4AGPA

Structure of the p53 core domain mutant y220c bound to the stabilizing small molecule phikan5176
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
196
structure length
196
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Halogen-Enriched Fragment Libraries as Leads for Drug Rescue of Mutant P53.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 49
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4agpA00
4LOEA 4KVPA 2J20A 5KBDA 5AOLA 2GEQA 2VUKA 3US0A 4AGQA 3WTXA 4HJEA 4AGMA 2J1XA 1E50A 2P52A 4IBVA 3TS8A 2XWRA 3WTUA 4G82A 3EXJA 2ADYA 4GUOA 2BIQA 2J1WA 4AGLA 4IBYA 2BIOA 2YBGA 2ATAA 2H1LM 4IBWA 4LOFA 3Q06A 3VD1A 4IBTA 1H9DA 2X0UA 3D08A 4AGOA 3D09A 4AGPA 4A63A 4LO9A 5G4NA 5AOMA 1CO1A 4IBUA 3IGLA 4G83A 3WTVA 2J1ZA 5BUAA 1GZHC 5G4OA 4L18A 3WU1A 4XR8C 1KZYA 2XWCA 2RMNA 4MZRA 3KZ8A 3WTWA 3KMDA 3QYMA 2FEJA 3Q05A 3US1A 1EAOA 5ABAA 3WTYA 3Q01A 4IJTA 4L0YA 2MEJB 5G4MA 4AGNA 5A7BA 2IOIA 5AOKA 2J1YA 1LJMA 3D07A 5LGYA 1UOLA 2IOMA 1IO4C 5LAPA 3EXLA 2AHIA 1EAQA 2BINA 4GUQA 1HU8A 4QO1B 3QYNA 3D0AA 3VD2A 4IBSA 3ZMEA 1EANA 4MZIA 3D06A 2AC0A 3IGKA 1CMOA 2IOOA 4L0ZA 5ECGA 3VD0A 1HJCA 1HJBC 4IBQA 2BIPA 2BIMA 4IBZA 1GZHA 1T4WA 1YCSA 5AOIA 1TSRA 2X0WA 2X0VA 5AOJA 2J6WA 2PCXA 2J21A 2OCJA 3D05A 5AB9A 3WTSA 2WGXA 1TUPA 3WTTA
chains in the Genus database with same CATH superfamily
1RLWA 4Y1AB 1NCAH 2J20A 5JMOC 1JXGA 1OXYA 3ESVF 3RGBA 5DJDA 1E4XL 1MH5A 1RZQA 3QJUB 3BWAA 3Q48A 4J3OH 4QHKI 4R7DB 4PGEA 1L7IL 1K2DA 1JGLL 1KBWA 1U3NA 2ZWNA 4R4NC 3WUWG 3ZE1E 4HJEA 1JPSH 1SDDB 4MMXC 5AZEH 4GLRH 4OF8A 2QV2A 2DBLL 3EW3B 1IAOA 1WGVA 2H9GB 3GSRB 2R4RH 4J6RL 1IFRA 4BXSV 5G55A 5T3XL 1FGNL 4PY8I 1TIUA 4P2OD 1M1XA 1I8KA 3LZPA 3PP4H 1ZHBB 4ODUA 4X98A 1DBBH 1IC7L 4KXBA 4EF3A 5I6NA 3PQYB 5CD5D 5I5MA 2VR6A 5DJ0B 3IXAA 4OZIE 5I17A 3EJPA 1QD0A 4HISA 1THCA 1SBSH 2HMIC 4ZW3A 2WLIA 3SZKC 4FA7B 3BESR 1A1NB 1ZPLA 3RVTD 1QWUA 1Z5LA 4BFGA 1MCWW 4BDVB 4ODVL 2CO7A 1YNKH 2Z91A 4HJTA 1JUFB 2H1XA 2O5YH 2EYSA 5DSCB 3KYKH 3X12B 2MTAA 4AEHL 1JS4A 1CFNB 4MMZB 5L8KB 1DQDL 4PB0L 2GJZA 2E7BA 3W3BA 2B4CC 4NRXA 5E1IA 5E9DB 3FT4B 4KOBA 5HGDA 5HJ3B 3ARWA 1S9WA 2AQTA 1J5DA 3MRGB 1IZJA 3NJHA 2FX7H 4U1SB 1JPGB 4WWKB 4HVBA 1JFQH 3MTRA 5JIQA 1OCOB 4XMPL 4K0OA 4KX7A 4ZTOH 1QBAA 1R34A 4F33B 4JFDB 3OR7A 1KLUA 1P5UA 4WHTB 4AJYV 3VRIA 2NNXA 5I1CL 3PYCA 4MB4A 3MFFA 3VXSD 1Z32X 3DX6A 4LCUA 1BVNT 1X7SA 4K5LA 3WCYA 4F8TA 3ARBC 4HGKC 4G42B 4R97B 3QQXA 2ENSA 1SXAA 1AQMA 1F2QA 4M8RA 1HKLL 3LKRA 3O6KL 1P1VA 3HZYB 1EHAA 3SDAC 2G30A 3DO4A 5K9QG 3NYKA 1DQJB 4P2RE 1DQIA 1IIKA 3BEVA 3DXAA 1VRSA 4AENB 2F18A 4Y4HA 1SF3A 3D06A 3QUYC 3M1BA 5FYJD 3PABA 3NCBB 4P9MH 3TXAA 2PTVA 1EHKB 3KPOA 4F58H 1WQVT 4Y2DC 2WXIA 4XWGH 4DTGH 1YECH 5J13C 3BP5B 3I02B 2BVQB 2X3BA 1N9PA 1G7IB 2NY2B 3KEHA 1OOAA 2HVJB 4JHAH 1SJEA 1EMTH 1G9HA 4CVXA 5GXBB 2IWFA 3QG7L 3OD3A 3QC6X 1I1RA 4JGMA 4N8VG 2XG5B 4AYID 2LVEA 3ATBA 4M1CD 5T1KA 1RU9L 4KMTH 2CDEB 3AC0A 4KVCH 1HWWA 3KJ6H 2H0FA 2JJSC 4J2XA 4FNUA 3X3FL 3HLKA 4BH7B 4DN3L 2AVFA 3HI6L 4Y2LA 2QLVB 5F6IC 3X13B 1EXUA 1PSKH 3QWOA 3LYRA 3F7RA 3NESA 4ECNA 1TKWA 2WUBL 3FH8A 1DFXA 4JO3L 4ZX6A 6TAAA 2XT1B 1PKQE 5IB2B 3FSOA 5FWRA 1MFMA 1OW0C 3I6GA 5I0ZA 1WT5A 3SODB 1RUKL 1MAML 4UV7H 1MI5B 4N5EC 4U2ZA 5DU7A 4KJPC 3G6JE 1BVKB 4GRWE 1X4YA 3BKCL 3HI1B 2JKJA 3I3DA 5LBSL 5HPOA 3RGVB 4PN6A 2COVD 1IM3A 2APVA 1FZKA 1LD9B 3MYZA 1FVCB 3CDCA 1T6BX 1ZA3B 4RGOH 5EU5A 3VI3B 1JZ4A 1TDQA 2XWCA 2VN5A 3MODL 1U8OB 5DK0B 3PE9A 4IMLA 1Q8MA 4N0FA 4OY9A 3ARPA 4S1RL 1MN4A 4WY7L 1SOKA 3ZHNA 1CD9B 4PJCF 4XNZB 1OSPH 2QVMA 1KOAA 3U0PA 4QUOA 4G8GB 3IJSA 5T5FH 3RVWC 5MENB 5JHDA 3CMOH 1LILA 4NFBA 1RLBA 2ETWA 1RH8A 3BMVA 4RFEB 1P1ZB 3NPSB 2EADA 1BM3H 1D2PA 4MRBA 1R19A 4TSCH 1T5WB 3MV8B 2CLRB 2FE0A 3LRSA 4QRPA 2DB8A 5DRZA 3GHPA 5E2WL 1HNYA 4PB9L 3VI4F 1ORQA 1V3JA 5KYUB 3EIFA 2OTUA 3L5IA 4LPUA 4QGTA 4TPRH 3JT0A 1BVOA 4RVBA 3VMPA 3OBAA 5J8OA 1YMME 3VFSA 2Y24A 2GHWB 1R1CA 3LTVA 2JSFA 1XB8A 1LEGA 4LSPH 4ZQKA 1ZVNA 4FXGA 4QTFA 4XVTH 4XMKL 2FZ3A 1S6NA 1FNGA 3WIFB 3A3YB 2ESVE 1FORL 3JWNH 4J4PA 1XR9B 4RMSA 5A6MA 5AB9A 2EDOA 3UGEA 2VZTA 1U8NA 1FL5B 3IK2A 5G2NA 1F4XH 3NRFA 3FT0A 3KGTA 5LLIC 3WHXA 3NJKA 4PMFA 2YK1L 5HYFA 3MLYH 4E5XG 4RIRA 3LEYL 4PTTA 2E86A 2MCPH 4G9FD 3F7YB 1GGIL 2VLJA 4IGBC 4H8PA 2GJ6D 4JFOB 3UTTA 3T1FB 4AMKL 3QRFM 2TRYA 1M1SA 3IMTA 3RUGA 2GJJA 5HJDA 5J4MA 3K8LA 4NBXB 4XI5C 4PSPA 4BFIA 3K6NA 2FNBA 3DECA 3F58H 3QCTH 1U3YA 1RUML 2DJ4A 4KGJA 1KB9K 4HIIA 3NZUA 4W9HC 1M2VA 3KL0A 1NGQH 4OIFA 1NUFA 2GABA 3QQDB 4UB0L 3WEAA 3UOAB 5I8OH 1W2KT 3B3IA 2HH0L 4TSBH 1QI3A 3CFCH 4YXKL 4ENED 4LLQA 2IPTL 4LCYA 5EEVA 5DWUL 5E6YA 3LHPL 2G2NA 4IRSB 4NT6A 5CZVL 2R1YA 3CCHA 1WHOA 1NCGA 3BPNC 3RX8A 4OZIB 3VJ6B 5EU6A 3QHZH 4PG2A 2FWLB 4OJYA 1T03H 5ESVB 2UYLB 3DV6B 4X6CF 3HG0A 4DQOL 2FAUA 3BRDA 2J6EA 1AZRA 3QXVA 4YDKH 1CJYA 1KCVH 2F7RA 35C8H 3TA3B 1PJWA 4P5TA 3IGAB 4TUJB 4AYMC 3V4PL 4B41A 1VZIA 1CLOL 4O9HL 3RWHA 2X7LA 2O6PA 1OCWH 4GMTH 4CMMB 1TZIB 4NIYE 1MIEL 2WTRA 1LP9E 4NJAH 2X44D 3GUFA 3V0GA 3BT2H 4KRPB 1H5BB 1UD2A 2WWMC 3U7YH 5KYXA 3HZKB 3UEZA 4GAYB 1H19A 2R0WL 4H20H 1C8QA 5FDWA 1CVSC 3ZMEA 4TNFA 3AXLA 1T21B 3PGDA 4N2IA 3TV3L 4S0HA 3BRGC 1SJHA 2PPDA 5I75B 3BFOA 4FABH 1IGML 3K72A 2DMBA 2WPGA 1BAGA 4PJAF 2WLLB 1Q9WB 3QWRD 5FK9B 3ASNB 4OV5A 3ARDC 5DJXB 5IHZB 1JZ8A 3NGBC 4LOVA 1EHLH 2Y5QA 2NLJA 2RCSL 1JGVL 3A6BL 1MAJA 4XOEA 4R5XA 1NINA 1OQXA 5KJRL 1L9SA 4ZMZA 4AIZA 3MGAA 3EF4A 3AY4A 1X5KA 2VC2B 1TQBC 2WC7A 3FRPA 2H1PL 2GY5A 4JY6A 1JZ2A 2DLTA 4NPJA 4DKEL 4NO2B 1A3LL 3MC0A 4ICWA 2EDDA 1F4HA 1WWCA 2IDQA 5ID1B 1IFGA 2Z65C 3GK8L 3QI9A 3J8F7 3D9AL 4P2RD 3QJZA 1GA2A 4NZ8A 4ZTPL 5FPIA 2HFFA 4TULL 4QRSA 4AL8C 2BFVL 1N26A 5I1GH 1PJ9A 1JIBA 3VVWA 1JSYA 4A2GA 4JG1L 1MJUL 2X2HA 1LK2B 1NOFA 2IH3A 2F15A 3IFOB 3WFBH 4UT9L 4ZSOB 4U1IA 1X4ZA 5LN4A 5C6TL 5FYLH 5IFHL 3S2CA 2N4IA 4I4WB 4APXB 3WDHA 5A43C 3PHOA 3IDJB 4PGDB 5I30L 1NCBL 1CL7I 1XQ4A 2XYBA 3T77B 5KJ4A 4ETQB 2IDUA 3HR5A 1O7VA 1ZE3H 4N0UB 3IS0X 3S5LB 1M05A 1WSST 2AJYL 4XVUD 1YEHH 3S88H 2OMUA 4ZPTA 3V4UL 4NUGH 3V8OA 2E3VA 4KKAC 2BFGA 3SSGA 3QEHA 3BQVA 3FT3A 3PHAA 2QHRL 1PKQB 5DJCA 2CO2A 3TNNB 5EU4A 5DQDH 3TO2A 2WXHA 1B9ZA 1ZDSA 5AAMA 5DYFA 1DQKA 4AOFA 3T6VA 4PD4J 1QBML 3OWEA 2LTQB 1CDCA 1OPGH 4YPJA 3C5SB 5AVSB 2Z93A 5FA4A 5EB9A 3GF8A 1KIPB 2K6ZA 3L8QA 4KUCF 3JV4A 5E9NA 3DUUB 4PFEA 1X44A 4MBOA 3L4TA 3STLA 1IO4C 1HWGB 1NOAA 4IJ3C 3EXLA 2YN5A 1P6FA 1FFNB 4ZW7A 4L05A 4Y5YB 1M9SA 3D69B 2A7BA 4FMKA 4YBLB 3LKNB 5KTEH 4DP4X 5TTRA 1DLHB 4ALAL 1E2WA 3GZKA 4U6VL 4YDMA 2YZ1A 1CU4L 1G94A 1B2YA 3ZE2B 2X4UB 3FNKA 1OTSD 2DI7A 5JW4R 3KWVA 4XBPA 2W0KA 4E9YA 3LEXA 1KJ2H 4Y2OB 1SLWA 1BQHG 2WWOA 3QNZB 2UX6A 3L5HA 3S3BB 4E41E 5H94A 2CIIA 4PJEF 5AOZA 1DLFL 5FCSH 2OTPA 4DGIH 1T4KB 2P47B 3K2MC 1NZRA 4WU5B 5AOLA 2EYRA 2AVGA 5CEYA 1SEQH 3CC5B 4HWBH 3EHBC 4XPBL 3DMMD 2OULB 5AENA 2VXQH 3BUIA 5DF0A 3T2NL 3O6LL 4HULB 3R06B 2VR7A 3U6XS 4MSWB 2Q6WA 1CFTB 3TVMB 3QUZA 4V1DA 3BKMH 3FU8A 2IPUG 1MCHA 4AV5A 1KJ3H 4R83A 4XNQA 4C4UA 3QUGA 4D94A 5JQIB 4HBQA 1PYWA 4A2HA 4Z7NF 3WN6A 3HPLB 3QSKB 3BH8B 2FB4L 2G4EA 4E42B 5L88L 3QK0A 2XY2A 1S7UB 1SOQA 1YMMD 2QVIA 4PV8B 1R75A 1U36A 3HHMA 4LSTL 5KSAD 5FGBA 4NN5B 3QFJE 1NH6A 1UA6H 4TXVB 3CHQA 4AIXA 2HA1A 1BFOA 2ESVD 2OR8A 4LHQB 1XL6A 2NZ9D 5FXCH 3ZE0E 3KYNA 4URKA 1AXSB 4HUWA 3VA2C 4ZPVB 2H3KA 3UJTL 3NFPA 5JW3H 1I9RL 3NJGA 2ZWZA 1OD9A 4WQOA 5F88A 1SY6A 3NACL 3GLAA 1GS6X 1FVDB 3MJ7B 3S8GB 2VLLA 3PWNA 4L8BA 1H8OA 1I3GH 1MWAB 4ZXBA 2CO1A 2R23B 4NB7A 4HIJB 4UOJA 5FOBB 4YOKA 3S35L 4HW6A 2A1WH 5F9DC 2NY5H 3QR1A 1TYRA 3EBIA 3S9DB 3B37A 2EUWA 3NVQA 2ZAHA 4JO2L 3VRLE 4XRCA 4LLVA 4HIQA 2IEPA 4XMVA 2FUTA 4PJ7E 1HQRB 1NDGA 5E03A 4Y4HC 5C08E 4Y19E 4XNMB 3VXMA 2IFFH 2XFXA 2YGNA 3O4LB 1T5XB 1OCZB 4I0PB 4FQIH 3M45A 1UOLA 4XT1C 1J0HA 2ADFL 4G3YL 4TKWA 1MFEL 3MLUL 4N0CC 3JWNE 4P06A 4XX1E 5F44A 4KTEH 5GS1A 2D8KA 2HLFC 1XDTT 2VR4A 4LHUB 3F6LA 4OLWL 1YEKH 3N3EA 3BGFC 3LMJL 1ID5I 1MFBL 1BAWA 5H37A 5KYNA 5T1DL 3UEQA 4HEPA 1B2WL 3OAUH 2XYCA 3M17A 1DANU 2B1HH 4IEFA 2O5XL 2Z8SA 4L4TD 1UWEL 3CSYA 1V3LA 4PSRA 4PBVC 4K8RD 4N2DA 5EU3B 2XWJA 4XNXL 3I75A 2VOTA 5CN1A 3W9EA 1IRAY 2EINB 4RGNC 3IU4H 2ZWKA 1IE4A 4NX0A 1WZ1H 5C09E 1SDAB 4XPGL 1HL5A 3MV11 2CD0A 4ZW6A 2WKOF 1E27B 3U6RB 1YY8A 2VM4A 3ULSB 2HTKD 5LG1A 2NYYC 2NX5E 4A04A 1FFQA 3FTZA 4YK4C 2ZCLL 2FX8H 3CLEH 1JWMA 1ES0B 1OSZB 3NP3A 2VN3A 2NYKA 1FNEB 4JZOB 1U8PA 4RMWA 5KS9F 3H54A 3MAWA 3TIDB 2ZP9A 5F3BB 1T6WA 1UQSA 4M7KH 1EGJH 3AMKA 3SO3C 1NPUA 1A4AA 3Q8EA 3QPQD 3LV3A 2F53E 4HXAH 4YSUA 3TN0A 3JV6B 5I1KL 5L7XL 2BNQA 4PJIA 1RZJH 5EDSA 1J9CT 3N1GC 1D5IH 3Q8CA 5HYIA 2EE9A 2XZZA 2GTZA 2WIIB 2YMXH 3FT9A 1K4CB 1TQCC 2BIHA 4Y4FC 4YL4A 2UXTA 2D7TH 4JFPA 2XPGA 4B9KC 4XOCA 4OJFH 1TJHH 4J3OD 5HDOA 2JXMB 4R7LA 5BZDA 5AW0B 4HBCH 1INDH 3NSYA 4ODSL 5DK3A 1G6RL 3QEQD 1EZLA 4NKMB 2J8UE 3QB7C 5KANI 2BW5A 4L3EE 5F8RC 3ARXA 1E4WL 3ECWA 4LLWA 1LE5B 3NJFA 4C4BA 3AUVA 3OB0K 4IDJL 4PJDA 1MW2A 4EDXB 3C12A 3GSNA 4MD5B 3A4DA 3HUJF 3WTVA 2VUYA 3G5VA 1QSEE 2MHAA 4FQLH 1U3HB 3HBPA 3IFLH 4M7ZB 2XVKA 3JUYA 1MNUH 1XB6A 3HEIB 3ABKB 4FXLA 2AJ3B 5ABDE 5LG6A 1CI3M 1I1AD 1R3IL 5GRWA 5DYOA 3UAJC 5SWSE 4AKQA 2QFPA 1SXZA 1BZ7A 2IBBA 1BVLA 1MCOH 3WS3A 4HAFA 4WWOA 3HC0B 2M8XA 3RVVC 3ASOB 4PIBA 3OJMB 1F4YH 3FOLB 3PGFH 4GG6E 4GKZA 1RIVH 3BPLB 4XNYH 3VFTA 4LL9A 3BE1H 2H0JA 4L4VA 4ZNEE 2CZNA 3EAKA 1UASA 3DHMA 4K5MA 2MRYA 1H0DB 4FXGC 4GEIA 2ZNXA 4ALAC 2J4WL 4MDRA 4L8DB 2I60L 1K3IA 3S35X 1M3JA 2XKUA 4KNTA 2B9AA 2OSXA 2YGPA 3MOAH 3MRHA 3DK0A 4JQIL 4PY7B 5B1JC 2AABH 2YPVL 1OP4A 1Z5HA 1J48A 3MRPB 3SKNB 5JORA 3W38A 4PRBA 4DH2A 4MJIA 1GGUA 5IBLD 2MNUA 3N1QC 2BC4A 1EFXB 1MCFA 1SYSA 2OR7A 2QQQA 2HVKB 1EZSA 2IAMC 3CZUB 3WIHH 4BCXA 1QNIA 2K7QA 4DVRL 3IM1A 3L9RA 4OZHF 2GAZA 4QKTA 5GGQH 3RTQA 2OJEA 3BOVA 1P2CA 3V0AC 4F92B 3VWKD 2CGYA 3QIBB 3WDIA 3O3EB 3E6HA 2DY2A 4MD0A 4X5XB 1MFAH 3G7TA 1WG3A 4Z95H 1JP5A 2XXGA 4G1EA 1IBGL 2HRPL 2ZX5A 4X7DC 3RDJA 3CX5J 3H2QA 2DM3A 2XN9D 5IVNA 3U25A 1BLIA 1VDGA 3CIQA 2ADYA 1JJUA 3R19A 5FO9A 1DEEA 1NDMB 3DBXA 3G04B 3CPLB 3OKLA 1JL8A 4E41B 2BVOA 5J11C 5I1LA 2D7MA 1J1XL 4H8HA 2JQAA 1U92B 2G2PA 1OLZA 3ARSA 4KXAA 3KBFA 1T7ZA 1TZ8A 4ZUVB 2EUVA 3GJEB 3BLBA 4EZJA 1HNFA 4H44C 4Y4KD 5EFIA 3T0ED 3EFDL 5EWIL 4WUKL 4C83B 3D33A 5K33A 3RWEB 2NTFA 1NMCB 1HCVA 4Q4IA 1JRHI 3H7LA 1DJGA 1WEJH 4PG2C 2BMKB 3PV6B 4X7TB 2KZWA 4CBZA 2EDFA 2KH2B 1JNLL 1AZBA 4UINL 2HSIA 1A14H 2GUOA 3LIZA 1JHKH 3OLIA 1TXKA 1ACXA 4OJCA 3ZL2A 4Z7OF 1YJDH 2OZ4L 1FBIL 1SN5A 4I18C 1RFDH 5KUKA 4JMXA 4FP8L 4DKDC 2IBGA 3BP7A 4YHZL 5D6DA 1IL1A 4FCHA 2P80A 3SGEI 5JDSB 3NK4A 3RPIB 1VZGA 3HS0B 4PCTA 1ZSHA 1E4XH 3U1QA 1H3GA 1K6QL 1A8JH 1DVFC 1D9KB 1SRDA 4BSWA 1T1ZB 5D1QC 5C8JA 1KXTA 3FFCD 2PO6A 2NY1B 4EI5A 5FB8A 2W95A 2DBLH 1NCHA 2W0FA 5FCUH 4P05A 3ECVA 4J6RH 1G87A 4AVHA 3DX8B 3KW8A 5GGVY 3QFJD 5T3XH 4Q58C 1QBLL 1SN0A 3X1BA 5H8DA 1CLCA 3O6MH 4GQZA 4H40A 4V2BA 4V33A 3T2LA 3U48A 5D7LE 1RD6A 2X4PB 3EYQD 3ESMA 4OGAC 1RZFH 1Q9KB 2A74C 1AGDA 2Q7AA 1PS3A 4YSCA 4EVNA 3QQ4B 3R0MA 5FM8A 4D9LL 2YBRB 1RZKL 4OLVL 3QA3B 4AQAA 4KI5C 3T0VA 4N2EA 3CX5K 1SOXA 4G8FA 3WXVL 4KRNA 4PI2A 4F80A 4PRHA 2QT6A 1OM3H 4NSKB 1D6VH 5HYJE 1AGEA 4P3WA 1BREA 4ZD3H 4XP4L 4PB0H 2N0MA 1IKFH 3RDTD 3CFDA 4WFFE 2OYPA 1KG0A 4NC2B 3OQ3B 4WGKA 2E9IA 5C08D 3CD4A 5DHXB 5CCGE 1U8QA 2CLZB 4JFWA 2YOCA 4XMPH 3X14B 2FQFA 1H9VA 3QHFL 4JZJA 1O7DE 4PGBA 3RBSA 3BQUA 4HH9A 4U1MB 2I32A 5C0CB 2DYPA 1NC2D 3S3JA 1T5KA 4BFNA 5EV7A 3UZVA 4C56E 2QADD 3VXRE 5F96H 2ZOKA 5HVFB 5IREA 3LZLA 4AEFA 2YIHA 1HXKA 4LOFA 3S96A 3C8DA 4HLEA 3INUL 3O2DL 1JWSB 4H88L 1GGYA 4ADGA 1Q9OA 4MDIA 3DV4B 4JDTL 4KKLD 3GMPA 5E9AA 5C09D 4D0BA 2D3NA 1EEQA 1KGYE 2F0CA 3CZLA 4PV9B 2Q8AH 3V0DA 2F53B 4ZX5A 1NBYB 3EYFB 4FQXA 5D7JB 2OI9C 1RK1A 4Z76B 3FONB 3ET9F 5E8PB 4XAKE 4FJ6A 2KKQA 3ZDZB 4N8CL 1GMEA 3FO9B 3MRNA 1N18A 3MA7A 5TK2A 3RIFK 5DRNA 3RKDC 2VM9A 3UROR 3LKQB 4L9LA 4N9OB 4UAOC 3KPTA 3U9PL 5D7IB 5I6OA 3RZCB 1W80A 2J8UB 2PYFA 4QWWD 4L3EB 2GIMA 1RJCA 2LAAA 1HQ4B 1YPZB 3L1GA 4R26L 4X6FA 3W39B 3QG7H 1W8NA 5D8JH 4A55A 3S4SG 2HWZH 4GW5B 2G5BA 2RQEA 3VQMA 1VFMA 2CJ3A 1G1KA 2ZF9A 5DI8B 2ZXQA 4G2AA 4WO4C 1KGUA 2JKXA 1DSFL 1WZLA 3MJWA 1ZK9A 2OR9L 1IGIH 4P48A 4PWIA 4PJ8A 2ZP0T 3GZQA 1BF8A 4Y2NA 1HHJA 3H42H 4JHUA 3ZO9A 3UBXB 4MZIA 3GQFA 2HT2C 4I87A 5C7XL 4BKTC 2JVUA 3VI4E 3BAIA 1IM9B 2YQ2A 4X6EA 4ANUA 3DJZA 3P3SA 5IBUG 5EN2A 2FATL 5IHHA 1BJ8A 4UTBH 1FL3B 4PJFE 4XP6H 4XCYB 1UWFA 3QCUL 4NWTL 1QSED 1TEFA 3DOSA 2OMXB 3O3AB 5IKCB 4B9FA 1WD9A 4DP2X 5IVXA 5TDNA 3FQ2A 1RZKC 1H3TA 3DPDA 2JK5A 1J8HE 3QJFB 5KSUB 1MDTA 4YMPA 4PTUB 1NWPA 1TEYA 2BCKB 5I1HL 4KK5D 4WEMB 1YN6B 3CC1A 3EJUA 3L4YA 4FFYL 4OB5H 4X7FC 5F1NB 5SWSD 3VG9C 3F7LA 5ACZB 2VR8A 3QUXD 4H7VA 2VERN 3N41B 4UDUB 3H3KA 5I1EH 1NKGA 5J9PB 4XBMA 3UXFA 4L1SA 5ALBL 3RA7H 1TQSA 1J5CA 4ZYKA 3WY3A 4QNPE 1FFPA 2JQZA 1F97A 2AXGB 1BV8A 3DTDA 1X5XA 3ILQD 4UIMB 1URZA 5KUMA 3W1ZA 1P7QA 1C5DA 3BN9D 4NI3A 1TVDA 4PHZA 2Z8VC 5F9WC 3KR3L 1QW9A 2DJMA 2YD9A 1UKTA 2JKIS 2RACA 3EYVB 3QNXA 5EC1B 5IMKB 5AALA 4JFYA 4OKVA 5HHOA 2QDWA 4HIEA 4A6YA 5BXFB 5DJAB 2IXQB 1FH2A 3Q06A 3RUGF 4QT5A 1ZLWH 5E2WH 5AVQB 1H9DA 3DIFB 4M8UA 1ZPUA 3M88A 3O9WC 1REIA 4PB9H 4OCWL 5BRZB 5JXAH 4P2QA 4UWQB 1T3FB 4X5PA 4JFEE 4W4NA 1AO7A 2H3XC 3KHQA 4GH7B 5ANMB 1SZNA 1QNZL 2VB5A 3QJHB 4KZCA 3HBGA 1S7RA 2B59A 3ULUF 2DEWX 9PCYA 4P5MA 2DICA 3NAAL 5TDPA 4DPRA 4MNGE 3EO0B 5EZIL 4QOKB 1R46A 3KLKA 5KSBB 3QQ3A 1I8IB 4KJWD 3ARGA 3TT1L 1JV5B 3ZRCC 1PBYA 4OQTH 3V5DB 2XZQL 3QISA 3VB9A 2NR6C 3GSOA 5FYLD 1JGEB 3LRMA 1RZ7L 5AKVA 3ZUNC 1RZGA 3EJZC 3HG4A 4X6CE 5EOTB 5AYQA 5IB5A 4L2LA 5K9JL 4XCNB 3UDWA 3C5JB 1GHFH 2QLYA 1NM4A 3LEYH 4XCFH 1WAEA 3MJ9A 2DQEL 2W94A 1NFAA 2AJVH 1U8MA 1XGTA 3NOIA 1RZ8B 2BCMA 4PJBE 2YPLB 3UTSA 3C08L 4QO1B 3A24A 3S3SA 3V2AR 1HOCA 3IF1B 3G3LA 5HI3C 3SPIA 2IPKB 1Q9LA 2K70A 2YR3A 1IBHA 2V2XB 2ZYRA 4R96B 2NMSA 5DRWB 5DMGD 3SDDA 4AL8H 1WZMA 5B3JE 1DZBA 1QVOA 1QPXA 3N0AA 5M7QA 1RUMH 3QDGB 4KHXL 5DLLA 4JRXE 3BUQA 4GS7C 3EOBA 3FTSA 2WZ0A 5J0BA 4Z3TA 5I73C 4Y9BA 4HS6A 5D1XC 3RWDB 4IW4C 3T3MB 3G5YB 3TO4B 1UWGL 2YEZA 1KDIA 2ZOOA 4AT6A 3UG4A 1NANH 2VXUH 2WQWA 4DGYL 4YDJB 2TAAA 2BS8A 4FADA 3KVPA 4RETB 3LS4L 3VW3H 2FHFA 4LASL 5EN3A 2QSQA 3LN9A 5DWUH 4Z7UF 3LHPH 5D7KE 3FUHA 3PWVB 3EOAB 3HE7A 2PN5A 4M62H 4C57C 4ABQA 5DS2A 1KXHA 3RB5A 5EPMB 3D4GA 4GP8B 4L29A 1TQUA 2AV1A 1A9EA 4H1LH 4DFIA 5ICUA 3WN5B 5E6IC 4YDVA 2GEEA 5EZJB 4GSUA 3PFQA 5DHEA 1R5IB 2GJRA 1BLNA 4C59B 3WXWH 1OAJA 1I7UB 5D4QA 3V4PH 3TM6A 3HB3C 5HYJB 2OAAA 4KI5F 2PXYA 5D7LD 4HPOH 1N3NB 1ZEAH 1U2CA 1AQKH 3D3VE 3WBDA 5K9KA 5E5MA 2X2YA 4BWTA 1AKJA 3P77A 1H15A 4I2XE 4I77H 4NYLA 4UILL 4KDVA 1NDTA 4YNYA 4ORGB 4LCVA 2VDQB 4BK5C 1Z9SB 4PUBH 5CGBA 3MYJB 4YEEA 1OTUD 5A16A 4JHVA 1G9NL 2PP7A 4HDIB 3X11A 1KGWA 3CPUA 3V9EA 1QI5A 2F74B 4WFFD 1JXDA 1OEZW 2WVSA 3PHQA 4IOSD 5DS1A 3CH8A 3HKFA 5ID0B 1HN1A 2RCSH 3A6BH 4QDGA 3AUWB 4NHUB 7PAZA 3SDCB 2ZUVA 3MBED 4HV8B 4QRUB 5E1AA 3ZKMC 4OCYL 5TPWL 4H8WC 2EVFA 4NWUL 2BZCA 2YA2A 3H9SD 1N8ZA 3NCEB 3K2IA 5FUZL 2IAAC 3V0VA 8CGTA 4JANB 3B2UC 3VA6A 3C8KB 4DKEH 2Y6TE 3FQXB 1UADC 3B9KC 1MG2C 2ATPB 5CGYD 2ENJA 1TMCB 4XCCL 2JH2A 3UZQB 3QFDA 3GSWB 5FM5O 1JV2A 2WQRA 4ONHA 2VLRD 3C8HA 4ZTPH 4WGWB 1BOGA 5E6RB 2FJUB 3B5HA 4KO5A 1PG7W 2BFVH 1PAZA 4OZGB 3OXSA 3SKUD 1Q94A 5KVEL 1KLFB 4MAUH 5JMRA 2KQMA 4HJJL 4AZ8B 5DMIL 2BZ7A 4QHMB 4UT9H 3HG2A 3T3PF 1YYML 5IFHH 2OXGA 4OR1A 2X89A 5TE7H 4JM2A 5I30H 2ORBL 1MY7A 5C97A 5TF1L 3VM7A 1H3UA 4J27A 4PJEE 3U4BL 1RJYB 5F7AA 2QPFA 1W9XA 1IGTA 3KPQB 4M48L 3GHBL 5EUKA 4Q9RH 2FH6A 4BJLA 4Z7VA 2X4OA 1B88A 3HCVA 3IDUA 5HDQL 2ZOLA 1L9OA 2P5WB 3MCG1 4NQDE 5AW6B 4GYBA 3EYUH 2DWTA 1WRFA 1LNUA 2F61A 3BVWA 3WE6A 3I84A 3BZEB 2G2RA 5IQ7L 2R4SH 2B3RA 5B7EA 3H4FA 1IBBA 1MPAL 5B4MD 3UBGA 1J5OL 5L4FA 3DNKA 1I9JH 4OLUH 4W4OC 1Q38A 4TQEL 3QO0B 1HDMA 3AITA 4FERA 3MV7B 2D2CC 5ERWA 2MCG1 3SYAA 5H35B 5CCJA 2NY6B 2UVFA 4JN1L 3LPGA 1F3DJ 4X6DB 4KQ0A 5E6UB 2R2EB 1I1YA 2KYIA 2BSEA 2X1PA 2DI8A 5D6DC 4YR6B 5DMKA 4LDOB 4OM0L 4X9IA 3Q6GH 5LQBH 4N2CA 2A6IB 1BXVA 5LDUA 2C1PB 3P4MB 2ADJB 2V7HA 1CU4H 3MXWL 4EDWH 5BUAA 5MERB 3R4RA 1C16A 4Y5XA 4E2OA 1FNFA 1G9NC 1P6WA 2BK8A 2WQAA 5FM4A 3NDYE 4BFJA 4F15B 4HLZG 1SFDA 1Y6MR 2IANE 5CN3A 1EO7A 4GW4B 4IU3A 1GOHA 2XDHA 5DZ9A 1NAKL 4NQCE 2X38A 3MNVA 4KFZC 3QAZC 4LL1A 3OLEA 4FNTA 4XPBH 1K8DA 4I1NB 5AOKA 3U4EA 2OXHB 2VSDA 3T2NH 4A37A 4BQ8A 2GSGB 5J1TC 3BZ5A 3H9ZA 4J28A 5CD3A 3O45B 4ZMWA 5SWQA 3NQKA 3D85A 4QAWA 1OE3A 3F2LA 4M02A 1KTRL 2J57A 5DUML 1F86A 5IJVB 3B34A 4KROC 4AZUA 3DURB 3IEAA 2FB4H 4JFED 3PY9A 4M7JH 5L88H 3QZMA 4JMNA 1U8KA 4JPWH 4PCSA 4LSTH 4G8AC 4UDTA 2BWQA 3QORD 4M9PA 3VXSB 2WGXA 3T2PA 1OPOA 4WSJA 2JKRM 4MB3A 1OARL 4UYPA 3ABMB 1UC6A 1A6AA 1QKZH 4M61A 4CSPA 4P46D 4AVKA 3BQUC 5J6HB 4ZFOA 3VDAA 2NY3D 3UTQA 5HGAA 5JPMB 3I50L 3RPKA 3EFFB 5B38A 1TLKA 2G3ZA 2XJKA 3WY4A 2VQ4A 4NOBA 2DQGL 2IJ0C 4G6JH 5IB1B 3U46A 1YNTB 2BVPA 4RZCB 1MIML 3KCPB 3NCYS 1ZLVH 1FO0A 3RY6A 2WTPA 5ADOL 1XGPA 1R3LA 3DJTA 4GSDL 3COOA 4KGLA 4RSYA 4JPIB 4AW4A 4B9YA 2FBJL 3K80A 1LM8V 3D25A 4U6XA 1OTTD 4ZFZA 3AQXA 3ARFD 2C1OB 4Z5RB 1T89A 2ADFH 4RX4A 5FM5M 4I0KA 1MFEH 4NLHA 4ODWA 2VW7A 2ICEB 4ALAH 4YO0A 1AZVA 1MUJA 2X2IA 4PJIF 2IWGA 1JOIA 5T1DH 5E2UH 3EO1A 3BEWB 1B2WH 1CGYA 2OS7A 5GRZA 4KKZA 1W72B 2WOBA 5ISZA 1UWEH 3HC4H 4HKJB 1Y6NR 3GRWA 3L45A 1CGWA 4P99A 4XHJC 4GAAA 4XNXH 3WI9A 5DHVB 4F20A 2P46B 3FSZA 2OMVB 5HHMB 5D7KD 3MJ9L 1UT1A 1E4KA 4KVNL 2V2TB 5AVRB 1HHGB 3N9GL 1W6LA 4NM4H 4UYQA 4XPGH 5DEZA 5EO1A 1JWUB 4OFQA 4GT7A 4PJDF 2WO4A 2EIBA 4KPHL 4XPHL 4EIGB 1VENA 3GO1L 5IW6B 5DJ2A 5I1JL 2B39A 1JVKA 2OTWA 4FNQA 4H5SA 2ZE0A 3MVSA 4NFDA 3WLBB 3SJVA 4L1BA 3AGVA 2G60H 2HG5A 2NNFA 3TBBA 5FYKU 2X9XA 3FO1B 4G1MA 4JO1L 4K71B 1XAUA 1D5MB 4XPFL 5FOJA 3QEUA 1DANT 4CU7A 1IGFH 3ULUH 3D3VD 4O5LH 2O26U 2R9HD 3GSVB 4NBYB 3EYOA 2VDLB 5BO1H 5I1KH 2XNAA 4GMSL 1KYOJ 4NZTL 1LE9B 3P4NA 4XWOC 1HCYA 3VXPB 3STZB 3PAZA 2NXYD 3P3YA 3O2VH 3AW5A 1EEYA 1DCEA 2WQSA 4APQD 4PVMA 4OT1H 4U3SA 2VDNB 4TLTA 3RI5F 5ES4B 5D1ZA 3EF7A 3O8XB 3TPUB 4CKVX 3BDBA 1R3KB 2EDBA 2FEDD 2DQIH 4IKLA 1QSVA 3C6LA 2K45A 4HFWB 1E4WH 1QEWA 1MAKA 2AQ3A 2F54A 4NQEE 4G6FD 2R2BA 2J6EH 5AB2A 1TCMA 4IDJH 5CUSL 4D9RE 1K4DA 2I9TB 2B3IA 3BVDB 4PJHA 1IGYB 5GGUB 1DN0A 3R4DA 1YA5A 4OZHE 2YRBA 3D87B 3BPOC 1IAKB 5EOCJ 2AAAA 1G7QB 2VL5B 5ELIA 2XN1A 3V9FA 3FQRA 1UOWA 4X8GA 3OZKA 4XXWA 1M6OA 5HI4C 1MCPL 2G9HA 3BAEL 1OSYA 5LXVA 1R3IH 4XB8A 1RXLA 5H4YA 3UO1L 4KUCD 4LSVH 3KXFE 1IAIM 4KJPD 4K5NA 2EIMB 3QDJE 1WE5A 1J1PH 1N4XH 3LDBB 2CGZA 4AYGA 4YHNB 4LBEB 4MA8L 1V7NL 1W0VB 4RDBA 4R7DA 3KPNB 1PDKB 3TP4A 3FDWA 2F8VA 1SDDA 2VJ0A 4MXWH 3QIUD 3DC0A 2VDKB 2X4TB 4O4YL 1J88A 2ZD0A 3RVUD 1LDPL 2J4WH 2NY4C 2H9GA 2NSXA 3GSRA 2CHXA 1OAXL 4W9CC 3ARGC 4KY1H 2OZNA 1E4JA 4HLZH 3PUCA 1ZHBA 2YPVH 2YD7A 4MVBC 2WVVB 3SQOH 2YRPA 1AXIB 2O6CA 3PQYA 4PS8A 4XR8C 5DD0H 4G59C 5DJ0A 1KACB 3UAEA 3I9GL 5C7ZA 4LCCB 1F3JA 1A1NA 3FQ1A 3K4ZA 1MXDA 4Z7OE 4L3CB 2ITDB 3WY2A 3TBSB 5IFAH 2FLBT 1EDHA 2HJLB 3IAPA 1FSKB 4BDVA 4FFVD 1VAHA 1UUSA 4Z7QF 1JUFA 3HAEA 1KYOK 5DSCA 5KVFE 3X12A 3QR0A 5F2FA 4BFKA 2R1XA 4RSVA 4KX8A 3T6QC 4XCEB 1IBGH 3FU7A 5E9DA 3PL6D 3FT4A 4LVNB 2YAQA 5IQNA 4CMHB 2UZXA 4R7NB 4P3DB 3U2JA 5CJBA 4B5EA 4WWKA 3NDZE 4U1SA 1JPGA 4JQXA 2P44B 4RAUB 3IBEA 1J1XH 2IOOA 3IT8D 4BCYA 1X5AA 4OFIA 4UTAL 4DCQB 1FZMB 1QFWI 5FFLA 1VHPA 3MUY1 5HHPB 3WNLA 4ESKA 3BKJL 4D8PB 2XX1A 1EAPB 5FECB 4G9DA 2OCFD 3KBEA 4G42A 1FCCA 4GRLC 4ZZFA 1RJLB 4PP2B 4FQQA 1T66C 2QQLL 2Z7WA 3HZYA 3PXJA 4M5SA 3AG3B 2D03L 2W1NA 1DQJA 3TYFB 4DNLA 4BKSC 4NQCD 1NCUA 4LKXB 4QY8B 5BVJB 2MSPA 1X5GA 2DM2A 3LOWA 4ONGH 1EO8H 4N85A 2OMZB 5EC2A 1A4KB 1RPKA 4ADIA 2PXYC 4O2EB 4NKDA 5HHXL 1A66A 2D31B 4A7QA 3FSVA 3I02A 1DO6A 4YHZH 1OWRM 1AC0A 2VGLM 1A3RH 2YRZA 2FQGA 1RPUA 3BUPA 4R84A 1G7IA 2HVJA 4P49A 2WBJC 3QZNA 4OFVA 4MQXD 2WLKA 2WXOA 3CXDL 4NZRH 2CKBB 2XG5A 3ZRFC 2CDEA 4WTZA 1KFAH 5FFGA 1IIIA 5HVHC 4BH7A 1I9EA 1QBLH 3PP3K 4LO9A 1VA9A 3LNGA 3QP3A 1UYWL 3ASWA 3BIKA 3HG1B 3LNFA 4LVEA 2BSDA 1TTGA 5IK3B 1YEWA 5JHLL 3WMPA 2FGWH 3X13A 3Q5YA 3IDGB 2VQ1B 4B53A 4FI8A 3GM0A 1EK3A 2YQGA 2MKWA 4L2YA 4DKFH 2Y0SA 3BWUC 3BWZA 3GMRB 4X99B 2P8PA 3CLFL 2WWMD 4JL1A 3GZOA 2V17L 2C7UA 1MI5A 1NFDA 1OP9A 2FT6A 4ZUSB 1FDLL 2ISDA 1BVKA 1KGXA 4LP5A 4UNVA 5L4JA 4LEXL 3RGVA 1FVCA 5A2LH 2RR3A 1ZA3A 1A1MB 2BINA 1YDPB 1U8OA 3F62A 5DK0A 4F7EB 4FL4B 1CQKA 2C4FU 3PREA 3S36X 3RWCB 4DO6A 3QHFH 4FTVA 3SEPA 5FYKE 4Y8AA 1MRDL 2HTLC 3R7RA 4UZGA 3WNKA 4G8GA 5JHDE 5MENA 4JM2C 2XN0A 3AG1B 2VDPB 4PRNB 4KZDL 4ODXB 4CSZA 1CXIA 4RFEA 4DWHA 4ZFOL 1SY6H 4TTDC 1P1ZA 2WZPA 3MI6A 4AITA 4ABUA 1EBAA 4MD4A 5EORH 4DGVH 2F6AA 1EBPA 1HESA 3BJLA 5F89B 1T5WA 3N40F 3F00A 1H3XA 4QRPE 1KPRA 2VE6B 2CLRA 1ZOXA 5F6HI 1ASOA 3BGAA 3LKSB 3MA9L 1BXXA 4MNQE 3ECBB 5CZXD 3SQBB 3V4VB 4V2CB 4ZS7L 5GZOA 1WBXB 1OT1A 3F5WA 2CRZA 3VWJD 4Z77A 1U8JA 3MFGB 5BOJA 4G80A 4N8CH 5JNYB 3IB4A 1S5IL 5IVXF 5I8EA 3VGBA 5JW4Q 3POHA 3ROLB 3FYEB 5FS5A 1DUYB 3WIFA 5J06A 1T1WA 3F83A 1MWOA 1QLEL 1QACA 2YHGA 4YLQT 3CGTA 1XR9A 5AD0B 2NY7L 3OKKB 1CICA 3LS5L 1KC5L 3ML8A 4UM9D 5E00A 1FL5A 3Q3GA 2QQKH 3WO3B 4BHUA 4LBAA 4XPAH 2TSAA 4LSSL 4WWID 3ARUA 1JK9B 4MGXA 4JN2B 1QSFD 4C58B 1CBJA 4OZFB 5FHBH 1OL0A 1DSFH 4IK6A 5I1IH 1YUKB 2VLJE 3F7YA 4KKAD 4NHCL 5IWLC 3LB6D 1EAJA 2W80C 2HLEB 4FCAA 3UTTE 4JFOA 5F9OH 3T1FA 3N44B 4PBWD 3RUGE 3X1EA 3J2PA 2E6JA 4XMLH 3T4AA 1K8IB 2KERA 4TLSA 3DX9B 1XXFC 1S46A 3SE6A 5HTSA 3II1A 4IM8A 2V8MA 4WFED 5I16B 2FATH 4OFYD 2B0SH 3NK3A 5IESH 4LQ1A 3WIIL 1T1YB 1N12A 4CVWA 2E8ZA 4PWKA 4QIRA 5DGQA 5C0EA 5KG9B 1XCTB 1YY9D 3QQDA 1MLCB 4GO8A 4JRYB 4F1SA 3ULUE 2ZXCA 2JB5L 4H2CA 4MS8D 1XBDA 3FQWB 2WQ8A 2BP8B 1GYAA 3X1GA 2LLLA 1H8NA 3RJDA 4IMKC 4NJ9L 5ACLA 3QDJD 2LT9A 3L4UA 4B0MM 1ET7A 1MHCA 1NIDA 4Q9QH 4IRSA 1WISA 3AM8A 3T1WA 2XTSA 2Y7OA 1JYVA 4OZIA 3X1FA 3VJ6A 1AACA 1TCRB 4MLIA 1CG9B 1XTLA 1UCBL 2DWSA 2AFNA 1PAMA 2X87A 2XV2A 5I5JA 1N6VA 3MLVH 3WMQA 5ESVA 3ULVL 2UYLA 3DV6A 4AKPA 1MVUB 3OLGA 1UZ6F 1CDUA 3BO8B 5HDWA 4IKKA 2A0LC 3P0VL 3KR3H 1PZ2A 1NEUA 3TA3A 3GSNH 4TUJA 5JW4M 3IGAA 1UHVA 4DEWA 4IS6B 2BVEA 4DW2L 1N5YL 2YFNA 5GJTL 4CMMA 1M6UA 1TZIA 2A2QT 4L23A 3FTXA 2VDRH 1OOWA 5IOPB 1A6UL 3QJRB 3CK0H 2IG2H 1H5BA 1UFUA 2W88A 2W91A 1X5MA 2ZSVB 2VWEE 3AACA 1S8DB 3EZJB 1SHSA 1NGPL 3RILA 1JGUL 1T21A 4JREB 1L0XA 3GLDA 1QNZH 3A6CL 1LMKA 1Z9MA 5BQ7B 5K69A 2CJUH 4HS3B 2RAMA 1KJMB 5HPMB 3EUDA 2L7QA 2WLLA 1FL6B 1L6ZA 5CINL 5GPRA 1DJWA 5FK9A 3IMBA 3IDNA 2BOBB 1DCLA 4L4TB 4KKPA 3K46A 4UMGA 43CAB 1T89C 3CSFA 3SCMA 4DP0X 3LNEA 3NH7H 2XZQH 2YD2A 4S0TD 2B15A 3FTUA 4LU5H 3ZYOA 2BP0B 4EN3B 1VEPA 3MRCA 4H8WH 3MLSL 3LH2L 4FLRA 5K9JH 1J7VR 1Z9NA 4PWJA 1EZVX 4PS4H 4AEEA 2GW5A 4R90L 2FIRT 2UZYB 1GC1H 4GAJL 1CS6A 1NCCL 3VFNB 5LCVA 1CF8H 2PF6A 2X4NB 3GGWB 2JJUA 3Q2CA 1G9EA 3EJYC 3PCYA 3C08H 1DE4B 4IOFC 4NO2A 3ABGA 1MW0A 3FQTB 3T6WA 4B9PA 5ID1A 4ETYA 5LGKA 2N7SA 3APMA 2J8OA 1MHPH 4Z23A 2L3BA 3DXAD 4GW1A 1S9XB 1MCNA 4E9QA 4PJ6A 2R56L 1LO4H 5I15H 2ITCB 1KTBA 2H6PB 2R83A 4AM0B 4F2MB 1LK2A 2K8QA 3IFOA 4N0CD 4HCFA 1I82A 1JPFA 4JCWA 4MA3B 4NN6C 2DIBA 2OLDA 4KXZH 2E27L 1CBVL 4APXA 1YEDB 3QUML 3IDJA 3QEQB 4PGDA 4RMBA 3T77A 4ETQA 4WEEA 3REWB 4LDEB 4NZUL 4FQJL 2ZKWA 5FW7A 3K2UL 5FYJL 4PEEA 5DJ6B 3S5LA 2O61A 1D5ZB 1QFPA 5JUEL 3I2CL 4RGND 3VFVA 1AZNA 2WXNA 5T1KD 1G1OA 4POZC 5D1ZC 5JYLA 1PKQA 3MGTA 4LPWA 4WDIB 3TNNA 1AXTH 2JFCA 1PX4A 3ULVC 2E74C 1J0IA 3E9TA 1FIGL 2H0EA 1ZS8B 2W5PA 1TTUA 2AJZA 2C3VA 3ZX1A 1I1AB 2ATKB 4GKNB 1W0WB 3C5SA 5HGGS 5AB0A 4MAYA 1IBDA 4HWNA 5CM1A 2JTYA 3O41B 1BBJA 1KIPA 1UURA 2GITB 5KVMC 2X6BA 3SYQA 1N6UA 3OKEB 3IDMB 5IB3A 4DESA 2WTOA 4MB1A 5CSGA 4UILH 4WI5A 4ZMTA 1WTGT 4Y5YA 3D69A 4QLRA 3WTXA 3OPUA 3LKNA 1DR9A 5J1AB 4P2OC 4S1QL 2BSCA 4BYHA 1KCLA 1DLHA 5F7EH 4D2NA 1G9NH 1R6VA 2D7NA 5HXMA 1Y6KR 4TQ8A 4QRRB 1IM3D 1MOEA 3F7PC 3L7FA 4OM1L 4JM2F 4Y2OA 2AZAA 3LKPA 2EP6A 4WCYH 2K4WA 3CZJA 3RVTC 5L6YH 4XE0A 2EH8H 1T4KA 2G75B 2EO1A 2R0ZL 4FFWD 4WU5A 5FYKD 3GI8H 2Z9TA 4OCYH 1CK0L 2VZUA 1S7SB 2Z35A 3CC5A 3MCYA 4LSQL 4QHKJ 4Z7VF 5TPWH 5JHDD 1YYLL 4WJG3 5JYMA 3DX0A 1TEGA 4UCFA 3R06A 1DQML 1FQ9C 1KIUA 4YH6A 5KSAA 3V5KB 3QUHA 4MSWA 4HU8A 1DDHB 3DIVA 4I48B 1CFTA 4PJGE 2QVFB 4V1DE 5AZUA 4ISVA 2XV6B 1UZ8B 3K6IA 3WHE0 1CDGA 2CBMA 2WXJA 4X80L 3AT9A 4LAJH 4QRPD 3SDXE 1LEIA 2VMEA 3LSOB 2JI3A 1YUHB 2XN9B 1OE2A 3HPLA 3CDGB 2EDLA 2BDNL 5BUPA 2VDNL 3BH8A 1GZHC 3IBOA 3VE0B 4BSVB 3CHXA 3THML 1S7UA 4X5LA 4JW3A 3G5XB 4L48A 4LRNH 4PV8A 3VD3A 2WP3T 3O11B 3OAYH 5J7CC 5DMIH 2EE2A 1M71A 1MCBA 1KBGH 1NIEA 2J73A 2HJFB 4FZEH 4Y16A 5E51A 3U36A 4NPKA 4Y4KB 4J4PD 3T0EB 2P43B 4JQXC 2XA3A 4WRLA 1AXSA 5I1AB 3CDZA 4Q6YA 4ZPVA 2PABA 3U4BH 1EJFA 2JIXB 4I89A 4RESB 3GHBH 5LAXB 1MJ8H 3MJ7A 1KCRL 3NP4A 3QC5X 5I2IB 4B5ZA 4GUQA 1UCTA 2AQ1A 2AAVA 2R23A 3L4VA 2IGTA 4N6QA 4HIJA 2VLJD 5BVPL 3L16A 4U1JB 3V6FB 2A73B 3ZGHA 4JVPA 4GP4B 3UTTD 3FT2A 5E8EA 4FRWA 5EBWB 1R24B 1A21A 4H8UA 1HQRA 1MPAH 1BHGA 4R5VA 5C0NC 4PJXB 2OBGA 3MDJA 1J5OH 1TSRA 2B8OT 3VXME 4CU8A 2HRHA 1A7PH 2CK2A 4XNMA 4TQEH 2WANA 3O4LA 1T5XA 4X7SL 4I0PA 4HU2A 1Y1UA 2DLEA 5E8OB 3HG3A 4HIPA 4M1CC 5CLTA 2EC9U 4ZQTA 1NCWL 4LF3B 1FYTE 4HHWA 3CZFB 1A7RL 4ZFFA 3ULUD 4Y7MA 2DQJH 4R2GC 5BOZG 1PX3A 4X2UA 2APWA 2FHCA 4IIQB 4OM0H 3ZIYA 2X4SB 3NCJL 4LQFL 4ZUTB 3ZZ1A 3UTZA 3D48R 3U2SB 2P52A 3ZO0A 1T2XA 4G6KL 3BMWA 4OTXL 4ZDHA 1OHQA 4M4PA 4DP7X 2PR4L 1KCSL 2GSIB 3KYOB 3FXIC 5IIEB 3O3DA 1S3KL 5EU6D 5I74B 4FN0A 5GS2H 1IT9L 1G4MA 4YL9A 3U7WL 1Y7VA 1E27A 5K59F 3BGMB 1G9ML 3ULSA 3ZIMA 1QASA 1YEFH 3TIEB 5T33L 2CBOA 2UZIH 2B9BA 3IE4A 4UOQA 2ENPA 4PAZA 3WKNA 5T1MB 1UM5L 2OK0H 3TV8A 3O0LA 4OSUH 4P5TD 4YDZA 1OSZA 3KWWB 2IV9A 4JZOA 4YPGB 1FNEA 3QZWB 2GTWB 5AG8A 3G5WA 4AK1A 4HGMA 4W6YB 3TIDA 2J2ZB 2Y1YA 4HOXA 2DM7A 5CHNA 3F01A 4LSUH 2YS4A 2NOYA 4PJIE 2DEXX 2EDNA 2P42B 5L8JB 3NJNA 5FV2A 4JL2A 2DS4A 5ICXB 2F1BA 5HYSA 2WIIA 2Z1PA 3EOTH 3EZ8A 5GISL 3HMXA 1L0QA 2JXMA 4BRVA 5HHNB 2XTJB 2QADB 3ZDXF 3H0TB 2D3LA 3HZVB 1YEJL 1NMBH 4NKMA 3MLRL 2MEJB 3MCKB 3POCA 4PBDA 2J8HA 4YHYB 4N6RB 4K3DL 3DVGB 4JPVL 4WW1A 5LGYA 4TLKA 4EDXA 4OIIH 4MD5A 1NIFA 2GY7B 1OVZA 1XSIA 2C9AA 1GYCA 4A6YH 2DQGH 1KB5L 4A1RA 5HGHA 1N0LB 1NEZG 1RPQA 3WJJA 2FNWA 4KI5D 3VAEA 2H0PA 3LPOA 4HHAB 4KI1A 2AJ3A 3RPBA 5JHBA 2CXKA 2Q0ZX 3BISA 1PZDA 4QEGA 1NEPA 3WFEL 1VKXB 2CR3A 4R7XA 5HJBA 3QBTB 2YRLA 1OZUA 4GSDH 2VAJA 2RIKA 3MROB 2FBJH 1A7OL 4HJ0D 3W9DA 1V27A 3HC0A 3ZW3A 1XSJA 5F72S 5GZOC 1GGTA 3QI9D 2RA1A 3FOLA 1KIRA 3QDAA 2QDVA 3SBRA 1A2YB 1AR1D 5TE6L 4D3CL 4XN9A 4N2KA 5GJSL 5AEAA 2BW4A 3FH7A 2Q2EB 1ADQA 2BY2A 1F2XK 5DRXB 3MXVL 4HXBH 1FZJB 5FV1L 15C8L 1F90L 5B8CB 1CXKA 1MEXH 1T1XA 4TV3A 1X4XA 4XN5A 1ZLEA 1CICC 4X4YA 2FK9A 4U7KA 1COBA 2LU5A 3OPZL 3WNOA 4PVBA 3EJJX 1OCRB 2OPCA 1ROCA 4W9ZA 4AQ1B 3MJ9H 2G5UA 1E9QB 3BUYA 3SKNA 4MJIE 2ZXEB 4YQXL 2AI0L 1ITBB 3CFNA 2RJMA 5CR1A 2YUXA 2WUCH 5CF3A 4D0DB 5JOFB 5A6LA 4PJHF 3NCYP 2EEXA 5GGVH 2BIOA 5KN5A 2YAPA 1G9MC 5JQ6H 3T4AC 1U8LB 3E2HC 3QIBA 2J25A 4QXVA 4X5XA 2A9NH 3SN6N 1A3QA 1Q4NX 3RKDD 3GI9H 4EPSA 2P9RA 2QGBA 3BVTA 1VLXA 2O30A 1NDMA 2CRYA 2VAAB 5DC0A 3G04A 3CPLA 4NZTH 2FYVA 3ES6A 4E41A 4DIXA 3LRGA 2R2HB 3GIZH 1GYUA 1U92A 4M6OH 5EBLA 2VLME 3QXTA 4R5TA 4JFHE 4ZUVA 3GBEA 3K7UA 4G6ML 5HYEA 4J3TA 3IJ8A 4R4BB 5I0XA 1N0XL 4YFLF 4O02L 1I75A 4CRPA 4OCRH 2CCVA 4DEPC 3AM8C 2VKXA 3R18A 4NZDA 3RWEA 4C83A 5KVDE 3Q01A 1FZOB 4P5SA 4PJGB 4X5WB 1N2RB 1MHEA 2APXA 1XR8B 1F4WL 2DWXA 2JLLA 1D6EA 2ZCHH 4X7TA 2BMKA 1MF2L 3PV6A 3B7SA 3FUEA 2MH4A 3GT6A 5B38G 2QEJA 1ZV2A 3OG6B 3V6ZB 5IMLB 3IDIA 3NN8B 2CAKA 3L6FA 4LLAA 4K7PY 4F57L 1AGCA 3PWLB 3GSXB 3ZVVA 3BAEH 4HAKA 5B1BB 3QUZD 1AD0B 4V1DD 5CBEB 5CLWA 2KMWA 3E1F1 5JDSA 3ZN6A 2E7LC 3ALPA 4AQ8A 3HS0A 4Y8DC 1E5BA 4MA8H 1D9KA 2LGNA 5I0DA 5DEGB 1OK8A 3NZHL 1T1ZA 5C0FB 4HUXB 3DSFL 3BAXA 3MNZA 4X8JB 5FUOL 5E0FA 1HEHC 1VERA 2VSKB 5INCB 4Z8FH 4Q6KA 2R27A 3DX8A 2XVGA 3AB0B 2BRQA 1QABA 3F05A 3SCMC 3OKOB 1T20B 3D30A 5LGJA 2RHEA 4AJVA 4M6NL 1UB6A 1IQDB 2X4PA 3A4EA 3QH3B 1BXUA 3VUAA 5INDA 1WCBA 1Q9KA 2VZOA 4QXWA 3WV0A 4TF4A 3DDFA 3KW7A 4Y19A 3QQ4A 4NQXB 4LOUD 2YBRA 2EDQA 3KAAA 4GO9A 5IHLB 5EF2A 4ZXBD 2GVYA 3QA3A 2CQVA 5MI0B 4ZO8A 3Q0HA 5LWYL 1PLAA 3SGDH 3JVFC 4PRHE 3C60A 3B7UX 3E8UL 4PU2A 5C3TA 3RL2A 1I7RB 3L48A 5D2NE 1WA2X 4NSKA 4PJ9B 4DAGH 5TGBB 1E5YA 5E4EB 2EIDA 4EQ2A 3V5HB 4MJ5B 4XVUC 3VXMD 3HN8A 4AGPA 2CE6A 2ED9A 1NGYB 4W9IC 4NGHL 3H85A 4QLWA 5DLML 4NS0A 2W8CA 3RWGB 3X14A 4DGWC 4IBUA 1WFUA 2VIRB 4YHLL 1FFTB 3IWUA 3MREB 5E6ZA 1GXEA 1OE1A 2Y3NA 4U1MA 4QRTB 5C0CA 4E5XB 4LEOB 3BKJH 5D7HA 1AOHA 2NX5A 1EH9A 2CKNA 4NRZA 3KMDA 2H5UA 3W5MA 3C75A 3APDA 3MR9B 2F5AL 4NC1C 1OP3H 5FKPB 3W11D 1JWSA 1RP8A 3TBWB 2AV7A 5MEPA 1GW6A 4PREA 2QQLH 3FBKA 3T09A 1JZIA 3I6LD 3SBWC 5HI3D 3TTSA 2D03H 1HYSC 4FYSA 4PIRF 3NA9H 2BNUB 2F53A 1CFQB 1NBYA 3EYSL 2Y06L 2FJGB 2P24A 3NJMA 3U83A 2W60A 5D7JA 3FN9A 1TQVA 3FONA 3OB0H 5E8PA 3DRTB 4K8RL 1GJIA 4OD2A 4JFFE 1H3PL 2NW3B 5C0BE 2X2JA 1NAML 3FO9A 1KPUA 1TPXC 3KPLB 4MAYC 2GFBB 4KMLB 1OTSC 3SGKA 3LKQA 1L3NA 1NFDF 5AW1B 3FB7A 3V0JA 5LXGL 1KIQB 4N1EA 4WI0B 1IAIL 5JA9A 4YHKH 3RZCA 1NIBA 2J8UA 1E9PB 4L3EA 2ZUTA 2VDOB 1YPZA 3TN0D 1AVAA 2BNQD 2WLMA 2WMPB 5EMYA 3ZDYB 4X7EC 1GGCH 3CVHB 4PG9A 4GW5A 4WW2B 3DMMC 3TWCL 4YX2L 2WP3O 4LESA 5DI8A 4F5CE 1TTFA 2IH1B 1QSEA 5EA0H 3TTYA 4TNVF 2EECA 2VDMB 3A23A 1XZ0B 4LLDB 5IHWA 1CQYA 1SQ2N 4CNIB 1OWWA 4HAGA 1BD2E 3ZTCC 3D34A 4WV1B 5AW4B 5I6PA 3WJLA 3GDBA 4LSDA 5CCKL 1KGIA 1IM9A 2J1XA 2WNKA 5BRQA 2XQ0A 1KFGA 3HB3D 1NCAL 2OCCB 3P3UA 4UOZA 5C70A 4GG6A 4XCYA 3CLFH 2EIEA 1ET8A 3GD1C 3O3AA 4E68A 2OMXA 2W65B 5KSAC 3HKZA 4ZNEA 3IFPB 4GQ9H 5AZEL 5FW6A 3HAEG 2EH7H 3O4OB 3QJFA 5KSUA 4Z0XB 4PTUA 2A38A 2AXFB 3QJSB 1T83C 4ELME 2BCKA 3HMWL 1EHXA 1FDLH 2NZ9C 1YN6A 2APTA 3CX2A 5EU7E 3GJFK 5F1NA 2IALB 1DBBL 5ACZA 4UDUA 4WKZB 2A3TA 4AQEB 4MJHA 5DHYB 4L4VD 3QCVH 5G4NA 4PJCB 2KLSA 1D5RA 4M4RA 1PLGH 1FNAA 3Q6FB 5BNXD 1AQDB 1T7XA 4Y16C 2ALAA 1LO2H 2PTUA 4KZDH 1HI6A 4MKTA 4YHPA 3LZFL 3ZKMD 5B1CA 5E5RB 2D7QA 1AS7A 2O5YL 1KZQA 2X09A 4KTYA 5EC1A 1L6PA 1JERA 4WWNA 5HHOE 5IMKA 1TNMA 5J12C 3B1UA 1FG2B 3B1TA 2IXQA 4RGMB 5DJAA 1EAOA 3B2UD 5BXFA 3ARYA 4ZBJA 1KN4H 1SLVA 2YA0A 1CLZH 3DIFA 2CUMA 4BQ6A 5BRZA 4MJID 4L0YA 3FU5A 2WZ5A 1FO0H 1T3FA 2FX7L 2YXWA 3MKKA 4HD9A 1JFQL 3TX4A 1RHHA 1AO7E 2DDQH 2IBZX 2V5TA 3LRKA 3SE8L 2FEEL 4S2SA 3L13A 2C4FT 3CXFA 2DTSA 3RTQD 4HT1H 1S5IH 3ZE1F 5MEOB 3D18B 4UOW1 4K94H 3DJSA 2ED6A 3TYGH 1HH6B 4CJ0A 3EO0A 1A64A 1QLEH 1ADQL 1VCBC 5LHDA 4GPVA 5KSBA 1JV5A 4F9PA 4GBXB 5F1IB 1BP3B 4F3FA 3TBTA 3V5DA 4CN1A 4P2YA 5F0PB 3PWPB 1KTJA 1FAIL 2AJXH 2BHYA 3FZUD 4Q56A 2ADIB 2Y7QB 5EOTA 3NJJA 1WAPA 3WEMA 4LSSH 1TJIL 1UZ6E 3FOMB 4XCNA 4LFHG 3C5JA 3GRWH 4WTZG 6FABL 4OZIF 1HAWA 3JV5A 5FKAB 4JFHD 4P9ML 2QBWA 3UTSE 1AY1H 3UP6A 1J10A 2YPLA 4F58L 1Q1JH 1IBZA 4XWGL 4QO1A 1YECL 4CVUA 1ZGLP 2R29A 1VPOH 3E3QE 3IF1A 1JHTB 4AGQA 2IPKA 3HNSH 2CR6A 3MRFA 3OHMB 3SYOA 5DRWA 2V2XA 4KHTL 4R96A 1OGAE 2JQMA 3OTTA 4JHAL 5GRJH 1EMTL 2J3SA 4U33A 2YWYA 3K5RA 3QDGA 3WIIH 1CDJA 3BAJA 5G5DB 2DBJA 4XXDA 1L9PA 3G08A 2DMGA 1JHLL 5D7SH 1X5HA 2VH5L 3HIZA 4J3OC 2W92A 3ZQ9A 1OAZH 3TO4A 2JB5H 4KRMB 2FR4A 2Z1KA 1SGKA 1JDAA 4MMXB 1V05A 2BSTB 5CSZA 4AV0A 4FS0A 1LO5A 4RBPH 4YDJA 3EGSB 5DFTA 1NC4B 2CG9X 1AAJA 4DP8X 3N1PC 3DKHA 3H2WA 3LRHA 4PI0A 1PSKL 3PWVA 3BUTA 2OJ1A 1S7WB 4H8QA 5D71L 5EPMA 1BQHB 2PO6D 3VVVA 4LRIA 1DJHA 4EI5D 1UCBH 4XMTA 3D4YA 1UT2A 3WN5A 3WEBA 1VFOA 4EZLA 3CQPA 1T2QH 3IDYC 3QPXL 1BWWA 1PD0A 1BECA 4B27A 4JLRB 3BAKA 4A7TA 3VNYA 1EXHA 3HOGA 4UV7L 3FMGH 1WP6A 4JDZB 1A6VH 1ILUA 1I7UA 1WK0A 2VLKB 3JZ7A 3WTWA 5HYJA 2X41A 5GJTH 5EZPA 5F7UA 1N3NA 3CZSA 3KJ4C 1J11A 2ZTBA 1A6UH 4RLDA 5I1DA 1LQSR 1ZCRA 3RFZC 3WOVA 4JFXA 3NIGE 4KROD 1EFQA 4RA3A 4EJ1C 5IEKB 4OD3L 4PBXA 2R69A 1E6OL 3A6CH 12E8H 4PRHD 2MTPA 3MYJA 4PJAB 4AYFB 1AZCA 2Y1ZA 2VT0A 4P2AA 3VG0L 3VXNB 3CMOL 4C56A 2Y3AA 5TH2A 3CXHK 1NLBH 4HDIA 1XGUB 3VXRA 4OI8A 4KY2A 2TRHA 5FW8A 1BM3L 1I3VA 32C2B 2UUDK 3ARBB 1P84K 5ID0A 5IBLC 3N50A 4YXLH 5AW3B 3MLSH 4TVSa 3WFDH 3SDCA 3QIWA 3BQUD 4QRUA 3SDAB 3ZTEA 4O2FB 2DYPD 4R90H 2V6HA 4GAJH 1NCCH 4KDTA 4NQTA 3VWKC 1QRNB 2Y7SA 2ED7A 2UY6B 3M86A 3QUYB 4LSPL 1HL8A 5C0BB 2V33A 5BCAA 4Y2DB 1EO5A 2WINB 3GBLA 3NZSA 2DLIA 5J13B 1AGBA 3UZQA 4ZRGA 3GSWA 3HAEH 2GHZA 5C0AB 1BF5A 1NSNH 2YD6A 4NQVA 5CP3A 1F4XL 2R56H 3MRRA 4FQXD 4ZFGL 3MRDA 1KLFA 1FFOB 3HE6A 4P2CG 4LGPB 1YQVL 4AZ8A 3AJ7A 2QZQA 4QHMA 3PV7A 1RJZB 3WSQH 1U2HA 3VFUB 2Z92B 5EBMA 2E27H 4MA7H 1CBVH 4L8SC 1P0SE 2G9KA 4MYWB 4YHOH 3ELAT 1BFTA 5T1JA 3GPSA 5E6SB 1RJYA 4FQJH 3TBVB 4U6YB 2H32A 3KPQA 1SHWA 5EDXA 5JUEH 4GRMB 5DVLA 4Z7VE 2EACA 3I2CH 2D7PA 5F6IB 1ZLSL 4OBSA 3VXUE 4PJFA 1DJYA 2P5WA 4W68A 1RHFA 1UJ3C 3QDMB 5E94B 5I71C 4HP5A 1UVQA 3IN0A 4PMEA 5I8OL 4PJ8D 1J8HA 2BH0A 4TSBL 1HHIB 3BZEA 4ELMB 2DJSA 3CFCL 2MCAA 1ZK5A 1JZ3A 1XX9C 4O51B 2A9BA 4JJHA 3Q05A 3W2DH 4JVWA 3QO0A 5L2KE 1I8LC 2VUOA 1BZ9B 2EEDA 3MV7A 4FXKA 2X3AA 1QWHA 1B0RB 3CFEA 2ICCA 4ZAKB 3QHZL 4X6DA 1SHXA 4JY4B 5C6WH 5FO2A 1WC7B 1WFMA 4YR6A 2GPZA 4FYQA 2XA8H 2ZXWB 4QXGH 2A6IA 4AQ8C 2C1PA 5D72H 1KCVL 3P4MA 3TPKA 2X6AA 35C8L 5MERA 1U8IB 4D9QE 2WQUA 2JTDA 5DZAA 4OGXL 4GMTL 1OCWL 4OM1H 2A9AA 2W81C 2BVUA 4NJAL 2RH0A 3BT2L 4GW4A 5AW5B 3WLWC 1DFBL 1LTXA 2MQ3A 2R0ZH 3LN5B 1F8TL 3MUZ1 2HLAB 2ZJSH 5KW9L 2MKLC 4H20L 1ZHLB 4UU9A 1P7QD 1UB5B 3J27A 1N64H 2ZG2A 3TEWA 1KTLB 1MLBB 4BFBD 1YYLH 2OXHA 2OCJA 1DQMH 3FO0L 2PWHA 1CGSH 3O45A 3P0YH 5HHOD 3IJHB 3CFIC 3DUSA 4JPKH 3RDTC 4CDGC 3C2AH 1DZ0A 1NUDA 1KELL 1R33A 3IKKA 4Z7NB 2Q8BL 4X80H 5DDHB 2NQCA 5IJVA 1KWGA 5FLUA 2R15A 1R3JA 3DURA 4P2QD 3JWNC 1HE7A 2PW2B 1LO3H 3C60C 3N42B 1AO7D 3B7YA 5GZNA 1AS6A 3ZZLA 1OAKL 4YVUA 3SY6A 2R7EA 4TMPA 5HY9B 4FMFA 1EVUA 4HALA 4W70A 4WUUB 1KBPA 3QULB 5C0RH 4RWHA 1ZXQA 1LDSA 2DTML 4PJBA 3V55A 4AYSA 2Q76A 4M6MH 4IGBB 3ARGD 3IVKB 2ICWI 4HZLA 2G0KA 4KKLC 2DYSB 5L2JB 5J6HA 5HI5D 2N56A 2OJZL 1KCRH 3WE1A 4DZBB 3EFFA 4FD0A 5I1GL 3OKNB 5FA3B 1E7VA 4FOMA 1U58B 2DF3A 4NRYB 4JRXA 5IF0A 1YNTA 1BIHA 2WN2A 3L3IB 5IGXH 2WVUA 4U0RC 3UTSD 3T0BA 2WXPA 1OT2A 2WXRA 1HT6A 5FYLL 2YEQA 4ELKB 4YE4L 3L3KB 1DEDA 2WZAA 3MUGA 4JPIA 4M1DH 4NENB 1A5FL 3WGUB 3PJLA 3SDDD 1PZ3A 3CFUA 4QRBA 1MCSA 2DKSA 4XVSH 2C1OA 2EDYA 2F19H 3DVIA 4X7SH 1VZHA 4Z5RA 4HOZA 4GI6A 3N1MC 1YEHL 3L95A 4OI9A 3S88L 5AYUL 3IE9A 3MRLA 4UT6L 1A7RH 1ZLVK 1VFAA 3WFHB 3BH9B 3BPNB 3SGKC 4U3HA 2YAHA 3NCJH 2IWEA 5ISZE 1W72A 4MMYB 4KDWA 5ILTH 1F42A 1CWVA 2DWYA 4G6KH 4HKJA 4NUMA 4OTXH 3F6JA 3S5YA 5L0QC 4J12A 4FX5A 4WGVB 5DHVA 4BH8B 3QYNA 2OMVA 3HE7D 1KCSH 3NSCA 2W07B 4M5YL 3QXUA 4ZODA 3FB6B 1N7ML 2QHLA 3PIQB 4MJ4A 1G9MH 2EE0A 2QTEA 1OGTA 3NQIA 4NO3B 3TCLB 3TC9A 3WLBA 3K4DA 4W9KC 4JHBA 5KTEL 1N5AB 2EC9T 2N1KA 4JJ5A 3AQDA 5KS9B 5PCYA 4LDLB 3FO1A 4APQA 2HG0A 3QUXC 4ANVA 2PXYD 4M29A 3V6OA 1UGNA 5C07B 2JI2A 5ADPL 1Z6JT 1L9TA 5F0JB 4XO3A 3V6BR 3US0A 3GSVA 2NNAA 1KJ2L 1LWHA 5E95B 4Q6IC 1AKJD 1OKEA 3ARDB 3NGBB 2C3GA 3NCCB 1LE9A 4DGIL 3BN9C 3PS6A 4RAHA 3TONA 2NRDA 3VXPA 4P4KA 5SWZE 1SEQL 4XNUH 1ROWA 4HUUB 3ATAA 5GISH 2IH8A 3VSVA 1WBYA 2IO5A 2VXQL 1C5CH 2F58H 2DPKA 3O8XA 3TPUA 1SMOA 1R3KA 1TQBB 1L3WA 3WDJA 4AGLA 5DD1H 1BXAA 3BKML 1PZCA 2DQDL 4KZ0A 3R8QA 4K3DH 4JPVH 2W0LA 3HUJB 3FB8A 4PJHE 1G43A 3AS0A 1JZEA 2I9TA 3FTYA 5GGUA 4NKOB 5CGTA 2K3HA 3BDXA 1JGDB 1ID2A 4RMQA 1E2VA 1HNGA 3CHRA 3UBFA 1Z2KA 3VRJB 3WFEH 3HNTL 1CPUA 4KJWC 1FV1B 1B9KA 3UC2A 1J5IA 1E3FA 4Y1AE 5D55A 4OFPA 4B50A 1BIIB 3WNJA 4J3XA 1Y07A 4NKIL 4YHNA 1LYQA 3IS1X 4D3CH 2HX9A 1W0VA 2A6DB 3BSZA 4IQHA 4J3BA 5D4JA 3S3CB 1PDKA 5GJSH 1ZE3C 4FI6A 4YIQB 3DROA 4N22A 2FRGP 3MXVH 1P9MC 2X4TA 1QSFB 2N7BA 2KQNA 4NQDA 2ARJB 5CU5A 15C8H 1F90H 1RUAH 2A1WL 2HTLD 2NY5L 4JKLA 1KSRA 2X89D 4JM2D 3EH1A 1EIBA 2WVVA 3PQYE 3BDYL 3HTLX 1PU0A 2AK1H 1GL4B 5LCVH 3UG5A 5B3NA 4FG0A 4IBSA 4KV5F 2CIKB 2IFFL 1B3IA 2FWSA 1G5GA 3P9WB 4LCCA 4FQIL 1LWJA 3UBXI 5D9SB 3V4PB 3VXUD 1EJ6A 2ITDA 1HXYB 1QFOA 3SY0B 3TBSA 2H3NB 2AZUA 3G6AB 4KTEL 5I6MA 2HJLA 4IBZA 3JWDL 4YWGL 2E7CA 1CIDA 4IJ3B 3UBHA 4N2LA 3FCTB 4J3OG 3OAUL 1N68A 3AQZA 2PCXA 4L5FE 4NNXB 4YHIB 3TCXA 2GG1A 5KYYB 2B1HL 3PJSB 4MDJB 3W5NA 5CCHE 5EZLB 3QEGL 5HHQB 1PY4A 2FO1A 4R3SB 1S2EA 5E9DE 4KX9A 1OSEA 4P3DA 5E8NB 2HT4D 4LGRB 4HIXH 3DUHA 3BWAB 3ZE0F 2IANA 4LP4A 2DWDB 4RAUA 2IBZY 3BUDA 3T8XB 3ZBMA 4Z7AA 4MLSA 5HYSG 4JFDE 1WHPA 3ESUF 4PGZA 3TA4D 5BS0E 3S4SB 4AVJA 1B3JA 2BSED 4DCQA 1ODAA 3MRMB 4ZUWB 1CFVH 4MX7A 2K1MA 1HL9A 4G6MH 4NO5A 3OJDB 5AYTA 1F45A 5HHPA 1G7JA 1RK0B 3AAZB 1FA4A 3IMRA 1AI1L 1N0XH 2ZOTA 3GJFA 4O02H 4D8PA 5IV2B 1WUZA 2FX8L 3EHBB 2BIQA 3UJJH 1E28B 1EAPA 3DTXA 4X98B 5FECA 4XOAA 3WO4C 5J56B 1RJLA 4PP2A 3I74A 4DK3A 1F4WH 1AZUA 3VRLF 4RQQB 3IXAB 4M7KL 3SE4C 2VABB 4L3AA 3WN5C 4KBPA 3TYFA 1PQZB 3FF8A 5I17B 2WLIB 1UG9A 4L4JA 3IRZA 5IBUB 4QY8A 4K7FB 1N8OE 5BVJA 3BVVA 1W8OA 1LGVA 1RZJL 1D5IL 2FWUA 2AP2A 3BVXA 1A4KA 1MCIA 1OTUC 4MKMA 4OI7A 2D31A 4OJFL 1TJHL 3T2OA 1RK7A 3D85D 2K7PA 2R0LL 5LBVA 1INDL 4ZX4A 2E4FA 3T4YB 1I9IH 5GQBA 3UJIH 4DUWA 3MLTB 4LLUB 1LHZA 1RAMA 1JXKA 3MBEC 1O7DC 3V95A 1F3DH 3NZHH 1KCWA 5KOVC 2CKBA 4FQ1H 4F9LA 3K4AA 4FQLL 5D1QE 5BV7L 3IFLL 4QHNB 4RRPA 2X1WL 3T8MA 3MFFB 3DX6B 2C4XA 4LARH 4LCUB 1F02I 2I5YL 2Q86A 1AFVH 1CYGA 1FN4B 5AAWA 2A0LD 1EX0A 3HG1A 5CGYC 4Z18A 5GIRB 3OHXC 1EERB 2NY5C 4JAMA 5IK3A 2HN7B 4JG0H 1U2YA 5D93C 3U0TA 2WSPA 3IDGA 3QIWC 1UOKA 3DX2A 7FABL 1C12B 4MRCA 3FFOA 4TN9A 1F4YL 2CM5A 2LW3A 3BEVB 1A6WL 3DXAB 1RIVL 4EUPA 4XNYL 3GMRA 3GRBA 3K0YA 4GB9A 4X99A 4Y4HB 3BE1L 1G5AA 1JVLA 1UACL 3PABB 1BAFL 3E8UH 1MI5E 2B08A 3QJQB 1A65A 5K9OA 4ZUSA 3F7VB 3JWDC 3BGFB 4LT7A 5AOJA 3GEWB 1WV7T 3MOAL 2A77H 1T7VA 1KEGH 4GAGL 1ZXKA 5DZLA 4CC0A 2AABL 4GAFB 3QYCA 3VI3E 1A1MA 2JLPA 1YDPA 2JKTM 3HE6C 4F7EA 2J8UF 4RX4D 1VCAA 5DLMH 3UAFA 3RWCA 4EIBA 4J39A 2WK2A 3FU9A 5ESQB 1WH0A 3JV0A 4RGNB 3UCRA 4I3GA 4G8GE 3WIHL 5KEZA 4EIUA 1WYJA 1V10A 1FF5A 4PRNA 1HCFX 4XOBA 1JNNH 1DVZA 4ODXA 4YSOA 1JDCA 5GGQL 4BUHA 5ISZD 3AWGA 2QVTA 3MRIB 2F5AH 1LXMA 1L5GB 2O6EA 1MFAL 4YK4B 5DS8B 3MV8E 5F89A 1J5HA 2WN3A 2VE6A 4DKTA 3P69A 2E7HA 3LKSA 3SQBA 3ECBA 3QRBA 4WTWA 3V4VA 4LSRL 4BUQA 3GLZA 3EYSH 1WBXA 2Y06H 3SO3B 5CJXA 4GG6F 3DOIA 3FFDB 1VJSA 5ANHA 4AXWA 3SJVD 2OA9A 2YWZA 5JNYA 1H3PH 1ZHKB 1NAMH 4P59L 2VSMB 4XX5A 3ROLA 4Y4FB 1LEKB 1DUYA 1TQCB 1VF5C 4JRWA 4NI6A 1QHOA 5FO8B 5LXGH 5AD0A 3ETSA 1IM3B 4FXKC 3OKKA 4NQEA 2YGOA 1WEJL 1JNHB 2F2HA 1D7DA 4IMLB 4ABVA 1DJXA 4HJUA 3C6SB 4HYTB 5IQ9A 3TWCH 1JK9A 2ZKHH 4JN2A 3II3A 4OZFA 1Y1DA 1FCGA 3U0PB 4TRPH 4PRPB 5B39G 4ZTEA 4LP8A 5D1ZD 1YJDL 5BV7C 1RFDL 5J5EA 1J12A 3NFSL 2IGLA 3C6LD 3T5WA 1GZPB 5I6XC 1DBML 2F54D 5CCKH 1K8IA 1U4FA 5J57B 4AWJC 1AHWC 1D5XB 3KXFA 3QDJA 3LRSB 4WI3A 5SX4H 5DRZB 5I16A 1FNSL 3U7AA 2EVJA 3P73B 4WNJA 3VGAC 4XX1G 2V3DA 2OTUB 1T1YA 3JWNG 2IH9A 1BVZA 5C0IB 4ZMNA 1TJMA 5KG9A 2GT9A 3K6DA 1MLCA 1SM3H 3QORC 3VFSB 4A38A 4WVRA 1R5WB 2VW6A 1LEGB 5FCUL 1P4BL 3RAJH 3VM5A 1CD1A 3GBDA 5JLZA 3HMWH 4FXGB 1WIUA 1AMXA 3AY2A 3HRZC 1XO8A 2FZ3B 4MCZB 5FGSA 5TDOB 3U0WH 4XNAA 2YPKB 4Y1AD 3RQ3A 3O6ML 3D05A 3AABA 4P46C 2K6YA 2WLNA 4LB8A 4NNYA 5GZNC 3H8NA 2WWNA 5KSBF 1RZFL 2NY3C 3HMXH 3RNKB 4JKPH 5AQ0A 4ZO6A 1MW1A 2H26A 1CG9A 3GM8A 1L7TH 3CFKB 1MVUA 1SDYA 3NZ8B 4YSRA 2Z7YA 3BO8A 3LZFH 3SZ6A 4Z3HA 2JNZA 3W0WE 4B97A 2IAMB 3PDOB 1OM3L 4JJOA 4PWGA 3SOTA 1D6VL 4ZMVA 4OUUB 4IS6A 3JWOH 4HF5L 4ZD3L 1OAYH 3PQYD 1OTTC 5SX5K 3ARFC 5AVTB 1IKFL 2CBPA 1ET5A 4I8DA 3P4LA 1A0QL 1ZV9A 4J23A 4D8OA 4YDLC 5EOCH 3FUDA 1SLUA 4F2EA 2ZSVA 4HIIB 2BS71 1M2VB 1S8DA 2YUVA 3L2LA 4FQHB 3SE8H 4M3JA 4R4FH 3BLPX 5FFOA 1QR4A 2YKKA 1BVNP 1MG3C 3LQMA 4WK4B 2F1EA 4LNRB 5BS0B 2EEBA 4ANXA 1L4IA 5J11B 3WFZA 4HS3A 4X42A 1KJMA 3T3MF 3KLSA 2PP8A 3HS9A 5HPMA 3BSZL 2UVEA 1FL6A 5F96L 3TF4A 2E9GA 2BOBA 1ADQH 4MHHG 1JK8A 4KAQH 5E9DD 43CAA 1PKOA 2VN4A 4UQ3A 2FWOB 4HEME 4FLHA 2C7FA 2MQ0A 4WWKD 1S7XA 1FAIH 2PWEA 2BP0A 4U6TA 4EN3A 3V52L 2XKNA 1TJIH 3F04A 2Q8AL 3EO9L 1G6RB 4JFDD 6FABH 3Q2WA 3SE9H 4XBEH 3KWUA 4LCWE 4ATTA 2UZYA 3VFNA 1VFBB 2YD1A 3DO7B 3GGWA 1JBJA 2WWKT 3RI5K 1JZGA 4FLOA 1U42A 4JZNB 5IJDC 5DC2A 1BQRA 1YJDC 2AJSH 4I18B 1TTAA 2R9HC 4KXDA 4H0IA 2FLRT 2OMTA 4KHTH 1Z66A 3CFJB 3PP3H 1XF5A 4GIPD 3DX3A 2OP4H 5C0ND 1A8ZA 3NFNB 4K15A 4PRIB 4BINA 3TURA 1NBCA 5D8JL 1MQ8A 1E8XA 4M8VA 2HWZL 2NXYC 2ITCA 5FDWB 3RIAF 4F2MA 4FA6A 1DVFB 1JHLH 2VH5H 4APQC 3PGDB 5AVYB 4M7LH 4YSAA 5D1QB 3NRPA 1PLCA 2PPAA 1PY9A 3K72B 4ZSOE 2QKIC 1NKOA 4HC1A 2FEDC 2GKIA 4G7VH 4LGSB 1SYVA 1IGIL 2Z4QB 4R2GD 4ZMLA 2FHBA 5AOIA 3H42L 4TS6A 4Z7UB 1YEDA 2D3VA 1WLHA 4OV5B 2NY2D 4N0UE 4IYKA 1U95A 2J44A 2Y5EA 2YSTA 4JCMA 5D71H 4P4KC 4DN4H 3NIFB 1WD8A 4UTBL 3LAFA 5F8QC 3ZQXA 4XP6L 2A74B 4HKBB 4RA0C 4CN6A 3EH5B 1ZLUH 4AIZB 4LFHD 5LO7A 1HSBA 2F7PA 3QPXH 1IKOP 1YHPA 4JY6B 4DUXA 2HJKB 2IVFC