4AGPA

Structure of the p53 core domain mutant y220c bound to the stabilizing small molecule phikan5176
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
196
structure length
196
Chain Sequence
b'SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
molecule tags Cell cycle
source organism Homo sapiens
publication title Halogen-Enriched Fragment Libraries as Leads for Drug Rescue of Mutant P53.
pubmed doi rcsb
total genus 49
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4agpA00
5BUAA 5LGYA 2J21A 3QYNA 1HJBC 2YBGA 1UOLA 2OCJA 3Q05A 5AOIA 4LO9A 5KBDA 3EXJA 2J1XA 2PCXA 3KMDA 2XWCA 4IBSA 1GZHC 2BIOA 2IOOA 2BIPA 2BIQA 4LOFA 3WTTA 3D08A 5A7BA 1YCSA 4A63A 4IBWA 3ZMEA 4AGQA 3WTYA 4LOEA 3Q06A 2J6WA 2J1WA 4AGPA 4AGOA 4AGMA 1T4WA 5AOKA 3WTSA 5G4NA 1CO1A 2X0WA 1TUPA 5AB9A 3VD0A 2MEJB 2ATAA 3WU1A 4L18A 2IOIA 3D09A 2AHIA 4IBTA 5AOLA 2X0VA 4QO1B 2J1YA 4AGNA 3US0A 1TSRA 1CMOA 2WGXA 5ABAA 5AOJA 3D07A 4IJTA 2IOMA 4IBZA 2BINA 4G83A 1H9DA 3US1A 4MZIA 5AOMA 4IBVA 3QYMA 3D0AA 3TS8A 3VD1A 2X0UA 3Q01A 1HJCA 3IGLA 5ECGA 3EXLA 2H1LM 2P52A 1LJMA 1EAQA 3D06A 3WTVA 4IBUA 4G82A 1E50A 1KZYA 2VUKA 2J20A 1EANA 2BIMA 4XR8C 4IBYA 5G4MA 4L0ZA 3KZ8A 1HU8A 2XWRA 4GUOA 4AGLA 2GEQA 5LAPA 4KVPA 4IBQA 3WTUA 1GZHA 4MZRA 2RMNA 4L0YA 3VD2A 4GUQA 1EAOA 3D05A 3WTXA 2ADYA 2FEJA 2AC0A 4HJEA 3WTWA 3IGKA 2J1ZA 5G4OA 1IO4C
chains in the Genus database with same CATH superfamily
4I3SH 5H4ZA 1MPAH 1WO2A 2XKSA 5DYFA 5CFAA 4JFEB 2YAOA 1F00I 1DVQA 1LO0H 4AEHL 5E00A 4XP5L 4E41B 2P44B 3PREA 4Q74A 2TAAA 4WEBH 4WW2C 1F11B 3AQXA 4OLXL 5CJQL 5HPOA 1IBHA 1YSOA 2J44A 3H9ZA 2H2SD 4XNUH 4F3FA 5A7BA 3CZLA 1BIIA 3NIGF 1YUKB 4U1GB 4XCEB 4Y4KD 4OIFA 1FNGB 1RH8A 2DQIH 4W9HC 2XYBA 3C08L 4D9QD 1GW0A 1I85A 3F58L 4LMQE 4ZO6A 1BYOA 5C09D 4N2AA 2W92A 3BJLA 3CX5J 4I9WE 2CA4A 4JVUA 2O5NA 4FQXD 3V4PL 2B4CC 5F9OH 1LD9B 2N1TE 2ROXA 3GSUB 2FX8L 1NIEA 3BH8A 3SO5A 5DJAA 3C6LC 4AYID 2VJXA 1NC2B 4J4PA 1K5NA 4N0UE 1W8OA 1WUZA 2HA1A 3O41A 3CHOA 1OAXH 2R9HD 2DYPA 3FH5A 2K9FB 4OCSH 3ZE2F 3G5WA 3U9UA 1WFTA 1IBYA 1CG9B 3IU3A 1K8DB 3O6FD 4HUWA 1TEFA 2QR0A 1CE6B 2VISA 1PPIA 5AOJA 4ECNA 2VZTA 5AVXB 5IF0A 1LK2A 1L7IH 1TTUA 3PNRB 2VRAA 2WO2B 5IOKA 1M6OB 4MRCA 4FNLH 4DEPC 4NO2A 4UOW1 4Z76B 4JDTH 3TZVC 2IFFL 2X9WA 3IJHB 4LLUB 3SD2A 3OGCB 2VLMD 3MRKB 3N43F 5TH2A 4WTXA 2OZNA 4M48L 2O6DA 1NGWB 3MBEC 3DVGB 4BHUA 4TNEA 4KX8A 3QEHB 4KJPD 3FF8A 3IDGA 1KBGH 1CBJA 3PFUA 4YDZA 4K0OA 4E9TA 5A2AA 5J7CC 1T1XB 3MRMB 2CLVA 1EX0A 2X5PA 2PPAA 1C5CH 1XSKA 4JO2L 5DS2A 1KIQA 5C08B 5C0AB 4GKNB 3CU1A 3K0WA 1I9EA 4AIOA 3HVNA 1DQKA 2V17L 1IC7L 3N41B 2VUOA 5LAPA 2HH0L 4G8GB 1KTRL 4P46C 5CSZA 2IH1A 1JI1A 1QRNA 1RSFA 3JWDL 5AZ2L 1QSFA 2JKLA 2UXGA 1HI6B 3ARXA 1FRGH 1HINL 1XD1A 3DV6A 3MUZ1 2HP4A 3QFJB 2VMFA 3IGKA 1ZTXH 1X4ZA 3EYOA 4PH8A 1ZJAA 2ZE0A 3MREB 4P3DA 4GUCA 4F80A 4I88A 3QAZC 1AY1L 3BEWA 4O2FB 5FR3A 3GXMA 4PV8B 2NY3C 2YPLA 5I5JA 1LP9E 3KBPA 5TE6L 1BZ7A 4PVNA 2RCSH 3O6LL 5C0EA 4HJTA 5H37G 1JPFB 4PJ9B 2P43B 2A9CA 3EDJA 3VFVA 3KVPA 3TA3B 3KYMB 5EIVA 3PUUA 4H8WC 3REVB 5I1JH 5SWSD 3INUH 2EECA 1Q0XH 5DQDH 4AIEA 5KVGE 1F13A 4OF0A 5C7XL 4DGVL 3VFPA 1MCRA 1FZJA 3D1MC 2XZQH 3H9HA 3O41B 4P2RB 5DMYA 4N0YL 1N6QL 4RWHA 3AT9A 1HHKB 1WZLA 3OKNB 2YPVH 3T0ED 3NCYP 4EN3D 3S8FB 3L13A 3CIAA 4UZGA 2VLJD 5IF0B 1YNKH 5CSGA 4HSQA 2OMYB 3E6FA 4LLYA 1TNNA 5L4IA 5C0RH 2CRYA 4PGCB 2X05A 1VENA 5FGCE 4AYBA 2AEQH 3QNXB 2NXZB 5JLZA 1QHOA 1DE4B 3VRLF 3ULUC 3MV9D 1KLUB 2HPOA 5T1LA 3MI6A 3SEPA 4RMQA 4JFOB 2X4PB 3MJGX 5C8JB 4LEXH 4TS6A 1MG3C 1H19A 1HL9A 4XN4A 2AP2A 4XAWH 1CDGA 1FFQA 1SMAA 1RI8A 3JWNE 1KTJA 2A9AA 2CLVB 5KVEH 5F9WB 1OQOA 2DY2A 4HHWA 2RQ8A 1OGAE 1DQJB 2K6YA 4YHOH 4JE4B 1GYCA 4QTFA 1OWWA 3ZDZB 1I4FB 3VE0B 5EU4A 4YSPA 4G8EB 2VDLB 3D06A 1KTLA 1E28B 4JFEA 4R5XA 1RZJH 3MBWB 3ARTA 5A3ID 1RVFH 1C12A 3EO1B 1IAOB 3GKZA 3VWJA 5DMKB 2Q5BA 3NCYS 2A9BA 3EFFA 1OSEA 5DRWB 3ARFD 5IZ7A 1ILSA 1IM3A 4YPGB 1AKJA 1ZS8B 3A23A 4BFEA 5CJBA 4Z7IA 5EZOH 4KJWC 2XBDA 1BMZA 3OL2A 4WFED 5L88L 2WC7A 4OD2B 5PCYA 3C60A 2W0FA 1D6EB 1KEMH 3UAAA 1UM6H 3MX0B 5SWZB 5JXAL 2FEDD 3KGRA 3PXHA 5C0EB 1NBVL 1GC1C 4YHNA 3B2VH 3NQKA 1T0OA 2BSSA 2E7CA 4RZCB 3A24A 3PNWB 1H5BC 5F1NA 4LHUG 5CBEA 1KSRA 2JKTM 3PPSA 1BF2A 2X41A 2Z6FA 4X4YB 3QHFH 2QSCL 2YBGA 1HJBC 5EORH 4GP8B 2YN3A 3MRCB 3SY0A 1CF1A 1CLOL 1AR2A 1Q9WB 1KPVA 3FQXB 3OQRA 3MR9B 4OGYH 1A4AA 1HZHL 3MBXH 4YGVB 3EJUA 1KYAA 5JIDA 5HHMD 4QTHB 3MRBA 3RGHA 1M05A 2O5ZH 2J8UA 4MD0B 3OZ9H 5T1MA 3SN6N 1XF3B 4OLWH 3UYRL 3AJ7A 4AMKL 4EUPH 5I24A 2VXUH 1XB8A 4ICWA 3EYUL 2BVEA 4AH2A 1PAZA 1ZHBA 1UA3A 4MJ2A 5IHWA 5JHDE 2DQDH 2WN3A 3SDDA 2OL3H 2OK0H 3BWAA 3NGBC 1ZT4B 4KUZL 3FQRA 4ONOA 2H6PB 3WTSA 2V5SA 3QQNA 5IWLA 4HUUB 4U1SA 5ECJE 1YA5A 2RQEA 4K9EH 2XRAH 2AXGB 5CNHA 5AAWC 4XVTL 3A6CH 1T1YA 3BSZH 5IB5B 3QO0A 1TZHA 2JIXD 4MJ5B 3SGEI 5J1SC 3MV8A 4LARL 3EIFA 5EO1A 5ALCL 2NNAA 5T3ZE 4LSQH 2YLHA 3HZMA 5L2JB 3EOYG 4PWHA 2OR7A 2A6DB 4I77L 2E0PA 5I26A 3FS9A 4HCRA 3P30H 4FLRA 5HYSG 3WUZA 2QSVA 3MJ8A 3KW7A 2SEBA 3FH7A 4LCUB 2G9HB 1MJJA 1FN4A 3L54A 1RZFL 4FD0A 3TWCL 1FFRA 3FFCE 3FU8A 4KJWD 2V9RA 1FNSH 3W57A 3N91A 3UO1H 2CSPA 4NQCA 4KFZC 4XI5D 2W65B 1HEZA 2ZSVA 4X98A 1J5HA 4I1RA 2JCCE 4YHYC 3AADB 4ONFH 3L1OL 5HYFA 4PJDA 3ILPB 3CVDA 2BVPB 1N3NA 3BWSA 3QNYB 3ETBF 1A4KB 1SOXA 2B59B 3Q48A 1WITA 1MLCA 3VXNA 2HVKB 1V55B 3NCWA 4UM8B 1XGYH 3A4EA 1OCCB 2K78A 4U7MA 3TWCH 3FCSA 1AO7B 3C6EA 1L3NA 3NSFA 3R4DA 1U8JB 3T0EB 1RK0B 1A7BA 1YEHL 2EC9T 2IBGA 1G4MA 3VCLA 1LE9A 2AJUL 5AWNH 2V5TA 3VXQB 2PP7A 5IB3B 4UANA 1BX2B 4NSKB 2NR6C 1HSBB 4MA1C 6PCYA 4LSVL 4GSRA 4RGOL 4LQ1A 4EMZA 1NGQL 3V5HB 3QDAA 4KJYA 2WHVA 4FEIA 4K3JL 1AZBA 2EXTA 1RUKH 1W16A 2KI6A 3A6CL 3N06B 3R18A 3QHZH 4ZMWA 4JFUA 3ROLB 2FL5A 3DX7B 1C16B 1EZLA 1H3TA 5JHDA 5MERA 4PP1C 2VL5A 4Z0BH 3TBYA 2NY6D 1C1EL 1HT6A 3HHRB 4YDKL 5FPIA 2EDXA 2B9AA 4TTDC 4GIOA 1RUQH 2YK1H 4JFFD 4YX2H 5KSAD 2R4SH 5GS2H 1IC4L 2A6KB 3P40A 5TDPB 1WUNT 4AGMA 3BZEB 3SPIA 1YEEH 5CKGA 2VXSH 3K2IA 4Y4FC 1O6TA 4P23B 4JHAH 4NKDA 5D1ZA 1IAKA 2XICA 2ZIDA 2C8NA 3CPLB 4JM4H 2UX6A 1XVSA 4XGZA 1KIUA 2GJ6A 5C07D 3QFGA 2NY3D 2QPUA 3VXOA 3U1QA 4OGYL 4A7VA 3ZJAA 1RUQL 5KYWB 4ZDHB 3WNJA 3QPXH 3MCYA 1YAZA 4MB3A 2C1PA 4OZFG 3QHFL 5DO2C 4X7EC 2ZOKB 1WAEA 3IN0A 4JL1A 1P1VA 4XMZA 4RFNB 4G7SB 4PEEA 3ZE0B 4YHNB 1SHXA 5DD5L 4WHTA 2R0WL 1Z9PA 5EDSA 4YFLI 3UC0H 3BP5A 3L3IB 2V37A 4L8BA 4BWWA 1T80A 4UM8A 4OVVA 1E50A 1S9XA 3D5OF 3OXSA 4FQQB 4NNPL 3MLSL 5D70H 3E9TA 3H7LA 3C09B 4GG8A 1UOKA 1N4XH 2R83A 4FNPA 2VDMH 2XWZA 4G8GA 5CP7A 1RK0A 1LE9B 1K2DB 3C8HA 1T83C 4JY5H 1XMWA 2OYLA 2FE0A 3FN0H 2R23A 3ARUA 3DROA 5KVGL 4MAYA 3TPUB 3HAEA 4U0QB 4M1CC 4JZNB 2BHZA 2X4SB 3E9UA 3UJIH 2FLBT 4LLVA 1YJDC 2D2CC 4FYSA 4YO0B 5F44A 1UZ6F 4KOCA 1EHAA 5I1KH 5D4JA 3K2UL 5ISZD 4QT5A 4JG9A 5D7JA 5IVZB 4M7ZB 1WFNA 5I6XB 3EHBB 5ID0A 1M1SA 3TBYB 4YSEA 2HAZA 3KLSA 1N8OE 4IMLA 4PB0L 3TBTB 2YOCA 1VKXB 2OR8A 2X7LB 2GJ6E 3BIKB 4L4TE 1SJEB 3TA3D 5IQ7H 3WTTA 1G6VK 5AW0B 1KJ3H 3GSNH 3KPRA 2GSIB 4EI5C 1JPSL 4YVUA 2H7WA 1QFOA 3WIAA 3QC6X 4P2RA 4WW2A 4LOEA 1FE8L 3V0VA 1FVCB 3SE3C 3DX1A 3G08B 1HHKA 5I6KA 3VFPB 2Y1YA 3U4KA 3HC4L 32C2A 1MNUL 4G3YH 5C07E 1BQLH 3OB8A 3FJTA 1VF5C 1A9BB 1GAFH 1T22A 1NBZA 2F54D 5GGUA 4AYGA 4R7NA 3AWFA 1HEJC 3V6FB 2E7LA 3T4YA 3PABB 3KPMA 4IKLA 3WO4C 4MQ7A 5HYSB 1IEHA 2H3KA 3ILDA 2G9KA 3MRJA 3QDGB 3ILPA 4MA1B 1H3PL 2MHAB 4QHLA 3QNYA 1CICB 3Q43A 1HS6A 1A4KA 4U49A 1M3IA 1QFHA 5I1IH 2AJUH 5AWNL 1XTMA 2Y23A 1OD9A 1A6UH 2XTSA 1PQZB 4XPFL 2WCSA 3X3GL 2AVFA 3HPLA 4RLDA 5AW4B 2JSFA 4B60A 1WFJA 3PGCA 3H55A 2E75C 1A6ZB 2Q3AA 3FQTB 5DUML 2O6FA 4YLCA 1QRNE 4IGBB 2VW6A 3FK3A 4MA7L 1XBDA 1G87A 1ZK5A 3ZN6A 3U9WA 3D48R 1BQHB 1HHHA 4H5SA 3RKPA 3LQZA 3JWNC 1QABA 5EUKB 1F86A 4IBUA 1IM9A 5AKTA 1X7TA 1WT5C 2H2PC 5D2NB 5A16A 4XB7A 5DUPH 1TYRA 2I5YL 3UBFA 4U1HB 4E2OA 1ZT7B 2ZX8A 3BKYH 3MBEA 1SFDA 1WBZA 4N26A 1FL5B 3IU4H 3TPUA 2VDQB 4U6YA 1XD0A 1IGJA 2PR9A 4NO0B 4OB5H 1D9KD 1NIDA 1DBJL 2HFFA 4KVPA 3FB6A 3CFDA 1G0YR 4JG5A 2XUWA 1D6EA 3FT4A 3B56A 4KC3B 2J1KA 4P2YA 1AD0A 3RA7H 5I76A 4KXAA 3C60B 1DBBH 5J6SA 4F2ME 2BP3A 3T3MF 4IMLB 3KAAA 5B4MD 3RYMA 1MW0A 4QRQA 4JO3L 4AX3A 3EXJA 3OD3A 5IROC 3VB8A 5DFVC 3H3PL 1AGEB 4K9JA 1J8HA 2FEEI 5E9DB 2QQKL 4D8OA 4HKJB 5TE7H 3MFFA 1OQXA 2WYHA 4HKXB 3WFHB 5K9JH 5D9SA 3O8XD 1IFHL 4JY4A 1CGWA 4HIQA 2PABA 1CXFA 3H3BC 4Q6IC 4Z3FA 4QTHA 4YE4L 1AKPA 3SPVB 4GG6F 3NSJA 5IREA 1NOLA 1N9PA 1TMCB 4OZ4A 2I60L 4ELMF 4GKNA 1KPVB 3FQXA 4QXGL 4LKXB 1OKEA 1KYDA 3GRBA 2E7MA 4U3SB 3LKQA 1A7QL 2NNXA 1U8PB 1T89C 3DXAE 3VUAA 2Z0UA 1YCSA 4RDBA 3RWGA 3K8KA 4OFPA 1CXKA 2DWSA 3NSYA 5I8EA 1RV6X 2EO9A 2P48B 2HKHL 4G6FD 4DCQB 4FXLA 2Z4QA 3ARQA 2DD8H 4WKZA 1Y18B 1J9SA 2Y1VA 5KSAA 3SGEH 4ZW7A 2JV6A 3G6JB 2L04A 3W81A 1P5VB 4QHMA 1XIWD 5A6MA 2DQIL 4N0FA 1AQKL 3QJFB 4UAOB 2MEJB 3FZUC 4OCMC 5FLUA 2FZ3A 1BV8A 1RUAH 4HCRL 4IOSD 1T5XA 4F57L 1BDYA 3VXTB 4WEEA 4F7TB 1ACCA 3US0A 3PV7A 2QV2A 4X9IA 3CFJB 2AQ2A 2H6OA 4XP6L 2E59A 2NNFA 2X4QA 1XGPB 1U3HC 2XTJB 3D85A 1UJ3A 4W9ZA 3EBAA 1X6NA 4YFDB 2QEJA 2ZOUA 4MWFA 5KS9F 4HMEA 5FS5A 3T5WA 4C8XA 2VLRA 4V1DA 4S1QL 4Y4HC 5IEHA 1IGJB 1ZIBA 2WVVB 1N59A 2YRZA 1YECH 4PMEA 2DH2A 3MNMA 3CK0H 2WXIA 2EIEA 4KXBA 3FUEA 4K7PY 3UIYA 4X6EA 5IFAH 5HGAB 2OPCA 3OJVC 3I3DA 5FYKD 4FNSA 2AEPL 1KNOB 1HFUA 3GXTA 3H9SB 4KTDH 4ETYA 3K6SA 1ND0A 3IB4A 35C8H 3W0WE 1EEUA 2R56L 3L5JA 4FHKA 3WY1A 4F1SA 4O02B 4ODSL 3LNIA 5C9JB 1QFWH 3VXNB 1HWGB 4AE0A 1NKOA 3IS1X 3VWJC 1PZ3A 5B1AB 4BRVA 4U6XA 5DK3A 4JMNA 1BEXA 3QISA 1NWPA 4HKJA 2FLMA 4Y1AB 5F21B 1JZ2A 4EOWL 3MRLB 1F4XH 5E8NB 2J57A 2ZT9C 1YY9C 5IESL 2P46B 1ZT1B 5DC2A 1K3ZA 1KY6A 4GSXA 1HQ4A 5H2BB 3I6LE 1RIHL 2Z7UA 2PXYB 3NABL 1A9BA 1I1RA 4LKXA 1XSOA 3W2DH 5BUAA 2CH8A 1RU9L 3VXRD 1M6OA 3JTBA 5L8KB 5IUCA 4NUGL 5AUMB 3VXQA 3HRPA 5I8KH 2ZSWB 3LXUX 1KBGL 3OGCA 5TH2B 3EO1A 4A2LA 5KAQG 4JFDD 2F53B 4L2YA 4OVUA 1UXSA 3BT2H 1DJYA 1U2CA 1QYGL 4FI7A 4LSTL 1ZS8A 1MUJB 1PKOA 2HTLD 5HGGS 3SCMA 1BVLA 4XPAH 2D4FA 4Y89A 1GL4B 1ZANL 4UQ3B 2C7UA 4N0FB 2LFGA 1T1WB 3L7EA 2HJFA 2A74C 3IN2A 1YYLH 2Q87A 3LV3B 4F7PB 3ASNB 3X3GH 4NC0B 1HAWA 3NG5A 5I1JL 4H5SB 4KO9A 1DANU 5D7LE 3WJJC 3M1BA 4KK8C 1IZKA 4PB9H 1ACYH 4XHJD 5ESAB 1BZ9A 5EBGA 3APCA 4M5TA 3WFZA 3U2IA 2OMXB 3QRBA 5I1EH 2WLIB 2CMRH 3QUZD 3ECBA 5BQ7A 3VXOB 2O26U 3BIBX 2Z7YA 4BUHA 1WBXA 4UNIA 2Q6WA 3BE1L 1I8MB 2IG2H 3ZVVA 1EXUB 4ZOEA 5DMIH 4OZIB 4MD0A 1AI1H 3TP4A 5CEXA 3QS3A 1MNUH 4G3YL 1TPXC 3DGGB 4FN0A 3BWUC 3I9GL 4GUPB 4ISVA 5E6ZA 4BKLB 5C6TL 1AXIB 3VI3F 4IEFB 3D85D 3LXBA 1KWKA 3U36A 4Z7UF 4CILA 4AXWB 1AGEA 2XDHA 3JV0A 4E9WA 1JGEA 5GRUH 4HIIA 4XN1A 3ZSSA 1IC7H 3CXHJ 2Y7QA 3GSNA 2LAGB 2DL9A 1NANH 3ZKXC 4PLJD 2MCPH 3BKCH 3MA9H 3WNOA 2RACA 2Z35A 7FABL 2FR4B 5BMFL 3FRPB 5SX4I 4L8BB 1WD8A 4M4RB 2CRMA 3ZHKA 4M6NH 2WBXA 2WP3O 3GC3A 3CUPB 4FQ2L 5C0GA 2H0EA 2WBJD 1RZKC 5ADPL 2YJQA 2XWEA 1MH5A 3D4CA 3ES6B 3EUDA 3OQ3B 2B1HL 4NM4H 3RIFF 3U82B 3EGSB 2CNYA 4DQOL 3BDBA 1KYUA 1N8ZA 3NEXA 1A4JA 4PJEB 1JZ4A 1TTGA 3WS3A 2ENJA 4FQ1H 5HI5D 3GD1C 2Z4QB 3T3MB 1BVKA 5AVQB 1QVOB 2WXRA 2WVTA 4TQEL 1MCKA 2X4SA 1LQSR 3BJ91 4HKZB 3P9MB 1YNLL 3MRIB 4A39A 1U3NA 1JVLA 3WFBL 3TEWA 1BBJA 2KDYA 4DP6X 1RJZB 4LCYB 1UOLA 3EJPA 3NUKA 5AOIA 3VQ1C 4Q97A 5DJCA 4LSUL 3GJFA 3QEQD 3ZIYA 2AKRB 1G9HA 3WL9A 3L7EB 2IALA 1TR7A 2YGNA 1YYML 1U3YA 4B0MM 5IY5B 1QP1A 4KKLD 5EUOA 3NZ8A 2F08A 4NN6B 3ZDXB 1MIEH 2R0KH 1GCFA 1A3ZA 5JPMA 4WW2B 3T0XA 1QWHA 3OKMA 4FFYA 3EFFB 2IDSA 5HDQH 4CSSA 2R15A 4FC3E 2AV1A 2DOCA 4RCAA 2WIIA 2OJ1A 3CXDH 1EXGA 5ISZA 5IEHB 2AGJH 2NY6C 3CC5B 4HK3N 4UTBL 4R7NB 1F02I 1Z0MA 4UT7H 3IDJB 2PW1A 2J43A 3RI5K 3QXUA 2JJTA 1EVTC 1ZSHA 3VD0A 1BX2A 4NSKA 1B0GA 5K9QG 5MEQA 4U3HA 5GQBA 2XQ0A 5HP5A 3RUGF 4Y4FA 4IEFA 2CBMA 1SEQH 3OKOB 4G7VL 4PJXA 1UZ6E 4DNLA 5AKSA 3LZFL 4RVBA 1J86A 1U91B 2AEQL 1SGKA 1L0YA 4Y1AA 1UA6L 4ERSH 3FQTA 3KLLA 5K93A 4DTGH 5CLXA 2ARJB 2BVTA 3MACL 4FFVD 5AOMA 4MNQA 1ICTA 4JO8A 4A66A 4HS8L 5BW7A 5B1JC 4MMXB 1GPOL 2UV3A 1KG0B 2APSA 3O9WA 2CJTA 3LQZB 2ZONA 2A6KA 3FFCD 4ODBD 3RPBA 4CC4C 4D3CH 5D2NA 3GXNA 3BP6B 1QUNA 1HHHB 1MFEH 4KKPA 4U33A 1R3KB 3TIDA 5A1AA 4GW4A 4F8TA 1NGQH 4YUEL 3CPLA 4K3EL 5E00B 2WOBA 3PWPE 5IV2B 4CDGC 5J0BA 4M7JL 4R96A 5EC2A 3G7TA 1WLHA 5K1VA 3IMSA 3DECA 1D5XB 4MD5A 3NFPB 4UQ3A 3J2PA 4LAJH 4GS7B 5D7SH 5DT1H 2CQVA 1RD6A 5FYKH 2V2TB 3R19A 3SKNB 3ZZQA 2D3VA 2EIBA 1RKRA 2Q7NA 4XO9A 1CXLA 3PL6B 5JIHA 4Y5VC 2UY6B 4PVLA 2A99A 3NN8A 1L9RA 1QWNA 1ZHKA 4XMKL 4OM0L 2VUYA 3OF6D 2GSMB 2J12B 2HT2D 1TZAA 1NBCA 4UT9H 4POZD 4DGYL 4R7LA 1GYAA 1NC2A 1GZQB 5F9DC 2B0SL 1CIUA 1I1YB 2CJSA 2R69H 4NN5C 4NYLA 3STZB 4UT7L 2JI2A 3PV6B 4PRID 4YAQB 4EZMA 2AS5M 2F54E 1YMHA 4UMSA 4K4KA 2A2QT 3RL2B 5L7XH 2WLYA 2HWZH 3UBGA 1EXUA 5CCKL 4HUWB 2Y4SA 4HD5A 3S5LB 1QI3A 4MA3A 3SGJC 1A6TA 1WC7B 5JXEA 1HYSC 5FYJL 3QNZA 2W65A 1I1AA 4NAQA 1PZDA 1E6JH 1P5UB 3LKQB 1XH3A 2ADGA 4OUUA 2B4CH 1AS6A 4JGNA 2AQNA 5CGBA 4Q56A 4FHBD 1BVNT 4TNWK 3QNXA 4K5PA 3H4HA 2QFPA 4YHZH 1SHWA 3JTSB 4MXWL 5DI8A 1A9VA 1O7DE 1I85C 1D3CA 3OC8A 4K5LA 4YO0A 3QEHA 4FXTA 1AZNA 1W0VA 4AQAB 4R84A 5LBSL 5MEND 2HG0A 3U6XS 3KPSA 3U4AA 1NINA 2IVFC 2WM0A 4GQ9L 2J3SA 4PTUB 1MRFL 3L95B 4PJ5A 1RUML 4TL4A 4XXDA 2WBWB 5B39A 1BOGA 3BSZL 2CO7B 2NT1A 2EQDA 1T6BX 1NOFA 5FYLH 3KLHC 1IBGH 1WZMA 3S36L 3NCBB 1MCFA 3OKKA 3K2KA 2BY0A 3D85B 3F00A 3CZEA 4X6FB 4F7TA 4G71B 1DJIA 2BOCA 4TUJB 3F12A 5E0FA 5IQMA 4MWFB 3DIFB 3EG9A 1WS7A 1DN0B 4FXKC 2HLEB 3MBED 1Y6NR 4I9WD 5D4QA 4UB0L 4Y1AD 4GBXD 2FX9H 2DYPD 1KBBA 4XB3A 3V4VH 4FNTA 3O6ML 5DRWA 2L8AA 3E0GA 1GY2A 2ATKB 1LLAA 1UOVA 4PJCA 1LQBC 1W8NA 3MTXA 4F2MB 1R3HA 4MD5B 1SYSB 4TV3A 1PLGH 1U4FA 4YDMA 1I82A 4CRPA 3AS2A 4IRZA 4ODXA 4RNRB 3ESPA 4ELKB 1VRSA 3O6KH 5DJCB 2BMKA 5TQ0L 1RUPL 4JQVA 5ILTH 5EORL 5D1XD 3Q2WA 3OAUH 5D1ZB 1ZLSH 3FQWA 4XN5A 2I07A 4NZFA 1C08B 1PZ2A 4QRRD 4DVRH 4LCIH 4HC1H 5D4HA 4XGZB 1AI1L 2WAQA 2OA9A 4U6XB 5ES4B 4J1UA 3ZT7A 1E5AA 4Y4KC 2DQGL 4HUCA 2OMZA 4LKCB 5EO9A 3TXAA 3PV6A 4NP9A 3MLZL 1E4XH 3PGCB 3LN5B 3VMNA 3ULVL 4I3RH 1F5WA 3DKHA 2VDKL 3LYRA 2F58L 5J3HC 1IBFA 4FLOA 5TQ2L 1WC7A 1KTDB 2OMYA 1HTYA 5FW8A 1BP3B 4OJEH 1XWVA 5E9AA 1D5IH 3RWEB 4XBEH 1KGCD 4XNXH 2Y7LA 3E8UH 5I75B 3OKOA 4LU5H 5FAAA 3A4DA 1F6LL 3IMBA 2X4OB 4ALAC 1GJWA 3FPXA 5JA8B 3RX5A 4JQXC 2WQSA 2G2RB 2Y7SA 2H6PA 1ZVSA 1NKRA 4WFEE 5I74B 2GBAA 3ZKND 4URTB 3EOBA 3NAAL 1FBIL 3OJ2C 2I26N 3S96A 1IEAB 1INEL 4ZUVB 3VXMB 2AXGA 3BT2L 5D1QC 3SGKA 4IHBA 1BOGB 1VADA 3CSPA 3BP7A 1JGLL 2FX7L 4XNYH 3NZSA 4YHZL 5CEZE 3FRUB 4G8EA 2IANE 5EU6B 4RQQB 1BQKA 1UATA 3GSUA 3TV3H 1OARH 3ULUH 3TIDB 4IQHA 4KZDL 3BPLB 1HWWA 2BOCB 1A0QH 1A0QL 4IRJC 3NGBB 1TJGL 3NCCB 4ZFQA 4APQC 2C9XA 4XVOA 4ZMOA 4X6DF 2AHIA 1LDPL 3BAWA 3QI9B 4JG1H 4OZIA 4MMYA 2ZKYA 3CWGA 5CEXB 3ZO0A 3UTPE 5ID0B 3KXFD 2F8VA 4Q9RL 1XGQA 1UD6A 1SYSA 2C1OB 1JNNH 5CZRA 1IJ9A 4GW1B 4JDVA 4FEMA 3SO3C 2ZCLH 4BUQA 3LRKA 2YGQA 3WYRA 4XZUA 1ET7A 3FTYA 3QYMA 2AXFA 4OLVH 4N20A 2PP9A 3QR1A 2ZUQC 3GMOB 3FULA 3ZL4H 2X4RB 1I9RH 4FMFA 1FZOB 1LJMA 3RPIA 2B3IA 1NGWA 4A7TA 3WTVA 5C71A 2NUTB 4JHUA 3T0EE 1S3KL 1VFUA 3M7OA 2EEAA 2KHAA 4Y4HA 2HJKB 1SF3A 2LV4A 2W60B 5AKRA 1OB0A 1ADQL 3ES6A 1J5OL 4M4RA 2LAAA 3EAKA 1KF9B 1CFTB 2R1WB 1ZGLM 2X6BA 2Z9TA 2G75B 5IMLA 3VCLB 2X3BA 4GG6B 4X5PA 3VXRA 3QDJB 2ZJSH 3H53A 2YJLA 4HC1L 4IGBD 2NY2B 3VWJD 4NZTH 2ZWLT 1SPDA 1HINH 4IHOB 4ODWA 1ZHBB 4CUCA 1F4YH 5LGHL 3GSRB 1CS6A 3FQ4A 3G9AB 4WUUA 1DBKH 3SDDB 4DKTA 4GRWF 4U4BA 3UDWC 3RUGB 3RNQB 1RZKL 1HL5A 1U8QA 2L4OA 4ERSL 3L95A 5I0XA 2V17H 1PLCA 1SMDA 4HYTB 3P4MB 4YMPA 2IALB 4P3CH 1RJZA 1VEOA 1PY0A 1R3IH 4LCYA 3QQXA 4CN6A 2VM3A 3MRRB 4XO8A 4QI3A 4XVJL 5TDPA 4ZOBA 5GHWL 5CWSA 3O0RH 2PLTA 3G5YB 1ITBB 3GFUA 4X9YA 3MV9A 1B6DA 1D6VL 4P23A 2XN9A 5KVFE 3L5XL 1P69B 3KM2A 4YR6B 4C47A 1FBIH 1YUHA 5DXWA 3OKNA 2WZPA 1SXNA 1MLBA 1WE5A 2ATKA 1JXGA 4G5ZL 5D5MA 2O5XH 2A77H 4TQEH 3RJOA 5A2BA 1UWGL 4PW9A 5HDQL 2B20A 4LU5L 3D6GA 1ZKAA 3DMMD 3HCVA 4XBPB 2PWEA 3ZE0E 3OM3B 7TAAA 2JB5L 3BQVA 4BZ1L 3H2QA 4L18A 4P5RA 2PWGA 2ZOKA 1QLFA 1BYNA 4OFIA 1MFUA 5BS0D 2VDQH 1CQKA 1E30A 3G6DL 1FGNL 5INCB 5JPNB 4WHTB 3FQUB 2X4RA 1KXQE 3BIAX 4MBRA 5H8DA 2QQLH 4RA0C 3WE6B 3MN8A 3GBNH 2NLJB 3GGWB 4J1UB 1K6QL 5FUCC 4HCIA 1HX0A 2W60A 4YHIB 2XNAB 3L3GA 3BP6A 1U8PA 1E28A 2ALAA 5GIRB 3ALXA 1RJYA 3M1BB 3D2UB 5DF0A 1G9EA 1RLBA 1TKWA 2WMPB 2ZNXA 3VDBA 5JQIB 2R69L 1CD8A 4QNPF 2CCLA 1R3KA 4ANVA 3H6JA 2OMXA 4XP5H 2YXFA 2P28B 4F91B 3DSFH 3SYPA 4TNVK 1ZLUH 4OF3A 4WUUB 3T6XA 5FF6B 1R5VB 4WO0A 2EH8H 4X7DC 4CJ1A 3WNIA 1KELH 1VFAA 1MAKA 4ZFGH 2GYSA 5DJYA 3V4VL 3QQ4B 3RNQA 4N1EA 4OFVA 5EMYA 3MU3A 1IEAA 3ULVE 1RFDL 1XF5B 1KEGH 2Q3ZA 3NA9H 1KGJA 3II1A 3X1BA 4Q4EA 2VLKD 5G55A 4NCDA 4GW5B 4HJEA 4JM2D 3D33A 4NC1C 3IAGC 4RQQA 5ISZE 1UZGA 2X4QB 2X1XR 3PL6A 1M42A 3SZKC 1GZQA 5I1HH 1UJ3B 1HAUA 2Z1PA 5F88A 3BKJH 2E9GA 5HI3D 2QGCA 2OJZH 3P0YH 1QTYT 3GSNB 3EOAB 3W0WA 5C07B 3QUMA 2H45A 3CHSA 3D7PA 3OC5A 4YC2C 3BPCA 5MEOA 2IG2L 3QCTL 3HEIB 3V0VB 2KC0A 1YUHB 2F1EA 5F7AA 3UYOD 5HYJB 2VE6A 4MLIA 2Z1KA 3PXLA 5KYWA 4GOSA 3BGFB 3SODB 1QLEH 5FDWA 6CGTA 5A6LA 1JUFB 1RPKA 2PNDA 2CAKA 2BHFA 2EIZB 2JQAA 4X83A 2OFQA 2XSKA 4LESA 2VMEA 4NPYB 3BQUB 1EDQA 2WXOA 3LNEA 5CD3B 1UVQA 1BVKB 2WSKA 3I6GA 5IQNA 1TJIH 3GXPA 3KPSB 3N1MC 3OKDA 2IDQA 3C6SA 3LMJH 4HOMA 2A74B 2F53E 1MCSA 3MRIA 1PQZA 3KJ6H 3QORA 2CXKA 2HTKD 3FCTA 1SY6H 2K6ZA 4QF1B 1I9IL 2PYEA 4BA8A 4TXVB 4MJ5A 4V2BA 2B0SH 4G7RB 4RGNC 2CG9X 4YHIA 3T0WA 2XNAA 3L3GB 1EAPB 1WH0A 5CP7B 4W9LC 4I18C 4LASH 3WE1A 1Z9OA 4A38A 4PCKA 4U3CA 1BPVA 1AFVH 3MV01 4KRNA 1U6AL 3EBIA 5C09A 3DROB 1I9JL 3SIKA 5HVWA 4JHWL 4JPIB 1MWOA 2R0KL 4O2EA 2EE9A 2E9BA 2ITFA 1E8YA 1U21A 3HZMB 2AEPH 4XMTA 3MROB 5ADOH 2PO6C 1FH5H 3RX8A 1W72A 2J25A 4XVUC 5DHDA 4D0BB 1IRAY 3FONA 4LPYA 3TT3L 4KX9A 1E8WA 4M61B 3VNYA 1OK0A 3ARFB 4YHPB 1KBPA 1RHFA 3DHUA 3MNVA 4G82A 4Z1PA 3IXAB 3O9WC 4JKPH 2C9VA 3ARSA 2ZX9A 5AVTB 1BXUA 3Q8FA 4FMVA 4JBSA 4XP1L 1ORQA 3ABMB 3GMPA 2EDMA 2GSIA 1QSZA 2P8MB 1RIUL 4MZRA 3RDJA 4YSQA 4J39A 2HVKA 3AM8C 3HG0A 1T83A 4U6VL 4CKVX 3S34L 3MDJA 2HKAA 1AYRA 4DTGL 4NM4L 5MI0C 1TPXB 4YDIL 2Q6WB 3L6FA 4WENB 3SPVA 2J6EL 3TF4A 4NQSB 4WEUD 1BXAA 2ICWB 3RGVC 3CQPA 4JGMA 4BFRA 4L4TD 4H2CA 3BDXA 5GS3A 2PCFA 2OMBA 3UTTE 3TNMA 2NXYB 3LJ3A 3B9EA 3BGFC 4G7QB 4LGPB 3RIKA 5E9NA 2WLLB 3QDGA 4P5KA 3TYGH 5A2CA 3KE0A 3AMLA 1OF0A 3L3OA 4TMPA 3IDGB 3I6GB 2XV2A 4MS6A 4WI2A 4G6JL 4B9FA 5IW1A 3V5HA 1MCBA 1U8KA 2X4OA 4X2UA 2DBLH 1GGIL 1HVXA 2XWJB 3ULVC 3OWRA 3TN0A 4ABUA 4PRBA 1U8LB 2JKXA 4NAJA 3CHPA 1WCBB 3QCVH 5H35A 1MH5B 1Q0EA 3AUWB 1BFTA 3F2LA 2VR7A 3SE3A 2J2ZB 3KYAA 2W5PA 4P0DA 3LAFA 2QFRA 4PJDF 1ZHKB 3LD8B 3OR7A 4ELMB 1L0QA 4WI7A 5E5MA 1WFIA 4YSTA 4B9CA 1KIUB 2GJ6B 4NKDB 4UUJA 1G0XA 3FN3A 3CDYA 1NMCB 2DWYA 3JWNG 1DFBL 3WV0A 2YZ1A 5D1XE 2ZTBA 3H9SE 5I16A 2C1PB 3RVTC 1BBJB 3EFDH 3S5LA 3SBQA 2UUDK 2WNXA 2A83B 4X6EB 2HLAB 4PP1D 2VT0A 5TE7L 1FO0H 1XH3B 2ADGB 2BZCA 3MQIA 4OUUB 3RGBA 2VLLA 2C1OA 5CGYC 3NEEA 3L3HB 4YBLB 1EGJH 3IDIA 2JTDA 2QSTA 2QLYA 1A6AA 1D7FA 1ZV2A 2K7QA 3C5ZA 4G8AC 2FGZA 4LLWB 3LQMA 1J8HB 1EK3A 2CJUH 3M86A 2WZ0A 3BUTA 4QTIH 4ZFOB 1YEGL 4AQ1A 5I30L 3R0MA 4L4JA 5JW4N 3LKPA 4N2GA 1BD2A 3T2PA 5HYJD 4M6NL 5EZIL 3W2DL 3VW3H 4NQQA 3L4ZA 1ITCA 2FATL 2V33A 2QKIB 3GM0A 5CAYB 3ABLB 3VACA 3M07A 1FG2B 1JPST 2L7UA 1JHKL 2HT4C 2DQEH 3U30B 3UFIA 5I6NA 4XXWC 1PVHA 4G5AA 2G75A 3PPEA 5AW7B 3LRMA 1QSEB 3FUDA 5ABZA 3PGFL 2VJ8A 4JFFE 4UZSA 1SXSA 2Y6SD 4WKZB 5JHBA 5D2NE 2LR4A 1G5AA 2YAPA 4GH7B 3ZYOA 5LXVA 5C92A 3FSVA 1JNJA 5IOPA 2BZDA 4Y4HD 4QT5B 5D7JB 4UTAH 5T33L 4CADA 4NERA 3OHXC 2XRAL 2J88H 2NQ3A 4WSJA 4NKMB 5I1HL 2VQ1B 1X9LA 3HFMH 1SBSL 3V0HA 5EU6E 5E6ID 3TBTA 4KI5E 5AAMA 3CVHB 3VE0A 3WEXA 2WP3T 5CWSB 3IPFA 3G5YA 2FIRT 4DWHA 1HCZA 3L2NA 1RZIA 3AY4C 5ICXA 1W0WA 5C0FA 2MFNA 3MC0A 4LNRB 4CA4A 5SWZD 1C08A 4IIQB 1E9OA 5LDUA 4F1ZA 4FJZA 2B5IC 4X0KB 5F0LB 4JN2B 5D7KE 4Z0XA 2WLIA 2ZYHA 1YO4A 4PJGE 3L9RB 4AQZA 1J9RA 4NHCL 3T2NL 1AH1A 1BAGA 4N2OA 3KLAB 4LFHG 3SDCC 1T4WA 4LVEA 1F42A 1EGJL 1ESOA 4JFYA 1PGRB 1J88A 5L2KE 1AQKH 3H9SA 3HCVB 1GR7A 4Q0XH 4XBPA 5D1XC 4F9PC 2ZOTA 2DIBA 3T4YB 3VYNA 4OFKA 1CICA 3GJEA 3DX9A 2OSWA 4ZMYA 4BFGA 2NY2C 5HVFB 5KZCD 2CR0A 1K6QH 4MVBD 2X87A 1FJ1A 4FKEA 4KAQH 4DK3A 1F3RB 2F1BA 2EEBA 1DLFH 3I2CH 4GSDL 4ZTPH 4APXA 3TEZA 5DJZB 4OKDA 1JBJA 3U2JA 4NYLB 4HIIB 2IPTL 1EMTL 1L0XA 1Q9KA 4N2DA 3VFSA 1ZVSB 3SPGA 3TNNA 4ANKA 5LHDA 3EOBB 1A7NL 4WFGE 5LXGL 1UASA 3IRCA 7CGTA 1JHLH 1AQMA 2ARJQ 2CBTA 2IBZY 2J8UB 4OH2A 4QMEA 1A6ZA 1WBYB 4Y1AE 4RFOH 1XF3A 5BV7H 2LU3A 5EOQL 1Q72H 3LRLA 4UTAA 3SOBH 4P5TA 1JERA 1HL4A 1T66C 4GRLD 2PCFB 3Q5YA 1ZT7A 4M62H 2A77L 3I6LD 1RZGB 3JUZA 4G5ZH 2EXWC 1UHVA 1NPNA 2V8LA 3AROA 3EGDB 1UG9A 3BESR 5E6IC 4DESA 3RUGE 2DJSA 2DN7A 3L3OB 3QT2A 3BMWA 1NMCC 1W0VB 3S6CA 4YEFA 4Y2NA 2E86A 5BRZE 2ZWNA 1USQA 3NJJA 4HC1A 4K8RD 2H1XA 2I27N 4KNTA 4JY6A 5CCHE 1NAML 5FF6A 3S5ZA 3ZDZE 2VQ1A 5DRXA 1RP9A 3WTXA 1K4CB 2WQUA 2J56A 4MMZB 5CS7A 3UTTD 1N67A 4OBRA 4F7PA 3F84A 2R1YB 4ZFZA 1QLEB 2YD5A 3MCG1 4FRWA 2HLFC 1X9RA 4U2ZA 1N0LA 1TCRA 4N8CL 3BZ5A 3W0WB 4ELMA 5D9SB 1YNKL 2FLRT 1HKLH 2H0JA 3SPJA 1DN0A 5F7EH 4U6VH 3OXRA 1EJOH 3TVMC 4UILL 5MEOB 3LNDA 1DBKL 3THML 4W4NA 4LBAA 5I1CL 1RZQA 3S0PA 2PCXA 3CFIC 1J18A 2BS8A 2H26B 2XZQL 2CKBL 1DQDH 3AWEA 4ZJ9A 3HI6H 5SWZE 2K3HA 1I31A 3MYJB 2BOBB 4Q4IA 3HB3B 1E6OH 3EYFA 1IKFL 4JM2A 2APTA 3DGGA 4J3UA 4RGOH 2CZNA 1IGTA 2MJWA 2XVBA 3NCFB 2KZ1B 2HCZX 2NZIA 2J5WA 2HKHH 1KBVA 1LO2H 5BO1L 3IEAA 1UT2A 5I74C 4HPYL 3ULUD 2IGLA 4HV8B 5T1LB 1A7QH 2YAFA 2A74A 5CJ8A 1ODUA 4GT7A 3BAYA 3HC3L 4KO6A 4NOBA 1P4LA 2YUXA 2NW3A 2WQAA 2OMZB 4LKCA 2PYEB 5EO9B 1BD2B 4KI5C 3VQMA 3AG2B 1T6WA 2E76C 2FBOJ 1U6AH 4OUOA 3UTQA 4I3GA 2ARJA 3TWYA 3LHPL 5F70A 2Z64C 4R4FL 1XZ0A 2AANA 3T2OA 4WK0B 1DEDA 2AV7A 1KT2A 3WG7B 4OAWA 2Y5TB 3AREC 2WCGA 1UD2A 4P5TB 1N5YL 3IRZA 4XH2B 4H44C 4HH8A 1OLLA 4H0GA 4F2EA 4BQ6A 3MV8E 1HCVA 4XMPL 3UO1L 1CFVH 3QWRD 2AABH 4RRPG 3MROA 4Q6IB 4R26H 3VW3L 2BNQA 1DUZA 4NWTL 1M7IB 4ZUVA 4GXFA 4LPXA 2NYYD 3EDFA 3BKYL 4AE1A 4J4PC 3NIGB 1MCOL 2V2TA 1QLFB 3NPSC 2XTJE 3QDHA 2A5UA 1EO8H 3SKNA 3OAYK 3QVAA 3KYMA 1GGTA 3OWEA 4IU3A 4G59C 2OZ4A 2OMWB 1N0LB 1TCRB 2BVUA 1ZA3A 1NAKL 4AK2A 4Z0XB 1P2CB 4ZODA 2G60L 1JGIA 1GYVA 3GIVB 2V3FA 3IDMB 4L8SC 3VA6A 4Z8FL 5EEUA 1HQ4B 5H2BA 3M6DA 4S11A 4PJAE 3MGAA 3GNML 3B7UX 4UAOC 4B97A 5GRVL 2G0KA 3KLAA 4HWZB 3DI3B 3ZYZA 5C0CB 5G4OA 1J10A 1T3FA 5BOPA 5GIRA 4LL1A 4JDVB 1RJYB 2BZ7A 4MASA 3WO3B 4Z7OE 3A3YB 3PWVA 4PJ7F 4RAUA 4KJPC 2YPLD 4CW1B 1X44A 3F58H 3TEUA 2R2HA 5J3HD 2KLTA 2XTJD 5DI8B 4KXZH 2CKBH 3DSNA 5C8JA 1S8DB 3S3BB 1CD1A 1VHPA 1YHPA 5CLZA 3TNNB 1P4LB 1VIWA 3S5YA 4MX7B 3ZU8A 1ONQA 4NKOA 4JJOA 1BZOA 3GHBL 2FYVA 3LV3A 1OAQH 4MB4A 1YDPB 3TN0B 2QDWA 3NSDA 4X6CE 5C0IB 1HKLL 2J2ZA 3CBRA 5FUCE 1JIBA 4TLUA 3OR7B 2EVFA 4BFKA 1ZLDA 2DJ4A 3B2VL 1VPOL 1G9ML 3UEQA 4EXPX 4XO5A 1TUPA 2NNAB 3B9AA 2YBRB 4N8VG 4URKA 3N41F 1X7SA 5ITFB 4G9DB 3SDCD 1GXEA 4JZJA 4LRIC 4JFSA 2UZIH 3UAJC 2JJTC 3DJSA 3L9EA 3W5MA 3PQYB 1HNFA 1F8TH 1XB6A 2QVMA 1U8HB 5DYOA 3S88L 4MNHA 4JY6B 4Q6IA 3VQLA 4M8UA 1WBXB 4TQ8A 3NJGA 2X10A 3UYPA 4HLZH 4L9LA 2AK4E 3N85H 5AALA 4M5ZH 1A6AB 1HEZB 3LNFA 4X98B 3SJVE 1G6RA 4M62L 1KJVB 2B15A 2WNGA 3PJSA 2XV6B 4GS7C 1RL1A 3K3QA 2FGWH 4F58H 1UVQB 3SE4A 2P5PA 4AQ1B 1BQ5A 2YLKA 3C5ZB 3GI9H 4P2QD 4P99A 1FLRH 4X5WB 5F89B 5CBEB 3L5WA 3ZTCC 3RVWD 4OLUH 2DLIA 4HLJA 5EC1A 1EV2E 1MVUA 4N9OB 2ETWA 1JZGA 4Z7QB 4GPVA 2N56A 5I15L 3WIIH 3ELQA 4MJIE 3TOPA 3EGSA 3AGWA 4KK5D 2PR4H 3EH5B 3QNZB 1R3IL 1FG2A 2CR3A 3CIQA 2ZZUT 2E6PA 2VAAB 2HRHA 3NA4A 2DWXA 4Y2OB 1HSBA 1FNFA 1PG7L 3HTLX 1W0YT 1N64H 1MHHA 4QDGA 5E1QA 1ACXA 2ZUWA 5INCA 5JPNA 4E9VA 2EE3A 4PP2B 1HILB 5IVXE 1W72B 1ZT4A 1TDQA 1IGYB 1QR4A 3WKQA 5K59E 2F53D 4F9LA 1IQDA 1E65A 4RGNE 4EDXA 1JI2A 1PYWA 5FYJE 3SD5A 4KZEL 4MX7A 4Z7OF 5BCAA 1DJSA 3G5ZA 4OZGE 1JRHL 1YDPA 1K85A 3MLUH 4EIUA 1BQHA 4PBVC 3U0WH 3GJFB 3B5TA 5C0FB 1KPUB 2AQRA 4BQ9A 1PNDA 5T8IA 4X6FA 1NEZG 1A6WH 3MKGA 5EEXA 3QRGL 1U3HD 4GAJH 3L3OC 4B9YA 1KB5A 1Z5YD 2Z8WC 5KYUA 3ATAA 5JPMB 5DLMH 5IJCC 1R0AL 4PHZA 2HMID 5I66B 3ASOB 2IH8A 2FT8A 4M7JH 3MJ8B 2RFXA 3NJHA 4XXCA 4NBZB 2X6MA 1KJ2B 4MMYB 3GB7A 3GMNB 5C70A 4DAGL 4YSSA 2A6JA 1H5BA 4ZW5A 2ZSVB 4RMBA 1N10A 5ACLA 4IOIB 1E4HA 1OAYL 5EOTA 1FJ1B 3BW9B 4JANA 4YBQC 4KJQD 5SWSA 1FDLH 3TCLA 2N59A 4NFBA 3A21A 3FUNA 3GO1H 4IU3B 5F6IC 4A55A 2VXTL 1IC5H 3DUHA 3ZZSA 2DJUA 1Q94A 2WNKA 4NC1E 3AFLA 5IW1B 4DGIL 4K3HA 1A14H 5DJZA 2YQGA 4PRBB 1NDMB 1JWUB 3QSKB 5H94A 1RQ5A 3QPQD 2HJKA 3BEVB 3T0EA 2XBZA 1HH9A 1NFAA 3CQFA 1M2VA 1W6LA 4QUOA 4M93C 1SVCP 1JNLH 1U8IA 3GSQA 4XT1C 4IS6B 3E8VA 3KL0A 4FLSA 5SV3A 3QO1A 1EO5A 4MAUL 4E42B 4WWID 1TYEB 5EC2B 3S98A 3UPCA 4L1SA 1ZA6A 3J7HA 3GYRA 4WNSA 3MRFA 3EGDA 4AWJC 3C6SB 3J27A 4J2QA 4R96B 3DSNB 3NFPA 4IMKC 2BPBA 2E6JA 5JW4Q 3Q2NA 1J87A 2H3NA 4M9PA 2XY1A 4B95C 1UM4H 4WO4C 5EIQA 1MY7A 1WICA 3AT8A 1HNGA 1K4CA 4MMZA 4TLTA 2HLAA 5TE4H 1ZAGA 2BO0A 4N86A 1NSNH 3UBXI 1NSNL 3S4SB 1KJMB 4GRLA 4J3OC 1WWWX 3EDKA 3KVDD 3BZEA 1QO3B 3CSGA 3FF7A 2CO2A 3P4LA 4ZW8A 1TG8A 2JB5H 1ZD6A 1WEJH 1OF2A 2P8LB 1V3JA 1S7SA 2HTLC 3LX9A 1E5YA 1YMHB 3U0PB 1NCNA 2AJ3B 2O5XL 4QJ5B 1SDDB 2NY0C 3RL2A 4RMUA 3HOGA 4GLRH 2EYTA 2WVVA 4XP9H 4H20L 4HGMA 4QRRE 1NFDE 3KMDA 4PJ5D 3C87A 4OZGF 3DUSB 4OLXH 5CJQH 1AIFB 1MLBB 4PFEA 4WFFD 5C0DB 2NY5C 2H26A 3O8XC 4WV1C 3TYGL 3O6KL 4NFCA 3V6FA 4JQXA 5M7QA 2MOQA 1EWHA 4AEHH 3S7GA 1BZEA 1QSEA 5HHPB 2Q20A 3BVXA 1R33A 2VDPL 2DZEA 2EZ0C 3GMOA 4N2LA 4PTTB 5DK0B 5SWSB 4R5TA 1AACA 5D1QA 1UWXK 2NXZD 4X6BA 3U79A 1RSYA 3JVGC 4IYKA 2NUTA 3M45A 5GXBB 4AQAA 1DFXA 1L7TH 2QSQA 3UABA 5E8NA 4BFFA 4ZUTA 2NW3B 1ZT1A 4GO6B 2AFNA 4KH2A 2XQBH 2CIKB 4KNQA 2NXZC 3PDGA 2AV7B 3LPOA 3CVHA 3UTOA 4UNTA 3MMEA 2JF1A 3HB3D 3HG1B 1XZ0B 4PJ5E 4PJ9D 3M17A 3HI5L 2JB6B 3IBEA 2UZYB 3TNMB 5ICXB 3D2UA 1CICC 4OAWB 2BINA 3BI9X 5CIPA 2QDVA 4HD9A 4M93B 3P1VA 3PWNB 4ZS6C 4JZNA 4OD1L 4E42A 2D9QB 1RERA 2OAAA 5GRJL 2UXTA 2CDFA 5AW9B 3NJMA 1I3VA 3NP3A 3RZWA 2VDNH 5GGSA 2X1PA 3CU7A 12E8H 3KXFA 2YAMA 1N68A 1GIGL 1S3KH 1ACYL 4H40A 3NIDE 2NSXA 1G4RA 5IQLA 2DMCA 2X12A 3P0GB 4KKAC 5I76B 1FYTD 1KXVA 1OK8A 2JJSC 4OIIH 4AQ8C 1VKXA 3F7LA 3DX9B 3K6DA 4KZEH 4GKZB 3WKNA 2CRZA 4IIZA 1IILE 5CLTA 5E8OB 4QRQB 2AMUA 3GBLA 4G6AD 4GIPD 3IT8D 1CDIA 5DJAB 5EO0B 3STBA 4APXB 1UCBL 4NZRH 2OZ4H 5CD5D 3UBXB 1K5NB 4JO1H 5FHAL 1L6ZA 1QASA 5T5FH 2GIXA 4AYFA 3U0PA 1PJ9A 1N7ML 3WMPA 1WD9A 2XZAH 4JG1L 1UWEH 1CG9A 1XCTA 1WZAA 4POYA 4NQCD 3CH1B 1QUPA 3GMNA 2GJJA 2LU5A 4Z77B 5INDB 1W72L 4GRMA 3MNDA 5DUBB 1UH2A 2VRQA 1T3FB 2ZCKL 1ZLVK 2YZ8A 2IAND 3B2UD 3L3HA 4NQUA 1UKSA 3Q05A 3TV3L 5F3BB 4W4OA 4WHCA 4YWGL 3VGHA 4PJEF 1KFAL 1SVZA 1G9MC 1E27A 2XC8A 3O6FC 3QQ9D 3X2QB 1NMBH 5BVJB 3FU9A 3KR3H 2FWUA 1EFXB 2FHCA 1QSEE 2XWCA 3SHSA 5KSAB 4WWKA 3UTSE 1T1XA 5L6YL 3AREB 1U8MA 5D1QE 3AB0B 3ARRA 2DI8A 6FABL 3ETTA 3EZ8A 3NJNA 4DGVH 5DRNA 5I71B 5IHZB 1CDCA 5CJOL 3VXMA 4Z3TA 3H42L 3A47A 3BP7B 5IP4A 2MKWA 2ZXBA 4XBEL 1QTPA 4TSAL 5EU6A 4XCCH 2O72A 5D7JC 3AQYA 3KLHD 1OAZH 4WUKL 1XGPA 1L7TL 1CVSC 1GA2A 1PKQB 2XA8L 4LGSB 1DVZA 3HUJB 2WB1A 2ZYRA 2WVSA 5IBUG 3U1SH 2NY4C 2KPWA 4LOVA 1HHGA 2EEXA 3K72B 4ZO8A 2HRPH 1PZ5A 2VDPH 3VB9A 1DBMH 3H4FA 3X1GA 2XQYK 1CLYL 1G7MB 3FT3A 4PRPE 4UIKH 2JKWA 2PPFA 5HPMB 3ZR5A 1QHQA 4PJ9A 1ZLSL 4PWEA 1B9ZA 3AXHA 2XIIA 4AIXA 4NIKB 1OCOB 3OPZH 5C0BE 3U4EA 2OMUA 2YD6A 2JLPA 3OKLB 1RZIB 4GFXA 4P9HH 4XZUB 4P48A 2EDHA 1B3JA 5F89A 1CBVH 5C9JA 2NPLX 2GBUA 4GI9A 4FFWD 2BOLA 1OPOA 2XETA 3GBMH 4X5WA 1FF5A 3CDCA 4TVPE 5FCUH 2V0AA 3AVEA 4M6AA 3WHXB 3L9RA 1VACA 1XHHA 3WJLA 4Y2DD 2O4EA 2OQJB 3P02A 1T2JA 4XP4H 4F7KA 4AC2A 4JFXB 5FECB 3L6FB 4C56E 1M3JA 4QO1A 2OP4H 4J3BA 1PSKL 2OXHB 1W9XA 1JUFA 1NKGA 1H3WM 2ADFL 2J8UE 2BSTB 1KGUA 5DUBA 5CGMA 1DYZA 5JLZB 4HFWA 3HG2A 1BFOB 2VWEE 5AZUA 3VXRB 3VQ2C 2YUWA 3WEBA 1CLZL 2KQNA 3EYQD 1MKFA 3N9GL 4OW6A 1HILA 1OCRB 1J0YA 2BK8A 1M6UA 1JZDC 4AQEB 4BCXA 1GKEA 3B2XA 3WLWD 2GIMA 1MHHB 3SDAC 2Y22A 4PP2A 2GAZA 1DUZB 1WEJL 4GQ9H 1JWSB 3SCMB 4NM8H 4FQ1L 1E2ZA 2LT9A 1LP9F 1U8LA 4YIQB 5KOVC 2AEIT 4OJAA 4KMQA 4QOKA 3DVFA 2ADFH 4JZOA 4GG6E 2LABA 5DRNB 1FGVH 3QDJE 3RGVD 3AACA 1KTLB 3O0RL 2EAEA 4XZ4A 2WLHA 4MAYD 5HHME 1ASOA 1M53A 2JB6A 4YL9A 1QBAA 4AUYA 2Y7OA 2OW6A 4OGAC 1GC1L 4H0IA 4P3CL 4Q6YA 3MV9B 2XXMB 4WU5B 4HWBL 3NH7L 4Z7VB 2GJ6D 4Y0GA 1KCLA 5L7XL 1RZKH 2AEOA 4M1CD 5GGTL 3NSXA 3U83A 1VFBA 1AJ7H 1TVDA 2RFXB 4B9KC 4C59B 4NQEB 2EUXA 5KOMC 1KJ2A 4FQJL 5ERWA 1ROCA 2VZOA 3RU8L 4PRHB 5AB9A 1XZWA 1WWAX 2WTOA 4XPHH 4LCWD 3ARDA 2HVJB 3HRZC 3LPWA 4O02A 1ML0A 2WWKT 1SJHA 2BSSB 3PUCA 5HY9B 2OMUB 4NFDA 3WE6A 3RDTB 1JYWA 1DQLH 3GGWA 2CJ3A 5D7SL 4A6YL 1KJ2H 1NGXA 3QIBA 3STZA 3UAJA 5C9KA 1RIVH 4UQ2A 4YHKH 4AM0A 4NGHL 4R8WL 4PJXE 2VN7A 3EBHA 4TSAH 3VFWB 4XTRC 1XCTB 4NI3A 2ERJC 4NLHA 4JRYE 1TJHL 1P7KA 4L9LC 5CJOH 4NUJB 2L0DA 1YY8A 2L7QA 2ORBL 1ASPA 4ES9A 4F5CE 3IJSA 1N5AB 2UZXB 1JYVA 3NJVA 1PS3A 1QSFB 4PQXA 1R5VA 3RTQD 3L4YA 3BWAB 3OZKA 2ZPKL 4B6ZA 5B8CA 3CFTA 4WWKB 2YRLA 2W59A 4FTVA 4L3ED 4RBPH 2CKBB 5F7DA 4GAFB 5B39B 3J07A 5IQ7L 3S4SA 3U30C 1S7RB 3NEOA 3NIFF 3TZVD 4UDUA 3GZPA 4R4ND 1EHLH 1BSIA 4PMFA 3U25A 1UZ8A 3VXSD 1B0RA 2X4NA 3KBEA 3WL9B 3K6OA 4LDEB 4QIRA 4BA0A 1DVFB 4I7ZC 4XMPH 4WNJA 3VFNA 4AJWA 2J72A 2BDNL 2KZWA 2YAQA 1W0WB 3V79C 3ZUCA 1AE6H 2XJLA 2YD1A 2JFCA 3WIHA 3UCQA 2IC2A 5LVEA 1MRCH 4CN4A 5K39A 1CJYA 1F4WH 3O3EA 4B50A 3BAEH 3WAJA 3CXDL 1MWAA 1R3HB 3MUGB 3FN0L 1E8ZA 1PG7W 3OSVA 4NKIL 3MRQA 3C75A 3QHTC 1G7MA 4KITB 3DUSA 4ODXB 3SOBL 5CLWA 4HF5H 2YD7A 4UWQB 3NJIA 4I5BA 1KBKA 1RLWA 3IJ7A 4OF7A 5DD3L 5L9DH 2X40A 1B0GB 2J6WA 3MLSH 2VDNL 2GJZA 2Y69B 3KPLB 4HPYH 1PBYA 4L4VD 3TCXA 1TTRA 1AS7A 2CK2A 4RWYH 3VGGA 3U48A 2R4RH 4TM9A 5AOKA 4I3RL 3FSWA 4ZFOA 1U93B 3I2CL 5EF1A 3MRPA 3FCTB 1RPUA 3BFWA 2DW5A 5EF2A 3U7WH 3FRPA 5E08L 2ZXDA 4P2RD 5DC0A 5K5YA 5HGBB 2PCPA 3QORB 1MCNA 1ZE3H 1LEKB 1DQJA 2AITA 3QZWB 3IMUA 4QO1B 2B2XL 3T71A 1N6UA 2UZYA 5J06A 1I4FA 3LDBC 1JZ8A 4PS7A 4OLZH 1M71A 3PWVB 1EAPA 4NCC1 1H6UA 3RWJB 3U4BH 4XNMB 3PWNA 3HE7D 3M17B 3QI9C 4NN6C 5F7BA 5IMKA 3RVUD 1GOGA 3WS3B 5E03A 1SLXA 4TOYH 4X80H 4P4KB 3Q5OA 3PAVA 4KKBC 2B1HH 4AT6A 2XZZA 3CX2A 5IV2A 1T7YA 3P3RA 5HHOB 3WENA 1ZGLA 4ANXA 3F7QA 1A2YB 2FL5B 3LEVH 5B8CB 1CYGA 2P5WA 3GIZH 2IADA 4DKEH 1GCYA 1R75A 1ZWIA 4KBPA 1CI3M 4J7RA 2D03L 3H9YA 1PEZA 5GGQH 1H8NA 3GWJA 4Z7AA 2HT2C 4E68A 3RGVB 3MNVB 1VZIA 1UWFA 3N0PB 1THAA 4UDUB 3Q8CA 1ORQB 3T1WA 2E5EA 3FT0A 4RFEA 2Y06L 1BLNA 4DH2A 3DBSA 5EO0A 3WFEH 4AJ0A 4H8UA 3S36H 1IM9D 1QX1A 1C5BH 2ED8A 4YE4H 1LYQA 3ME0A 1MREL 4LL4A 1F3JB 1TQUA 4ZSOE 4FQIH 3WKYA 4MKTA 3FHEA 5GS0L 2WTPA 2GT9B 4NNYB 4NQTA 3VXSE 4QEGA 5KAQF 4BXVA 3MUGA 2PW1B 1JWMB 3FU5A 2HVBA 5DSCA 2UZPA 3PG2A 4GRLC 2AXFB 1DP0A 5AEAA 1J0JA 1KY7A 3ZTEA 4G80A 1GTNA 2B4CL 2DQ6A 3VFOA 4TPRH 1KENL 1JCKA 5I73B 2WLLA 3ABZA 2X53A 1E3ZA 2MSPA 1FZOA 1N0XL 2AABL 3JTSA 3RPIB 2IOOA 3S48A 5C2BL 1EFXA 5D6DC 3FKUS 1XSIA 2BSRB 3SKJH 2PMZA 1V27A 2YKKA 3CHXA 4E9QA 4D9RE 4QHKI 4BEIA 4FQQA 5DFTA 5E5LA 1KGYE 3SDDD 1P4IH 2N7AA 2VN3A 4S1DC 1S46A 1KG0A 3O9WB 3QJUB 2FJSA 2ZOOA 1WBYA 3T2NH 1WWBX 5F97E 4WHDA 2HPTA 1F1AA 3QWOB 1HXYB 4FQXB 1UURA 3MTRA 3NZHL 3UAEA 5CZVL 4CJ0A 1KTBA 1W6WA 5D7KD 3P0VH 1IFGA 3PRZA 4I85A 3C5SB 4UQIM 3GSRA 4M43H 3HS0B 4CNIA 4HWEH 4ZTEA 3JVGA 1EBAA 2GPZA 3QEQE 15C8H 2ZOLB 5LXGH 3K6NA 3MXVL 4KTGA 1D5XA 3RBSA 3S3DB 2FHFA 3K72A 2LHAA 1IV8A 3S35H 4LSDA 4LPVA 5B4MC 4W70A 4XNBA 3HHMA 3RFZB 2J6EA 3LZOA 2PTUA 2WN2A 4ZUUA 4IOSA 4XNZB 3CFQA 4OZHB 3ZHDA 1SZNA 3BZDA 5HVHB 2EP6A 5AQ0A 1FFPB 4RFEB 1N3NB 4Y9BA 3IDUA 1MCHA 3CSTA 3RWHA 4KVCL 1A5FL 2B59A 2R0LL 3WSQH 2OL3L 4OCLC 8FABB 4L23A 4ZT1A 4YN3A 2DTSA 3D4ZA 5LUMA 3GIVA 5BO1H 5FUZH 1GHFH 1B2WL 1R5IA 1AZVA 1F4HA 1IEBB 3AG3B 4XC3H 3IETA 4NN5B 3QORC 2OQJA 1YN7B 3DX0A 3KL5A 2K4AA 1FHNA 1A6TB 4U6HA 5E6IA 2DM4A 2NX5B 2X4UB 1YC7A 3ZHNA 4PB0H 1SRDA 2ZKWA 1Q0YH 3QDMD 3VWKD 1P5UA 2VERA 1VSCA 4FMKA 1A6VH 3AU1A 3F04A 2WKOF 5DSCB 4BKTC 3MRJB 4I18A 4QCIA 3R8QA 2ZKHH 3OMAB 4YDVA 4OGXH 5I5RA 1B3IA 1WFOA 1R47A 1G9NH 5H4YA 1KGXA 1XAKA 5B1JA 3Q6FB 2WXGA 2NLJA 2P7TA 4KXZI 4OLZL 2GCYA 2Q2LA 4FQHA 3SCMD 1PG7H 1XH0A 1NDMA 2GAZB 4G1MA 4NKMA 1AC0A 1QBMH 4ONGH 4D9LH 5BRZB 2OCJA 1UB6B 2IPKA 1OIOA 2BS9A 4PJ8B 5IFHH 2AERT 3H9SD 3CQQA 4PGBA 2GTWB 1KYFA 3TVMD 4ORZC 4TUJA 4PJAF 4X6CA 5IHBA 1S6NA 5J13B 3PQYE 4XN8A 5FWRA 1HXYA 1S7VB 2BC4A 2DEYX 1FL5A 1E40A 1A3LL 1U3HA 5C86A 3C5SA 1FIGL 4X5XB 2NRDA 1KXTA 3HS0A 5F7FA 3NESA 2YWYA 2HFFB 3AM8A 4WV1B 1YY9D 3LH2L 5FLVA 2MPVA 2B3RA 1UXMA 2HRLA 3CD4A 4EIBA 2QKIC 4I89A 3KLKA 1LEGB 2DMBA 1AANA 4NQEA 1DQQB 2VKWA 3GUFA 5JHMA 4OZFH 3RGVA 5AVZB 5HDBB 5BV7L 4XHJC 5JOPD 4PRHA 3APNA 3ULUF 2BHYA 4NBXB 2FAUA 3LY6A 2BXYA 1BXXA 4O02H 1BZDA 3VGDA 4F15C 5BVJA 5KVEL 4TRPL 2ICEA 1KPRB 2YO3A 4DK5A 3NCJH 3QGVA 5CEYB 3WXWL 2I07B 1Z3GH 3MFFB 4HX1A 3MZTA 1ZA3B 2GTZA 2DL2A 4X5LA 2BXZA 3NYKA 4JY4B 4CBZA 1BLIA 2EC9U 5E6UB 3PYCA 1TJIL 4P4RB 4AOFA 1F90H 5IG7A 3HNVL 3MUHL 4XBMA 1BM7A 3FUMA 4ZXBA 3WIHH 2ZOWA 3HA0A 2GT9A 3TN0C 5T1KD 1S9XB 2F9BT 5J11B 2WQRA 1CVRA 1A7OL 3L1GA 5FDWB 1BD2E 4DERA 5DUJA 2R1WA 3GTVA 1IC4H 3T3PE 2DWDA 3C9NB 4FNQA 4HJ0C 3V0IA 3IJSB 4ZMZA 1IBBA 4NUJA 1UACL 1J9CT 4DPCX 5HHPA 1TU2B 4K94H 3LNGA 3CE1A 1PKQA 1BA9A 4Y2OA 1BOYA 4F8PA 2JNZA 4OJFL 1IZJA 5DQ9B 4TVUA 3QUZC 2R2CA 1WA1X 4BQBA 5AKVA 1CYXA 1R46A 2AK1L 1O75A 4BE5A 3GUTA 4MD4B 4X99A 4AG4L 4AY0A 1K3IA 2P5EA 2CMRL 5A6IA 3RX7A 1T5XB 3UACA 4R8WH 3DDGA 1ADQA 2FO8A 4PI2A 1BM3H 1X7QA 4ZD3L 1S9VA 3GHPA 3JXAA 2WCPA 3O6LH 2W38A 3CFKB 1OSZB 1QI5A 4XOEA 5DGQA 3ZRSA 2X7LA 1M4KA 2COVD 4KO7A 1BFVH 3OGOE 4HVBA 4ZNCD 4FA6A 4OSUH 5I5IA 5JORB 1FWXA 3HNSL 2DLFL 3KPNA 1U3HB 2XTJC 2XVKA 1VLXA 3D0VA 1KXTB 1QI4A 2XG5B 3K8MA 4F33A 5D93B 4C4UA 1BQSA 1L0PA 1PTZA 2VERN 2XXGA 3EYFB 4JM2B 4RGMC 5HJ3B 4BELD 4L9LB 2PTTA 3RFZA 4JNXA 4JO5A 4XTRD 3LDBB 4ZUUB 3LMJL 2E27H 1FPTL 1A4CA 3DYPA 1N0XH 2FSDA 4HV8A 1EBPA 4HEPA 1J05B 1U4EA 3HNVH 3DJRA 1OOWA 3KYNB 3QUXC 2WWMC 3UBXA 2E74C 5I30H 2AQQA 1H8OA 2X6VA 3T0AA 2WXMA 2XLLA 3KYOB 3KGSA 5I1KL 4FZ8H 4WSKA 4LSQL 1XQ4A 3V10A 3NJKA 9CGTA 3OMZA 1P7QD 4JEGB 3V2AR 4DEWA 3LTVA 4WHYH 5E99H 3AU1B 3L17A 1KT2B 3P3SA 1MREH 2V9UA 2IOMA 1WCQA 1FAIH 5HHVH 3FQNB 3QUGA 4MHHI 3GRWH 4HHAA 4M9OA 2N3JA 3RNKA 4G1EB 2DQTL 3I50H 1WBZB 3ESMA 4DO5A 2G30A 4OT1H 4FJYA 4LSPL 5I8OH 4AT6B 2QPDB 3ESUF 2IADB 3QIBC 1E5BA 2K9UA 3UCRA 4MHHG 1YECL 1VFBB 3WOVA 1SEBA 3RWFB 3RUGA 5T1KA 1RFDH 1E5UI 1U8MB 2VLKE 4DPAX 1HYRC 1U8OA 1FNGA 2P5WB 3MV11 4Z7NB 3SE4C 5ERWB 4B9GA 4ONHA 3BPNB 4X99B 2F18A 2R0WH 4APQA 1OAJA 2BIMA 4JDZB 2AJYH 2VABB 1OW0C 2P5EE 5BRQA 1F58H 4X4ME 4F8LA 4YDIH 4N24A 3ME0B 1U0QA 3GQFA 5DHMC 1S7VA 4DP0X 4Y2LA 1WGVA 5F88B 4M8QB 5TJWK 2PKDA 3IJ9A 5EIIA 1HHGB 3HZKB 3ZT6A 2AAAA 4POUB 1PCXA 1YNTF 3BPCB 5E2UH 1ZLWK 4YHMH 3Q3GB 2P1YA 4L1BA 5B3SB 2VE6B 3GMQA 5EN3A 4GKOA 1AIFA 5DJDB 1P7KB 5C0DA 2HRPL 4NRXA 3VA2C 5J6HB 3NIGE 4P2OA 3U7WL 4YZFF 4RMVA 3OLIA 4Z23A 1MJ8H 3MLRH 1G1KA 1MHCB 4JB9H 4ZYKA 4R3SA 2F74A 1U58A 3ZK0A 4UQ9A 2Q76B 3V52H 2J6EH 3BW9A 4JANB 3LZNA 3TTSA 1RJCA 4YXLH 1FYTE 4DCQA 4XCCL 3MRHB 1WP6A 2R4SL 1JGEB 4DP7X 1QBLL 1Y18A 2EDYA 2YK1L 3G5XA 5GGRY 1Q94B 4UYQA 1QSED 2ADJB 1CK0L 3QDGE 4S1RH 3TJEL 3AWGA 2VN4A 4HALA 3V5KA 2DLTA 3G3LA 3S2AA 2XY2A 4L8CB 4ZXBB 4KRMB 2BSRA 1NM9A 1S7RA 3LN4B 2K7PA 2CIKA 4P59L 1J5IA 3H7BA 4QD2E 2CWRA 5F9JA 2CKNA 1EZSA 1DANT 3HG1A 4CC4A 5CSZB 1YZZA 1WS8A 3T77A 1A4JB 1AGFB 3FRPG 3G5VA 5AL8A 3VXUE 1A3LH 3PWUB 2QJDA 1NMBL 4XMXA 2LGNA 1AQDA 2WJ5A 2DKUA 1XGZA 4YDNA 2IPTH 5TDNA 3V6OE 1V3MA 4YK4C 2IIJA 4G1EA 4MNHB 3P9MA 3QJOA 3KPOB 4V1DB 4I0PD 2P80A 3PQYA 3SBWA 1Q9LB 3FXIC 3UYPB 3R0NA 1U8HA 5DYOB 3MRQB 5D72L 4M61A 4IBZA 4YIQA 4ONGL 3QXWA 2BSEA 4YJZL 2OL3A 4JZOB 4JCLA 4GP5B 3IXAA 1GMIA 1UQSA 3EO0B 1NBYB 3R7RA 4U4IA 4GW5A 5EBWB 3VFVB 1XGRA 2NDGA 2OCCB 3WY2A 2B5IB 4IRSD 3BDYL 1SHSA 1AMYA 2NNRA 4JFPB 2NUPA 3I3BA 1XF1A 1YPZF 1EAQA 1OF2B 1XL6A 3VRLE 1G94A 4QHPA 1E9OB 5K1JA 2WYTA 4ZI8A 1FNSL 3P4NB 5DUMH 2YS4A 3KPNB 4NWUH 2WIIB 4YHLH 5DQJA 4EEEA 1PFOA 3ARBC 1XXFC 4R5VA 4X8CA 4UQAA 3ZGHA 1EEQA 4MCZA 1AOZA 3HHSA 1O5DT 1IEBA 2APWA 3BX7C 2PXYA 1IGIL 4J3OH 4ZD3H 2GEQA 3TH3T 4GMSL 1YN7A 5F7UA 4I18B 4QCIB 2GBTA 1LO3H 3RWJA 2GKIA 3WUWB 3IGAA 3SDDC 5C0CD 4TUKH 3VFTB 4ZO7A 4UM9A 1SJHB 3Q8BA 4KVCH 4EQ3A 3IE9A 4WO4A 3MLZH 3BQUA 1FV1B 2W88A 2JK5A 5KVDH 5CM1A 3RPKA 4XC1L 5D1QB 5AAWA 1ZTXL 3OKDB 2ZP0T 3BYYA 1IQDB 2W1NA 2EVGA 4QLRA 1Q9KB 3VFSB 2JTYA 3VSQA 3K8LA 4ZRGA 5FV1L 3G5ZB 3RLSA 3QUYD 1S7WB 1CB4A 1ZHNA 5H35B 1PYWB 2ILLA 4KKAD 3VWKA 4KTEL 4RAVB 5I75C 1PX3A 4DKAA 2WQWA 3C60D 1FNHA 5KYXB 4JRXD 1AQ8A 5DDHB 4WTZA 4W9EC 5M94B 3MBWA 3UZEC 4JPIA 1ZV9A 5BOZG 2VC2H 3FW6A 3O8XA 4L29A 4OCRH 4D7PA 2BC4B 1TOXA 4F7MB 2QQLL 1UH3A 3T8VA 4EKXA 1G1OA 3LOWA 1CXHA 4XNYL 2N7SA 1I8LC 4I2XA 5AW8B 4IOFC 4PUBH 3HZ3A 2XN9E 3SBPA 5J6GB 5T1KB 2A6JB 1I1FA 4K7PH 1BAFH 2IFFH 1HEHC 5DCCA 4R90H 4XHQA 2VR9A 5DJXB 5DMGD 5DRXB 3MRNB 1J0IA 3GB7B 3WKMH 4E41E 4FABL 1B9KA 3ARDD 4PJ8C 5LGKA 4J8QA 4WJG3 2R1YA 4ZFZB 2X4NB 2YFNA 3TVMB 3IDIB 2P3YA 3CG8A 2YGVA 1VESA 1DQML 2CR6A 4OY9A 4B96A 2XT1B 3OSKA 5IG7B 4EF3A 3MOQA 4KDVA 1B4JH 2C3GA 2JMRA 3RY5A 2DQCL 4BZ2H 4B53A 1KB9K 1T2XA 2YEZA 4HKBA 3TH4T 5EZOL 5DHVB 1BQUA 5EN2A 1VACB 3WO4B 4NQSA 4YNYB 3BEVA 4MA3B 1QFWI 3N42B 3UJJH 3A5VA 5INDA 1MFNA 4EZKA 2VZUA 1DJGA 5J6HA 5L2KA 3FFDB 5BZZA 1UM5H 1E43A 2DIJA 4OBSA 2Z7ZA 2HUHA 1JXKA 4G2AA 4IS6A 1IKNC 4FGMA 1KZYA 4H88H 1WIUA 2FH6A 3KL3A 4Y19E 2ZUVA 3CLFH 2VC2B 1KOAA 4PG2A 5GS0D 3DHJA 1G9NL 1KXVC 4AQ8A 5FX3A 1U8KB 2O6CA 3V4LA 4HUUA 1KB5L 5FDYA 2VR8A 3PDDA 4LHUD 4EJ1C 5CFHA 3ULVF 5AB1A 2X2YA 4HETA 4WFHD 3X1EA 1SM3H 2ZJSL 1WCBA 3VSTA 3VGBA 5I1DB 5IB5A 1TYJA 3OKKB 3GEWB 2AKRA 3BOVA 3K4DA 4JQIH 4N2BA 3LS5H 4WO4D 2VSCA 4UB0H 1BBDH 1OCZB 2JCCF 4HIXL 4R2GB 1UXLA 5HBBA 5JORA 1D7DA 2J21A 4HEME 3VTAA 5I0VA 4HT1L 2JKRM 3IBOA 1Z66A 5A2JH 1SDDA 5JR1L 1DJZA 4P8QA 3M7FB 4MJID 5JHAA 1ZGLB 2XG5A 4F33B 4YDKH 1AXSB 2AMGA 4Z7VA 3C6LB 4K5OA 1OO2A 5JMRA 2DEXX 2IXQA 2WYZA 3JWOH 4RNRA 4ELKA 4W9JC 2R51A 1EVUA 3DMMA 2IANA 5I8CA 3TN0D 5DLML 3BVTA 4KUCD 3LPFA 1JTOA 2AK4A 5MEQB 5JR1H 1A9EB 4X6BB 3II2A 1E8XA 2KPNA 3Q8EA 4HAFA 1DUYB 4UBDC 1A6WL 4XWGH 2HT3C 4RA3A 3UJTL 5CKAA 2Q7YA 1C7SA 3IPEA 3QUKA 5E8PB 1D7CA 1F3JA 1IJNA 4ADJA 5T3XH 1G7IB 2A6IB 2UWEA 4MNGB 4N9GB 8PAZA 2DKMA 3GBEA 3ARFC 2QKIA 2V9QA 4WKXA 5JOEA 3DK0A 3VFWA 1KCWA 5IT2L 2DM3A 1EDYA 1O6SB 2Q8AL 3I75B 3OZLA 1U8CB 1UXWA 1GSMA 3RI5F 1H15A 3JSSA 2IAAC 5AG9A 3TJPA 4GW4B 4PREB 2CDFB 4AQEA 4A2EA 5DEFB 3DO7A 2NY1B 4ODHL 5BVPL 1IGFH 4PJ9C 1S8DA 4BFIB 4P2QE 2YD0A 1RZFH 3AGVA 4KHXL 4BK5C 4YDLC 4PRAB 4W6YB 4XXCC 5C0ND 2IWEA 4PU2A 5DZPA 4X7SH 1SEBB 2VDRB 3JV5A 4HK0B 3RWFA 1SN0A 3GSOA 3H0TB 2BJML 4TSCH 2AJZB 1TIUA 2RB8A 3WN5C 4P3WA 4F37F 2IGTA 4DP5X 4MJHA 3F85A 1JE6A 4LLMA 4OCXH 5IK3A 4L0ZA 2WQ8A 1FLRL 4H0HB 3FB5A 1PY9A 3QPKA 5GGSY 4XOBA 5B3JF 2ID5A 4N3TA 4HJGA 3KEHA 4GT0A 4YUEH 5E8OA 5JZ7C 1YNLH 2GITB 3EJCA 4E5XA 4AMXA 5ITBL 3W3BA 2G5BA 5CGTA 4WU5A 3HI5H 4CC1A 1OEZW 2CUMA 2VDRL 1FSKB 3BFQG 4BSWA 1J1PH 1X5IA 4JMXA 3T1FA 1ADWA 1CUOA 3Q3GA 3N85L 5ANME 5FW6A 4V2CB 4M6MH 2PPDA 4MJ4A 4PBDA 2DQJL 4NT6B 4Z6AT 5ICYB 3IDNA 4I13B 4Z7VE 3MYJA 3SDAA 4GQPH 2Q76A 2QHLA 4P2OB 4KMTL 4LOUD 1NBQA 1PLGL 3QJSB 4FQCH 4I5BB 4LP4A 4Z7UB 4PN6A 3GJEB 4J12A 2E3VA 2LVEA 1E90A 3O6MH 3S97C 1R3LA 1P53A 2BSCA 3KHQA 4TSBL 4Q9CA 3OZ9L 4KRPB 3QUYC 4IBSA 2BIOA 4HUMB 4K5MA 5F9AC 4HPOH 3QZWG 4HIPA 1J11A 4A2DA 5LBSA 3K74B 2Q7YB 1JV5A 4AM0B 4TNWF 5DVLA 1O9ZA 1CLOH 2W80C 5C0CE 2FJFA 3GKWL 3GKWH 2J5LB 3UTQB 3LRHA 1T7VA 2K3TA 5F9JB 2CE6A 1GTFA 1X7QB 4KKCC 5AD0A 1AGFA 1D2PA 1X5FA 1OSZA 3JZ7A 4WFGD 4FJ6A 4EE2A 4FKHA 4AEEA 3U46B 4O4YL 4FAAB 3BE1H 2DV6A 1ZOXA 1JXDA 2APXA 4XNMA 3ATDA 1ZVYA 4I3SL 4RX4A 1OB1B 5EU5A 5T3ZD 3EO9L 5HXMA 3ASWA 3D09A 3BUBA 3EHBC 3VTMA 3QEGL 3TURA 5E4OA 1SBBA 1IGYA 2CCVA 3ZTDC 5DVOA 3JV6B 3NACL 5DJ2B 4AGNA 1U8QB 4EDXB 2WGXA 5L9DL 1QOKA 4Y19D 3QC5X 4NN7C 2GB2A 3DLQR 3HVDA 1SNRA 5GZNA 4FP8H 4PJ7E 1QHPA 1E6JL 2ENQA 2AZAA 2BW5A 2AJXH 1HESA 5T5NF 4Z8FH 4MLSA 5IBLD 4NX0A 3CFEB 5FYLL 1JNHA 1KCKA 1UWGH 2Z3FA 4PGBB 1DVFD 1KB9J 6FABH 2RH0A 3EO0A 3VI3B 5T1DH 5ITBH 2VB5A 1F4WL 2VSKB 2I7OA 3KPRB 1BLNB 1ETZA 2NY5L 4XCYA 3KYNA 4R97B 3MLXH 1CI5A 1OV8A 4BGDA 4K7PL 1FVCA 3LKNA 4OFYA 4OF8A 4RISL 4AL8C 3KYOA 5M95B 1Y6KR 4JFXA 5D1XA 5FECA 3WUWG 1E4XI 2Z34A 5GRXG 3T1FB 1H3GA 1AP2B 3O9WD 5B1BB 3NFSL 3T0BA 2RTTA 5J56B 2OXHA 4UINL 3WFDH 4A67A 2VC2L 4KI5D 1H5BB 1WSST 2GJPA 3HBQA 5KSAC 5BMFH 1BFOA 3DMMB 1UCTA 2G5UA 2J8HA 4UM9B 2BVYA 4O51A 4DGIH 4L0YA 4HLZG 1TQVA 4IK7A 2JK5B 4QRAA 4HFWB 4G80B 4GQQA 1N7MH 2F7QA 4CW1A 4RDQG 1KPRA 1NCBH 2A9MH 4CAGA 3IJYB 2WLZA 3ZR6A 4O5LL 4XCNB 2VW7A 2Z91B 5DVKA 5KSBF 2OZ4L 5DZNA 2Y24A 3B4NA 4LEEA 1TXKA 2YEVB 2MPAH 3BAKA 5EULV 5ETUB 4KI5F 3LXCA 4JVWA 3IMTA 3RWHB 1MFEL 3KHOA 2OMVB 4MSWA