4AGNA

Structure of the p53 core domain mutant y220c bound to the stabilizing small molecule phikan5116
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
197
structure length
197
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Halogen-Enriched Fragment Libraries as Leads for Drug Rescue of Mutant P53.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords CELLULAR TUMOR ANTIGEN P53
total genus 50
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4agnA00
4IBWA 1EAQA 2VUKA 5LGYA 3EXJA 2RMNA 2PCXA 3D07A 2WGXA 3US0A 3IGKA 2X0WA 5A7BA 4IBQA 4G82A 2J1YA 3TS8A 3WTXA 3QYNA 1GZHC 4IBTA 3VD1A 2ATAA 1CMOA 3WTVA 5AOIA 2J20A 2H1LM 4AGOA 4AGMA 5BUAA 2IOMA 3D08A 2J21A 4IBYA 5G4MA 2BIMA 2OCJA 2J1XA 4IJTA 5ECGA 3WTUA 5AB9A 3IGLA 4GUQA 4MZRA 2MEJB 3D05A 5ABAA 5LAPA 2XWCA 5AOKA 3WTYA 2IOOA 2X0VA 4LOEA 2AC0A 4KVPA 2BIOA 5KBDA 2BIPA 4A63A 1GZHA 4AGNA 1T4WA 2J6WA 3WTWA 3Q05A 1HJBC 2BINA 2FEJA 2P52A 3WU1A 3EXLA 1YCSA 1H9DA 3ZMEA 4L0YA 4IBSA 4QO1B 1CO1A 2BIQA 5G4NA 4AGPA 3WTTA 2J1ZA 4G83A 2XWRA 3D09A 3Q01A 4LO9A 1E50A 4IBZA 1KZYA 1TUPA 4LOFA 3KZ8A 3D06A 5AOLA 3VD2A 4L18A 4IBVA 1UOLA 3VD0A 4HJEA 3US1A 4IBUA 4AGQA 2AHIA 3D0AA 1IO4C 5AOJA 1LJMA 4GUOA 2IOIA 2GEQA 4XR8C 3KMDA 1EANA 4AGLA 3WTSA 3QYMA 1EAOA 1HU8A 4L0ZA 1HJCA 4MZIA 2J1WA 1TSRA 2ADYA 5AOMA 3Q06A 2YBGA 2X0UA 5G4OA
chains in the Genus database with same CATH superfamily
5KYNA 1AO7D 5D7LB 3FSOA 4ODTH 4F15C 2Y3AA 2CM5A 3BO8B 2X2UA 1TO5A 3T04D 4HPOH 1P2CA 3A6BL 1EHLH 3HZYB 5FFGA 4FFWC 5GRUH 3WS3A 5DEFB 4MZ2A 1S9XB 4QHNA 4ZPVA 5ANHA 3WTVA 5C7XL 2L7JA 1AD9A 1E6JH 1LP9A 3E9TA 1DANU 1DFBL 1NBYA 3QE5A 1ZOXA 4HIQA 4XNZC 2XN2A 4HV8A 4YR6B 3SKJH 3K6SB 1VIWA 3VRJA 4PR5B 5CKGA 4MB1A 5D7IB 4LLDB 3FQWB 3QUZC 4YLQT 1ZLSH 3S7GA 5IFAL 2DL2A 3Q0HA 3QORB 5CSGA 5AZ2L 4H5SB 4MCYA 1BLNA 3QIWB 4ETQB 1OARH 4ZUSA 2XYCA 3ZT5A 1U42A 2WNXA 4NZUH 3BPNB 3Q5TA 5SWSD 1Z3GH 3WY4A 5IBLD 2LABA 3DJTA 4JFFD 1G6RA 3GTVA 4YL9A 3IJ7A 2YAEA 3O2WH 4E5XB 4WKXA 3SDYL 4W4OC 1A1NA 4M8UA 2NY4B 1TJIH 3TBSB 2ADFH 1XCQA 1IGJA 2J8UE 4BA8A 2OXGA 4LQFH 4A7GF 3NFSH 3DYMA 5E70A 2V3FA 1QSEA 1W6LA 1E2VA 1ORQA 4HWEH 1IEAA 1VGKB 3AWFA 5T1KB 3O3EB 1DZBA 5KOVC 3S88L 2KI6A 1LQBC 1L4IA 4TSCL 3VXRA 5ICXA 2GG1A 4W9DC 5F7KC 4XNUH 1H3GA 3DSFH 1YEHL 1DQJA 1FN4B 3O2DA 4FI6A 4B96A 4JN2B 1KPRA 5L2KE 2DB8A 5D5MF 1XF4B 1R5VB 4KFMA 4UZSA 3CN1A 3JV6A 3IRZA 3TVMC 1GW0A 4IEFA 1W2KT 2UZYA 4R84A 2AK1L 3M1CA 4M3JA 2OMYB 2JB5L 3EGSA 4FXGB 5DZPA 1VFAB 1E4KA 2ITCB 3UTSB 5I1DB 1SMDA 1JTPA 5IOPB 4R7DB 4HJ0C 1RUKH 5DK0A 4ANWA 5I1GL 5LXGL 4EE2A 2ZWZA 4ETYA 4KITB 3V4UL 4WI0B 2N1KA 5I8KL 3D18A 1GYUA 1G7QA 4GW4A 5FF6B 4J3WA 2E4TA 3UJTL 3D9AL 1OGSA 3N0PB 4UV7H 3RVTD 4P2CG 3C6SA 3Q8AA 5DD0L 1LILA 2VDPL 3IE9A 1EIBA 1G87A 3M7OA 3WEXB 5MEOA 2W8CA 2VYRE 5K9OB 5FUZH 3U82B 1CCZA 1MXGA 3O2DH 3K71B 4OF3A 3CVHB 3ZZLA 3K81A 4PHXA 1XZ0A 5B8CA 2NZIA 3P4NA 2ESVD 3KYMA 3QG7H 5EA0H 4DHLA 3TN0A 2NCEA 4NENA 3LQZA 4XPAH 4FKKA 1ULVA 3V0GA 1SOQA 2X4OB 5AQ0A 5D1QA 4YIQB 1BM3H 4U1NB 4C4BA 5KJRL 5SWQB 5HHQA 3IXAB 4POYA 3CFJA 2R0WH 3H3BC 3Q2LA 4RIRB 1P7QB 3IMWA 3RGHA 3L5XL 2VDQH 2GJ6A 4P59H 4YHOL 5DU7A 4HVBA 1FIGL 1Y1DA 3SKNA 4YHYB 1R1CA 3LEYL 3NSXA 2VQTA 1OAXH 1IMHC 1DJSA 4PBVC 4JO4L 1SDDA 4APXB 3P77A 2EIZA 3TPUB 1KCWA 1RI8A 4KKBC 4HT1H 1KXTB 1OAKH 2F53D 3APDA 1KJMA 1NUGA 4MXWL 4R2GD 4QLWA 5E6IA 5GGRB 4KZDH 1EHNA 5CLXA 3VXQB 3QUML 4LEXL 2RTTA 1T22B 4BSWA 5DRWB 3OSVA 5I8KH 4DGIH 3ZU8A 1EHKB 5KG9A 2DWDB 2GBVA 5TE7L 3BCDA 4H8WH 1Q1JL 5CZXC 5EOCH 4WO4C 5FAAA 1OTTC 4E5XG 3H56A 3ARPA 3NFPB 4WHTA 1A8JH 2R56H 3O4OB 3QXVA 4GW5A 1AQKH 3FOLA 4ONHB 1OB0A 2FJHB 5E8EA 4L18A 1MFEL 4AJ0A 1CVSC 1S9VA 1UOLA 2NXYC 3K2KA 4R8WH 2Z4QA 4UV4H 1M6OA 4M5ZH 1S7XB 1JHKL 2WVSA 1MHCB 3ESOA 3L3OC 4EN2A 1HKFA 4MXQC 3F83A 5GRXG 4PUBL 2VMDA 1NDGA 4RNRB 1XHHA 4UQDA 3LZPA 5HPMA 1CGWA 1EVTC 3QSKB 4JLRA 3X2QB 3B2VL 3PHQA 1LD9A 4X9IA 2DYRB 4GMSH 3P2DA 2R69L 4UWQB 5DGQA 5HY9A 4JZNA 3UYPB 1AQDA 3MBEB 2YO3A 5MP6H 3P11H 4YSPA 3H53A 3MHZA 4K3EL 1WP6A 1PAMA 4N86A 5EO0A 2NZ9D 1J8HB 1UURA 5HYQA 4F27A 4Y7OC 5HVGB 3GUFA 5DJ2A 4PJIA 1XXDC 1YYLL 4FFYA 1I3GH 4ZQKB 4CVUA 3H6JA 4OUUB 5I0DA 4NQTA 2R0LL 4QXGH 5KAQG 4AT6A 2FO4A 3MRJB 3IDYB 3MRMB 3ZKXC 5CKAA 1CMOA 2A9DA 2Y06H 2CDFB 5EF0A 1HQ4A 4CAGA 4ZNCD 5DO8A 2VR4A 3ARBB 3C60D 1Z3GL 1JNNH 1AXIB 4QHPA 1R3KB 2CE6A 3BD3A 4HS6A 5E94B 2ZCKL 3WFCH 1RK1A 2OM5A 2BX5A 3LIZA 4FQ1H 2FJFB 2IPUG 4OGAD 3U4EB 2O72A 3QYCA 1IGTB 1AZBA 1NCWL 4R26L 1T0OA 1QRND 3HNTH 3SEPA 1Z1WA 5D4JA 3UPRA 1ICTA 1P9MC 3UIZA 35C8H 4Y19E 3OKDA 1QHQA 3CXHJ 4PBDA 2LR4A 5I1IL 1IM9D 2WO4A 4EXPX 1DVUA 4UT9L 4ZXBA 1NEZG 2FATL 1GZHA 3NYKA 4TTGA 3NA4A 3TP4A 1MIEL 4QO1A 5F2FA 4HQQL 3RX8A 4QHUB 1A6PA 1OGAD 4PJEA 2DWTA 1MQKL 1NICA 4G5ZL 2VDLL 4PB0L 1P7HL 3L1FA 1T7VA 1A7NH 1K85A 4E9WA 2Q2EB 5ESVA 7TAAA 3ZDYB 3TVMB 5CZXD 3QISA 1PZCA 1WCBB 4NHCL 2CO3A 1NGWB 4ANXA 4LARH 2J1ZA 4F37K 4R90L 2CK0L 4LP5A 2OMUB 4MKTA 3QIUD 4NKMA 4JO3H 5JHLA 4HH8A 4BH8B 3ZE0B 5D55A 2YMOA 3C9NB 3UTPE 2DM2A 4GSQA 4NKQB 1SVBA 2XTSA 3K5SA 2B0SH 2YD1A 4LVOB 1T1WB 1IBGL 2WAQA 1C12B 3BGAA 4HJEA 1TEGA 1WGVA 2K45A 2CO4A 2H6OA 2VR5A 2MKWA 2XBTA 3Q3GB 3A6CH 4YSRA 1IUZA 1C12A 5EBWB 3HMXA 5BRZE 4UTBA 3ENEA 1D5ZA 1AHWA 1EANA 4QRTA 3BZEB 4Y7MA 4QXTB 2BSDA 2QQLL 5AKVA 1A3LH 3VB9A 2C7UA 5E99H 1EDQA 4DTGH 3T0EE 4K73A 3CMOL 1M57B 2BFVH 4G6KL 3A6CL 2UV3A 3CX5K 2EDYA 4IMLA 5E1GA 2Q7YB 5I76B 4MHHI 4HKBA 3RGVB 1WDAA 4H7VA 1HYSD 2Y7NA 4X42A 4JKLA 5J6SA 4PCYA 4P5KB 4EI6B 3HN3A 5HHPA 3UJJH 3WG7B 4Y2DB 4HUXB 1L7IL 2B2XL 2VZOA 2WLIA 4U49A 5FYKH 2NW2A 3BYYA 3ULUL 3P1VA 1MRFH 2E9IA 5LQBL 3MV7E 3HE7A 1FG9C 2K9FB 3GINA 1R9FA 1U8IB 5J9PB 5T3ZH 4IKNA 3ARFA 4HIIA 3SN6N 2WVUA 3L3IB 1YY8B 2GUOA 4W9HC 3NIGF 3MRNB 3C5ZC 2XWCA 4PJ6A 1KGUA 1J18A 2ROYA 5A2LH 4IRZA 3V5DA 3BDBA 4D0DB 4NQSB 3BIKA 3W11C 3EJPA 2Q8AL 2LGNA 3K0YA 4UM8A 1UWGH 35C8L 1SBSH 4XCYB 1XD1A 3P73A 4WWKB 1UM5H 4R4FL 3GI9H 4YO0B 3U9UA 5J4MA 5MEND 2AQTA 3QJRB 4PJGE 5ID0B 1LGVA 3GSRA 4HIHB 1N8OE 3FBQA 5ESVB 3HR5B 2EDBA 3U7YH 5DA4A 1NBZB 4M4RB 1MW0A 1Q8MA 2YD8A 5DJYB 2XBDA 4QHUA 1CI5A 1DBBH 2PYEE 1XD0A 2GIYA 1OE3A 2NY5L 3CX2A 4A04A 5DWPA 1FZJA 4Y9GA 1N7ML 3K6IA 4FG6C 4I0KA 3V52H 3T6ZA 2EINB 3VFSA 4PJXB 3VFMB 5K9KA 1SHXA 3KH3A 1NEZB 1INQB 4PRAA 4X6CE 4NFCA 1OP3H 2BMKB 1YAZA 1Z9OA 1RJYB 3HZMA 3ZZ1A 1T5XA 3TM6A 5E08L 4AYFB 3CZUB 1JL8A 1NQBA 2A4EA 4UQ3B 1WTGT 1T5WB 3FYEB 4I77H 4PPTA 5FGRA 1J0KA 5AD0B 3QC6X 32C2B 5EF1A 5E6YA 4AGQA 3CFCH 3WKMH 1LJMA 4HS6B 4LF3A 1F0LA 3V5HB 1SVCP 3II2A 3ESMA 2VLKD 3Q3GA 1UD3A 2YD7A 2BNQE 1Z9SB 4JKWA 4H88H 1ZLVK 4J3OC 4YPGB 2WXJA 1MPAH 2EACA 1EAOA 5D1ZB 1RZ8A 4FYQA 3CBJB 4ONOA 3BT0A 4G8GB 3FB6A 1L9MA 2XKSA 4PJIB 4MQ7B 1L0QA 2EDHA 3VXQA 2QQNH 2IWGA 3KBEA 3K2IA 4O2CA 2VLRD 2L7EA 4OZHF 5I6OA 1DP0A 4UTAL 2B7DT 5B1KA 5HHNA 3THML 5BUPA 3T2NH 3DO7A 2QVIA 1SRDA 5H94A 2FT7A 2L04A 2G5RA 2MH4A 4GAFB 2BVQB 3DMMA 5I8EA 2TRYA 2O6CA 3P0VH 4BFGA 2KBGA 1BQSA 5K69A 2JJVA 2F61A 1J1XH 1NC2A 3BIAX 2R7EA 3DJ9A 2OS7A 3I6GA 2EKSA 4QOKB 1A66A 4Y4KC 3VW3H 1FHGA 5SWQA 4S1RH 1QR4A 1RP8A 4K3JH 4LHQB 5E5MB 2CZNA 4X7EC 2MTAA 3KGRA 5E03A 3EDFA 3OAYK 2HX7A 3GBML 5LBSH 4OGQC 1FIGH 1JRHI 3SE8L 1Q9OB 3QH3A 2J6WA 2VDQL 4PREB 4YHKL 1ZV9A 1DQDL 3T5WA 1HHJB 1IAOA 5IVXB 1L9TA 1A9EA 4LOVA 3ATFA 1BM3L 1E6OH 1D5RA 2EVHA 1JYNA 1CIUA 3U7AA 3VD5A 1S7UA 2QL1A 5HHOE 3T09A 3S5LA 5TGBB 2L7QA 4KFZC 2BY3A 2P7TB 1E67A 3O4LA 3L9RB 4ZMLA 4OY9A 2ENYA 1I8MB 2VC2B 4Y16B 3IJHA 5C92A 2WP3O 3F85A 4EDXA 3PG2A 5EBLB 5BVJA 1YMHA 5F7MC 1MFCH 4V2CB 1SPDA 5JW4N 1LD9B 1PZSA 4IK6A 4PG9A 5DD0H 2V37A 4MXVF 3RPKA 4LF3B 1EHXA 2Y5TB 4R97B 4ZK8A 2P8PA 2K8MA 2IOIA 2WBWB 5E2WH 3X11A 5I28A 2A9CA 4GH7B 1FNEA 4H8HA 1REIA 3IDJB 3LH8A 5IIEB 1VSCA 2QSCL 1M7UA 3EAKA 4Z7NF 3KEDA 2XYBA 3EG9B 4JHWL 3HE6C 4QRRD 5K39B 1JD9A 4JRXA 2EDMA 4RFEB 4QWWC 3RIFK 1UWYA 3U2JA 2CLVB 3ATBA 4OZFA 3ARDB 3QRGL 3ZDXE 3ZTNL 4YX2H 5CF3A 3RVVD 3W5NA 1FO0A 3AB0B 3CN3A 1LWRA 3RQ3A 3CHXA 2F54B 3MI6A 3ROOA 3QR1A 1J86A 4XWOC 5C86A 5MHSE 4HD9A 4KRLB 1A1NB 3HFML 4HKZA 1M4KA 3HNSH 3N40P 2FL5B 1UZ8A 1KCBA 3GIZH 4WW2F 1CGYA 2GJRA 3SDXE 2AJZA 2YS4A 4XNUL 1XGUA 1RCYA 3HKFA 3Q5YA 4J6IA 1NUDA 5AUMB 2AZUA 5CBEA 3ZUCA 4A7UA 5HGGS 5JHDE 5EBGA 1UFUA 3FFCA 2FWOA 4ZAKC 1O7DC 1OF2B 2W65A 5FO7A 1GS7A 2P49B 4IKKA 4HWEL 4NQSA 2B1AL 1KBVA 5FC9A 1NAML 4EN3C 4OF5A 1F13A 4B9CA 4U1HB 2O26U 4XN2A 3VXUA 2RQEA 2IQAB 5JZ7D 4HKXB 3RL2B 3F01A 4WWOA 1KTJA 1GC1L 5AEAA 3WHE1 3SQOH 2AEQL 4FI8A 4CMMB 2HKFL 3IXAA 1F1AA 4BH7B 3ALXA 3A22A 1CYXA 1D9KC 2QHLA 2FGWH 3LPGA 1SEBB 2A6JB 3U1QA 2DQ6A 4EJ1C 3V0VB 4UU9A 1P7KB 1INDL 2VW4A 2B1HH 1HH6B 5DD1L 3VI4A 1P5VA 2VXSH 3FO2B 3RFZC 1JV5A 1UWEH 2UWEF 5FUCC 3IN2A 4ZUTB 5HI5C 3VG9B 2ITDB 1I9IL 5K1VA 5TE6H 4XNDA 2A74C 5KVDE 3AS3A 4L0YA 2A6IB 4FXKB 4ZTOL 3F7KA 2AJSH 1X5YA 1OVZA 4NQEA 4OD2A 4PJBE 3OB0K 2DYPB 5DRNA 4MGXA 3QO1B 4D2NA 3D0LB 2HRPH 3GSXA 5C0GB 1KG0B 2AJ3B 4JFZL 4TUJA 2QVKA 5GRUL 2JCCA 3T2QA 4ZO9A 3MOBH 1HSBA 5IOPA 3M6DA 4MD5A 2QPFA 4ELDA 1L0YA 3FB7B 1FG2B 1W9XA 3CHSA 3K6FA 3PRZA 4YHML 2NNAB 4LL1A 4PR5A 1CLYL 3B9KC 5AOJA 4K9EH 4MMXA 2BP0A 4M5TA 4OT1H 3VI3B 1JGVH 1DQTA 4ODXB 5IV2B 2C9VA 2QGEA 3PWNB 1B0GA 1QZNA 1QACA 5TPWH 1CT8A 2Y7QB 1MJ7H 2HVJB 3DVNA 4HFWA 4XT1C 4NO2A 5HHXL 1F4HA 1RPKA 2CCVA 5D5ME 4MA3A 1ETJA 3GJEA 3JTTA 4XXCA 2CUMA 3GRWH 5F9JA 5MEQA 3VQ1C 3EYQC 4KUZH 1HEZB 4U7MA 2X0UA 5LKNA 4ZMZA 4K8RC 1RZGA 3EHBC 1Z5LB 4X8JB 3FUJA 3CBKB 1ZJBA 3VB8A 5CWSA 1QA9A 2R2EB 3TO2B 4X6DA 2W9DH 4FQHB 3WTXA 1KC5H 1E43A 2FB4L 4L3EB 3U6RA 4H25A 1IAKB 2HLAB 3HG4A 2IH1B 3CFBA 5JXAH 1MHPL 1D6VL 1JPGA 1KTDA 1X5FA 2YOCA 4M1DL 2BP8A 5E56A 3IDNB 3TFKD 2VDLB 4X9BA 4LNRA 3O4LE 4MNQA 4IMKA 1ZSDA 4N1HB 1H5BC 5DS2A 5L7XL 5KVGL 5AALA 3T3PE 1YDPA 2FJFA 4YUEL 5GS2D 2CBMA 1UWEL 3U2SB 4S1QH 3QFDB 1FVCB 4PP2B 1INDH 5DD1H 2JI3A 2RFXA 3GC3A 1II4E 4YHLL 4Z7NB 3H2QA 4QHMA 5LCVH 5GGQH 4JCLA 1UT9A 1IGML 4EO5A 4Z76B 4RGMB 2G2RA 1V3JA 1EEYB 3BGMA 4OUUA 3WLWC 4DKAA 4Z8FL 1HC1A 3T6QC 2KDYA 2Z92B 2WWMD 2XZQH 3K8KA 3T0DA 4JN1L 4PJBF 5EF3A 3EJQA 3IRCA 2FX8L 5DDHB 1OE1A 2Y36L 3HRPA 1S5IL 3MO1B 3QARA 3EF7A 4U1MB 4ZX5A 1JPGB 3RTQC 3TBYA 3PDOA 1RZQA 3BAYA 1VZGA 2ROXA 1T3FA 3DC0A 4MAYB 1RHFA 4X9HA 1VCBC 3IGUA 4CSZA 4ADIA 4F2MA 1N18A 1U95B 5IUSA 3ZDZB 2D4DA 1E28A 4FI7A 4PRHB 4YBLB 3GMMB 3HE6D 5I16B 3LS4H 1X5MA 5FO8B 5LWYH 5C0RH 3Q8EA 5E5LA 2V2TB 1DUYA 1OALA 3S3DB 2DZEA 4UDTB 3MRCB 5HPMB 3VFOA 3OZKA 1NDGB 2FR4B 3MCKA 1G5AA 1KIRA 4ACPA 2FSDA 4YDLB 1MHCA 3V7AE 2Z4QB 4DO6A 4FA7B 5HTSA 3AREB 4F7CA 4FS0A 4PVNA 1XB8A 4QIRA 2VITA 3JV4A 2N0MA 3S3JA 5D7KE 1QLEL 3G5WA 3FFOA 2DTSA 5A2JH 5C0FB 1IEBB 2HRPL 4D8PA 2JMRA 1N70A 3V0AC 2R8SL 3U4BL 2VT0A 1X7TA 4PTTA 4BK5A 3B9VA 1KTCA 3FQRB 4N5EC 2H1LM 5EU6E 3T4YA 2OQJA 3MZTA 2MNWA 5L0QB 3MLZL 2GITB 4DOHB 4FP8H 2DIBA 4M1CC 3BRDA 4EZLA 3GZQA 3IFLL 1KJMB 3LEXB 5D71H 4LCWB 4TUJB 3PQYA 2ZXDA 2C9QA 1KFAH 4XBMA 3X17A 2P9RA 3SE9H 4DN3L 2Z7ZA 4N90E 1EGJL 2FGWL 3Q1SL 4KPHL 2PPFA 3WD5L 2AVGA 3FTXA 4X5WB 5EBMA 3V5KA 4Y4KB 4CNIB 1HCVA 3U0WL 4F58H 1TTBA 5AW3B 1TCMA 2Y2YA 3DIFA 4IGBC 1QFHA 4Y5YC 5F3FA 5AVZB 4D9QD 3N0AA 4UM9D 4JO2L 4DP6X 4OF8A 3S37H 2MEJB 2X38A 4KTEH 2OZ4L 4YXKL 1P53A 1I1AA 5JLZA 2YFOA 4DH2A 3GSOA 4WFHE 4PJ5A 4P3CH 4F3FA 3L6FA 3TN0B 1ZA6A 2WTRB 2IDQA 3ZO9A 4G71B 4FA8A 3KPRA 4BH7A 5EF2A 4D0BB 5E7BA 4EN3B 3O41B 1W8NA 4OZGB 4QKXB 4HH9A 2PW1A 2CUAA 4LBAA 4WI3A 4MX7B 3SKOB 1BIIA 1EA9C 2AXFA 3F05A 4CW1B 3O9WD 4DP0X 3ZRSA 2I07A 4WWID 3EJZC 4P2RE 2YRPA 1G7QB 5BNXD 2JWYA 2NRDA 4C4KT 4Y16C 2RCSH 3VFWA 1NUFA 1ZVSA 3BKYL 4JJHA 2DPKA 2BRRH 5AG9A 4NPYA 4YDIL 2HVKB 7PAZA 1ZVSB 1HT6A 1OPGH 2NYYC 2DF3A 4S0HA 1OQXA 4WFGD 5AKTA 2HX8A 1I9JL 2B4CL 4TSBH 3PF2A 2E9JA 3I6KA 5JDJA 3ARTA 4IU2A 1QI3A 3EYQD 3T8XB 4M6AA 3H9ZA 1PJ9A 4NQDD 5KANG 4IIQC 3MYJB 2Q5BA 4FG2A 4KVNH 5IBTL 4DGYH 4Z18A 5IQ7L 3BOVA 4QRRA 4IDLA 3O41A 1DZ0A 1X7QB 5IGXL 4HHAB 2H45A 3B7SA 3NN8A 1QBBA 3AREA 4YE4L 1PG7H 2JKTM 2IDFA 1FL6A 1FNEB 1T0MA 3VWKB 1QPKA 2VC2L 1XGTB 2A4ZA 5IQMA 1IGYB 3L9EA 5EUKB 1SVZA 4UTCA 3HPLA 2ZF8A 3DKHA 5CZRA 4UTAA 1A9VA 2OTWA 1ZVNA 2K6WA 4LP8A 1A3RL 1QEXA 5AFAA 3ZW3A 2ZUYA 3HS8A 3LVEA 4LSDA 2X4PA 4HAGA 1H5BB 4I0PB 5CFHA 1U95A 4BQ8A 2EIDA 3FUKA 2LVEA 1F4XH 3QIBB 3VD1A 2X6BA 4H1LG 3O4LB 5DMIL 1J1OH 2F1EA 3KPOA 5IJBC 4Z7UE 4NWTH 4OCLC 1TEFA 1V3LA 2XRAH 1HZHL 3NEXA 3DHPA 4MJIA 4DP4X 4XPBH 3VXUD 4HG4J 4OH2A 3G5YB 4FMFA 4K3JL 3WS6A 3D5OF 2Q8BL 5GHWH 1QBMH 3H7BA 3BMVA 3W5MA 1Z7JA 3GMLB 3QORA 3DX8B 5KOMC 4BD4A 2C34A 4RZKA 4OZGA 1QSEE 5D4HA 1UM5L 2LV4A 3EJYC 4R4FH 3QXUA 1WWAX 1SBSL 2QLVB 1DL7L 3BPNC 3L9BA 4KAQH 1F3RB 3VX0A 4PRPB 1JRHH 2HFFA 2RHEA 3ARXA 4FKHA 5E2JA 4Y88A 3NVQA 1G5GA 3L6FB 1T1XA 5D5MB 4CGUB 3A4EA 1CFTA 5ALCL 5D1ZD 1VRSA 3BH9A 4TL5A 3HB3D 4WU7B 4AW4A 5D7JB 2VDNL 3PWVA 4B9ZA 3NRFA 1OM3H 5LGJB 3IBEA 3QWRA 5DHVA 4B9JA 4P2RA 2R7EB 4MYPA 4UIMB 4KROB 5HYSB 1SDYA 2ENPA 4JHUA 1KYOJ 4H25B 5IB4B 4C56E 2EDEA 5B38G 4DKDC 5FO8A 5J89A 1MF2H 3VXMA 4I48A 4LO9A 1MPAL 1MFAL 4JRLA 2D7TL 4PBXA 3BLPX 3OGCB 4Y5XA 1IL1A 3T3MF 4F2MB 5IHZA 3PQYB 3MQIA 2QGCA 2WLLB 5KEZA 3KWXA 4IRSD 1BBDH 2XLLA 5I74B 3C87A 3B6SA 4ZW6A 1AGEB 4OLXL 2XPGA 1DLFH 5CP7B 5F7YC 5FFLA 3BP7B 2DICA 5IHBA 6FABL 2BFVL 1KCKA 2YC1B 3N1GC 2Z1KA 4N0CD 2VTFA 5EO9B 3WUWB 2OK0L 4N3UA 1ECZA 3EUDA 2ZP0T 3GXPA 3WFBL 4GKZA 1I4FB 3BX7C 5DMJB 4XC3L 2XTJB 4I0PC 1LO2H 3VXRE 3CPUA 3HMXH 3L5JA 4JRWA 3H2WA 3IJEA 2G2RB 3PPSA 1DVSA 5TF1L 3T0WA 2AI0L 2DM3A 3V52L 2HSIA 3VXNA 2XCMC 4R5TA 1UB5B 4O4YH 1LMIA 4KKZA 3GJFK 2R59A 3JWOL 2BIHA 2OJ1A 1G7PA 4L4VB 4YL4A 1YVLA 4NNXA 4Q52A 4W9GC 2A74A 4EI5A 1PKQB 3MX0A 2OSLB 3VFOB 4W1TA 1AKJD 2YJQA 3NCJH 1SYVB 2ZT9C 5CEYA 5IR1A 4H8WC 4XO9A 3QYNA 1U33A 4PRAB 4WO4A 4GAYB 1W16A 4KHTH 3O6KH 5D70L 5F0LB 4Z7WB 2HJLB 3F7VB 3HG3A 1GH7A 1NC4B 4OFKA 1RFDL 2WBJD 5C8JA 3O6FC 3IF1B 4OUOA 1HI6A 4MNQD 1EXHA 3BVNA 4N85A 3MJ7A 3QIWD 5DF0A 4BUQA 3JWNG 3FHEA 4KMTH 4FN0A 3K72A 4R96A 3ULVD 1K4CA 1M53A 2OCFD 1NPNA 2LTQC 5GJSL 3TEUA 3KPTA 2A83A 1DBAH 1E4XH 1M05B 2DKSA 3MRQA 3VI4B 1F41A 4YFLI 1ZT4B 1TR7A 3HFFA 2X7LA 3L13A 3KM1A 4LPWA 5BQ7B 2IAMC 4X4ZA 4NCC1 3CSTA 4TQIA 5HD8C 1ZV5A 3CHRA 1CPUA 1CT8B 2Y7QA 3QFDA 3S35L 3OKNA 5T5FL 3MNMA 5AZEH 1SJMA 2XWDA 1I9RH 1BVKA 3RA7H 3QXDB 1DBKH 2J7LA 2AXGA 4R97C 2BS8A 2ICEA 4IRJD 4G9FE 3LNIA 4DQAA 1CLVA 1XH3A 4YZWA 3T4AC 2QQLH 3CFBB 5HVHB 1YEIL 1S7VB 4LLVA 5HVHC 3RY6A 1N64H 2XVLA 3KBFA 4XX5A 2XV3A 4H20L 2CR6A 4FQQA 1TJHL 4XCCL 1IGFL 2A0LC 5JHDA 5DS1A 4LKCB 3DI2B 3IPBA 3MZGB 1P4IL 5L6YL 5CSBA 3RVXC 3DTDA 4CILA 1GOFA 4ABVA 1RUPH 2AEIT 1BBDL 1U92A 5EDXA 4I8DA 4GBXA 3JTTB 1K2DA 2A9NH 3DTXA 1CC3A 3JYCA 4XCEB 1CF8H 1AHWB 1CD9B 2PPDA 1QYGL 3H0TB 3R8QA 2YD2A 5JW4Q 4Y9CA 1SJVA 2J6EH 3PHSA 4ODXA 5IV2A 1WBZA 3UBFA 1A8ZA 4FQXA 3RVWD 1MI5D 1QQDA 3IGKA 4NRZB 5A7BA 3LZOA 4LVNC 3G6JE 4Z77B 3BPCA 2WXOA 4DJMA 2ICWB 2R56L 5I30L 5LLIC 2ZSVA 3C9NA 4ODHL 4U1GB 4J4PD 4KHXL 3HPJB 4I9XA 4QOKE 5J13C 4K55A 1DHKA 1Q1JH 5TGBA 4KAQL 3QUXD 5L4JA 4JFED 3IDYC 3VA6A 4NEHB 3SDXF 4E2OA 1QWHA 3E3QC 3GRGA 1KPVA 3BVDB 1XGUB 3QULB 5AUMA 1LDPL 2VXTH 4G1MB 4L48A 4PLKD 3TA3C 3WOVA 4JFSA 1T7ZA 2PKDA 4DP1X 4TRPL 2WVVB 3ARRA 3WDHA 1K8IB 43CAB 5FW7A 3BHBA 4UUJB 3PWUA 3F5WA 1X44A 3HCVB 2ZX7A 4D9RD 2C8NA 4YHIB 1T80A 1TJMA 3L7EA 4HT1L 4WTQA 4PJ5D 3SE3C 4AW7A 2ZCKH 3ARVA 1WS8A 1MCQA 3D2UA 5KS9A 2P48B 1KUMA 1SGKA 3ECBB 4LDOB 3PGCA 2YUWA 6PAZA 3CNKA 1CE6A 2Q86A 5DMIH 4PU2A 4G8GE 1E9QA 3RIAK 1OGAE 1F4XL 1TZHB 4QPEA 3N1MC 3DSNA 3MA7A 3L5XH 4G6MH 3MLVH 5FO9B 1S9YA 2E3VA 2ERJC 2V9RA 4GLRI 1A6TB 3UTTB 5ADOL 2OX5B 5KJRH 4RX4A 3Q6FA 2NY1B 2G75B 2IBGA 1YO4A 4MASA 1G84A 3NDYE 3CFMA 1JZJA 1MQ8A 1IVLA 3DMMB 1HQ4B 1OAQL 1TFHA 3IEAA 4ODUB 3IJHB 3MV9B 2HB0A 4EI5D 3CZFA 1URIA 4L1DA 4PGEB 3I50H 5JR1H 1PZUB 4OJEH 4NQXA 5CR8A 1U4FA 1M9SA 2JJTA 4JANA 1SEQH 4UV7L 3QJTB 5B1CA 3B9KB 3G5XB 3GXUB 2NDGA 1RZ8B 3O3DA 5DRZB 1JV2B 4YDKH 4QAWA 2ZPKH 2B77A 3ARGC 3QZMA 2BRRL 4HMCA 4RFEA 5K39A 2RACA 2G9HA 2X4QB 1HHGB 4YDKL 5J12C 3NESA 3Q2WA 4Q4IA 3BUYA 1SM3H 3MNZA 5D2NE 3EDKA 4P23B 2VDKH 2DQGH 2GJZB 4APQB 1EO8H 2G5BB 2UX7A 5C3LD 4HU8A 3QUMH 4M3HA 3PABA 1A5FL 3U0TA 1A25A 5GGSY 1ES0A 1A4JB 5LDSA 4KZDL 5KVGE 4LSRL 4XCFH 1EJFA 3X1NA 4GB9A 1EDHA 5BRZD 3S3PA 2G9HB 4QOKA 5BV7H 4TV3A 4NNPL 5M95B 1L0XA 5T1KD 4AL8L 1JMXA 1FZJB 2FE0A 5IJCC 3NCWA 4MA7L 3T77B 3ATDA 4BWUA 4E9QA 5FYLE 2IOMA 1WZAA 2Y6SC 2VMJA 1HSAA 3BDYL 3NFSL 4YSEA 4OI7A 1G0DA 4PS7A 3FH5A 4C54A 2EXSA 2NDFA 2V17L 4PV8A 5ID0A 1MWAA 3FMGL 5F44A 3DA0A 3MV11 4H2AA 3WTYA 1LO4H 4WI9A 4CBZA 2HT3D 3UGEA 3LDBB 4FLSA 4RA0C 5D1ZA 3G6DL 3OPUA 5C08D 3S34H 3SE6A 1WBYA 3EO0A 2OX5A 1JNLH 4NI6A 4PM1A 4KJYA 4W9EC 3IE4A 4A6YB 2QV2A 1AG6A 1I7TA 4FQXB 4LLUA 1P84J 4MJHA 5AW4B 3MA7B 4DP7X 3FC8A 4GKOA 3LZLA 3SQBA 4ZFFA 1S7SB 3ARQA 3LQZB 5I17B 3OR7B 1IIIA 3FQXB 5J8OA 1U58B 7FABL 1JCVA 5EIIB 1CXIA 2WCGA 3ZHDA 2DEYX 4HUXA 1HYSC 3NZUA 5K33A 1MI5A 4IRSA 3ZE1B 1MRDL 5K9OA 1U92B 4Y4FC 4YWGL 2OJEB 2F19L 3QNZB 2MPAH 5HI4C 3RGVA 3VFSB 3ZE0E 5DQ9A 4AWJC 2WLMA 2YA2A 1YC7A 3FQTB 1WLHA 5IESH 5CN3A 4M8QA 5ID1B 1AR2A 3C2AH 4Q6IB 1G9NC 2J6EL 2GSIA 3WFHB 1FFOA 4HIPA 1GJUA 5LWYL 4HX1A 1ZE3C 4OF6A 4QXTA 1BV8A 5EZLA 1BAWA 2VSDA 1A1OA 1IQDB 1WZKA 2JKIS 3K74B 3IK2A 5INDA 3R7QA 1PLCA 1BA9A 4FXGA 4XCYA 1AZZC 5JA8B 1XBRA 3LKNA 4I18C 1P6AB 1NBCA 1RK0A 4OJDH 2DI9A 3UTTD 1S5IH 1EEQA 2CDGA 4AM0B 3SGKA 4N9GA 5JMOC 2VLLB 3QDMB 1G1CA 1RMFH 1CXEA 1TJHH 1T89A 2OZNA 4LHUD 1UZ6F 4PLOB 3I6SA 1YC8A 5L4MA 3ZYZA 4KJPC 1H3UA 1VPOH 3EBIA 2FEEI 3O8XD 4NKMB 4GFTB 5BZZA 4TQEL 5GGQL 2VXUH 4YNYB 4AJWA 2OTPA 5AOIA 5D2LF 5CJOH 2C9PA 3CVHL 5ILTL 1J1PL 3D34A 4X7SL 4HBCH 3QJFB 4B9GA 1BZ7A 1A14H 3L48A 2FBRA 1YEFL 1ZCRA 1RPUA 4GAGH 5DZOA 3NSCA 1JF1A 4GUQA 1Y1UA 2F7PA 2F6AA 3BVNB 1J11A 2APFA 1KIQB 5FA4A 1XAUA 4OLYL 3ZHNA 4AZUA 3MRHA 3GSRB 4JG1L 2XVBA 3QWQB 3HS0C 4PCKA 5E6ID 2ID5A 3LNGA 1SHSA 3SE3A 1UD6A 4DGWC 2Z35A 4F8PA 1L9SA 3U6XA 1GL4B 2VDMH 4KXDA 1Y6KR 3KLLA 1N68A 4QLRA 4B3EA 4P2OC 4L4VA 2XACC 3EBAA 4PFEA 3ULAB 1ILSA 5EBWA 5I9QC 3OKOB 2PR4H 1WCQA 1J8HD 3ZKMD 4JY6A 3RI5K 3CZNA 1A6AA 3D1MC 3L54A 4JRYD 3VWJC 1FVDA 3QDGE 3U4AA 1D7BA 2K0RA 2VLMD 3SJVE 3IJ9A 5HHXH 4YHPB 3FUMA 5JO5A 2VLJB 3F7YB 1RU9L 2WY3B 4X8XA 3NCXA 3QZOA 4XNBA 1PAZA 4YMPA 3K80A 2X89A 1PZ3A 3K6DA 2F68X 5IW3A 4KU1A 3R18A 2X9YA 4MMXC 2VDQB 4OT1L 4MFHA 3CIAA 3JWOH 3VFUA 4X4YA 1YUHA 4HXAL 5J1AA 2Z93A 1N5YL 4MDJB 2X44D 1JZ8A 3Q7JA 4RRPA 4XNYH 3UYPA 3W11D 2C7UB 3B3IA 1WIOA 1JNHB 3W0WB 4AGLA 5IEHA 4M9OA 7PCYA 5F9AC 1U8MA 1AXTH 2YZ1A 1UZGA 4JPQA 3ESVF 4LVEA 1G7HA 4NOFA 2XV0A 4DPCX 1MREH 5GXBB 5BS0D 2OKMA 1PKQA 3EW3B 2VDPB 3KHQA 3GWJA 3KPLA 3MX0B 5F7LB 4UB0L 3UEQA 4B5EA 5HVWA 3C5XA 4LPTA 3N40F 1CVRA 1V8HA 4QF1B 2AJSL 2NQ3A 2VUYA 3QXDA 3AG2B 5DHVH 4LLUB 5J6GA 3BH9B 3DJRA 4D7PA 3QZPA 4ICWA 1XIWB 3ZYOA 4NCC2 4IRJC 4A6YA 1HIML 1IAIM 1ED3A 3DROB 4QWWD 2B5IC 5CXPA 3T4AA 5DJCA 4Z3EA 2WJ7A 5DHXB 3DBSA 3RY5A 4FQCL 4N28A 4GKZB 4BFFA 3APNA 1PX8A 1J87A 2FO4B 3MRJA 5A2BA 1AVAA 1HXMA 1NIBA 3REWA 3R7RA 6CGTA 2ICES 2FRGP 3GMLA 4Z7VB 5BVPH 5EU5A 5F3BB 1HK6A 2ZCZA 5FS5A 2Q10A 3OJDB 4L1TA 1RZJC 3LRKA 5C9JB 3FOMB 1T03L 3CIQA 3AM8A 1HSAB 1WPCA 5GS1C 4QNPF 4JFXA 3UTQA 3WENA 4JFOA 2ZZUT 3FNKA 2DH3A 1LK2A 3GMPA 1RUAH 2PWEA 4KROC 4PRNA 4U0QB 4YE0A 1VADA 2YEVB 2PCPB 4IS6A 4Z9KB 1D9KB 2IADB 1C5CL 1CFVL 1FV1A 2OR7A 4PV9A 3SKNB 3FPXA 3ZE0F 2P4AB 5JIHA 2ICWJ 1X6NA 4G72B 2DIAA 1ORSB 3DV6B 1SY6A 3OMAB 5HXMA 4JZJA 3GIZL 2WBXA 3EH5B 1OAZH 3Q2NA 5GGRY 4WK0B 3HNSL 2A4CA 4XX1G 4CVXB 2BS71 2G3ZA 2NY1C 2VR6A 3GJFH 1GPOL 1ZGLA 2YR3A 2J88H 3KYMB 4ZOBA 3AQZA 3RWGB 3GJFA 4Y4HD 4YX2L 2DDQH 1BF5A 2C9AA 3UJIL 5EC2A 5EFIA 1XCWA 1KLUB 3J27A 4Q0XH 2X42A 3DOSB 3AT8A 4BKSC 2A99A 4YBQC 1R3HB 4L37A 5DMYA 3GI8H 5I75B 3ABGA 3VTAA 4FNQA 2MPVA 3W82A 1D5BA 3T8XA 1SMAA 1KELL 4BQ9A 5DRXA 5ISZA 2VQUA 2QLYA 1XR9A 5EO9A 2E0PA 2JKWA 2BXYA 4WJG3 1JZGA 5CP7A 1RZJH 3RAJL 4F5CE 5JOEA 2XKNA 3TF7C 1DN2A 4B9YA 1ZLWK 1RJZB 2VO5A 3MXWL 2H3XC 5H37G 1TQBC 5IGXH 3P77B 3C8DA 1AZRA 3BC9A 4N87A 4WW2C 1X9UA 3LNFA 5IQ7H 3E80A 1JGLL 1HJCA 3MYZA 5E9AA 5I6LA 4R3SB 7FABH 1T0PB 3M7FB 5DJAB 3TZVD 3QEGL 1EZSA 4K7PY 2AK4E 3WJMB 1C8PA 2Q0ZX 4G9FB 3CSBA 3ZSTA 4CW1A 1C7SA 4GP8B 4Q6IC 3TIEA 2YZ8A 2NQDA 4A67A 2Z31D 3VRIB 1P4LB 4I87A 2B4CH 4ZS6D 1KT2A 3HVNA 3CX5J 4D0BA 4PJAE 4OB5H 5D7JA 1QRNE 2LFGA 4Q0XL 4MYWB 3O11A 1M3JA 4X0KB 1DBJH 4PHZA 1E9QB 2YD3A 3BKCL 3DX6B 3I3EA 3GMRB 4WCYL 3HG5A 1AZVA 3NFPA 4WHTB 4AC2A 4PD4K 4KX9A 3EJJX 3ARED 3OPZL 1TDQA 1NBQA 2AJYL 2D2CC 4K8RD 4OCSL 5KYWA 3MGAA 1LO4L 3BP5B 4KKPA 1XCXA 1HHHB 5DRWA 4P57B 3QR0A 3VI4E 3VYPA 1ZSHA 3HG1D 4PWEA 4XP5H 3LNHA 4Y4KA 1W72L 2FEDC 3D05A 3PAZA 4NPYB 3OQRA 3E6FA 3KXFD 4LSPL 2VZSA 1TNMA 3LYRA 4NS0A 5IROA 1Z9PA 3M8OH 5ELIA 2AEPH 2XWBB 4WI0A 2FHCA 4G43B 3P3YA 4GSDH 5GZOA 3SDAD 2ILLA 4AYID 2YWZA 4JDVB 2ZSVB 4A2GA 1QLFA 2J43A 4JM2F 2W91A 4U3SA 3DXAB 3EGSB 5KSBB 4PJ9C 1XQ4A 2G2PA 3PP4H 4J6RL 2OQJB 4JFQB 3BSZH 3MJGX 2W59A 3PJSA 1A5FH 3VXTA 1PKQE 4JE4B 3EO1B 1BFVH 2DQGL 2VDKL 3RVTC 2YA1A 4TLUA 2XWEA 4QCIA 3QDGA 1BLIA 1CFNA 1RK7A 2R1WA 2VQ1B 3LIZH 3MRIA 4H26B 2MCPL 4HWBL 3LEVH 5FKAB 4AEEA 4OZHA 2MCMA 4LFHD 1N6UA 2EEDA 3D8MA 3L5IA 3MV01 4JBSA 5CGYD 5D96B 3U1PA 5L2JB 3BO8A 1HNYA 4QRRB 3VD2A 5JIPA 5HJ3B 3ZO0A 1DVFA 5C3TA 1AI1H 1P84K 4RGND 4X0NA 5T3XE 3G5VA 1FZMB 3MRCA 2PXYB 4NC1C 5IG7B 3G3LA 1JZEA 1WZ1L 1MWAH 4IU2B 1XCQB 3P3SA 5BRQA 5BZWA 1J5IA 3PNWA 2O30A 3TV8A 4ZZFA 1QLEH 4NT6A 3RDTA 2VLRE 4AQ1A 4M6NL 2FQGA 2OW7A 4N2IA 1ET8A 2E9GA 1QSFA 3EYUL 4ZAKB 1W8OA 2DJ4A 5C0AD 4IIQA 3B83A 1CG9B 3CUPA 3SIKA 4XRCA 5DC0A 2UZXA 2APBA 4F24A 4TQHA 4QRRE 2OMXA 1YRKA 3OMIB 4BJLA 2IV8A 3D48R 5C0RL 4OIFA 4L9LA 2OMTA 2R83A 4LVNB 3VVWA 2J1KA 2VR9A 1JYVA 4F9PA 3K5RA 3S8GB 4EVNB 2HYMA 4ENED 1Y0LA 3E6HB 2Q8AH 5EZJB 4PTUB 1TQVA 3DO3A 5EWIL 1PIFA 4CN4A 3KPPA 2J8OA 5GQBA 1T66D 5LAXB 3PAYA 4N2LA 3MBED 1ZSDB 1OCZB 1QSEB 2YEQA 3DXAE 5KSBE 1DUYB 1GAFL 2CR0A 2JLLA 1AGDB 4G7VL 4P2OA 5IJKA 4XMZA 2D3VA 3ZR6A 1R47A 4JW3A 4JVUA 5A2IH 1X5JA 3MRPB 4UOZA 1FJ1B 4Z8FH 4U1JA 5I1LA 3K4DA 3KDMA 4XVJH 3T08A 1N5AA 1IJ9A 2K1MA 2QPUA 4NI3A 4I2XA 5C0CB 2NTFA 2IGFH 3EZJB 1NC4A 3PNRB 4L23A 4N0FA 1S9KC 3WI9A 1VADB 3WV0A 3RNQA 2ZSWB 1MW3A 4ZMQA 4S1QL 4XP4H 1M6UA 1FFRA 4ODHH 4JFTA 4CDGC 4P2OB 2XUWA 4HIJA 4RGMC 5BS0E 1GGBL 3KLKA 1X4XA 2ZNXA 4G11A 4QHKI 5B21A 2I69A 1PGRB 2K3TA 3SYAA 2LU5A 1QHPA 4I88A 3EXLA 1HFUA 1FWXA 4JDEA 1TTCA 1NDMA 2EDDA 3FW6A 5D9SB 5C0ND 3AT9A 1FAIH 3CVHH 1BSIA 3E6HA 2EH7H 2MJWA 3U25A 3WEBA 2GIMA 1XMWA 4PS8A 4DEWA 4JFHE 4HS8H 4IKLA 1QYGH 1BWWA 1G9HA 2VXUL 2EKJA 4NB7A 4CMHB 4LOFA 5E9DE 5I73C 4NJ9L 1XR8A 4Z3GA 1L6ZA 3CDFA 3QUYA 2LLLA 3O45B 1EEZA 4S1DD 3VG9C 1OZTG 1MELA 2EIBA 2CLZB 4JFPB 3ZTCC 4F7CB 5IMMB 3SGKC 3H9YA 4F92B 1BAFH 2XG4B 2R1YB 2IC2A 3BPLC 2EDKA 3AQYA 5C0JB 3AMLA 2GEQA 4DO4A 3HOGA 5CINH 1IAKA 2HLAA 2IFFH 4CADB 3LCYA 3EOTL 1YN6A 2MWCA 3KLAB 4P5TB 1KTBA 1GOHA 3PLYA 4LCVA 4Y4FD 5FIEA 1EAJA 1JFQH 4R7NB 3GSVB 3DK2A 3H3KA 5JHMA 4ISVB 1WFTA 3D0VB 3N5AA 2HFGH 4AQEA 4P2RB 2H0FA 4K5MA 4U1MA 1ZVHA 1N2RB 2AK4A 2FT6A 3B5TA 4NC2B 5FGCE 5A2CA 1F4AA 5DDHA 4PB0H 2YAMA 1ID5I 1JWUA 3DHMA 1MQKH 3IPEA 2LU7A 4JJ5A 3S3SA 1C16A 4EUPH 1MRDH 5LAXA 2VXQA 3J8F7 2E74C 3S35H 4DNLA 4AV4A 4OZGE 1CGXA 4YHPA 1KDJA 3K6OA 4JR9H 4AXWB 5PAZA 2I32A 3RZCC 4GPVA 4DK6A 2DBLH 2AV1A 4HSCX 1F6AA 2X70A 3EYOA 2UUDK 3D6GA 2Z91B 4BCXA 4EVNA 1X4YA 3Q44A 1KGCD 4AIXA 3I9PA 4XVJL 2GTZB 2E9BA 2XWJA 5I1EH 5DVKA 1CXLA 1YECH 5F8RC 4N5UA 1FG2A 3HLKA 1XGPA 1QUPA 3WTUA 4MD5B 3WJJC 3UGUA 4JDVA 2V2WB 4K71C 1AGCB 1YQVL 2B4CC 2EEBA 2I60H 1H8SA 3A5VA 1TVBB 4Y19A 4KVCH 3G6DH 4RFOH 5ACLA 3E3QE 2QMJA 3EH1A 5GRZA 1DVFD 3O6KL 4FQJH 1LWHA 4RBPK 4OGAC 4U3XA 4X80L 3S4SB 4OV5B 2HKFH 1MCHA 3SCMC 1B6UA 1B6DA 1ZHBB 3HBGA 2KZBA 3MRRB 1UA7A 3X1FA 2EIMB 2ITDA 3HBPA 3CC5B 1BD2E 4OZFH 1IARB 1X5XA 5D2NC 3ABKB 4RZCB 4KY1L 5HJ3A 4MA7H 1UKTA 3MV8B 2H6PA 1GJWA 3NFNB 1T0MB 3KDPB 4KV5E 4I3SL 2EYTB 1VENA 3P2TA 3VXUE 3MRIB 4HF5L 4P4KD 4DWHA 2E76C 4GMSL 2P8MA 4NKDA 4HC1L 4L9LB 3BUTA 4JFWA 3GXTA 1HILA 3TT3L 5HHVH 1IBDA 1N6VA 2XIIA 1EO8L 5KVMC 1CTOA 1MCRA 3ZTNH 1RIUL 2UX6A 2NY2C 1F2QA 2CO1A 4GRLB 4IIQB 1VKXB 1AQKL 4X5LA 3K1DA 4XX1E 5JDSA 3LEVL 2D7TH 4PI0A 1RJZA 1GKOA 2G9KA 1NZRA 1MF2L 1O6VA 5TE7H 1WAAE 1PQZB 3AT0A 1CD8A 3DWTA 4PI2A 3WFEL 3CFNA 4QDGA 3MBXH 3T1FB 4JGJA 3RX5A 2I07B 2DYPA 5DRNB 3KCWA 2NR6C 1T20B 1MLBB 2GCYA 3DO4A 4J28A 3DBXB 4JZOB 2BVPB 2P5ED 3Q13A 4JDTL 1JI1A 3PGFL 5F89A 3TYFA 1OAKL 2NX5A 3VUAA 3OTTA 2WMPA 4YQXL 1KIPA 3MFFA 1OB1A 2Y1AA 4LASL 1GGYA 1F1DA 1NMBH 3JTSA 2HFTA 3U1SH 3ZGIA 1ONQB 1XL4A 1FAKT 3FCGA 5B38B 5CEZD 5KYXA 3QPQD 5CJBA 3EO1A 4ZS7H 1QMUA 4OTXH 1DLHB 1QHOA 1MAML 4GQPH 3FH7A 4XTRD 1XB3A 5AVXB 3I6GB 3LRGA 4U4BA 4E9XA 5A6IA 1KB9K 3O81A 4Q9QL 4P3DA 4YGAB 4HP5A 2PR9A 4DKEH 3L81A 2E59A 4Y9FA 4N1CA 1M7DA 4XGZB 1ZLEA 1L9RA 1K3IA 3OXRA 4HXBL 3VDBA 1I8KB 3U48A 2C3VB 3GBMH 5LBSL 2PTTB 2IV9A 2V3DA 3OPZH 4JHZA 3SBPA 5E8PA 2WLHA 4G42B 4HUNB 1JE6A 2XWBA 1CD0A 3BKCH 4M48H 3HB3B 4NO0A 1PTZA 2WTOA 3ILDA 3JSSA 1JXKA 4OB5L 2Q9OA 1HE7A 3OQ3B 1V05A 4J4PC 3BLBA 3CXHK 5IW1A 1Z5YD 1HHJA 1IAOB 1UKQA 3PIQB 1W0WB 2SEBB 4R7VA 5E1AA 2VDPH 2AJVH 4HKZB 1MHHA 4ZS7L 5KBKA 3NSJA 4N2NA 5A2KH 3VTTA 5GZNA 2QBWA 3WO4C 3GK8L 1LO3L 3SPHA 2W38A 5I24A 4BKLA 3TTSA 4YQXH 2EECA 2XWZA 3ZTJG 1Z3RA 5F21B 5HDWA 3QDME 1U3JA 4OJAA 2IPUK 5EC2B 3B1UA 4WENB 5KN5A 5DYOA 5E9DD 4DUXA 4R5XA 2J57A 3D25B 3AQXA 3P9LA 1A4CA 3HHRB 1R0AL 1SLXA 1XH0A 3P02A 1G7LA 4ORGA 1T5WA 2G30A 3FKUS 4XAWH 1L3NA 3PJNA 1GGIH 1PX3A 2E47A 4R3SA 1IU1A 5C2BL 1JNHA 4WUUB 2CHZA 4XMPH 4L29B 4RQQA 1WWCA 3MR9A 2HRGA 2A9NL 3PJLA 4TSCH 4IRZL 4OGYL 3MV8D 5E4IA 2ED8A 3T71A 1E7VA 3RGVD 1YYCA 3E0GA 2F7OA 5IHUL 1P4IH 1XB6A 5L6YH 2X6MA 4BRJA 3IRPX 3IDIB 1WBXA 3SKMB 2ORBH 3RWIA 5I15H 2PP9A 3NIDE 1O7SA 3U6XS 1RHHA 5DUBA 2V6HA 2XV6B 1ZT1A 4JHVA 4CKQA 4ZNEA 2GY7B 4G82A 3GPSA 4PMEA 4YLBA 3RU8H 3MODH 3HE7D 4PJ8A 2P45B 4RSVA 4MMYB 1G0XA 3OAYH 1NIAA 2DTMH 3QQ4A 4GAJL 4P2QA 3QQDA 5EZPA 4MRBA 1DBKL 3BGFB 4OVVA 5G4MA 5CGMA 3QFJA 2CO2A 5C09A 3RP1A 1N6QL 3L1EA 2F5AL 2YPVA 4H8UA 4HKJA 3UIYA 3DX7B 5CHNA 2CBTA 3UGXA 1SN2A 3NZ8A 3WXVL 3O6MH 4XMXA 1TYRA 5T5FH 2FO8A 3RY4A 1U8QA 3L5WB 4X80H 4UAOB 4GO6B 1XSJA 2ISDA 1DFBH 2ZOKB 3OMNB 5J57B 1OE2A 1AHMA 3BWUC 5CS7A 5DC2A 1E6JL 1IVTA 5C7XH 5DD3L 4NPKA 1KFAL 1OIOA 3DK0A 4PV9B 1U8NB 1WZMA 1U8MB 1OAUL 1I1YB 2PPAA 3TH2T 4AGNA 1BVOA 2BVQA 2AGJH 5GJSH 4KOBA 2VZ1A 1FDLL 4GUCA 3SDXB 3GO1L 1HOCB 4JQVA 5EIQA 1RZIA 4NSKA 3GTTA 3P54A 4WFFD 2WINA 3RTQB 1AC6A 3P4LA 2MTPA 2KMWA 1MNUL 4N6RA 4YS4A 3QHFL 4PJEF 3RWJB 2ZOWA 2C9XA 1CL7I 3ZDXB 5LGKA 5L88H 4UYPA 3RZCA 2DYPD 3DMMC 4FNUA 4PVLA 4YBLC 4M7JL 1BG1A 5CP3A 4PJAA 1VJSA 1NCNA 2N59A 3Q1EA 1BECA 4K23H 3L3IA 4AEFA 2NX5D 3QA3A 3ARFD 5IWLA 1H15A 5HGBB 1AP2A 1A7OL 5D2NB 1CXHA 3QXTA 2NNAA 2ZG3A 2IXQA 2V2XA 5INDB 3ZL4L 4FG4A 3M17B 1PZ5B 1LYQA 5IB3B 4Y4FA 1A1OB 1IQDA 4Y5VA 4PWIA 4AYMC 2XXMB 2X9ZA 3O2VL 4XCEA 4XBPB 2EDFA 4GQRA 2D03H 5AW1B 5IEHB 1NGWA 3LD8C 1B3JA 5JOFB 1JTOA 3RTQA 3B4NA 3LD8B 3OKLB 4GT7A 5L0QC 4KRNA 2Z93B 4MJIE 5CM1A 3BN9D 2CJSA 1JPTH 3S96B 3DX4A 4OZIF 1TZGH 1IBYA 2VDML 4YDJB 3EH2A 3L17A 4IM8A 1JYXA 4QXWA 5EEYA 5F7WC 2Z7UA 3BAEL 4NQQA 4IDJH 1RPQA 2H2PD 1EJ6A 4LGPB 1TYJA 3UPRB 5MI0B 2WO2B 4K94C 1Y6MR 1U8QB 4YNYA 5F88B 1SDAB 4R83A 3SQBB 4ZFFB 4JM0A 1B4JH 1NCIA 4PW9A 4ZXBD 1ACCA 3TONA 1QFUL 3B9AA 1E3XA 2WZ0A 1OANA 3HHMA 3ME0A 5C09B 2EH8H 3KPSB 1NJ9B 2H26A 5GGVY 3EOBB 5TF0A 5AB9A 5TDPA 2VLKA 3MTXA 1MCWM 3SY0A 4M02A 3EO9H 2QDWA 2WAHA 4GXVL 2V5MA 1D6VH 5CJOL 5CEXA 2D9QB 5IT2L 4Z0XB 2AXWA 2LFEA 3OHXA 3GRBA 2D0GA 5C71A 4PY8I 1VPOL 3O8XB 2W9DL 4FNTA 4G8EB 2FLRT 1JP5A 1DDTA 1LNUA 2X4UB 3DURA 2VLRA 4LCUB 1RMFL 1R6VA 4ENEC 3WU1A 1AO7A 2Q8BH 3ZSSA 1JHLL 2F9BT 4J2QA 4ZMTA 1HI6B 4PRID 2JKRM 2AW2A 4RAVB 1S5HB 2WPGA 2D7NA 5EWIH 3EDDA 1A6UL 2B39A 4Z7WA 2BC4B 3V4VA 2XIBA 1K9TA 2D7MA 1J1OL 4ZOAA 3MRBB 3CVDA 1WFJA 3TA4D 2ADGB 5IMOA 3VFRA 4L9LC 4N2GA 4UTBH 3C2SA 4HKJB 1ES0B 3MLSL 4Y4FB 3ZE2F 1DQQB 3T2LA 2BNQB 3UTPD 4JPVL 5F1NA 5IQNA 4KK8D 4PJGF 4PJ8D 4LCCA 2ZYRA 3C09B 2EE0A 4AVIA 4KI1A 3FB5B 3KLQA 5HGBA 3OWEA 3NCMA 2BZDA 2MPAL 1CZ8L 1QVOA 1PG7L 2GIXA 3CK0H 5J06A 3N41B 4BSVA 5A40E 4N2FA 3N85L 2DWEB 1FGVL 2B3IA 2VR3A 3RNKB 4JG0H 1ZT1B 1HE8A 4X7CC 4DGYL 4YZFE 1VEPA 3QHZL 2N7AA 4X6CB 5GGUA 1RAMA 1EERB 2JKSA 3HS9A 4JFVA 4PJXE 3AC0A 1E0OB 4MAUL 3ZE1F 3QPXL 4FABL 5SWZD 5G4OA 3QEQA 3C5JB 3BSGA 2F0CA 2CLRB 3X1GA 1W0WA 5EO0B 5FPIA 2H1PH 2PYEB 5IP4A 5L8JB 4IGBB 4GMTH 4Y5YB 2R15A 4PREA 2WBJA 1DFXA 4ZFGH 1GIGL 2MMXA 3TPUA 4AY0A 1IL1B 4Y1AA 4NZTL 4Z7OE 2DYSB 4L4TD 4FTDA 1KULA 1QBLL 3L95B 2B1HL 4RSYA 3HG1E 4H8WL 4L8SC 1M9WA 1TXKA 4PIBA 3QGVA 4R7LA 3HAEG 3OKKB 5E9NA 1OP5H 4AGOA 4XXDA 1BFVL 1R3LB 4AVJA 2ZOKA 4RIRA 3G5ZA 1A7QL 1E5AA 2XBZA 2YPKA 3NIGB 3SQOL 1S7SA 5ITFA 4BZ2A 4P06A 3HN8A 1RURH 5ECGA 3UMNA 4XBGB 2OMWB 3QFJE 1R34A 2NY2D 1ONQA 3TOPA 1NAMH 2V9UA 3CQQA 3ZKSD 3HI6L 3U4EA 4OF0A 1EWHA 3CXDH 2OTUA 1T21B 3VJ6A 2ZOLB 4MQXD 3OHXC 5FCUL 4CC0A 4UQBA 4JUTA 4PWJA 5LXGH 3F7PC 2ZG1A 1HAUA 1TF4A 4TNFA 2GK2A 4A7SA 4QY8A 2YOAA 2JKJA 1PLBA 1ZK5A 3WN5A 4YVUA 1T4WA 1MIML 2FLMA 1T1YA 3ZKNC 5IQOA 4S1SH 3D33A 4DQOH 5C6TH 3S37L 3Q05A 3MKGA 3F6IA 4RDQG 2NNRA 4EN3D 3QCUL 4IGBA 4Y5YA 1KXTA 1WEJH 2AERT 4TSAH 4HG4K 4F8QA 3T1FA 1F45A 3KBPA 1WBXB 2DQUL 3HE7C 1TETH 2GFBA 4H8PA 4KKBD 2QR0B 5IZ7A 5HD8D 3E2HC 4NQCA 3A0OA 4GQ9L 4MJ4A 3BUIA 4HZLA 3KVPA 4JEGB 4TQ8A 4IJ3C 2ICWA 2FJSA 2NY6B 2DQDH 2HRLA 2WWNA 4BELD 2JKLA 2QSCH 3TN0D 1OD9A 4I0PA 3SBRA 1YPZA 4L4VE 3S36H 4EIZC 2VZVA 1CUOA 2FECI 1EJOL 4JFDE 4TNWK 4DKFH 5IBLC 1ACXA 2IMMA 5D1XD 4E9RA 3QPXH 3BYTA 3V0WL 5F1NB 4CRPA 4FQ2H 4DKFL 2UY7A 3L3JB 4FMVA 1KN4L 3QHZH 1MFCL 3V4UH 5C6PB 5FO9A 5DS8B 1ZWIA 4WW2A 1FGVH 3IETA 5C07A 4HUWA 4WHDA 2YPLB 4NQUA 2I85A 2QKSA 3HC3L 4F7TA 4EI0A 1U8CA 4HCFA 2AANA 4W9FC 3ECBA 3QQ9D 5EU6A 2QMKA 4H0GA 3O3DB 5DRZA 1T0NB 4HGWB 1T22A 1E6OL 1BJ1H 3X1BA 1YAIA 5IWLC 2CIIA 5GRVK 3TBSA 2EUWA 2DWSA 1ZHBA 1DQDH 4F7PA 1KBWA 2AQPA 4LLVB 3WYRA 5BW7A 1TKWA 1P1ZA 1MIMH 1J0HA 1F8TH 1LK3H 1MW1A 1PY9A 4LNVA 3LKOA 3WKQA 3QQ3A 1SNRA 4WFED 1B9KA 4PRDB 5IM7A 2DQHL 1LVEA 3A4FA 4P23C 1E27A 4L8DA 1O6SB 3B9EA 4ZZKA 1AE6H 1JZFA 1XGPB 1BLNB 1TQCC 4X6DF 2ADJB 3MREB 4KXZH 4NLHA 4NKDB 1A22B 5C97A 2ZX5A 3NCBB 1MFNA 3R1GL 5KYYB 4JFHD 1U8IA 4N2DA 5J9PA 4F33B 4ZD3L 1NBYB 1U8PA 2VXTL 1IGMH 3O6FA 3VFTA 5B38A 4MMZC 3P3UA 2CGZA 1KPUA 5IT2H 4BZ2H 1GW6A 3RLSA 3HLAB 4X7TB 4URTB 5J7CC 3M07A 4GXVH 2JTYA 1UM6H 5JLZB 2HWZL 2F5BH 2KT6A 3D2UB 3VA2C 5KS9B 3AM8C 3V7MA 1ZGLM 2VZ3A 1GZQA 1GIGH 4RMTA 4P5KA 1IGJB 4UQCA 5HHPB 2YAPA 1HYRC 2EO1A 4GW1B 3B7TA 4NBXB 3V6FB 5L7XH 4IMKC 5BRPA 5AWNL 3IMVA 4JHAL 1IKOP 1U8HB 1VA9A 2PETA 1NCBH 3QJHA 3QS2A 4XH2B 2Y3NA 4M8VA 2NSXA 3T0BA 8FABB 4NGHL 3OVUB 1B4JL 1AYRA 1X9LA 4MAYC 2K7QA 1OSZB 1A6VH 4AM0Q 4I1PA 1PD0A 1R3IL 4GAYA 3L3GA 4ZMWA 1CFSA 2WGNB 1C7TA 1OKEA 4QRBA 1LWJA 2FB4H 4WGWB 3O4OC 2H0EA 2X09A 1RZKH 2NX5E 3UZEC 1UXLA 1GGTA 3QQ9C 2GITA 3UBHA 2AXHA 2OMYA 3US1A 1KYUA 2XWJB 5EEZA 4NAMA 1T6VN 1JZHA 2DQTH 4M6ML 4HV8B 5J0BA 4MS8C 4EOWH 4JPVH 3TC9A 1OCRB 4KMQA 3CVBA 4UB0H 3VDAA 3VGAB 5E24E 1MSPA 1YMME 3L16A 4UYQA 3CCHB 3QFGA 3RPIB 3OKNB 2DQIL 4ZW3A 4DZ8B 1ZV2A 1WA2X 4Y2OB 3ULVH 3S97C 2O6PA 2R4RL 1JWSB 3K8MA 3NIFE 3VFGL 2AP2A 2ADYA 4DUVA 2D7PA 3VFNB 1NMAL 5HYJB 1PF3A 3ULVC 2JK5A 1VGKA 3N04A 4NJAH 1XIWD 5GGVH 5T1KA 3TVMA 3PQYD 1YEGL 3QJZA 2Y1ZA 5AAMA 3NGBC 4S1DC 4AKPA 1JGUH 5GS0D 3ECUA 4OD3L 5H35B 4B0MM 3U46B 2VISA 1U2HA 3MRRA 4IW4C 1E28B 4KNQA 1FYTB 1N10A 4M7JH 3B2MA 3GI9L 3QJSB 1I1YA 3WN5C 3IAGC 4K5NA 2IH3A 2VNCA 4YHZH 3N2JA 1E8XA 5GS0C 2QPEB 5I1KH 4J3OH 1BBJB 2CKBL 4TQPA 4URKA 5I1LB 4FQXD 1BQKA 2R1YA 3U9WA 1X4ZA 2W07A 4WDIB 4G9DB 2AVFA 5J1SC 3FO1A 2GI0A 1BXAA 4GT0A 4XN1A 5BV7C 5EZOL 5J6HA 1XSOA 3AU0A 3AXHA 3UOAB 4Z7OF 4R0LA 1IGTA 4ETQA 4XTRC 1ACYL 2PP8A 3VNZA 4NYLA 2UZPA 4JY4B 2VXSL 1ZGLP 2WWKO 3QCVL 3K6SA 3ASNB 2DQJH 1XGYH 4OZFG 2RFXB 4Z78B 1WFNA 2YRBA 3DPBB 2O5XH 3ETBF 1LE9B 3I02B 1MCWW 2APXA 4M61A 5D2LA 2BCKA 4PLNC 3IFPB 3V4VH 4H1LA 3WXVH 4R0LB 1JVOA 4DGUA 1AJ7H 4N0CC 1QSFD 1YEFH 4OJFH 4HIJB 1NINA 2DLEA 2LAAA 1F1GA 2B1AH 2VL5B 3WIFB 3RWFB 3BWZA 4OIAA 3LRSB 2XA8H 4OAWB 15C8H 4LVHC 4A2MA 4BCYA 3CJJA 2IO5A 3INUL 5D1QD 1E50A 1MCFA 4NQVB 2J8UF 3FAXA 4DOHE 1NCAH 1FFPB 1AGDA 2CGRH 2DLTA 4I13B 1XGRA 2P5WA 3D2TA 4H13C 1AG0A 4MQSB 1AIZA 1P5UB 4G70B 5KBNC 3P9LB 5DJDA 1DLFL 4O02B 4MD4B 4OLXH 4EQ3A 1YYML 1YY9D 3BVVA 5EZJA 3P9MA 1ZD6A 2W95A 1UACH 3CDGB 1KF9B 4IRZH 3LS5L 1A64A 3RJDA 2F8XC 2K70A 5K9QG 3QNYB 3BQUD 3CSYA 5C0IA 2EADA 1CB4A 1QEWA 2GK0A 3RPIA 1HZKA 5DJZA 1N9PA 1SY6H 1TT6A 3BSZA 4XAWL 3V10A 5MENA 2DM4A 5SWZA 1DSFL 2VXVL 3INOA 3ABLB 1NGYA 2PWFA 4LQ1A 3HTLX 4PJ7E 1HVXA 3CC1A 4B97A 4P07A 1CG9A 3CUPB 4GP5B 3HUJA 3DXAA 4Y1TA 1J12A 5KSBA 3TXAA 4ICXA 3ECWA 5E6IB 1W80A 4PJ9A 5GGRA 3HZKA 3I3DA 4HIEB 3DOIA 4ZMXA 3DETD 3FUFA 1NCDH 3JWDC 3QUKA 4NQDE 1KG0A 4DN4H 4XWGH 2FUQA 2I26N 2XVKA 1MCLA 1CFSB 3P4OB 5F97E 4ILDA 5SX4H 1OSYA 1JBJA 2E4FA 3GSQB 2ARJB 2X40A 3P69A 3RUGE 3IDGB 4HWZA 4BK8A 4ZUUA 1A6WL 2B15A 3HNTL 4UNUA 5KSUB 2NTFB 1FZMA 3EFOA 3BEWA 4D0CA 1QTYT 4XOAA 1FLTX 4JMNA 1JZ6A 3IVKB 5FA3A 2YKLL 3LV3A 4QOKD 1JZ3A 3KPNB 4LSTH 2L8AA 2YMXL 2ADIA 3AAZA 4FL4C 4FQ1L 4U1NA 1J05B 5IEKA 1UJTA 4ELMF 4Z7NE 4LPCA 1HZHH 2PNDA 1CFTB 3SDAB 4GAJH 1ZHLB 4QT5B 3UL4A 3V0VA 1UJ3C 4PJ5B 4QR7A 1PU0A 3QZWA 4WK4B 1DEEA 4F3FB 5C6WH 2V5TA 5IFJB 3RL1B 4Y4HB 1AOZA 1U8JB 3U9PH 4KZEH 3CDCA 1H6EA 2XG5B 4WTZG 2BK8A 1ZEAH 5F7BA 3K4ZA 2F1BA 2R29H 4FCHA 3PDDA 3FT1A 3DGDA 3RL2A 2OZ4A 4DVBA 4OLVL 3ZHFA 1MAMH 1M7XA 3T6WA 4U3SB 2BVPA 1AQ8A 4U1LB 3QNXA 5BMFH 3QUZA 4KK8C 3RZWA 5F71A 2VWEC 1CQKA 3TT1L 2OMXB 1QO3A 1H6TA 4PLJD 5IHUH 2B08A 2J44A 2BVUA 2W65B 3HAEB 2XFXB 3P11L 4NM4L 4IJ3B 2EVGA 4GP4B 5MP6L 2L7UA 4RMBA 3ILQD 2G0LA 4JM2C 3LN4B 4MA8L 1VEMA 2X9XA 3HZ3A 3MBWA 5SV4A 1NA8A 1K3ZA 3T2NL 4XCFL 3BXNB 2YD9A 2OFQA 3AQDA 2PXYD 4LSRH 1XF3B 4NIYE 4OCWL 1TZIB 1VFBA 3FF8A 4GG6E 5E8DH 1HHHA 1MNNA 4QXUH 5E8DL 2IBZX 5JXEC 2HMIC 4R4BA 1HILB 2R39A 3WHXB 2E56A 1U8CB 3BPLB 5BOJA 2X1WL 4QRPE 5TD4A 5AW0B 3NAAH 2UYLB 3QJOA 1BOGA 1YJDL 3NN8B 1D7FA 4KJQD 4YSOA 5IIEA 1QR1B 1BFOA 1P0SE 3BUDA 5HYFA 5TDOA 3JWDH 3TV3L 5KUMA 4AEHH 2CJTA 4L1LA 3WHE0 1IEAB 4YSCA 3KCPB 2FAUA 1NCTA 2YXWA 1KJ2L 2NXYD 1IM3B 1PFCA 3QWRD 2AMGA 3FQNB 5DJAA 2VN6A 2ARJQ 4AUUA 5A3IC 4YSSA 3I50L 3UYRL 1KXVA 2Y6SD 4RWYL 4BBWA 2FDBP 4RMSA 4DETA 1EXUB 3QI9D 1E2WA 5ECJE 3RJQB 3VXMD 4I3SH 1DO5A 4Q7DA 4G59C 2P7TA 4ZJ9A 3OD3A 4NQCB 3SZKC 3R19A 2F7QA 3VFWB 4XNAA 4OFPA 2H32H 1HX0A 2DOCA 5FYJL 3AWEA 3PL6A 3MRLB 1J9RA 2BW5A 2D3NA 2FLBT 3ELAT 5F0PB 4DP8X 3L1GA 3FU9A 4N20A 9PCYA 5EU5B 2XZAH 5F3BA 3IGLA 4XMKL 3FQWA 4J3OG 3FB8B 1CIDA 2GTZA 4AH2B 3WN5B 3O9WA 3C5SB 3WD5H 5F7NC 4G7YH 1L6PA 1J8RA 1JI2A 1WFMA 4FQJL 5MENB 1YNKL 3RL1A 1IBBA 3RRQA 1T1ZB 3STLB 4N8VA 1B4TA 4DN4L 4P0DA 1A7PL 1IC4L 2HG5B 3VXSA 2I60L 2VITB 2G4GA 5FYLL 3TFKC 5K9JH 2YJLA 4IRJA 1TZOA 1UD4A 3J07A 4JDTH 4JJ5B 3AXIA 4QF1A 2QFPA 5I19L 4X99A 3BE1L 2XZZA 1LDPH 4XXDB 3UJTH 1KCVL 2BVTA 5LQBH 2Z31B 3CHPA 3H9SA 1QFWI 2Y23A 2P5WB 3VWJB 2Z31C 4XVSH 1A7RH 2YGNA 3BAIA 5EH1A 2XWTB 3QAZB 4X9YA 2LLGA 3P4OA 4OCXH 4X2UA 3RTLA 1JXDA 3QUKB 3O3UN 3TZVC 1Q0YL 3MJ8A 1OP9A 3IYLW 5E1QA 5EUOB 1BMZA 4M62L 2XY1A 3AADB 4JO1L 2QTEA 2HFEB 4YOKA 4BE6A 2ZE0A 3C09C 5KZCB 1L0PA 3CH1B 1EO5A 3RHWF 3F64A 1HXYA 1AMXA 1S7TA 3KMDA 1YEHH 1KGJA 3HE6B 3LZRA 4A55A 2ZD0A 2BCKB 1SQMA 2DJUA 4ONGH 3V0EA 3PWNA 1QSVA 3V9EA 1MCPH 1QVOB 3DPBA 15C8L 3HC0B 3LKRB 1NBVL 4J3OF 4OIIH 3NMEA 3ELQA 3RWHB 2OJZL 4FE9A 3GJFB 3DECA 3FT3B 3KXFB 4PJ7A 2IDSA 2ZQKA 2AZAA 5DJ6A 5T3XL 2VRKA 1Y18B 3NDZE 1AJ7L 4QRPD 1NKRA 2X0WA 5E2UH 4UQ3A 2OL3H 4XHJC 3MLPA 1BX2B 3JZYA 1JPST 2WZAA 3LPPA 4MA1B 4WQOA 3O2WL 2BP8B 4NQVA 3D0LA 1KB5L 2FIRT 2WIIB 4RRPG 5T5NF 1ZA3A 4HS8L 5BXFB 3NJLA 2W0FB 3KYOA 3VU1A 1D9KA 4L3EA 4F2FA 5DA0B 4LPXA 4NQCE 2VWEE 5HI5D 4X4YB 1ILUA 2XXGA 3QEQE 1JF1B 4XH2A 5LGHH 4BWWA 4CU8A 2VO8A 2VL5A 2HCZX 3WIFA 4CVZB 3N1FC 4FCAA 3D2UD 4LMQE 1RJLA 4AITA 5EN3A 1UWFA 4XMUA 3DX9B 4K94L 4HZ1A 2EDTA 3FFDB 3FO0H 3SKJL 2VL4A 3HLAA 4X7TA 4DK5A 2FATH 3KPPB 3FRPA 4WWKA 2EXYC 1C08A 1T83A 4L2LA 5L9DH 3CFQA 3GJEB 4C4KO 5MEQB 1XF2B 5EZIL 1HAWA 3SPCA 3V6OC 1U8PB 2IGFL 2JVUA 4D0DA 5DHDA 5KBMA 4FFTA 1KC5L 4DZ8A 5ITBH 5B3JE 4K94H 1GZPB 3QDMA 1N4XH 2VLLA 2WQRA 2HUEA 4N26A 1R5IA 2Y2TA 2WXGA 4KMTL 5EOQH 3Q8BA 2YD0A 1PY4A 3QVAA 3DMMD 3X13A 3T6VA 3EFFB 2C9SA 3OL2A 5JQ6L 3GRWL 4JPIA 3POCA 2CDEB 1CF1A 3Q6GL 5ENWA 3D09A 5CBEB 4GG6B 1IFHL 3EH3B 4KQ4H 3BJ91 1FPTH 1BBJA 1BZOA 5C70A 1TKWB 3U6RB 4BWTA 3QXWA 3D39A 4DGVL 2WXMA 2Y7LA 1UUSA 2ZUVA 3GSXB 5E2UL 1THAA 2HXAA 3HHSA 3PYCA 5T3XH 3D4GA 3LNEA 1JZ7A 3G5VB 4NP4L 2OJZH 4C56D 1MVUB 1BEYH 2DL9A 4O4YL 5JNYB 1KIUA 3GMQA 3PDGA 2CGYA 4PRIE 2AI0H 2YPLA 3MUUA 2FZ3B 4XR8C 3X3FH 3IWVA 3IFOB 3VXOA 1ZWIB 2YQ3A 1QKZL 4JE0A 4O2FB 5C0CD 5IB3A 3HMXL 2FIKA 5G2NA 3ULVF 1B0GB 5B1BB 2XN9B 3OB0H 4ESKA 2VZUA 5D93B 5AOZA 3S5LG 1MWOA 3SY6A 2E27L 1LEIB 2ZXAA 4P49A 3MVSA 1PD1A 5F72S 2QELA 4M5ZL 3UBXG 4CMMA 5CCHE 4JCWA 4JFQA 3EADA 4RLDA 4OLZH 3V4PL 4M4PA 3W0WE 1EUTA 2WANA 2JCCB 1Q9LA 4LXFA 2BOLA 5EEVA 1A7RL 1I1FB 2GFBB 4N8VG 1FUNA 2E86A 5D8JL 1AZUA 1OGTB 2FSEB 3PAVA 4XZUA 3CU1A 4ZD3H 1BP3B 4J12A 5GSVA 1G4RA 3R1GH 1QPXA 2BVOA 2VDNH 5EU4A 4FL4B 4BINA 1E5YA 5K9JL 3WY3A 2VLJE 5E8NA 1YNLL 2CH8A 1U8OB 2AV7A 3SJVB 3FTUA 3RG1C 4KI5F 5DUPH 5AL0A 1JV5B 4FDWA 1Y7VA 4JMXA 2VB5A 5KYWB 5CCJA 4KQ3H 1P5VB 2J6EA 4JRXB 2BSCA 3LEYH 1FZKA 4LAJH 4J3BA 4DIXA 3EG9A 4CJ1A 1F8TL 1LK3L 1MVFA 3EJZD 3LJ3A 4AG4L 4DPRA 1EGJA 4OI8A 1BQUA 3DUUA 4Z7QF 2CBQA 1OWWA 4MCMA 5E00B 1FL3B 1WJ3A 4PG2C 2KKQA 3ILPA 4WNQB 4XP5L 3TBTB 1DJXA 5D7KD 3ZMEA 4FFYL 1JGDA 4XPBL 1CO1A 5CU5A 2J12B 3KLHC 2XWXA 2JH2A 4P5MA 3TN0C 5D2LE 3QG7L 1A0QH 2X4QA 3L95A 2Y22A 2Y2WA 4M1GL 2VJ8A 2OL3B 1YMHB 4RDQF 5CILL 4WKZB 1JZ2A 4P99A 5IKCB 3O2DL 1I8MA 4LL4A 3ET9F 1Q9KB 4DK3A 2DH2A 3C5ZD 5HGAB 3GD1C 3RWIB 4YZFF 2Y0SA 4U7SA 4A38A 4FQ2L 5D4QA 2Q76B 1HDMB 2P8LA 4KXCA 3WFHA 3ZXAC 1KDIA 2CJUL 3N6YA 4JQIL 4XCNA 2UWEA 1T0NA 4HGWA 4XO5A 3QDGD 4AEHL 3GLZA 5TJWK 1NKGA 4UIKL 5J3HC 3RNKA 1SXBA 5J1TC 4TTDC 2XPYA 3C6EA 1F97A 1PIGA 3DX1A 4BSVB 1T1YB 4GKSA 2GEEA 1RUKL 5I1GH 2WW8A 2DQDL 2FQFA 3GHBH 1KGYE 2VAAA 5FKPB 3IETB 5C07B 3PHQB 3WCYA 3ZMNA 2J1WA 2EDJA 4KVNL 1XF5B 4PJHF 3OKYA 2DAVA 5EIIA 4WUKL 2R4SL 1TTAA 2OTUB 3BKJL 3W9DB 4NQED 1ZGLB 4BE5A 3FQXA 1XEDA 1T2JA 4LIQH 4ES9A 1TCRA 2G0KA 2BLFA 4U0RB 3DSNB 3ULUE 2P80D 4DQOL 4NZRH 2VLKE 4V1DB 2JLPA 3SE8H 3LPWA 4PJAF 3SODB 1UZ6E 1WBYB 3PS6A 1ZS8A 2ATPA 4KDWA 3QDJE 2CR3A 1QZ1A 2PABA 3VD7A 2QV4A 4DAGL 3S5LB 1B4RA 4WW1A 4BGLA 5HDBB 3S4SG 3PWUB 2FWUA 3KPQB 5BMFL 4Y1SA 1P1VA 3A4AA 4R4ND 2OCJA 2WVVA 4POZD 5I6KA 2YHGA 1DSYA 1PVHA 5F9OL 2P43B 1HXKA 4JPSA 4MA1C 4HDIB 2BZCA 4LCIL 1FNAA 1XT5A 2DJMA 4OZIB 3PWPB 2HT2C 2X0VA 2AJYH 4KH2A 4UM8B 4Z95H 1AQMA 4NNYA 3US9A 5GGUB 4XOEA 4LVHB 3ZTEA 2VKXA 4G8GA 3V5DB 4POUB 1RUAL 4X5QA 3GLEA 3G7TA 4L4TB 2OZ4H 4YXKH 5T1MA 3FU0A 1NCGA 2IANE 4WI7A 3UFIA 3UTTA 4DEPB 3AZUA 4TNGA 3ILPB 3AUWB 4WNQA 1UA6H 1H6FA 2OLDA 3BKMH 1OK8A 4AK1A 4APQD 1YMMB 4EBQH 5TH2B 3S0PA 3WNJA 1KLGB 5HPOA 2BVYA 5F6HJ 3ESPA 3ML8A 4YH6A 2IWFA 1ASOA 3DUSB 3TO4A 2Z6FA 4QJ4B 4MNGB 3Q9PA 4IBZA 5C0BD 3K71A 4NUMA 4B5ZA 2GSGA 2NX5B 4TNWF 2RALA 2ZXWB 3HCVA 2YGVA 4L3CB 3W3BA 3TJPA 2R2HB 5CJ5A 4QYAA 1K8IA 5FDYA 4U2ZA 43CAA 1CGVA 4LDEB 1OO2A 3OG4B 5CCGE 1FC1A 1N67A 4XZUB 4H2CA 1KPVB 1JUFB 3QULA 3VAEA 4I5BB 1AO7B 4DESA 3GZKA 1FGNH 4A6YL 5HI3C 5DK0B 5EO1A 3SGJA 4KQ0A 4OFVA 1T04B 4U6TA 2R0KH 2GW5A 2CDEA 5T1LB 4BFRA 4RISL 4L0ZA 2I5YL 1UACL 3DI3B 2LAGB 4ZYKA 4LLYB 4KH9A 2EILB 3I9GL 3WUZA 2CMRH 2A0LD 3QG6A 4AUJA 2CKBA 3B7YA 4LDLB 4PJ7F 2D8KA 4XE5B 1EZVX 4JN2A 2F15A 2BOCA 1CL7H 1A2YB 1T66C 2A77L 1NFAA 1TMCB 3RX7A 3HA0A 3DUUB 3RZCB 2CU9A 3QJQB 2OMUA 3INUH 1PZBA 2GBAA 3NFNA 5EHFA 4ZI8A 1TZ8A 1U21A 2XA8L 3H85A 4RZCA 2A83B 4D8OA 2Y36H 4KO9A 5H37A 4M7LH 2OSYA 1Z66A 2X4RA 4OSUL 2J1XA 5IREA 1NOAA 2WQWA 2RB8A 2B59B 1IIKA 3DGCR 4IMLB 4ODBD 3LAFA 3SGDI 2V9TA 3QO0B 1Q72L 5HI3D 1WGOA 5D1XC 2ZYSA 2GC4C 3K2MC 3WE6A 1I7RB 3WY1A 3KWVA 1AHKA 5JW4R 3BAEH 2GB2A 4XI5C 3GSNL 1MFMA 5GZND 3NZ8B 1Q9LB 4D9LH 3BIKB 1QW9A 4QRTB 2QKIA 1PLGL 1MVYA 3LH9A 2A74B 5KVGH 5DMGD 5DJ6B 3RVUC 4E41D 2AAVA 1SOXA 2EIJB 1RK1B 2BSSA 2DY2A 1PLAA 1CD1B 3QUMB 4J3VA 4OLEA 1RZFL 5I18H 4WEUD 43C9A 5F88A 2DI7A 2NW2B 3KJ4B 3T0VA 5DEFA 5DTFA 5JIMA 1TUPA 4M5SA 4BM7A 1A21A 4EIGB 4NZDA 3ZHLA 2NXYB 3OR6A 3OXSB 3RWDB 4KDVA 1OT2A 1T5KA 2Y7OA 4LLWB 4IBVA 1M1SA 5HGHB 3SGEI 1KBGL 2GSIB 1NCOA 3NCYS 4ORZC 1E9PA 1W0VA 4FLHA 2OSWA 3CN4A 4C56A 1IO4C 3L3OA 3LRHA 2Y5QA 3MJ8B 1BW8A 4GIOA 4QI3A 2YBRA 4YBHA 2I5YH 1LEKA 1ZA3B 5BXFA 3TJHC 4L29A 4RQQB 4PGBA 3TH3T 4C47A 2WIMA 5JOFA 3QZBA 3UTSE 2ICCA 2PTU