC 1XEUA 1ODUA 3JVFC 1Q9KA 2CKBA 4JM2A 4XI5D 3H56A 1OB0A 4GQ9L 3OX8B 3GIZH 5GXBB 2IWGA 4FLHA 4IM8A 3VFTB 3NRFA 4JRXB 3EIFA 3W9DA 2VXSL 3FQWB 3ILPA 4BRVA 2WNXA 1DZ0A 1OO2A 3LKQA 3WSQL 5DD0L 3VXSE 1BDYA 3FH8A 1IMHC 3EJYC 2QV2A 1NCBH 3NIFB 4XMKL 1NUDA 3JUZA 3BPLB 3WFZA 5HYSB 4BYHA 1CGXA 3BSZL 5DQ9B 4UOQA 1JPSH 4YO0B 4ZTPL 3WY1A 4NM8H 5HSFA 4JKPH 4UV4L 4D8PB 4I0PA 5AVSB 3HVNA 1QMUA 4HC1L 1YMME 5D7JD 4H1LG 4GAGL 4FGMA 3A6OA 1AHWC 1IGCH 3TIEA 3B34A 4OCYH 3SDXE 2RQ8A 2NY3B 5DURB 2ZYHA 2L7UA 5H2BB 4YLCA 1Q9OA 5EIQA 3WUZA 1II4E 3E2HC 1IC5H 4OLWL 2XN9D 3WHXB 4RFNB 2P4AB 4X42A 3DHPA 4NJ9L 3VD2A 4MXQD 5F1SA 1U8PA 4XR8C 4DGWC 4N3UA 2EE3A 1D9KB 3IM1A 4UQCA 5HHNA 2VXQH 2YBRA 5FDWB 1BG9A 1SXZA 1Z9SB 4ISVB 4L8SC 3WIHL 4AM0A 1ETJA 3KLHD 5EN3A 2CK0L 5A2KH 3ZK0A 1GGBL 5CN1A 1EVUA 1SBSL 1RHHB 3NIFF 3RWJA 4BGLA 2ZG3A 3NFNA 2XI9A 3O4OB 3Q05A 1NDTA 2FWOA 3UH8A 3W2DH 5KVFL 1LM8V 2GG1A 5F6HI 3PWUA 1J8KA 2E59A 1HZHL 3A67H 3HMWL 3WDHA 1XCTB 2J43A 5I0WA 4QRPB 5GRUH 3RU8L 3F6LA 2C7UB 4NC1C 5C0RL 3MLXL 3OKNB 4OZHA 1HCYA 3KBHE 3G5XA 5HGHB 2D4DA 1JWUA 2WQWA 2J55A 2YA2A 2PNDA 5KANI 1Y0LA 2OJ1A 2B0SL 1AZVA 3GSWA 3QYMA 1J1OH 3IE4A 1AZRA 1QWUA 1H6FA 2UV3A 2IDUA 4PWFA 5DTFB 2GC4C 3T0EB 5CMAB 5HBBA 1E2WA 2DWYA 2XT1B 3MACL 2XQBH 1DQLH 5C70A 4ETQA 2ZZUT 1HC1A 1XIWA 4JZOA 1XAKA 2GK2A 5IHUL 3UABA 3T6ZA 1T5WA 4EUPB 4ONGH 1DBJL 3HHSB 1XDTT 1S78C 1MFAH 5DC0A 4TOYL 4AG4L 4R0LA 5D8JH 1KLUB 3ILEA 3EYUL 4IJ3B 3RWEA 1I9IL 3STBA 3UG3A 4WHCA 3P2DA 5CN3A 2UY6B 1N67A 2XQYA 3HNSL 5HGDB 2J88L 1GSMA 2HVBA 3QJFB 1BBJB 4G1EB 1JHTB 5DD6B 2FATH 3DX6B 3TXAA 4LLWB 2IGFH 2VERA 4M48H 5IM7B 1EQWA 4N2MA 4RLDA 4W6WB 4NKDB 5CUSL 1O7DC 4YHZH 5ICZA 5FYLH 3K8KA 4ZPVB 3SD5A 4JW3A 3O6FC 4FQQB 1KEMH 1V10A 5SWQA 3TN0A 2DRUA 5E1IA 3LN4A 4NFBA 5F9WC 5TE6H 3CWGA 4HLZG 4NIKB 1LDPL 3E6FB 4NNYA 1FDLH 5TH2B 1ZHLA 4M8UA 3CK0H 1ADWA 1T2XA 1A0QH 2ARJB 4Z0BH 5FGBC 5C3TA 4DT2A 5HHOB 1CXLA 4ZUVB 5IW6B 4JFOB 3QB7C 1SF3A 1UH4A 3LRKA 1B4TA 5EN2B 3RGHA 4B0MM 3U9PH 5D7IE 5BZWA 1A8JH 1JZ3A 5E9DA 4U4BA 2FD6H 1R3LB 3QPQD 3T77B 3WHE1 3TU6A 3ZT5A 1HHJB 2WNGA 4GW5A 2EEBA 1WYJA 1NTDA 2DWDA 3NIGE 4LL4A 4K3EL 2XIIA 3HAEH 3RNKA 2X3AA 3OGCA 1ETA1 4Z78A 5ITBH 3P3RA 4G9FD 5I17B 5KVEH 2ZNXA 1IAOA 3QDGB 4Q9BA 4XXWA 5E08L 4HT1L 4BINA 2WWKO 3MV9A 1NAKH 8FABB 1D5ZB 2HX9A 3L1OH 3GSOB 1G5AA 5KSBB 4MA8H 1TQVA 5D93B 2F8XC 1L9SA 1J12A 3UTTA 1HFUA 2ARJQ 3H42H 1AKJB 1GGYA 3UZVA 3C5SB 5SX5K 3L1EA 1TIUA 5EU4A 2LV4A 3WJLA 5F6IB 4OJFH 5JR1L 4UMSA 3NEEA 4N9GB 2OTWA 1S3RA 4H8WC 1SEBB 8CGTA 4JN1H 4KRMB 3S3CB 5MEOA 4Z1PA 4K2UH 4X6BA 4P4KD 4DN4L 4CU6A 3HKZA 5JHLA 1UJ3B 1S7XA 3BAYA 4AZ8B 1PCSA 1QSEE 5CP7B 3AQXA 2WXNA 4OUUB 2XPYA 4WV1B 2XETA 5I6XC 3MLSH 2OMXB 3QEHA 3IDMA 4CKVX 1PX3A 4NHCH 4HS8L 2EEAA 4KZDL 4CU8A 2NY7H 3LPFA 3R1GL 2A3TA 1GTNA 1E4XI 2WXPA 1Z5LB 2GYSA 3WEOA 4K8RC 1OXYA 4M7LT 4OLXH 3SDCA 2HT4D 3GMLB 4ORZC 4XE0A 5IJKC 1R1CA 3EFDH 4W6XB 4CUCA 2R2BA 1MCPH 1J8HD 1W0WA 2Q86A 2ICEC 4C56E 1DN2A 5BVPL 5E6IC 2MPAL 5EBGA 3O3AA 3KWXA 1G1CA 4JFFA 5CBEB 3MUGB 2QPFA 2ZWSA 2IOMA 3V55A 2AQSA 3TEXA 4EVNB 1A6AB 5I8KL 2DMBA 2XA3A 1A9VA 4PJ9A 2E5EA 4L9LB 1ETB1 1DLHB 1OANA 1IB5A 2UWEE 3KBPA 3MLWL 2H0FA 2HFFB 3ZE1E 5LVEA 1NSNH 2Z31B 3BVWA 5FA4A 3V0DA 3QXVA 4GRLD 4JY4B 4HWEH 2YUWA 1KDIA 3LEYL 4OZGE 1RURL 1KJ3H 1F6AB 1FN4A 3AMLA 4NRXB 4WSGA 3S4SA 5JDJA 1YRKA 2OXGB 2XYCA 1JZ2A 3ULVH 4RFEB 2R1WB 1J9SA 5EA0L 5C07E 3N9GH 3SBWA 3F12B 4XB3A 2K3HA 1BAFL 1M6OB 5JYLA 4LVNB 3DIFB 1A1NA 1UZ6F 2OMYA 5F7LB 3OR6B 2ZSVA 5FHAL 2IQAB 1BFVL 1I85A 2RCSL 2Y72A 1QASA 4GT0A 2WOYA 5JHDE 1W2KT 5L8JB 3D05A 4NO3B 3TTSA 3L17A 1NL0H 4Z7UA 3DROB 4NPYA 1A5FH 3LV3B 1PLGL 2OKMA 5LGKA 3T2NH 4JQXA 4PJ7A 5TDPA 3VXQB 5F9JB 3CAFA 4ODHL 3BP7B 1CVRA 2QSCH 2VR9A 2OSLB 4JX0A 2B4CH 3JYBA 2L7JA 2GC7C 2IF7A 1JF6A 3S7GA 3MRRB 2CH8A 3BPNC 4U4IA 5F1NB 3X11A 3VQ1C 4EN3B 3BZ4A 1N2RB 4EBQL 3AS2A 2NR6A 1M9SA 3VVWA 4JHWH 1DO5A 2JFCA 3E3QC 3OSKA 4L3EE 2H2PD 4R4NC 2WLNA 4IRJD 3UZEC 1C1EH 3Q01A 3OJDB 1QD0A 3OQ3B 4N1HB 5AZEL 1J8RA 4LL1A 3BEVA 1LEKA 3RVTD 4LQFL 2XSKA 3G3LA 4M3KB 4NQEE 5DD3L 1QEWB 3J07A 2XOTA 1AXTL 2CRIA 1CFQB 3MLRH 1TG8A 3OKKB 2XTLA 1AXIB 2CBOA 5CR8A 1C9SA 1HHIA 5HD8C 5HYQA 4AL8L 5IFJA 3BGFC 4UM8B 4Y19E 3IJ9A 3L3OA 5EOCH 4YUEL 2ITFA 2D7NA 4R97B 3TV8A 4R4BB 5IQNA 1YEHL 1FNGB 2DD8H 2L8AA 3GK8L 3TNMA 4FKKA 1SDYA 1NCAH 1TVHA 3VXUD 2G75A 4MCYA 1KBGL 4XBGA 2OCCB 3RBSA 1MF2H 2CRYA 2W0PA 5H37G 1CL7H 3DO7B 2EINB 1F4HA 3ET9F 6PCYA 2XX1A 5D1QA 3FT2B 1CLCA 1GCYA 3JSSA 4GIOA 4OVUA 2J1XA 3ESVF 3WTXA 2UUDK 5DRZA 3MLZL 1ZV5A 3HLKA 4AQAB 2FJHB 1CGSL 5TGBB 1RVFL 4UTBA 4N90D 4UCFA 4FQCH 4GG8B 1BFTA 4XCNB 1I9JL 1MI5E 1S9YA 5AVZB 4ZDHB 2BVOA 5I76A 5KVMC 3CU1A 1QSFE 3MO1A 5HY9B 1DJSA 3P3SA 2VMFA 5DJCA 1UKTA 1DVFA 3N04A 1NOAA 1MAKA 2XN1A 4XPHH 1GC1L 2KLTA 5EU7E 4AIEA 4K71B 1HL4A 3KE0A 4PWEA 5F3HA 4F9PA 2FSEA 4LHUG 4UDTA 2WO3B 2WWOA 5CGMA 5DS1A 1JV2A 1NAMH 3ISRA 4GIPD 5KBMA 1ZGLA 4M1CD 2XG5B 3CVCA 4PREA 3DJRA 5E8PA 3GLAA 2IXQA 3I9GH 2BIIA 3W11D 2FYYA 1G7LA 5I15H 5GZND 1JV5A 2OR9H 4I9WD 1QFUL 1E4KA 2E27H 1DQKA 5FYJL 2NY0B 3ULUE 3OHMB 2EIZB 2ERJB 2VLKA 4BZ2L 3U46A 4N25A 1H8NA 5ECGA 1MDAA 3D33A 3K6NA 1TETL 2DLFH 1AQDA 5AVQB 3ERXA 4K7PL 1A6TB 3KW7A 4NQVB 3CSPA 3EXJA 5E8DL 3Q3GB 3BVNB 1MHEB 4TL5A 2V5MA 5ESVA 4NQDD 3VM7A 4XHJC 4A7VA 3D39B 3S34H 4DN3L 4DP7X 1XF4B 1PSKH 3KLAA 3VDCA 3MPCA 1MVYA 1B4JL 3BIKB 3QEGH 5GS0H 4S1DC 4V1DB 1ES0A 1GHFL 1I3RA 2NY2C 2IAMB 2P49B 2KS0A 2YD1A 3CVHH 1QP1A 4PLKD 1F4WH 3K2UL 4OTXL 2NT0A 3ZZQA 1F3DH 4E9TA 5D4JA 2A1WL 4UT7L 1JNLH 5T1MA 1FA4A 2WUBH 4GKNB 3SJVE 4GXVH 5AB0A 3TLRA 1K3IA 2M26A 4LZKA 5GZOC 2FX9L 4L37A 4BFIB 4PGEA 4JO3L 2ZUYA 2OPCA 2J6EL 3KLLA 3FQUA 3KWWA 3FUKA 4I87A 5I6NA 1P6WA 3QI9D 3SGEI 3FKUS 5KN5A 1Q9LA 2F58L 3B9EA 3QHZH 4M8VA 1S4IA 5SWSE 2BSEA 4HXBL 2XWTA 4U7MA 3BT2L 4JPSA 3VH8A 3RL2A 4HJGA 25C8L 3WN6A 3AS0A 5HVHC 1P7QA 4AZUA 3BPOC 5I1EL 3FUHA 4MLSA 3BSHA 4F37F 4NPJA 4X7FC 4F15B 5GJSH 1EZSA 3FN3A 4P5KA 5D96C 3H0TA 2FJGB 1MFEH 3ILDA 5EO0B 2VM4A 1WSST 2HVJB 4LAQL 5I26A 1G7MA 1MCRA 15C8L 4MGXA 3WMQA 1CFMA 2E7MA 1P4BH 3RIFK 1R3HA 2PWFA 5FUZH 3S8FB 3LKSA 5IB1A 4KKQA 1FSKB 4F1SA 5HHMB 4Y5YA 1JZ7A 1X4XA 3RGVC 3QNFA 4HUXA 3ATBA 3VI4A 1MAMH 3WUWG 4MNHA 2W94A 4XMUA 1CLZL 4KVNL 5C0EB 4TUKH 2IBGA 1FZMB 3V6OA 3EJJX 4HUVB 1MSPA 2DQGL 4WI5A 2O1AA 3GSQA 4WDIB 5B4MD 3OZLA 1G7IA 3B9KA 1U9KA 3IJYB 1T1ZA 3SPCA 4HH8A 1A3RH 2EDDA 2VABB 3MU3A 2XA8H 4IBQA 4RESB 4WI0B 5BMFH 5I5IA 3FW6A 3SKMA 3GMPB 3JWNC 1ROCA 2ZG1A 4HUWA 1J87A 1SMOA 2PCPB 1RD6A 4K3DL 4X6FA 5C0CB 4MKMA 1YEEH 2XZCH 3REVB 5CLWA 1J86A 2K6ZA 3G04A 1MW1A 1ZEAL 1M42A 3MLUL 3Q5TA 4Q56A 1G9MH 2RTTA 1UZGA 5HHQA 4CC4C 5KVFE 3KMDA 1DSYA 2XWEA 3HG0A 4AW4A 1AC0A 4AIOA 2G3XA 3FFDA 4LE8A 5C09B 3NACL 2OYKA 5FO9B 4IBSA 4YPGB 4D0BB 2VSKB 3ULUH 1RZFL 2Y5TA 2N7BA 4X9BA 3P9WB 1SDDB 1RIHL 4QRQB 4JJ5A 3D51A 4O9HH 2PPEA 5BS0B 4P9MH 2MCPL 3RIAF 1NH6A 3BKML 5TE7L 1W72B 4KU1A 1IIIA 1K2DA 2IH1A 3QWOA 4DIXA 2AZUA 4D0DA 2YQ2A 3MRNA 1W6WA 3V10A 4HKJA 1U21A 1E6OL 1T7YA 4M56A 3UJIL 3PWLA 3CC1A 1BZ9A 1OGAB 3IRZA 4PHXA 3FU7A 5DC9B 4NUJA 4LVOB 4PG9A 4GMTH 5L2JB 1RPKA 3HG2A 4PRID 1IFHH 4JFPB 2VIRB 2JXMB 3H9SB 3OKYA 3TZVB 1N5AA 2UXGA 1A3LH 4KMLB 2J57A 4X4YB 2FEDD 2A4EA 3NPSB 5ABZA 2GAZA 3SYCA 3B1TA 1W0VB 4W70A 1B0GA 1N4XL 1YJDL 4W9KC 1AS7A 3CLEL 3HFMH 1ZJBA 2EDFA 3LRHA 3NCBB 3Q9QA 3OLEA 4HUUB 4JM2D 4N2HA 1NM4A 1KJMB 1XXDC 4P2OA 4ZODA 3ZMRA 1WFOA 1NDMA 4K5LA 4FEIA 3W1ZA 2WSKA 4U49A 5TK2A 3PHSA 3QG6B 2JI1A 2EUXA 1NOLA 1XGQA 3K8MA 4P2RA 4JFHE 2FCBA 2AEOA 4K94H 4Y2OA 4WK2B 4UANA 3APCA 4CW1A 3ARRA 1FL3A 3ZKXB 4ZFGL 2FLBT 4HWBA 3DRTA 1O5DT 2E7HA 5PCYA 1RZKH 1JF1B 3MNWA 2IPTH 2H9GA 3JWDL 2HH0L 4AK2A 35C8L 4LHQB 1EZVX 1MLCB 4XOAA 4I0PD 5FYKH 4N5UA 4OCSH 5FCUL 3UMTA 2F7RA 4BWUA 2DIJA 4TNVK 2VDKH 2IPKA 5ENWB 4KUCD 4I1NB 1JGEB 5B7EA 3UBXG 1YN7B 5B38B 4YNYB 5D4QA 2YSSA 4Z3FA 1U58B 3BEWB 4M6MH 4Q97A 4JRXA 2H32H 5J8OA 1MVUB 1LNUA 2KLRA 3JVGC 4QXWA 2F54B 2VQ4A 3CPLB 4HJ0D 4CILA 2GIMA 4FQHA 5DQ9A 4YO0A 3P11H 1UWEH 4D8PA 1G7PA 5IBUG 3RZCB 3BQUA 4L4JA 1OY3B 3DXAA 4HIXL 1P5UB 3QDMB 4AW7A 4GXFA 1CFNA 1X5FA 4XNMA 1M2OA 3K4ZA 1R47A 2NQ3A 1FYTB 5CFHA 2MNUA 1UTDA 1I1FB 1V3MA 3BIBX 3H3KA 3K2KA 1JWMA 4ERSH 3WHXA 3H85A 3AXIA 1DQML 1DDHA 2WVUA 1RAMA 1MNUL 1EO8H 3S5LG 4LU5H 2APXA 1YEGH 1JSYA 3L5WB 3VX1A 3ARGC 4RAVB 4UUJA 2AQ1A 3ZMNA 4QHUA 3A21A 2WVTA 2Y36L 1QPXA 3N40F 2ZWZA 2PLTA 3ZU8A 2FT8A 4AJ0A 3AB0C 1B88A 1XIWD 3MJ9L 5DJYA 2DKSA 5G2NA 2XFXB 2Q8BL 3ARUA 3NCJH 4XCYA 1R0AL 1BZ7A 3S36L 1XCTA 5IB3B 1QZNA 2BY1A 4F33B 2C7UA 4KVCH 2YWYA 5CGBA 1EAPB 3BLPX 4UU9A 2OL3A 3D25A 5HGHA 5D7LB 5CZKA 2EEFA 2D7TL 4BQ9A 2UVEA 4JO4H 5DWUH 2NXZB 3LKOA 1LDSA 5GGSY 4J3OF 4PJAB 1BD2D 1DJYA 3UC0L 4NQCE 2NNAA 3QEQA 4CGUB 4AT6B 1LP9F 2AFNA 2JB5L 4L5FH 3L3DA 1CD0A 3I75B 4JRYE 3B7RL 4NFCA 4F8QA 1Z6JT 4B53A 4KX7A 1FO0H 2IALA 2QGBA 1HTYA 3HW7A 3TN0D 2CGRH 1JOIA 4NZTL 3H4FA 1ONQA 1HS6A 3RPIA 1SN0A 3GXNA 3KBFA 4Q0XL 2CLZB 1PD1A 2X4UB 1CXKA 1AH1A 4G8EA 3MV8E 5IT2H 2GUOA 4PJXE 1YYCA 2FT7A 4YL9A 1T2JA 3BHBB 4HISA 4XN5A 2FIKB 5I73B 5HGDA 1E9PB 1FAIH 3MCYA 4U3SB 1ZPLA 3MRHB 4XCCL 3BO8A 1THCA 2ESVE 1QBBA 1JHTA 5E9DD 1DFXA 2WQAA 1YEDA 2ZIDA 4JFDA 4QCIB 5KVGH 1YY9D 2F2HA 1U2HA 1ADQH 1RZPA 3V4VA 3BI9X 1IBGH 5IMMA 3X2QB 2VC2H 3LKNA 4PJAF 2AXFA 3NBNA 3DSNB 1RZJH 2R0LL 1RULH 4P3WA 3E6FA 4YHNA 3BLBA 4R8WH 3WFCL 1QUPA 2BIOA 2VDOH 1U36A 4POUB 3MV9D 2R29L 1EMTL 4JFOA 3MOQA 5CZXD 2DQEH 4WFGD 3WS3A 3UTTD 5FGSA 4GPVA 4I89A 3L3GB 2NSXA 1AG6A 2MWCA 1EFXB 4HEPA 3KM1A 4QRSB 3T77A 1A64A 2YK1H 1HHJA 2CRZA 4ZS7H 2H26A 2X53A 4N8VA 3WD5L 3PP4H 1LE9B 4WENB 4AENA 3Q13A 2WP3O 4IOFC 4RWYL 2YLKA 5AVRB 2FR4A 2BDNL 4MQ7B 4BSVB 5KSAB 3MBXH 1JNNL 3GRWA 4FQ1H 2UXFA 5B3JE 2NRDA 2Z6FA 4P49A 2MCAA 5CJOL 4G9DB 4JG9A 1ZJAA 4K5NA 4ZFZA 1I8MA 3VWJC 4A2LA 4XN2A 1AGDA 2YC1A 1D5ZA 2HB0A 2XC8A 5CBAA 5DC4B 2E86A 3GSOA 1WUNT 2GFBB 4MD4B 2RD0A 3TA3D 3UAAA 1NEZB 1UEYA 3IMBA 4OD1H 2ADFL 4TYUA 1OM9A 2NXYD 2IGLA 2ZUQB 2XN0A 3SDCD 3IFPA 4N9GA 2BNUA 4PJCF 4IBLT 2A38A 4F5CA 2BSTB 1PVHA 1GSKA 3UACA 4DKAA 3ZJAA 4Q6YA 1EO5A 4PV8B 3IDNB 4OIBA 4EXPX 1C12B 2NSQA 2CR3A 1KN2H 5EOTB 1TZ8A 4AOFA 3QDJB 1M56B 4PJ6A 1OAJA 1V7NL 1CR9L 2YAFA 4JFFD 4AEIL 3WE6B 5KBPA 1N5YL 1NM9A 5DEFB 2FH6A 1U92B 2VZTA 5A2IH 3KGRA 2VXTH 3KL3A 4PJ9D 1J9RA 3L3HA 3KYKL 5AKRA 1JPFA 3FCSA 4IBUA 2VZ3A 3RWGB 5JLZB 2X4RA 1JXGA 1KLGB 2B7DT 2LU5A 3HBPA 4ZUUB 5IP4A 4JPKL 1OOAA 4Q9RH 3LZQA 2H47C 3ZYOA 2VUOA 1YLBB 2BPBA 2XCMC 4HZLB 1CL7I 1TTGA 4XN1A 2Q8AL 3C2AH 3FHEA 3HE7C 1QYGL 3L1FA 3OXRB 4FZEH 1KPVB 4G2AA 4XNXL 4L1SA 4A2FA 1HOEA 2OW7A 2ENPA 4RSVA 1P7KB 4BSJA 3PIQB 3RWDB 5CBEA 3P0VH 5ABDE 1LWJA 5E8EB 3GUTA 1FG9C 4FG6C 1IGFH 1I4FB 4DZ8A 2CHZA 1NIBA 4IU2B 3F58H 3BUYB 3HKFA 3QCUH 4L9LA 3TWCL 3ZDYE 4XOCA 5SWZB 5CLYA 2YUVA 2HFGL 4I18A 5C8JA 3P9MA 2TRYA 5CP3H 3RKDD 3U0PA 1DBKH 4RFEA 2R1WA 3MRIB 1MG2C 4MLIA 2AJUL 3F12A 3VM5A 3VXTB 5L0QC 3JTTB 4JCLA 2VKWA 4OU3A 5L2KD 4P5SA 1M6OA 2NR6D 2YD8A 3FYEB 5JW5A 2WGNB 2IQAA 3BXNA 3JTBA 1QRNB 4WGVB 1I53A 4NO3A 2AABH 4I3SL 1MW0A 2R0KH 3PABA 4BH7B 1IKOP 3CFCH 1AGBA 4LKCB 3LNIA 3KR3L 4X4KA 3QIUA 4NN5C 3BGAA 5EU5B 5AVVB 3RGBA 4OQTL 2BSCA 3II1A 4URKA 4PD4K 2QQKL 2OSLA 4B50A 4JZJB 1V3JA 1UWYA 3P4MB 4G9FE 3HZKA 2P8LA 2G2PA 2YRBA 2BNQB 3AADB 4MYPA 5ABAA 1CLOL 4AX3A 1OF2B 2IDQA 3I2CL 3QR0A 5BQ7B 1N2RA 3WYRA 4DP2X 1NPNA 3SY0B 2BX5A 3IGAA 3ZKSD 1MCSA 2JIXA 1FVDA 4ZT1A 3VO0A 2K8MA 1XF1A 3CIAA 5EWIL 3WCYA 4A2MA 2V9QA 1UH2A 43C9B 2Q0ZX 5I8OL 2OTUB 1QKZH 1S7VB 3VAEA 4UT6H 1N19A 5INCB 1HXMB 1JI1A 3GSUB 3VSVA 2JCCA 1SLVA 3INUL 5EZIL 3CCHB 2DBLH 3B1UA 1EHAA 1T1YB 5FHBH 4XP5H 1LL1A 2BWQA 3NGBC 2O5XL 3P54A 4B27A 3GGWB 2Y5EA 3QQ9C 4K55A 2FB4H 3HS0C 3POHA 4IGBC 3PXJA 2VLRA 3VXMB 4U1KB 3CC5B 1FNGA 3OKOA 3PL6B 3KCPB 4QYOA 2XIBA 1U91B 3UAJC 1DHKA 1KGCD 4KROD 3L7EA 4K23H 1IAMA 1MUJB 2B39A 1DVFD 1KMGA 2AJZB 1AFVL 5ALCL 3TFBA 3H3PH 3KPLA 4FP8L 3QYCA 3I02A 1JNHA 3T0VA 4Y4KC 5T3ZL 2TAAA 1KTBA 3BFQG 2HJKB 2IQ9H 5HYIA 4KZCA 4N85A 3GNML 2PCFA 3T3PE 4AQAA 1ACZA 1HEJC 1BXXA 4GKOA 5IEKA 4PSPA 1ZLVH 4ZDHA 5KS9F 3IE9A 4LSTL 5GSVB 2FBJL 5HI3C 1QTPA 2KZ1B 2VLKD 1GOFA 3S5ZA 1PJWA 2LAAA 1D2PA 4CN4A 4RIRB 1U93A 1LO4H 3VG0L 1KCLA 2VZUA 3O2DA 1UOKA 3LNHA 5AW2B 2X7LB 4XAWL 4P9HH 1HH6B 3PWPB 4YSDA 5HVGB 5D5MA 1A66A 1XVSA 1YC8A 3RY6A 3HI1A 3DK0A 1SXNA 1XGRA 5GJTL 3O3DB 3KGUA 4P59H 1AI1L 1SHXA 3B8SA 3ZDXE 3V79C 3MRGB 1E42A 2UY7A 4XWGL 3K2MC 3C5ZB 5EZOL 4R2GC 5BUGA 3N55A 2H6PA 1OTUD 2HTKD 5DJDA 2GSGB 3NSCA 4F2EA 1SM3L 4N68A 3VTAA 4MSWA 4XBEL 4NQVA 2GJRA 5MENB 4Z7OB 3TBTB 4WK4B 3BVNA 1FPTL 1CD8A 4LASH 1H8OA 1YQVL 1T7ZA 4KI5D 1JPEA 4HJEA 3GS7A 4NJAH 2B4CC 1UWXH 5IWLC 3HC4H 3D39A 1FFRA 3GSVB 4J6RL 4NBZB 2A0LD 1OCOB 2BSED 3B3IA 3UERA 2VDLL 3BIKA 4A7TA 3LZFH 5C9JA 1TVBB 2A4ZA 5JHLL 1P7QD 1SXSA 4HMDA 3PWVA 3WNIA 4FFZH 1QG3A 1S5HB 1BEYL 3QISA 4Q58C 4NQQA 4FJ6A 3PY9A 4FTVB 2AF2A 3QUYA 4AEEA 2CLVA 1PNDA 2H1PL 5C0IB 1CU4H 1IFRA 3VB8A 3CH1B 4BKTC 2EIJB 3ME0B 4XVTH 4N0UB 3VXRB 4KWUA 4X9YA 5E6SB 4X50A 2ROXA 4FYRA 2IH9A 2Y1VA 4EDWL 4GAJH 1RZIB 1G9HA 4AQZA 3MXVL 3A4EA 1KC5H 2Y7OA 1OVZA 1RXLA 3IBEA 4HS3B 4KKZA 3MLYL 1RP8A 3JV6B 4RSYA 2PR4L 1BOGB 4U1NB 3MFFB 3PUUA 4HWUA 2FJGA 1MFDH 4Z7VB 4M5YH 2R7EB 5EO0A 1SBBA 4H4NA 1TJHH 5IOPB 3BP5B 1TU2B 2Z8VC 1IQWH 3VYOA 1T20A 1TZHB 4BA0A 4L0ZA 3RNQB 1SMAA 3EHBC 5HDOA 1UCTA 3U7YL 4AE1A 4TRPL 3U4AA 4I3RH 4JKNA 2VR4A 1M53A 5E00A 4E9VA 5E4EC 3HNTH 3ALPA 5L4JA 1E67A 1HKLH 3CQQA 4G3YH 2ZXGA 4BKSC 2O26U 2R8SH 1XH1A 5C0EA 1BLIA 1DSFL 1OAYH 1A7NL 4YHLL 1FZMA 4HUVA 3DV4B 4MAYA 4G7QB 3IU3A 2OJEB 5TF1L 5F7KC 4N0YH 3GSXB 1VZIA 3IJYA 3AS1A 4LMQE 3BVVA 4ZS6C 3D09A 5BCAA 1IM9D 1CLYH 4G8GE 4WI0A 3MA7B 3P1VA 3EZJB 3GJFH 3GMPA 3NQKA 4I9WE 1KB5A 2FHBA 1QFWM 1OAZL 2DTMH 5C2BH 3FF8A 4O02A 3DX7B 4Z7VF 1H3TA 3UP6A 1JHKH 1A1OB 3RQ3A 2BMKB 3ISYA 2ORBL 1NGPL 2AW2A 2FEEI 3IFNL 2XXGA 3QCTH 5H4ZA 2Z4QA 5F2FA 3IMSA 3Q8CA 2AXGB 2YPLD 3X3FL 3IVKB 2C3VB 5GRVL 2P8PA 2XPZA 1BM3L 2C9SA 4NQDE 3IB4A 4G7RB 1OTSC 2Q1EA 3HB3D 1NGQL 4APQB 4JO2H 4Y5XC 4Y4FB 5I8EB 4U1LB 5CD5C 1SVZA 5D1XA 1R5WA 2QKIC 3ES6A 3MLVH 1LQSR 4MNQB 4WZ9A 3V0WL 3S8WA 1EVTC 1SHWA 4YDJB 1NGWA 3AREA 2O93L 1K3ZA 1UB6B 4UM9A 1W72A 3SZ6A 2AXJA 3JUYA 4P2OD 3SKJH 1TZIB 2NX5B 2L4OA 3BZEB 1DSWA 2V7NA 3H9ZA 5DUPL 4P2RD 1KB9J 4JK0D 5L2JA 2FO1A 1MLBB 3TZVA 1TLKA 3ZSSA 4CDGC 4QHKI 3GTNA 4MMXC 1XHHA 2VAJA 2OJZL 4PWGA 4LOEA 1W0VA 1KTCA 1E9OB 4M02A 3ZTJH 3EXLA 1M6UA 1B6UA 3FAWA 1JGLL 3OB8A 4AIXA 5IVXB 1DQJA 1UA6L 2WQUA 4GP8B 1SUHA 3X12A 3RWFB 3VSQA 3ECQA 2R69A 3FO2A 3MJ7B 4LARH 4QXUH 2XBTA 2FGWL 3OHXB 4JRXD 3WTUA 3G6JA 3ZYJA 2VDMB 5GGUB 2K4AA 5ETUA 4CC0A 1C8QA 2XRAH 2E9GA 4QXGH 3OMAB 1KENL 4UILH 2WAQA 3DJ9A 5EO9B 3O9WC 4YAQA 1UD8A 4FMFA 2DYPB 1CMOA 5C0BA 1NCGA 3C5JB 1I8LC 1SFDA 2WSDA 1JF1A 2D7QA 1ZTXL 5BV7C 3WJMB 5L9DH 4O58H 1MLCA 3CHSA 1S7WB 4JKWA 3S37H 5IQ7L 3UTOA 2C4FT 3BD5A 3PGDB 1V27A 3V9EA 3A0OA 4LRNL 5ENWA 3LQAL 2NY3D 5B38A 1PFCA 1ORQA 4GAYB 4HIEB 3PS6A 2QGCA 2EC9T 5MHSD 4QHNB 5L6YH 1MVUA 3FRPG 4RAUB 5IVXF 4E9RA 4D9QE 2F74A 5AZ2L 3CPLA 4AGQA 2I9TB 4ES9A 5J9PA 1WBZB 2F5BH 4X8XA 1PZ2A 3QNZA 5F8QC 3X1EA 1X7SA 5E4AA 4PJIB 1XGTB 5DGRA 1HVXA 1TKWA 3RZCA 2DWEA 1DLFL 4ONHB 4JHVA 4PP2B 3FB5A 1GJIA 5I8CB 4OZFA 2XVGA 1G1KA 4M7JH 1A6UH 4IMKA 1E27B 2JKNA 4A68A 5ISZB 4K5MA 3VGHA 5MENE 5IFHH 3IKCA 1TTBA 5HHVH 4KDTA 4NSKB 3L7FB 4F2ME 4KRPB 1LP9A 1F42A 1RZQA 5DYFA 3SBQA 5IBTL 2GIXA 5FECB 2Z93B 1MCWW 3L5WA 3NZHH 2NY5L 4QPEA 3QRGH 3BDYL 5L7XH 3NABL 1FH2A 1VCAA 1F45A 2VGLM 3W56A 1U8CB 4X98B 4FL4B 3KPOB 4H26A 1NGZB 3X14A 3BOVA 2AXHA 4HD9A 2BJML 2EICA 1VSCA 4TSBH 3A4DA 1E4WH 4PJIF 3VW3H 5IB3A 4JB9L 4MB5A 2RH0A 2BZCA 2BWIA 3VD3A 5CAYB 2F0CA 1CO1A 2ITDB 4ZX3A 1CTMA 1X5ZA 3VX0A 1AIZA 2A74B 3FT4A 2ZF8A 3LS4L 1E5YA 2DQFB 3KHOA 2J6WA 4BD4A 1INDL 1IIKA 1DQVA 4PJAA 4ZOEA 3QAZB 5KYXA 3AXHA 1G7HB 2AJ3B 1UD5A 1UUSA 3GO1L 1UXSA 4X6DE 4JFDD 4EAEA 2RFXA 3FQNB 1L0XA 4KJQC 3NYKA 3PDDA 1JCVA 4AUJA 5G4NA 2EIEA 2BY0A 2WO2B 1I7ZB 1Q94A 1DJIA 5EU6A 2BERA 3U6RB 5IHWA 2OK0L 4KFZC 5IUSA 3MGOA 1KPUB 9CGTA 4P5TB 4YOKA 2ZSWB 3QFDB 3KPMB 3TO4A 2X4UA 5A2CA 4OV5B 4QHMA 5ADOH 3RE0A 5HHOD 2X4QB 5GRJH 1NMAH 4Z7AA 4GRWB 1KY7A 3VFPB 2R9HD 3V6ZB 4U3SA 2OMVB 4MZ2A 4OV6F 4WI2A 2B1HL 3A3YB 1T4KA 1HX0A 1UM5L 5ESQB 2ADIB 5DQDH 4QCIA 3T1WA 4K5PA 3VFGL 1IKNC 4B3VA 3BP6B 1N12A 2BOCA 3CXHJ 2ZICA 4WQOA 7FABH 1PKOA 1F2XK 4Y16C 1KLFA 4WO4B 3TBWB 1NMCC 4TNGA 2D7MA 4ZQKB 1ZHBB 2YGNA 1LO0L 4L2LA 3QJHB 2J2ZB 5EBMA 3PGFL 3K71B 1SN2A 2IOOA 1XO8A 4IU3B 1A1MB 4PJCA 1WHOA 1BVZA 1HNFA 2HG5A 4NZUL 4YE0A 5BOPA 5JOEA 3F7KA 3ARBC 3S3DB 5K9JH 1EFXA 3K6OA 3WD5H 1BVLB 4QRSA 4IHOB 4YXKH 1LE9A 1IGIL 1TJIH 2CPCA 2HAZA 3NIDE 4RFOL 1AANA 4Q4IA 2AJYH 1FFTB 4X99A 2H3KA 4ENEC 5BO1H 3CMOH 4BSVA 5K59E 1OCWH 4M8RA 1GS7A 1ERNA 3DIDA 5DMIL 1S7RB 4NXSA 3FO9B 2CBQA 2X87A 4G9DA 4F9LA 1XZ0B 4TNEA 1MRCL 2J1WA 1KEGH 1KJ2H 2ZXCA 4QXTB 2ZOOA 5EIIG 5IFAL 1FL6A 2AKRB 5HGAB 1ECZA 3VGAC 2VDRB 4NCDA 1JYVA 1NFDB 3VYPA 4UV7L 4DETA 5A7BA 1VKXA 1HINL 1UT2A 2XNAA 1L7IL 4AXWA 3QUMH 4YSCA 5I30L 5IB2A 5FM8A 3ZN6A 4LSRL 2XZAH 1GL4B 3RVUC 2EDNA 2Z7ZA 1FI8C 3CN0A 4M4RB 4UQ2A 1C12A 5B1JA 4E5XB 3VWKC 4U1GB 4OUOA 3C8DA 2X6AA 2XY2A 3L9RB 3QDJA 4RGOL 3GKWH 3KXFB 5B8CA 3WE6A 4AYDC 5HDLA 3T65B 2A6JB 2AQ3A 5I0XA 4G43A 3ZUNC 1AHWB 1YEKL 4TUJA 3SQBA 1NGXB 4QWWC 1MREH 3CDGB 3TBVA 3NJJA 3P9LB 4ZUUA 2ZCLH 4CAGA 1ZWIA 3E2HB 4HWBL 4M1GH 4BFEA 2H2SD 2EKSA 4KKAD 4XXDB 4BUHA 4XNDA 1FIGH 1NFDF 3KLSA 1HEHC 2G30A 4QY8B 4S1QL 5CLZA 3WLBA 4O2CB 3FOMA 1KFAL 5IVZA 3EBHA 2H8PB 1DJHA 3C9NB 2CKBH 3RIFF 2CM5A 3EYQC 4QJ5B 5KZCD 4BHUI 2YARA 5L88H 3OZ9L 3PIQA 4L8SB 4LLUB 4TQPA 1G6VK 2VT0A 1PZ5B 5F72S 1R17A 4GYBA 1FE8H 4TQ8A 4M5SA 2EXTA 4XPTL 1CXFA 3ESPA 1QI3A 3BUYA 1QZ1A 2BRRH 2VDQH 2W0FB 4QTFA 3TT1L 5ID1A 3HZVA 4NQSB 4PRHB 4XNUL 3F7PC 3QIUD 1J05B 5JOFA 3MA9L 4ODXA 1U3HA 4XVJH 3VG9C 1MCWM 3UTZA 2X3BA 3TVMA 4HU8A 2WUCH 3VCLA 3CDFA 1BZOA 1R9FA 1A6VH 4E9YA 1OK0A 2MFNA 3HPJB 5AW0B 4F3FB 1YNKL 5TDOB 3TA4D 1DEDA 4FYTA 4KXBA 3VXTA 4WFGE 3BFOA 2VH5L 3JTTA 3NESA 4FABH 2QPEB 1ZHNA 4RH4A 3VU1A 1KELL 3UTTE 3WO3B 2JIXD 5E6UB 1G0XA 5EF3A 3M6DA 1DVQA 2NW2B 4D94A 2CDFA 4NHUB 1T1WB 2P5WE 3IDXH 3MUY1 5AZUA 5EC1A 3W5MA 1T6BX 2GPZA 5MEQB 1IGYB 4LKCA 2IANA 1MQKL 3S9DB 4LVHC 5GSRA 1WLHA 4X83A 2DQUL 4JZJA 1EJ8A 1VAHA 1KF9B 4LEXL 1P4LA 3IGUA 4OCXH 4I48A 3NSFA 2VLRD 1VZHA 3CN2A 2AV7A 3PP3K 1MHPL 2BO0A 4U1MA 3VXPB 5KYUB 3QHFH 2W8CA 1UCBL 4UINL 4HG4J 4G1MA 5T3XL 1A02N 3Q6GH 3K46A 3O6FB 3OJ2C 4J6IA 4NGHL 3C8HA 4N2LA 2AAAA 4ZUSA 1S7TB 2OTUA 1BFOA 3SYQA 5F9WB 2Y7MA 1NICA 3DLQR 2OL3L 4WW1A 5INCA 2GK0A 2E76C 3IT8D 5GISH 3CCHA 4OGQC 3LVTA 5TF0A 5KS9A 4NWTH 3IJHB 1WZLA 5I5MA 3JWOL 1X4YA 1AD0B 1TO5A 3K7UA 2PO6B 2ZCHL 3VXMA 2BVPB 4U1KA 1YC7A 3CC5A 1K4CB 3V0JA 3WFEL 1HQRB 2YR3A 4EPSA 5FW8A 1BZQK 3B5GA 4H40A 3NCFB 3OLDA 3ZRFC 1YHPA 2N59A 3BCDA 2AVGA 4ZZKA 4JO1L 4LBEB 1K6QH 3S35X 1XV8A 1MCKA 2YD3A 4WJ5B 2JVUA 3W0WA 5CJQL 4LHJB 2N4IA 4LLDA 4K9EH 1H3WM 1C5DB 3LXBA 1QTYT 3P4LA 1G9EA 3RG1C 3M1BB 4TNVF 5FFLA 5DUMH 3UG4A 3V4VL 1S9VA 2ETWA 4XVUD 2MSPA 3T09A 5JA9A 2W92A 3WS6A 1J0ZA 1IBYA 3X13B 3R7QA 3ZE0F 4F8LA 2NY0D 1Q9WA 4FFWD 4U6XB 4Z7UE 4ECNA 5J1AB 4HOWA 1D6EA 2G3NA 2O5ZH 2N7SA 4OM0H 4P57A 4PJ7E 2KZBA 3KYOB 3TCLB 1YEIL 3BVTA 3HA0A 4PRPA 5F96H 3QJVB 1HZLA 4AMKL 2VXUH 4P46C 5CEXA 1J5OH 1S5IL 3QCVL 5EG6C 1EXUB 1HH6A 2J1YA 3LCYA 5I6XB 2CDEA 5LUMA 1AHMA 3IGLA 2MCMA 4M7ZB 3CFDA 3QXAA 2FWLB 4YDVB 4BQ6A 3D39D 3BRFA 3WKYA 1H0DA 4Z9KB 1WEJL 2A9MH 4KK9D 5I0VA 4G7YH 3LH8A 1VCBC 4V1DD 4PUBH 3GRWL 5GGTL 3A6CL 2VXQA 1NDGA 2X6BA 3H8NA 3VH8G 1DJWA 1F4XL 4Y1AE 1UFUA 4KNSA 4PJ5B 3AU0A 4XCFH 2NQCA 2UYLA 1EUUA 3HBGA 4FFYH 5EFIA 2EVIA 1JGUL 4PJFA 1SJHB 4FXKA 3QUYD 2F1AA 4N4YB 4Z23A 3D48R 3RWIA 2PW1A 4L0YA 2H3NB 2VDNH 3DV6A 2AQPA 4FZ8L 2HJLA 4S1SL 4PRAB 2YFOA 3EFOB 2WCSA 5F8RC 3HRZC 3KYMB 3GSVA 3DURB 4Z7QB 1D5IH 2Q2LA 4ZMLA 5G4MA 1OGSA 3ETSA 4RMSA 3EGSB 4NM4L 1TVBA 4Y88A 2WWMC 3IXAA 2D3VA 2QADC 4OCRL 2X6UA 3LOWA 5FK9B 2QQLL 4ACPA 1IC7H 2BRQA 2CLRB 2XY1A 4J39A 5D1QE 4UQIM 4XNQA 3S96B 1J5CA 4FTVA 1TJGH 4NNPH 1UOWA 3BW9B 1BWMA 3WNMA 5DJXB 4PJHB 3UROR 3LVEA 3ZO9A 4K3JH 5C0IA 4MX7A 2VJ8A 2VDRL 2HP4A 1WE5A 3FQ2A 4R7VA 4AL8C 2YD2A 3EH3B 3MXWH 3KLHC 4HUMB 1T66C 1U8KB 4DFHA 1AZUA 1F58L 1HSAB 3LEVH 3O6ML 4MFHA 1ZTXE 2ZPKL 3SOBH 4IBYA 1ZLUK 5HHMD 3D18B 4WNQB 2PTUA 1UXMA 2W88A 4JFSA 2VCOA 3WXWH 4Z7QF 4DGIH 4HS3A 3BYYA 3OM3B 2E9BA 2HKFL 5I66A 1AS8A 2WNWA 3BPNB 1E8YA 1L9TA 3MCLL 2WVVB 4U1NA 3WOVA 4PVMA 4LCWE 4X80L 5DLLA 2R7EA 3BKCL 4A2DA 2AGJH 4QRTB 1F4YL 2AI0H 4HBCL 4MD0B 4W4NA 1QLEB 4PJHF 2HYMA 1SF5A 2VLKE 1EXHA 2B1OA 1CF1A 5A6MA 2IH3B 1MIEH 3BAKA 2I9LA 2Y2YA 3KPNA 4IW4C 3A6BL 4KTGA 3P2BA 3O3EB 4HXAH 4O2FB 4B9IA 2OX5B 3B7YA 3GJEA 1CYWA 2MEJB 3KPQA 5I74C 1CTOA 3BGFB 5CIPH 3QWQB 2LE9A 1GC1C 1HHHB 2KPWA 1QVOB 2GQHA 4KJYA 4IJ3C 3HAEA 3OBAA 4XNBA 5JW3L 5J3HC 1CZ8L 5A2AA 4WCYH 4RMQA 3U0TB 2N0MA 2VWEE 2X42A 2Y7QA 3E8UH 4OR1A 4J3TA 5D1XD 4OFQA 1Z5HA 1GKOA 4JMXA 3VFUB 1XR8B 3NH7L 5LAPA 3WNNA 5AOKA 1WRFA 3ARED 4UM9D 3Q5YA 4OGXH 4C83A 1WT5A 1AO7E 4CGTA 1J11A 3ZR5A 4NRZB 3QUZA 4NZFA 4KQ3H 1RUQH 3BKJH 3NEOA 1A1OA 3DO3A 2QDWA 4NWUL 3PNWB 2C1PB 1ITBB 4J2QA 4MMZC 4M6OH 1MHCB 5CU9A 2V2WA 3QW9A 2QHLA 3TZVD 2WGXA 4BIKA 3H9SD 1HESA 3IVKA 4TQIA 2K6WA 1CE1H 2OMBA 2Z92B 1QR4A 3IEAA 5IW1B 4YS4A 4PJDF 2H5UA 4AQEA 1UYWL 4G6JL 5I8EA 4BA8A 3US0A 2Z9TA 3EUDA 5I19H 4H2CA 4TTDC 3M8OH 4MNQA 3SDYH 5FWQA 1EGJA 5DRWB 3FT9A 1GMIA 4P23A 4CU7A 1VACB 2F53B 4IRZH 2L0DA 2QTEA 4JG1H 1OPGL 3SPHA 4KI1A 4AH2B 3FDWA 3BZEA 3VFWB 1NCDH 1IAKA 4QT5A 1BZDA 1JCKA 3OLGA 2YOCA 1WQVT 2BP8B 2WV3A 3FN0H 3MODH 1WAEA 4R3SB 1MW2A 3AG3B 3I85A 1PX8A 2OSXA 3C6EA 4ELKB 1PKQA 1A9BB 5J11C 1V3LA 5C0BD 3BZFB 1S9WB 2FBRA 3DMMC 2GT9A 3FYIB 5GGRY 1AZZC 1QFHA 5D7SH 1DQDL 3PXLA 2EDJA 4RMTA 5BO0D 1R3KB 4PW4A 2X89A 3APMA 2D3NA 3O45B 4EI0A 1XF2B 2XYBA 1YYLH 3H7BA 4W81A 3VI4E 4KPHL 2OXHB 3MJ7A 1BLNB 4P4KC 1MCBA 4N2KA 4XO4A 4C4UA 3F8UB 1HHKA 3OHXA 3V6OE 4HKZB 4UTBH 4ONFL 1UB5A 2E7BA 3Q1SL 3QO1B 1OAUL 4G7VL 1AP2A 3GYRA 1UACL 2VUKA 1UD2A 2O6PA 4KH9A 4Y0GA 5B21A 5LWYH 4KNTA 4WV1C 2W65A 2WXIA 1NPJA 2XKSA 3U2SA 1MEXH 5EORH 5I1CH 3RAJL 3QFJB 2NY2B 5E70A 5AW8B 3RZCD 3U7WH 1DANU 4KZ0A 1EHKB 2ZKXA 4XMPH 5DZNA 3KWUA 1SOKA 3M7FB 3O2DL 3QDMD 2B15A 4QRUB 5LGJB 5I1KH 1ZA3B 3MI6A 1JVLA 2NCMA 4GB9A 3L5HA 5KJRH 1EDHA 2P43B 4GAYA 4WFFD 1FYTD 4JRLA 2DI9A 4FXGC 5AWNL 4EOWL 1JS4A 2EDBA 3CXDH 3NJFA 5F88B 3F2LA 2Y7NA 5AG9A 1M05A 2LVCA 3L3IA 4UQAA 4AVJA 4FFTA 3V4PB 5A16A 5HGBB 4DAGL 3HFFA 2BK8A 1KGUA 2K7PA 1K4DB 1N6QL 2VDPB 1B2WH 3LN5B 3EGXA 2XHNA 3O0RL 5I1LA 4ZAKA 5FO8B 3CQFA 5HVHB 4FQJL 5JXEA 3U4BL 3BPOB 1A65A 3WJJA 2VQ1B 4XCEB 5EO1A 4MJIA 4K5OA 3APDA 2Z31C 4GRLC 1DQIA 5B39B 3WNPA 1E27A 5D96B 5ISZA 3GHBH 2KBGA 1KCVH 2XZZA 3QP3A 4RISH 5DRNB 4H88H 3ZBMA 4WLCA 3PV6A 4FYSA 3HG3A 3FUDA 4NSKA 2O6DA 5E8OA 3VD9A 5D7LD 5J57B 1EHNA 2NY6C 3OAZK 2CO3A 3VTMA 1OKEA 3EOAA 2AS5M 3LXAA 2ISDA 3IS0X 1TNMA 4LVNC 4N6QA 4U0QB 3V0GA 4Z5RA 1ZT7A 3QC6X 3SIKA 4AY0A 1I7UB 2J8UB 2QQNH 2GTZB 5FUCE 2YQBA 3RGVB 1UM4L 1VADA 1JP5A 1LO3L 2X4TB 4IHBA 1FJ1A 1WAPA 4GH7B 5EU6D 1LO5B 5DHXB 2GTWB 4R4FL 2XPGA 3UMNA 3ULSA 4GQRA 4DKEH 1IEBB 3GB7B 4WO0A 3TO4D 4DOHE 4HPHA 2ITDA 1HIMH 5J89A 4WTZA 4G5ZH 3P0YL 3GSNL 1VLXA 3O11A 1KYDA 2DQFA 4YSQA 1VGEH 4HA1A 5AOJA 1D5BA 5TE4H 2K6YA 2VRAA 2W9LA 4KAQH 1G7HA 1IBHA 2AJ3A 5FYKU 2H2PC 3TO2B 4FI6A 4B3EA 4WWOA 3FQNA 1YJDC 1OIOA 5HYJA 3GEFA 1EZVY 5E2JA 5H94A 1GGIL 1K5NB 2VSMB 1RJLB 1I7ZA 3RVTC 4AQ1A 2VSCA 5HI5D 3EJPA 2AQTA 4N8VG 3HMXH 4ZX4A 3SCMA 4PIBA 3JT0A 4JLRA 2F1BA 2IDTA 2J8UF 3PRZA 1TZGL 3QFDA 3UPAA 5I1JL 3KPMA 5IQLA 4JNXA 1FBIH 3CUPB 4LGRB 3FSAA 1BQLL 4OFDA 2YRZA 5AL0A 3DTXA 2HT2D 2R23A 3LPPA 3K1DA 3VFPA 1QBML 2OMVA 2XWCA 2B8OT 2EADA 4V2CB 4B9GA 1EFXD 4JANB 3DXAE 2J1KA 3JWDC 5ESQA 1T22B 2ADIA 3U1QA 4LCUA 4MA1C 3FO0L 2ADYA 5F89A 1CDUA 3BP6A 4BRJA 2WYZA 3S98A 1HJBC 4JHAH 3R8QA 4M7LL 1UKSA 2IMNA 1ZHBA 1BGXL 3C6LA 5CZVH 4ZUWB 1RL1A 2JELL 3DI3B 3QJHA 3MGTB 5B1BB 5DO2C 2J2ZA 1PQZB 2VLME 1KB5L 3DX3A 2EXYC 5E2WL 4ZTOH 7PAZA 2HSIA 5E1HB 1RZ7L 2C4XA 1QLEL 1XGZA 2EZ0C 2KL6A 1L0YA 2CAKA 4LLVA 3WEAA 4N2IA 5EUKB 5EBWA 1BVLA 4Y2DA 1MWAB 2OMZB 4IHOA 3SHSA 4U7KA 2BHZA 3MRKB 3UBFA 1IBDA 4AGPA 3WIFB 2E7DA 4HX1B 2QGEA 4IRSA 5BRQA 1FRGH 4FQ2H 3CVHA 4HWNA 4JR9H 2PCYA 4TSCH 3RJOA 4B9CA 4OKVB 3DJZA 3HI6H 5E2TH 2NUTB 3QDJD 3CFUA 3ZKND 2D31B 5DYOA 1NGYA 3VGGA 3W3BA 1AQKL 3ARDA 2SEBA 3QEQE 3QZMA 5DVPA 1CBVL 5CZRA 3D3VB 1ED3B 4GKLA 4CMMA 4BQ8A 2OS7A 1S9XB 5D4IA 1JZ4A 5IHLB 1I1AB 1NCCL 2KLSA 3ZTEA 2FO8A 3TFKC 1WPCA 2ITCB 4ODSL 2MKLC 5F7HA 1UVQB 1MCOH 5I6PA 3ZPDA 1UQSA 3VTTA 4NDMB 3KZ8A 3H9HA 3KXFA 3VD1A 2CIIA 2R69L 5LCVA 5AB1A 1AHWA 3HJ0A 1Q1JH 3CNKA 2MNWA 4JFDE 2IAMC 2AVFA 1E2ZA 2V3FA 4AJWA 4GXUM 1O9WA 4L3AA 1AQ8A 5DQJA 4GW4A 3DVFA 4ODWB 3EDJA 5SWZD 5E9AA 1U3HD 4LK4A 3BUTA 4NPKA 4LT7A 3GI8L 4QY8A 1DBAL 1VZGA 3IU4H 3WDJA 3C9NA 3HN8A 3QI9C 3ARGB 1JTOA 1M1SA 2YGPA 4L8SA 4MQXD 2J5WA 4LLUA 5DK2B 2H0PA 2P8MB 1PZ5A 4OM1L 2FSDA 2GTQA 3OKDA 3FTGB 5AKVA 3TT3L 1A7RL 2WJ5A 1OGTB 1OPOA 3FPXA 4ZMZA 2PYEA 2JJUA 5I6MA 4S2SB 3MR9B 2W0FA 1ASQA 4ZO9A 4FC3E 2IAND 1R5VB 2AMUA 4ODVL 1I7TB 1R3JA 3O4LA 4PFEA 5EF1A 1KPRB 5GS1A 2VMJA 1ZVHA 4LPWA 1RJZB 2NT1A 2GW5A 1J1XL 1JPGA 2H1XA 3QJUB 4X6CE 4F3FA 1JZIA 1UFGA 2VN6A 1GZHC 2YMXH 4ODTL 3IN2A 4TS6A 3F7YB 3ZY7A 4PEEA 1CGYA 4DVBA 1GYVA 3UO1L 3U83A 4LOVA 3IF1B 2O5YL 4NHUA 1T1WA 5F9AC 4YX2H 1Z2KA 5K39A 1IGYA 1WP6A 2FTAA 3BD4A 3LIZL 4MXWL 5I1HH 2A99A 4GUOA 4LPVA 5FM5O 4QGYA 4ZX6A 3BAIA 4HCRL 4OJCA 5B4MC 1UGKA 3V4PL 2L04A 3DGGB 3TIDA 4HD5A 5JDSA 3VFMB 2WJ7A 2W0LA 2AJSH 5C08B 4A7UA 4D7BA 1N0XL 5BRZE 2X28A 3VXMD 1N0LB 3TEZA 1E4XL 4XBPB 2ODHA 3P69A 3PL6D 3VXPA 1M7DA 4MNGB 1GIGH 3V8CA 3OTTA 3U0WL 1CICA 3ZQ9A 2JQAA 1ORSB 4XMLH 3AM8A 3CSYA 3FH7A 3LKRB 4NI3A 4LBAA 1YUHB 4AEHL 2J56A 2IFFH 5C2UB 3W0WD 1MDTA 2WN2A 4WEEA 4PB0H 1ZOXA 2Y5QA 3IRCA 5B7FA 1S9KC 4KHTH 1L9OA 3HZYB 3FSOA 2RAMA 3GSRA 3D9AL 1JFQH 1SHMA 3RWHB 3PV7A 4PS4L 2BVPA 4I3GA 1MQ8A 4JN2B 4EKXA 1Z9NA 3LMJH 1K4CA 5C7ZA 6PAZA 4TVPL 1HQRA 5IKCB 2Q76B 3NFPB 3LAFA 1X7QB 3LQMA 1XGYL 4GLRH 1IKFL 4QUOA 4LBEA 5JYMA 2ZCKH 4H0IA 3GIVA 4DEPC 4PRPD 4DK5A 2O5NA 2AJVH 2Y22A 1Z3GH 2GITA 1C5DA 2BFGA 4HJ1A 3NUKA 1XGPA 2Z65C 4XP1L 4X4MA 4W9CC 2H32A 5TFSL 3VWJB 1F90H 5I15L 1CB4A 2JKLA 2P52A 2IPUG 3G6AA 4L3FA 4U6VL 4QDGA 4WUKL 1RCYA 1SLUA 4D8OA 4HJSA 3DSFH 4NB7A 4S0SD 4JM2C 3GI9L 1MIMH 4R5XA 3R06B 3NA9H 1CG9B 2APVA 3NRPA 3DVIA 3QORA 2P48B 2PMZA 3SKOB 3ZOAA 3MV7A 4F91B 1G9NH 3QZWB 3TV3H 1ODAA 5JNYB 2H3XC 3RY4A 4PJBE 3KYOA 3VGFA 3WIIL 2AERT 4HJJH 4H44C 3HLAA 5DMJB 1YECH 1OTTC 2JB6B 5AYUH 5AW5B 4MZ3A 3GBDA 1YEJH 4PB9H 5FV2A 1OP3H 5CCJA 1YA5A 2ATKA 5D6CA 2I7SA 2E46A 4I0PC 5JOPE 3HG1A 4HK3N 4L8BB 5CSBA 5C7XL 2A9DA 4FG4A 1WO2A 4JFXA 2NOYA 4GO9A 3MOBH 4DTGL 3MRCB 2ZTBA 3W39A 2V6HA 4KKBD 3BVDB 4L2YA 2BNRA 5LQBH 2FZ3A 3RDTB 4NT6B 2NY1D 3TWYA 1FGVL 4KY1L 4U3CA 4PJ5A 3L4CA 2JCCE 1KYAA 2RMNA 4FTVD 2KQNA 3SE9H 2UZXB 3HE7B 1AR1C 2HKAA 2ICEA 3B2VH 3FMGH 4O51B 4BZ1A 2M83A 3ASNB 4HJ0C 3ABMB 2YD9A 5E6IA 4DVRH 1FNFA 2KZWA 4QRRA 1MJJA 3SBRA 2VQTA 2VLRE 3PGCB 2Y07L 2AQNA 4NBYB 2LFGA 5F0PB 4MCZB 1AS6A 1IBZA 4HPYH 3O2VH 4O2EB 4HSCX 1FORL 2QHRL 4Q2ZA 1FZJB 1PLAA 3GZQA 4ZD3H 4G6FB 3GS0A 5ILTH 4Z6AT 1I1CA 3DYOA 1T0NB 2CLRA 3BE1H 3S96A 4B9FA 4NLHA 2DS4A 1MPAL 5DJXA 4PJHA 3NCEB 5L0QB 3F04A 1PBYA 4JZNB 3P77A 3NCXA 1IILE 3L1GA 3MJ8B 2L7QA 1SUJA 3MRLB 1WFTA 3E6HA 3PCYA 3ARFC 1A7PL 3HCVB 4JCWA 4OLZH 1YQ2A 2WP3T 3J27A 3QQ3B 4NO2B 1HSAA 5J12C 4DGYL 5JO5A 3GDCA 5JQ6H 5CKAA 1EAOA 1XIWC 4MA7H 2YGQA 3D18A 3FK3A 1KXVC 4NN5B 5DZAA 3TYFB 2ZOLA 2Y0SA 3Q1EA 4KHXH 4PTTA 1KIUA 4GQPH 2JCWA 1WZ1L 1IVTA 4MHHI 1ZT4B 5D5ME 3TBYA 5JXAH 1A6WL 3E80A 3O2WL 1F2QA 5F1IB 4QRTA 4I4WB 2XWBB 4WUUA 2MOGA 1E6JH 5DZVA 3SDXB 2XWRA 4UDUB 3UZEA 4F1ZA 5KANG 2YAEA 3QUZD 3T6VA 3UO8B 1DUZB 5JW4N 3TN0C 4GSUA 4R26L 4PJDA 3O3EA 5DDHB 4O2FA 3FL7A 1OSZA 2OX5A 4QRBA 4BK5C 4X5WB 3Q6FA 1GAFL 3RA7H 4G7SB 2BCKA 3NGBB 2IEPA 3K72B 5IB5B 4U2YA 4FXTA 3T4AB 5CWSB 3ZKMC 4F58H 4CVXB 3HS0B 2Y6SD 4IGBB 2OBGA 4APQD 2P5EA 2JTYA 3BIAX 5AB2A 1A6PA 2DDQH 4UMGA 1JZDC 1JXKA 1XR8A 4AYGA 1UEMA 3A4FA 4MNQD 5I75C 4S1RL 1LTXA 5F44A 1O6VA 2HLFD 4ICWA 4P23D 1QA9A 3NSJA 1YY9C 4DKFL 4ZW5A 1C16B 5I28A 4PYHA 4NRZA 4FMVA 5GGQL 4TPRH 4MJ2A 2IGTA 2QLVB 5DZ9A 2C1PA 4OFIA 2QFRA 4KK8C 4PS7A 4Y4KB 2IIJA 3SDXF 1W9XA 3N50A 3KJ6H 5IZ7A 1R6VA 1XR9B 3L3JA 4BWTA 4X5LA 4DZBA 2OMTB 4OH2A 2N56A 4YXLH 3NA4A 1IX2A 2YJLA 1IEAB 5C0AE 5IR1B 2YIHA 3OKMB 4AYBA 2K70A 3OPZH 5T5NF 5TQ0L 1N7MH 2CHWA 1PY4A 5D1ZA 1R4XA 2QTVA 4YDLC 1L0PA 2X89D 5EUOE 3T0WA 2E7LC 1KCUL 2AANA 3L95B 4R7NA 3HI5L 5E1GA 4RRPA 1VACA 3ZR6A 2XXMB 1B0RA 2WLIA 1JYWA 4DP5X 3VFWA 1BYNA 1WIOA 2PP9A 4LLAA 2FQEA 4LNRA 5KSAC 2BP8A 3LHPL 1KSRA 5I5RA 3M86A 1HSBB 3QXUA 4R3SA 4C4KO 3O6KH 1P5VA 5F93C 2C9AA 1DJXA 1UZ8B 4FTDA 1R24A 2JK5A 3FOLA 4A6YA 3TYGL 1DJZA 4QRFA 3WEMA 1PFOA 1ZA6A 2GKIA 4PWHA 4I1PA 3AXLB 1TZOA 3ULVD 5B7MA 2Q2EB 5F7DA 5EZJA 3LB6D 1JMXA 4R2GB 3GIZL 1PZDA 3ARYA 1XF2A 3OVUB 1T80A 2XJKA 4KJWD 1HDMA 2OXHA 5AB9A 4PLOB 2E47A 4MS8D 4OZFG 2AZAA 3PDOA 3ZDWA 3IWVA 2DMCA 5IQMA 1NCBL 1KXTB 4I5BB 2KZKA 5E8NB 2HPTA 4QEGA 3MCKB 5C92A 3IJEB 5D7IB 1FNLA 1JPSL 3EJQA 2GJZB 3IRPX 4NM8L 1RFDH 4JKPL 4UTAA 3DOIA 1CFVH 4K15A 4ZMQA 2PKDA 4P2QB 4LPTA 2LAGB 5CJXC 1ZCRA 1ZHKB 4P2AA 3V0VB 1BIIB 3WFBH 1MFMA 4ZAKD 1AXSA 2CNZA 1EDQA 5JXED 3J7HA 3NIGB 1IGCL 5GGSA 4OCYL 3UIZA 1I3GH 2R4SH 1MCNA 1I7RB 3EOBA 4JFYB 4MJID 1MFNA 3MSPA 2DQJH 1BJ8A 1HI6B 5ISZD 3FH5A 3EKCA 1NC4B 1IC5L 5GZOA 3D7PA 4Z0XA 5LGHH 4H1LB 4X5PA 5EIVA 4KRPD 1T3FB 1CFBA 4PGCB 1FFOA 2ICWA 1XTMA 2EIKB 3SBWC 3GMOA 5BXFB 4TNWK 2ED9A 4FNUA 4MA3A 5D1XE 2VXQL 3ZDZE 4LLQA 4FQPA 2XXFA 1K4DA 1I85C 3P02A 4RX4A 4XT1C 3LN5A 3U4BH 3DETD 4M03A 1U8JB 3BPCB 5D7IF 2EYTA 2WTPA 3W2DL 3K1KC 2YA1A 3A67L 3D6GA 3MUHL 1NIAA 1AOHA 2JH2A 1KGYE 2BH0A 1QRKA 5GRUL 1BMWA 1BXUA 1QSEB 1V55B 1RUAH 4NUGH 4DCQA 5I71C 5DRNA 1YN6B 3QQ4A 6FABH 3N44B 2YLHA 3NIGF 3SE3A 1WFUA 3LSOB 5FLVA 3UC2A 1JK9A 4DERA 4GKZB 4G42B 3VFVB 5BVJB 2V4LA 4JDEA 1J1OL 3L9YA 3EHBB 2HT3C 4X7EC 3R8BB 3VE0B 3IDJB 5A6LA 1HQ4A 4M6NH 1FLRH 3FTVA 2MRYA 3MC0A 1WV7T 1X6NA 4HFWA 4KKNA 4PCSA 4WRLA 4GW1B 5E4EB 5DS8A 1SXCA 2XQBL 5HYJD 1DQLL 1E43A 3KWVA 3U36B 4RQQB 3VI3E 3U4KA 2MJWA 1EERB 3G6JE 4HK0A 4ONGL 1Z0MA 3EFFA 3X1NA 1FF5A 1IEBA 5FOJA 1MFAL 4C56B 4FA6A 5K9QG 3AT9A 2BVQB 3FQXA 3L3OC 4PG2C 3FZUC 4N2FA 2IWKA 5D8JL 4LSQH 1QI5A 1XF5B 1D5XB 5C0BE