4AGPA

Structure of the p53 core domain mutant y220c bound to the stabilizing small molecule phikan5176
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
196
structure length
196
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Halogen-Enriched Fragment Libraries as Leads for Drug Rescue of Mutant P53.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4agpA00
5AOIA 4AGLA 3EXLA 3US1A 3WTTA 1H9DA 1GZHA 3WTUA 4L0YA 2IOIA 1IO4C 5G4NA 4LO9A 2AC0A 2RMNA 5G4OA 2BINA 2J21A 2XWRA 5KBDA 1T4WA 2GEQA 5LAPA 3TS8A 4LOEA 3D09A 1TSRA 4AGOA 2IOOA 4AGNA 3WTXA 4IJTA 2BIOA 2PCXA 2IOMA 2BIMA 3EXJA 2FEJA 1EANA 1HU8A 5G4MA 1LJMA 2OCJA 2XWCA 5AOJA 4IBUA 2X0WA 4IBVA 4AGMA 4A63A 1HJCA 1KZYA 4MZIA 1CO1A 1CMOA 5AOMA 1TUPA 3Q06A 1UOLA 5LGYA 4IBSA 2WGXA 1HJBC 3WTSA 2ATAA 5ECGA 3D08A 4XR8C 4GUOA 3WTVA 3VD1A 4AGQA 3Q05A 1E50A 3WTWA 2H1LM 1YCSA 2X0UA 3QYNA 2J1ZA 2J1YA 3D07A 3D06A 4GUQA 5BUAA 3IGLA 4QO1B 4L18A 2YBGA 4IBZA 4IBTA 3D05A 2J1XA 4IBYA 2J6WA 3KMDA 2ADYA 3ZMEA 2VUKA 3D0AA 1EAOA 3QYMA 3VD2A 2P52A 5AOKA 4L0ZA 1GZHC 5ABAA 3WTYA 4G83A 3IGKA 2X0VA 3Q01A 4MZRA 4IBQA 5AOLA 4G82A 5A7BA 2BIQA 4HJEA 2J1WA 2J20A 3WU1A 4AGPA 2MEJB 4LOFA 3KZ8A 4KVPA 2BIPA 2AHIA 3VD0A 3US0A 4IBWA 1EAQA 5AB9A
chains in the Genus database with same CATH superfamily
3VI3F 5E03A 4C47A 4RAVB 3KM1A 5B1JC 1HN1A 4QRRE 2WY3B 4J28A 4I5BA 5HYJD 2H3XC 1XDTT 4ZOBA 1CDIA 2XWZA 5EIVA 1H3TA 1YSOA 3QHFH 4PB9H 3S37H 2MMXA 3RG1C 3B7UX 3ESPA 1AR2A 4TQIA 4JUTA 1XEUA 2NZ9D 3LQMA 1F1GA 25C8H 3MJ7B 1B4RA 2APTA 1JGDA 1JMXA 3UJJH 1H3UA 4MJHA 4U6HB 4ENED 1NMAL 2QKIC 5DURD 5BOZG 1KJMA 2HRHA 4M56A 3FFCB 5CJOH 4PJAE 4IBUA 3RDTD 2B3IA 4XGZA 1CGXA 1E65A 3NZHL 4MQXD 5H2BB 3WV0A 2O5XH 4YZWA 2Y6SC 1XR8B 3QFDB 4F33B 1ZV5A 4BQ8A 3I84A 4B95C 1JZ7A 3P73B 1E4KC 5D1ZC 4YDJB 4RDBA 5E1GA 5IMKB 3EGSB 1FFOA 4PCYA 2PCFB 2WLMA 4MMYB 4XRCB 5FYKH 1PIGA 1CL7I 3ZO9A 1WYJA 4N24A 3UO1L 2I24N 3L5JA 2HT4C 5DUPH 3MU3A 1DEDA 3NMEA 3UDWA 1EXUA 2CG9X 4HS3B 4QHUB 3ZL4H 4ODTL 2FWUA 1J9SA 3DVGA 3HAEB 3UACA 3V6FB 2OJ1A 4HUVA 1AS6A 2GBTA 5E6UB 4ZUSA 4QJ5B 2Z92A 3C08H 1PY0A 3GRWH 3MVSA 4NO3A 4WGKA 4ZW6A 4I5BB 2D7TH 4FFYH 5H35A 3P0YL 2YAHA 5FA4A 2XIDA 1SXBA 4KVNL 3QYNA 4MKMA 1AR1C 1LWJA 3LEVL 2WLJA 4QOKD 3S7GA 1A3RL 1T6BX 2ITEA 3DSFL 1A25A 1JGDB 1FFQA 3LKNB 1IM3A 4NO5A 1KJMB 3C2AL 4HGWA 2SEBA 5FYKU 3UAFA 5SWQA 1A7NH 4RFOL 4K07A 2GT9B 1JTPA 3IM1A 3D52A 1D5XA 4NBYB 4XGZB 4P9HH 3FO2A 3GIZH 1OQOA 5GHWH 1TJIL 2QQLL 4YXHH 1H5BA 3AG1B 3NTCH 5I1HL 4DUVA 1L7TL 2PLTA 4EI6A 1FFOB 3PAZA 4JX0A 1JPST 3RIFF 1EXUB 3RBGA 3DVGB 3PIQA 2EXYD 2RQEA 1VZIA 2PR9A 5IV2A 4I7ZC 4ZUSB 3NACL 3Q2VA 4XPAH 3C6EA 4GT0A 1AFVL 2EKSA 4NO3B 1IC5H 1TJGH 1C7SA 2APWA 5H35B 1OOAA 3D25A 5FA4B 3WKMH 1WS7A 2UYLA 4QRAA 5B8CC 2NY6C 4Z1PA 4NRYA 2A74A 4OLUL 2HMIC 4PGBA 2F7OA 1JS4A 4LVHC 1DJSA 4LIQH 3WFDH 1QNZH 3V7MA 3NSDA 4PR5A 1G0YR 3L1OH 3INOA 2L4OA 3ZDXF 1MCFA 4D9QE 1IM3B 2Z4TA 1X4YA 5HVWA 4NO5B 5JXAH 3HRZC 1OE3A 4AGOA 4J3OH 3FU3A 4HGWB 2SEBB 4PLKD 4WENB 5SWQB 2ICEC 1D5XB 2JI1A 2J57A 4ZXBC 1D6VH 2AAAA 3FO2B 3A0OA 3BMWA 4N5ED 5BQ7A 1KACB 1ZOXA 1C8PA 1H5BB 5A6LA 3NRPA 4N0YH 4BWTA 1BSIA 3MOAH 3DX6A 4EI6B 2RIKA 2WUBL 2B1AL 2V5SA 1NA8A 3ZYOA 3ZKXC 1CI5A 1JNHA 1WZ1H 1JOIA 2VXVL 2JB5H 3H9SB 1QSEE 1XHHA 3PIQB 2P8LA 4DK5A 4F15C 5EEVA 1JGLH 1D9KB 1JXJA 5IV2B 2Q8BL 1XF2A 3MV9E 4ADJA 5SWSE 3G6JA 4OQ1A 4YSPA 2EKSB 2Z31C 5EZPA 2EEDA 1A6AA 2M8XA 2WOBA 2J88H 3D25B 4GUOA 4G8GE 2R7EA 1SLXA 2UYLB 3B5HA 4AE0A 4F5CA 4NRYB 3DBSA 2KZ1B 1G5AA 3E8UH 1RUPL 4PGBB 2V9QA 5LN4A 2YPVA 1A02N 3HNSL 5F70A 4PR5B 5KWYC 4R4BA 4N25A 2N59A 5BOPA 3QIWC 3BE1L 3BLBA 1S9KC 1GA2A 4FDWA 1H9VA 1EDQA 2WSKA 4OR1A 3RL2A 2Y1YA 1WEJL 1VCBC 1RUKL 2CIKA 1ZV9A 1BYPA 4M6MH 5I0ZA 4KVCL 2P24A 1KBKA 5HPOA 1F6AA 3PGFL 3Q0HA 4LP8A 1FPTH 1U8QA 4HIJA 4HJ0D 1UVQA 3C2SA 3LB6D 3DX6B 4XCCH 5EZOH 4FQCH 4S11A 2HZHA 2W9DH 5KJ4A 1JNHB 1NGQL 2YRPA 3WLWD 4IKNA 2UXTA 1DQML 3HUJA 2P8LB 2ZWKA 1WZMA 3NJKA 5FUZL 4Z76A 4XP9H 3GXNA 5JHDD 1XF2B 3I02A 3G6JB 2ZWSA 2VXQH 3QARA 3G9AB 2AHIA 4Q9BA 1A6AB 3ULUE 4HXBL 1BYNA 2R7EB 4GAFB 3DA0A 1EMTH 1L0PA 4MQSB 1THCA 5DC4B 1HE8A 2HT2C 3GMQA 4CKVX 4NZJA 4R4BB 2R83A 4FG6C 4JY4A 1SYVB 2GBAA 2H1PH 1XZWA 4GMTH 1S7WA 1V8HA 5D5ME 5D1QE 3RL2B 4P2QE 3B5TA 1M71A 2WKOA 2P24B 4KWUA 3WE1A 1AD0A 1F6AB 1OCCB 3T77A 4UAHA 4Q56A 1U8QB 1RIHL 4HIJB 5CSBA 1ZLSL 3TFBA 1UVQB 2F7PA 4X7SL 5LKNA 1IVTA 3PU7A 4Z0XA 2XPZA 4ODBD 3HUJB 3AQZA 4LP5A 2ZUUA 1NGYB 2KT6A 4ZMQA 4F2FA 1C12A 2AVGA 3I02B 4FF9A 4N6RA 4PJ6A 2WZPA 1JPSH 4ZNEA 2DMKA 5K33A 2FCBA 1JRHL 4N86A 4JFPB 5EU5A 1ACZA 3T3PE 4W9ZA 4BBWA 1E40A 4FABH 1B0RA 1EHNA 4GSQA 3RPIA 4UZUA 4OM0H 3O3EA 3ARGC 3ARUA 1Q9LA 4ANUA 2GC7C 3GMQB 4KKRA 4UZSA 4KZ0A 2RCSL 1XSKA 3EH1A 4M93B 4WK4B 1CZ8H 4JCMA 5HHXL 5ITFB 1S7WB 4L9DA 3LKOA 2AJUL 1CUOA 4G59C 4J3UA 5E4EB 1WAAA 4GP5B 2YGOA 4P46A 1M71B 1XGYH 1LGVA 5D7IF 3MUHL 2Z6FA 3QNXA 4F9LC 2DWXA 4XPFH 5IHZA 3T0VA 3KMDA 1AO7A 3T77B 1JTOA 4KK8D 4U1HB 3VFGH 5B3NA 5LO7A 3IWVA 2WCPA 4XVJL 1NM4A 2BRRL 2AXFA 2BP3A 4G7YL 4YSQA 4WFHD 2GABA 2WKLA 4Z0XB 5HDWA 3VXSE 1RK0A 2Y5EA 2GB2A 4NQQA 4HBQA 3HZKA 1C12B 4N6RB 5I26A 1TFHA 4U0RC 3QHZL 1T1XA 5EU5B 1SXCA 4JN2A 2I9TA 1ZT1A 2Z3FA 3UG3A 4ZOEA 4PB0H 1B0RB 3ARDC 2XFXA 5BMFL 3RPIB 3O3EB 4F8OA 1Q9LB 1IZJA 3EJYC 4PJ7E 3ZTDC 2ZUYA 4XTRC 3CLFL 3H4HA 4LPTA 5D55A 4NQTA 3LKOB 3JWNH 5LGHH 5KBLA 4LASH 1G7PA 1N12A 1WFJA 1RH8A 2DOCA 3D4GA 3JWOL 4P46B 4F9PC 5KBNC 4G3YH 1IM3D 1RKRA 1AY1H 1V7ML 2B2XH 5IHZB 1AO7B 1JPFB 2WLHA 5DLML 1M7IB 5ACZA 3HE6A 3IN0A 3U48A 5T3ZL 3MACH 4TLTA 5DMIH 5EO0A 2CO6A 3MLTA 5E2UH 2AXFB 3F7YA 3TNNA 1NDMA 5FWRA 3PREA 1B4JH 4JJHA 1RK0B 1NFDE 1QTPA 2D0HA 2X4RA 3ZE1E 4X4XB 3NABL 3HZKB 3OLGA 4GS7B 5AZEL 1BFVL 4A2FA 1F90H 3QUGA 4PG2A 3C5SA 1T1XB 3KW7A 3BSZL 3ZLQC 1RFDL 2VDPL 4JN2B 2I9TB 1ZT1B 2WGXA 2XVKA 2FYYA 1C5CH 4WCYL 1OPGL 2XFXB 3QJVB 2ZXDA 1MXGA 5AVXB 4P2RA 3OC5A 1QFHA 3EYQD 5DTFB 3I50H 3GGWA 4A04A 5CBAA 3S88H 1BGXH 5FCSH 1BP3B 3BKJL 4J4PA 1HZKA 3LN4A 5E2TH 5ENWA 4QLWA 4OF3A 5A6IA 1G7PB 1L0XA 4XVTH 2GIMA 3NQKA 2IBZX 2I26N 1SN5A 3MCKA 4BHUA 5L4FA 2A38A 4JJ5B 3VD5A 4P3CH 4DUWA 5AB2A 2P8PA 4WIQA 1CK0L 4RGMB 4PUBH 2C9AA 3EGDB 4HS8L 3BAJA 5ACZB 5J5EA 3HE6B 5EO0B 5KS9B 2DDQH 1GYVA 2CO6B 3MLTB 3ZMEA 1XQ4A 2DLTA 3F7YB 3TNNB 1Y18A 3KWVA 1LO2H 1NDMB 1SDAB 1XCWA 3UYPA 1F02I 4TF4A 2B20A 3MR9A 1EX0A 3PPSA 2VDLB 2IPTH 2X4RB 5D93B 1OZTG 2ZCKL 1BX2A 3BVUA 3T65A 2VZTA 2CNZA 1ZANL 5L4IA 2Y0SA 2PXYD 4XPHL 2EC8A 3C75A 3FNKA 4HJEA 4FNRA 2FYYB 4LEEA 5LJYH 2OQJA 4NPYB 2APBA 1CYXA 3GI9L 1EZLA 3BAYA 3FHQA 4P2RB 4YDVA 1F3JA 4GSXA 1CFMA 4A7QA 3AY4A 3AG2B 5CBAB 4Z7UA 2X4NA 2VMDA 1G9ML 3FQXA 3WFEH 2GJ6A 3EUUA 4XN1A 5F6IB 1SOXA 2QEJA 4G6MH 4QXWA 1CPUA 1A8JH 1KELL 3D30A 3AS3A 5JPNA 4MZ2A 2XCMC 1K6QH 4NWTH 5ANMA 3X12A 2PW1A 2XWRA 1NAML 2G4GA 4OCYH 4DP4X 1IX2A 4L9LA 5JIQA 3TURA 1UWGH 5CGTA 1CF8H 5EU3A 3QT2A 4PJCA 5C09A 2BFGA 1CDBA 2FHFA 2NY4B 1EXGA 1Y18B 4AL8L 1N4XH 1V10A 3QUMA 3RIAF 2BIIA 2P28B 3UYPB 2Y7QA 2OCJA 3MR9B 3GKWL 5DVNA 3IE4A 1CQYA 1I1AA 3T65B 2Q7AA 5HBBA 2IWEA 2D7OA 2B0SL 3U4AA 1A5FH 5CJXA 5ITBL 3ZUCA 3LIUA 5F1SA 5F3BA 3V4LA 4B96A 3NA9H 3P3UA 2H6PB 5CKAA 2EIBA 4YSAA 1XH3A 5IM7A 4E41A 3IJEA 2OQJB 2ORBL 4BA8A 4X5RA 2J55A 2UWEA 1C16B 2ODHA 4JLRA 4YDVB 4YMPA 4QLRA 2FIKA 3V8OA 2FJHA 3BT0A 2BERA 4U3HA 4M5ZH 4TUKL 1TCMA 4K5NA 2X4NB 2C9SA 4O2EA 2YPKA 3FQXB 2GJ6B 3CJJA 3MRGA 1KTJA 3K4ZA 5ICYA 2Q3ZA 3E1F1 1FHNA 3AADB 5F8QC 5EG6C 4OFKA 5JPNB 4NOBA 5ANMB 3X12B 3BX7C 5I15H 2PW1B 3A5VA 2HTLC 4N26A 4ELMA 5DO2C 1QFWI 3SSGA 4HYTB 4L9LB 1A1NA 5EU3B 5C09B 2NQDA 3ORJA 4MTMA 1HEJC 4ALAC 4NKOA 5GGVL 5IGXH 3QUMB 4KMLB 3TFKC 3DJTA 5KVFH 1R5VA 2Y7QB 2XTLA 3NIFE 2WQVA 2YOCA 4OZHF 1I1AB 2L3BA 1KYOJ 3FO9A 4G6AC 4FG0A 3EYOA 1HOCA 5F7MC 4XP5L 3RGHA 3RA7L 5F3BB 1EIBA 4BFIA 4FA6A 1L7IL 1XH3B 2ZSVA 1M6OA 5GISL 4YL4A 5IM7B 4E41B 3SBWA 4Q9QH 2WZPD 2UWEB 4BCYA 3QRGH 3S35L 4GQQA 3L3OA 4JLRB 5HP5A 1BMZA 4PVMA 2FIKB 3RAJH 3IMBA 1A4JA 2HXAA 2FJHB 4X6DE 5JR1H 3F84A 2RD0A 3VD0A 3BH4A 4UBDC 3A67H 5K9KA 1T22A 2EO7A 4AJVA 2WCGA 2YPKB 3P11H 4O2EB 1ZMYA 3MRGB 4HUKB 2UZIH 4ZSOB 4OUOA 3HEIB 2ZPKL 3U9WA 4W9EC 2BVUA 3IF1A 4UDUA 2AJYH 4JPSA 5F97E 4L3FA 4MLSA 2C9XA 1TXKA 2W88A 3QVAA 3T9WA 3MA9L 4KFMA 4ELMB 5J12C 4FA8A 3U4BL 1A1NB 4P46D 3NCJL 2VUYA 4O02H 1E4XH 1YNLL 2PYFA 4V1DA 1EERB 2JKJA 1O0VA 5J13B 2X6MA 5FHAH 3OAYH 1LP9B 4NKOB 2BOBA 1AO7D 2YOAA 5EEYA 4BINA 1AYRA 4YJZL 3T6VA 1R5VB 1R17A 2A9DA 2HX9A 5T5NF 2BFVL 4BUHA 4RA0C 1BOYA 5IFAL 1A14L 4NHCL 2XACC 3LYRA 4LOVA 3ML8A 5DA4A 3EYOB 3LZQA 1CLCA 1OAXL 1XH2A 2WAQA 1S9YA 4BFIB 3WNPA 3LRHA 4FNQA 1IQWH 2ZSVB 1M6OB 5JPMC 1NAMB 1FVDB 3DOIA 4Z7OB 2D8KA 3AREA 5DLLA 1JD9A 1B2WH 2Q20A 2PO6A 2NY1C 1WHPA 1A4JB 1MCPH 1A7OL 4XVSH 4XXWA 2R2BA 1U58B 4IOSA 2DWDA 5C0IB 5K9KB 1CI3M 5EOQL 1T22B 4FG4A 3ULVD 1YG9A 1LE5A 2VMCA 3DRTA 4RFNC 1XB3A 3LPWA 1WD9A 4OFDA 4Z78B 2BS8A 2H3KA 4E9WA 5JQ6L 3IF1B 2DJSA 4UDUB 5KJ7E 3VW3H 2DI9A 5JA9A 2VAAA 5I73B 2QLYA 2WJ5A 4MQTB 3ULAB 3OM3B 1YAIA 1DJWA 5GZOA 1F8TL 3ECVA 2AMUA 3CFNA 3UZEC 4AMXA 4V1DB 1QG3A 4XBGA 5AVWB 9CGTA 3PHOB 4LLVA 2BOBB 2D03L 3JTSB 4Z7NF 3ZTJG 4NGHH 3HE6D 4GAGL 4N0CC 2FGWL 2CRIA 2VYRE 3IVKA 1T7ZA 4NJAH 3O11A 4JFEA 2DBJA 4AV0A 1L9PA 1UD4A 1Q0XL 5B22A 3VSTA 3I2CH 2I7SA 4DEPB 2X0VA 3V6BR 3AREB 5AYTA 3GLDA 4OLEA 3MLRH 3QUYC 4E9QA 1NH6A 4ZPVA 2YD0A 3B8YA 3QPXH 1Z9NA 2DWDB 4UT7L 3PDOA 4FQ1L 1GZQA 4Y8DC 5HD8D 4PBWD 3T5WA 3ZQ9A 1SJEA 2X44D 3IEAA 4P2RD 3KZ8A 3GXIA 3DRTB 5DD6A 3LVEA 1AHWA 5SX4H 3U9PL 3EXLA 5DI8A 1GGCH 4XMLL 4L8BA 1J8SA 5FB8A 4J4PD 1EAPA 1IBZA 2VAAB 3D87B 4AV4A 1F0LA 4PBXA 1R19A 5AAWC 4XBGB 3VE0A 4S1SL 4FFZL 4LLVB 1IV8A 3MJGX 2P5WE 1SOKA 4FLQA 1U8MA 4JZJA 3IVKB 1F3RB 4JFEB 1ADQH 2NY4D 5LBSH 3ATBA 4ZMXA 4EUPA 1I7RA 2NNFA 4LFHG 4OIIL 3RNQA 4LOUD 5GGRY 1YEDA 3TJHD 4WKXA 2HRGA 3A4DA 1INDH 3MXVH 2UXVA 3KPRE 1N7MH 1WFTA 4BQ9A 3TTSA 3U7YH 4Y0GA 2R51A 1H19A 1Z3GH 3T4YA 1AZCA 3FK3A 2DL9A 5E99L 1OALA 5KTEH 3TBVA 5KANI 2QZQA 1U8HA 4QPEA 4ZPVB 5FYJL 3N42B 2UY6A 3NK4A 1QBAA 1E6OL 4I1RA 4WHYH 3PDOB 5I71B 1GZQB 3RZCA 1G94A 1SJEB 4Y2LA 5DD6B 1AHWB 1MQ8A 1CGSL 5D71L 4CN6A 3J07A 4A67A 4G43A 5DI8B 2R1YB 5A43C 2HG5A 4B5EA 5I75C 4L8BB 3WENA 2FJSA 5I5JA 1XBDA 5FB8B 5K9OA 3TO2A 1EAPB 2GJ6D 2Z9TA 5C92A 5JYMA 3D3VD 4JK0D 4DUXA 5KSBE 1IAOA 3NSJA 2VM3A 3PWJA 3GO1H 2C4FT 3VE0B 3NVQA 4PG9A 3KEHA 4MAUH 3RKDC 1ZK5A 3BN9D 1U8MB 4JZJB 5C09D 4U1GB 1ZLDA 1KF9B 2ZUQC 5C0ND 1GOFA 2O5YL 3WUZA 4H8QA 4EUPB 1I7RB 3DO4A 4PV8A 1KIUB 3ERXA 3RNQB 3P4NA 4X6CE 3KLSA 1YEDB 1EAOA 3HMXL 5DVOA 2MFNA 4GAYA 1KG0A 2XTJC 4F80A 3FQTA 4MWFA 4L0ZA 3VGBA 1I1AD 2BJMH 2V37A 3VMNA 4P23C 3T4YB 2AGJL 3TBVB 4PRIA 3FBQA 1FAIH 1NKGA 5FGBC 3MLUH 1RP8A 1IGFL 5DD1H 3UROR 3EFDH 1U8HB 4BJLA 4FFZA 1CTOA 2UY6B 1CD1B 4KJWD 2OFQA 2ESVA 3CSPA 5DZLA 3RZCB 1OLLA 2YGPA 3I6LE 3IMUA 2MSPA 3VSQA 1NMCB 3CFUA 1MW3A 1RZJL 1UQSA 2I25N 1O6SA 2HG5B 3RTQA 4X5PA 4GBXC 5L2JA 1F41A 3E9UA 2IQ9H 4PJXA 1NCGA 3BAIA 5K9OB 4X6EA 3TO2B 4BFGA 1F4XH 2FB4L 5E5LA 1JZIA 4KZEL 2APSA 5GQBA 1IAOB 3CXDH 3DV6A 4ODUA 3PWJB 5BO1H 1IQDA 2PCYA 3AUWB 3C6LA 2CNYA 4N68A 4Z18A 2OMNA 4YEEA 4JZOB 4PG9B 1WWBX 3M7OA 3V4VL 2DQCL 4WDIB 2A9ML 1DANT 1M1XB 1OF2A 5KOMC 5HDBB 5F89A 1N3NA 4HUUB 1MCOL 1OAUL 2WVTA 5HGBA 2WUCH 4TLKA 4PV8B 4XB3A 5CWSA 4ZX5A 1D5RA 3BKYH 3TEXA 3P4NB 1BXAA 5I24A 2Y25A 1R4XA 4OCLC 5JW4N 4GAYB 4GW1A 2GEEA 1PDKB 3QAZB 3S5LA 3FQTB 4MWFB 1SEQL 4IDJH 3SQOL 3GSNL 3V55A 2NY5L 3BUDA 1DLHA 3HZ3A 4R8WL 1USQA 4PRIB 4A63A 3FJTA 4OCXH 4C56E 1TEYA 4MZIA 4NWUH 2GTZA 3WHE1 4M1GH 1QP1A 1MCHA 3TV3L 4OZIE 2BY3A 3IFOA 2ESVB 1AZRA 4MYWB 1HYSD 2IEPA 3DHMA 1DL7H 1SF3A 1WZAA 4LHUG 1D2PA 1YPZF 2GTQA 1UQSB 4N2IA 1O6SB 4JRLA 4WWID 4X4ME 5FGCB 3HMXA 3RTQB 4PJXB 3B43A 4AG4H 5L2JB 2OZ4A 4DVRH 4I89A 2ICWI 4PP2A 4I2XE 4KUZL 4X6EB 4XBEH 1T5XA 4GXUM 1I8LA 4ODUB 3UIYA 4U3XA 1NFIA 1IQDB 1UOKA 3C6LB 2L7JA 4FLHA 5IF0A 3Q2NA 1EEYA 3GIVB 5EN3A 5DRXA 5DVLA 1DBBH 2J1YA 2B15A 4LE8A 1OF2B 4GUPB 5F89B 3N44B 1N3NB 4JRYB 5HGBB 3ZTCC 4OQTA 2WVUA 3KEDA 5CWSB 1KNOA 5DEGA 1NBYA 2PABA 2EKJA 2IGFL 4H88H 2QLVB 4GW1B 1ODUA 4IHOA 3WFZA 1LLAA 4J6RH 1AIZA 1OY3B 2B3RA 3H8NA 5AW9B 3S5LB 5JOFA 3JSSA 5T1LB 2VH5H 2VZOA 4D0BB 5CZRA 4Q6IA 1D7CA 4D9RD 4BSVA 1EBPA 2CJ3A 4AQOA 5F7YC 1JHKH 3VI3E 2C4XA 2F58H 4H5SA 4P3DA 3NGBC 3IFOB 1BEYH 3V4VA 3ARED 3ESUF 4B7IA 1ZHLA 3O8XD 2X5PA 4MD0A 2PO6D 5D7JA 3SDXA 3IDJA 4OZFA 5FECA 4IOSD 1GH7A 1IGYA 3HNVL 3SJVD 1V5JA 4S2SA 1QBBA 4PP2B 3US9A 4MA1B 2OMUA 1T5XB 4GRLC 3US1A 1USZA 2OR8A 1NFIB 2PWDA 1X4ZA 4DPCX 2N1KA 1PPIA 5IF0B 3WJJC 3WFCH 2M26A 1EEYB 1FH2A 5DRXB 1WIUA 1QLRB 2J73A 1T5KA 3VGAC 5GZOD 5D72L 5DUMH 2Y4SA 3M1CA 3X3GL 4AE1A 3IFNL 3JWNE 4YC2B 3S48A 1KNOB 3FHEA 1NBYB 5DEGB 1QUPA 2XXCB 5LAPA 4IHOB 4JFED 4K3EH 2XX0A 4HIHA 5CR8A 5FS5A 1JERA 4Q6IB 4H8UA 1SDDB 4UNIA 4BSVB 4KK6D 5J1AA 3NJHA 2ZYRA 3LNEA 3K2UL 4Y9FA 4H5SB 4P3DB 3UTZA 3F58L 5HI3D 1YJDL 1L9MA 3TPKA 4M7LT 4Y16C 3V4VB 4PJHA 2V3DA 4HWNA 5EU6A 5TDOA 1OTUC 4YFLF 5E1QA 2GSIA 3P1VA 2C3XA 4MD0B 5D7JB 3SDXB 2PTUA 3IDJB 2XG4A 3GD1C 3FTVA 1KC5L 4OZFB 4EI5C 1RQ5A 4F3FA 1G6VK 2VN6A 3CC1A 2XXMB 1IGYB 4YVUA 5EDXA 4DKDC 1F1AA 4UOZA 3VSUA 4N90E 4S2SB 3ZTEA 1Q94A 4DN4H 1A6ZA 4LARL 2OMUB 1IRAY 4LCCC 4UTAH 1KOAA 4PLNC 3K6FA 2EABA 2C4FU 1UB6A 1OT2A 2W9EH 1QBLL 1O5PA 3MBXH 1JCVA 3O81A 1BG9A 1NMBL 2ERJB 1RZFH 3KPQA 4IMKA 5D7KE 1KTDA 1DHKA 2OS7A 2XJKA 1BBDL 1U8PB 2VDKH 5GJSH 2IANA 5DCCA 4ONFH 3HG5A 4TNFA 1S5IH 1J48A 4U1JA 3CFCL 4HIHB 2HKFL 3BPNB 5MHSE 1PG7W 3WY2A 4Y7MA 2F18A 1DSFL 4CAGA 5J1AB 3UADA 3UTZB 4BZ2L 5B7MA 1H8SA 3ABLB 4F8PA 1UHVA 4IIQA 2Y69B 3CVHH 1MFEL 4UMSA 4PJHB 4ZQTA 2BK8A 4KZCA 5EU6B 1U92A 4OSUL 5TDOB 2AZAA 3PWPE 5AZUA 2GSIB 1N0XL 3CPLA 1BQLH 2XG4B 1LEGA 4F3FB 3VXTA 5F7BA 3DGCR 3RZCD 4AJYV 3EZ8A 3L08A 1Q94B 1ETB1 2VZUA 1IFGA 2JJTA 2WYZA 1A6ZB 3FU0A 5IB4A 4BRJA 3R0MA 3ZDXE 1LK3H 2H26A 3OAYK 3U36A 3IMTA 3KJ4C 2NCMA 4C83A 5BV7C 1UB6B 3P54A 4ZW5A 5JIDA 1PSKL 1B9KA 2E6PA 3KPQB 1KYUA 4H20L 1DANU 1KTDB 2QQNL 2XTJE 3RL1A 1QLEH 3Q2WA 4KKQA 2WQ8A 4FYQA 5SWZA 1B0IA 4MMXC 2IANB 3KGUA 1JZ8A 3D0LA 3ILQD 5I1GL 1HHJA 1GAFL 5E6SB 2KMWA 4I13B 4XT1C 4OJFH 4F2MA 2YEVB 4U1JB 3VU2A 4MX7A 1OAKL 3QQ9D 2Z0UA 5CIPH 3ZDZB 4AKQA 4ZI8A 1T21A 4MS6A 1IBGL 4JHAH 1QBMH 5GS3A 1T2XA 4UI2A 3M88A 4BQBA 4IIQB 1OARL 5AW0B 3CZUB 1U3HA 2XIIA 4HZ1A 4PRID 2WO4A 2E3VA 4IYKA 4BZ1H 5CLYA 2HPTA 4XMVA 1ZIAA 3ZVVA 2G9KA 3CPLB 2ZF9A 4B9ZA 5C0EA 3N5AA 2VDQH 1LEGB 2VRKA 1P4LA 2ESVD 1KBGL 4ONGH 4PLJD 3IE9A 5IB4B 2CKBH 3LZFL 2VLJA 2H26B 3FHAA 3H56A 3U36B 1NLDH 4KI5D 4N2CA 1EZVY 3RTQD 5LWYL 4C83B 1MREL 1A66A 8PAZA 2VE6A 3I74A 1U8IA 2BDNL 2EIJB 3GXDA 3T71A 1BVOA 4GKOA 3WJLC 2OP4H 2B4CH 3PP4L 4BZ2A 4HWEH 3CDFA 3RL1B 2O6PA 5BS0E 3CFTA 1DO6A 2Z4QA 3C6LD 1HILA 3C87A 5IFJB 5SWZB 1FLTX 1KJ2H 3SO3B 3RJOA 3QI9C 5C0CA 1SJXA 5IEKA 2D3JA 4LSTL 3D0LB 1K8DB 4RSYA 1IGMH 5B39G 2H0JA 1L9QA 5FYLE 1KXHA 4F2MB 1UH4A 5EH1A 3V6OA 1XCQA 1ZKAA 1FE8H 4MX7B 1T4KA 3K8LA 1T21B 4HEMA 4YHIA 4GINA 2H45A 4M7ZB 2ZOLA 4TPRL 5HI5D 5KVFE 3AM8C 3S36L 1U3HB 4H0IA 4LRNH 4AIZA 1D5ZA 4LQFH 5EIIA 4WSGA 5C0EB 2YQGA 4MYPA 3FZUC 1AH1A 4FJZA 1P4LB 2DIAA 3DBXA 3OHMB 1LVEA 4M7LH 5MI0B 4R2GB 4AMWA 5C07E 2QVKA 3RU8H 3EF7A 2VLJB 3GUFA 4AQAA 4AJ0A 3EJZD 4FQJL 1U2HA 4DNLA 2VE6B 5FR3A 1U8IB 5TFSH 2CDFA 3JWNG 4QRRA 4UIKH 4N87A 4Q9RL 3ME0A 5FDYA 2Z4QB 3ARFC 3DX0A 2G0KA 4RGOH 3SKJL 1HILB 2X9XA 3GLZA 3LNGA 3DX9A 5C0CB 5KYUA 1JK9A 1X4XA 4KXBA 4X9YA 5IEKB 3E8VA 3ZDYB 3I9IA 3ZW3A 2WLKA 5ILTH 2OBGA 4R4FH 4EIUA 1XCQB 1NAKL 4MNHB 1T4KB 2G5UA 1Q0YH 2H2SC 3B4NA 3BDYL 5JMRA 1J10A 5ELIA 3RVWC 3GBEA 2I60H 2Y3AA 3MRFA 2NQCA 1WS8A 2R4SH 4YHIB 1J5IA 3VO0A 3WO4B 4WWKC 1FRGH 1JYNA 1MG3C 2JVUA 4H8HA 2D3LA 5EIIB 4AIZB 1D5ZB 3N41B 2DY2A 1RUQH 1I8IA 2CU9A 3G5ZA 1JI1A 3VQ1C 4LKXB 3WN6A 1RZ7L 2XQYK 5JOPE 2DQIL 3DBXB 3UTPD 3KL0A 3DHPA 4PJGA 3KDPB 5ISZA 1BOGB 4PY7A 5D7JD 4Y5XC 4JHUA 3OZ9L 4BK8A 2X87A 4HUNB 3JVGC 3WO3B 4AQAB 5DQDL 4E9LA 2GSMB 4PVBA 5B3SB 2CDFB 5FHBH 5JUEL 4QRRB 2XY2A 5D7IE 4WTQA 3G6JF 1ZTXE 3ME0B 4B9KC 1S9VA 5JW5B 4IRSD 2X1QA 3DX9B 3UBXI 5KYUB 1JK9B 5J06A 3CMOH 2QMKA 3T4AA 2BHFA 4ZPTB 2V9RA 4GI6A 4EN3A 2YWZA 5TGBB 1XXFC 1E4XI 2HFGL 4FQIL 3K6IA 3UL4A 5KG9A 4WRLA 4G5ZL 2AK1L 5KBMA 2AJSH 2VO8A 3LQAH 3K6OA 4X83A 3TT1H 3DGGA 1VFUA 5IP4A 3QR2A 5I66A 5FDWA 3QPQD 1TZIA 5F9OL 1I85A 4OY9A 1I8IB 3G5ZB 2BHYA 3RIAK 5DHDA 1U4EA 5EU6D 2VMFA 3N1MC 4OLVL 4PJGB 5ISZB 4PY7B 1FO0A 3VXME 5CFAA 5CZVL 4KQ4L 1GC1H 2VWEC 4K3DL 1YLBB 4Y4FA 4O58H 1SYSA 3EGXA 3HUJF 4Q9CA 4X4YA 3BGFB 4GAJH 2CLZA 3V52H 2WBWB 3LDBC 2YSTA 2VJ8A 5AKTA 1JVKA 5J6GA 4YL9A 1IC7H 3C8DA 4YDNA 5ICXA 3RFZC 3OPZH 4HBCH 3A6CL 3MRIA 3VXRD 1FVEA 5ETUA 1DVUA 3T4AB 1I4FA 3U7AA 4EQ3A 2V3FA 4I3SH 3HMWL 4I8DA 1XAUA 1WO2A 5HI4C 4EN3B 3MX0A 2IAND 5KG9B 3HZMA 2EH7L 2J5WA 5EPMA 1DTUA 2A3TA 2C3VA 5KBDA 1Q1JH 3ABGA 1GS8A 1UKSA 5I66B 5FDWB 1ZLUH 1CFVH 1DVYA 4J3VA 4NQCB 2N0MA 2YRLA 4AM0Q 5D70H 2AQNA 1TZIB 3IB4A 2WKOF 3H42H 2X12A 2JB6A 1XIWA 4X80H 3HIZA 3ZQWA 3VCLA 3A6BH 5F7WC 3B56A 4R97B 2H3NA 1I7TA 4NI6A 1RXLA 4Q8BA 4XCFH 2APXA 3QG6A 1SQ2N 2CGRL 2KLTA 1LO4L 2NY3B 3TEUA 1QSEA 5J11B 3HW7A 3V0WH 4Y4FB 1AC0A 1SYSB 1ED3A 3EGXB 4QAWA 2DMHA 1KLGA 3VXNA 4X4YB 2CLZB 3HBQA 4GI9A 2A77H 1IMHC 3MV9A 3TNMA 5SWSA 2R8SH 5HYIA 2RH0A 4MXWH 1DR9A 5ICXB 2GY5A 2IAMA 2VN4A 5EBGA 2O6DA 2W95A 3O0RH 4PPTA 1UD5A 3FRUA 3MRIB 2I69A 5ETUB 3N85L 2FSDA 1I4FB 1VEPA 4XX1E 4BGDA 4KTDH 5E9DE 5C0BB 3NIDB 5BRPA 5SWZD 3MX0B 3SGEH 2J8OA 1RK1B 3MKKA 3HZMB 3QORA 4FP8H 2AK4E 3QDJE 1MVUA 3CSTA 2PR4H 3QFGA 1QW9A 3OBAA 2EIZA 4X9GA 5EPMB 1MRCH 2A6IA 1DBJH 4GB9A 1TZOA 2JIXB 3P9MA 2C3VB 3IKCA 2FBOJ 4HQQH 2VOTA 1A64A 2NMSA 3O6LL 5HHVH 5KW9H 1OL0A 1WAAF 5EUOF 1TTAA 4NQED 4FERA 3U0WL 4HOWA 4AUUA 3LRSA 2JB6B 1XIWB 2YBRA 3VCLB 1IIKA 3WGVB 1D3CA 2QFRA 1TJMA 2H3NB 1H3GA 2GHWB 1I7TB 5D9SA 1U3HD 4XO4A 1R9FA 4Z6AT 2Y6TE 5DVKA 4UTBA 3QG6B 1I9EA 3MCLL 2AF2A 3IFPA 1QSEB 4EO5A 2JCWA 3FTGA 1T7YA 1ED3B 4JFZL 2FZ3A 1KLGB 3VXNB 2I32A 4R2GD 3MV9B 3TNMB 5SWSB 1QFUH 3P3SA 2V4LA 3BH9A 2QADB 2VLJD 4IM8A 1UD8A 2W5PA 2YGNA 4POZC 1KEML 1NIEA 3FRUB 4N1CA 5AB0A 2CD0A 2WTPA 3GNML 3IAGC 3AC0A 3ULVF 3DJZA 5CUSH 4H8VA 4KY1L 3V7AE 1ZA3B 3QORB 5C0CD 1VFBA 5A16A 1MVUB 3FB8A 1W0WA 4I3RH 3UZQB 1CDJA 2EIZB 3JUYA 2A6IB 4XPBH 3P9MB 1INEH 3IKCB 4L8DA 5HY9A 5D5MA 5D1QA 4BFBD 4P2QA 1CBVL 4FZEL 2XU9A 5L9DH 4JE0A 4W4OC 1K72A 3HPLA 3LRSB 4XHQA 4ZTOL 3IPEA 2YBRB 2ADJA 1MJ7H 5D9SB 2B4CC 4HIPA 5KS9F 4ENEC 4BFJA 2VSMB 1XV8A 4OFQA 2OXHA 2VZ1A 2XXFA 4LHJB 4P4KC 3T0XA 3IU4L 2NLJA 1KEGH 5DUBB 5GS1C 3FTGB 2COQA 2WZAA 2FZ3B 4JDZA 1HFUA 1MFBH 3SDYH 1E5YA 3KPLA 3QR0A 4YHLL 3W11C 2FR4A 4LEBA 4N9GA 4J1UA 1YN7A 1SHWA 1IVLA 2CHWA 1SZNA 4HWBH 2QKIA 4FQ2L 4QRRD 5I74C 4LSUL 1XAKA 1OTSD 4GSUA 3RUGB 2IPKA 5CKGA 2WW8A 4PRDA 3V9FA 2XYCA 3CU1A 5A16B 3FB8B 1W0WB 3ZTNL 5DFWH 3GJEA 3BWAA 4OZHE 2E8ZA 1OZUA 2WTRA 1E4KA 3B9VA 4L8DB 5D1ZA 5D5MB 5HY9B 5KN5A 2WWNA 5EF0A 4WW2C 1IL1A 3IGLA 2H5UA 3HPLB 1GPOL 1R5WA 3PCYA 1PS3A 3RVXD 5T3XE 1INQA 3L3GA 2FEEI 5DJXA 1KTLA 5I8CA 1TQBC 1NMAH 2GJRA 4RWYL 4UILL 3CK0L 1OPOA 4QHKI 3BXNA 2OXHB 3K80A 4YO0B 2F5BL 3M45A 2NLJB 4HLZH 2A6DA 1ZGLP 3NZHH 4JDZB 4NO0A 1FGVL 2IALA 1A1OB 5ISZD 2W65A 1E9PA 5C6PB 4G82A 3KPLB 3V0GA 5CHNB 2FR4B 3M7FB 2BNUA 4N9GB 4J1UB 1UWYA 5IJDC 3U7WL 1NUFA 1YN7B 4JE4B 2PP9A 4BCZA 3ETBF 3UO1H 1UH3A 1UACH 2QKIB 2EO9A 5HDRA 4YPJA 2K9UA 1WITA 3EDEA 5FUOH 3CHPA 2IPKB 3US0A 4GEJA 1JBJA 3FTZA 1WFMA 4P04A 3A24A 3GJEB 3BWAB 3ASOB 3P0YH 2WTRB 3QXDA 5D1ZB 4EN3D 5KN5B 5FOJA 4UDTA 3WMSA 3T3MB 1I82A 1W0YT 1IL1B 4DPAX 4A39A 5D7LA 3LEVH 4PRHA 1R5WB 5ALCL 2OJZL 2VWEE 1INQB 3L3GB 3TC9A 1A3RH 5DJXB 1KTLB 1RJLA 5I8CB 3BP7A 4JG9A 4Q14A 2C3WA 3DETC 5HDLA 4OJDH 2Q8AL 2DQ6A 3C2AH 3BXNB 3QC6X 4R4NC 5HYQA 5F96L 4RFOH 1EK3A 1CLYL 1NFDA 1TT6A 4WHYG 1IGTB 2A6DB 5B8CA 4NO0B 4OCNC 2X2JA 1AR1B 2QQLH 2W65B 1E9PB 3S6CA 2BPBA 5I1HH 1L7TH 3Q7JA 4Y4FD 2BNUB 5HGGS 2YPVH 3SE9L 5KVDH 1JF1A 4KHXH 5EU7C 3KWUA 4N85A 2XQYG 5ANHA 2R69A 3HRZA 3L4WA 2UWEF 2ICEA 2XXGA 5FV2A 1QSFE 3QDHA 3LHAA 4Z7NE 8FABA 4ZXBA 3NACH 3FQNB 4MS8C 2BCMA 2EDWA 4J3WA 4M7KL 1OK0A 3QXDB 3BQUC 1XL6A 4UDTB 2EAEA 1V3KA 3N1QC 4Y7OC 4BE6A 4D9QD 2AXWA 2VCOA 1QZ1A 5D7LB 4TSBL 4PRHB 3K3QA 4MJ5A 3SYQA 3S3JA 1HHGA 5CP3A 5IW3A 4ELMF 1EVUA 2G2NA 3LKRA 5L0QC 3QUHA 4XN4A 1RJLB 5IVOA 3BP7B 4ATTA 4GQZA 4ZMOA 1XIWD 3OL2A 1JWSA 3LH2L 3PWVA 5TDNA 1LP9F 4AXWB 4A2DA 5HYQB 1PMYA 3R19A 1IEAB 1NFDB 1ZPLA 3MRBB 3T1FA 3ZE1B 5B8CB 2NY6B 1XF4A 1WBZA 1IAIL 4EIZC 3CVIH 1F4WL 1ZIBA 2J12B 3ARRA 1QHQA 1PTZA 4LPVA 1CS6A 2MTPA 4LVHB 1QSED 2EXWC 2UX7A 1IC4H 3WELA 2B1AH 1T2JA 1JF1B 3H3KA 4ZRGA 2A2QT 3MV9D 3QIWA 5SWSD 3ELAT 4L5FL 5GZNA 2NZIA 3V7AG 2VXVH 2XZAH 3FF7A 4Z7OF 2J20A 3L3HA 2IAMD 4X8JA 3WY1A 2ODIA 3IDYB 4W9IC 1MEXL 3EH5B 3P9WB 3QUXC 4LOFA 3BZDA 4NKDA 2Q8BH 3WKPA 8FABB 4YHZL 4CVUA 4JHWH 1UXMA 1MI5E 3ZY7A 3KYNA 3MV7E 2LLLA 2X9YA 2NNRA 5AOZA 5C3IA 4XNUL 5GSVA 3QORD 4FS0A 4LLYA 2NUPA 1DFBL 1M7DB 1VGEL 2F53E 3ILPA 3T8VA 1AG6A 1RUPH 3ZKXB 1MRFH 5C7XL 3Q43A 2WHVA 4MJ5B 1HHGB 3MBEC 2RMNA 4F15B 5HHQB 2QVIA 3BSHA 3LKRB 3MLPA 3BUBA 2V9TA 3BE1H 2N01B 5DT1H 1G9NC 3PJSA 3PWVB 1JWSB 2DB8A 2XZQH 4HEPA 4JFVA 4LSVH 1WEJH 4N2OA 5TDNB 1VIWA 1CE1H 3N43B 1N68A 2X3CA 3T1FB 4DGIL 1XF4B 1WBZB 4DQOL 1AGCA 4L1SA 1RK7A 5J3HC 4YSUA 1N6QL 4K7PL 4XWGL 1FLRL 4FXTA 4PV1C 3P4OA 4ENZA 4B0MB 3QIWB 3B34A 5TE6L 3OQRA 1XF5A 1SMOA 2BSTA 3L48A 5HGDA 3L3HB 4X8JB 5FUZH 1MZYA 3QQ3A 4NKDB 4K3HA 4Y8AA 1JNNL 4Z7WA 3KYNB 4FQHA 4HXBH 1J8HE 4PYGA 5F9DC 4WI4A 5GSVB 1T7XA 1DFXA 4LLYB 4HJJH 2NUPB 3ILPB 3QA3A 4XAKE 3Q05A 5D7EA 4NN5C 2A4ZA 5D1QD 4XNDA 4P2QD 4QTIH 4RISL 1CD8A 4LLWA 2EE3A 5A3ID 5IHLB 2XA3A 5LUMA 1V3JA 4APXA 1P53A 3PJSB 3FL7A 1XF3A 3DUSA 5EZIH 1XSJA 3EO9L 5DRNA 3VA6A 1QATA 4PHXA 3HKZA 4AYID 5EEWA 1NCWL 4ZS7H 3RHWF 1HQ4A 4NAQA 1AGCB 4QRBA 1FCCA 3LKPA 3ARGA 2EIKB 1ZLSH 2DQDL 2DIEA 3ULVH 4JO2L 2IF7A 3ML9A 2F5AL 2HJLA 3GJFA 1CC3A 2Y36L 5T5NG 2BSTB 5HGDB 3U46A 4B9CA 2IDQA 4HF5L 3K0WA 3T0EC 4PRPE 4X6DA 3QQ3B 4F9LA 1DE4A 1P4IH 4PEEA 4QUOA 1S5HA 4GOSA 2IFFL 4Z7WB 4R5XA 4FQHB 1ZLUK 3PNWA 1RZKC 3QA3B 3BWZA 3ISWA 3T2PA 4TQ8A 2Q5BA 3KL3A 5D1ZD 2DQMA 4KNQA 3KWXA 4LAQL 3NJIA 4LLWB 2VN7A 1SJMA 2VDLH 4NJ9L 2HT4D 5AVSB 4APXB 2H8PA 5HHXH 3KPSA 4EDXA 1XF3B 3DUSB 1SHXA 2XT1B 2G4EA 3MNVA 1HQ4B 3ZKMD 3F7LA 1UXWA 3BUPA 3ARDA 1J9RA 1OGSA 5J89A 4TLSA 3LKPB 3ARGB 1BYOA 4B9YA 4NO0D 1P7QA 2BRRH 4G7YH 4YXLH 1QPXA 1AR1D 2XFGB 3LS5H 2IJ0C 1KGCE 4KMTL 5C0DA 2HJLB 1B3JA 4AX3A 1CO1A 3GJFB 5IROC 1EBAA 1DBAH 3I3DA 3SY6A 3U46B 4F9PA 4PTUA 4A6YA 3VFTA 3CSGA 5DJDA 2R0KL 3SODB 1J5HA 1S7VA 3L5XL 5IHBA 1S5HB 3QZMA 2W9LA 2MPAL 3S3DB 2HX7A 2JCCE 3NPSC 2BMKA 3ZT7A 4Y1SA 2RFXA 4OCMC 3WAKA 3PNWB 1D9KC 2IH9A 3M8OL 1NKRA 3P30H 5BMFH 1Z9OA 3FFDA 3Q9PA 4LHUA 3FO0L 5E08L 1ZGLA 3HNTH 3EYFA 4AGQA 3GZOA 3D2UA 3NRFA 3CLFH 2V8MA 1P6AB 3WMQA 3FFOA 5D7LD 1HCZA 3KPSB 3D07A 4EDXB 15C8L 5G5DA 4DPBX 3JWOH 1ZS2A 4JL1A 2QL1A 4M7JL 3NDZE 5EU7E 4CN4A 3G5VA 1P5UC 3S3PA 5HDBF 3MNWA 1UXWB 4TULH 3ARDB 4RMSA 2EIMB 4U05A 3O4OC 5DLMH 1FH5H 2VB5A 1UJTA 2C3GA 5T3ZH 3RWIA 2V3EA 5CR1A 3UIZA 5I1KL 2R4RH 4IJ3C 2NY6D 4MA8H 1P7QB 4UT9L 2Z34A 2HMID 4GO6B 1TNMA 5ABAA 2HWZL 2L0DA 5C0DB 1HXMA 4CNIB 4PTUB 4A6YB 1MJ8H 1S78C 3OG4B 5DJDB 3NABH 1ZA6B 1S7VB 5AZEH 3AGVA 1EAJA 3B8SA 2AEOA 2BMKB 1RFDH 5K1NA 2RFXB 4QGTA 3X11A 4WCYH 2XDHA 1VF5C 2MNWA 4ZXBD 4WV1B 2JF1A 1OPGH 1MCKA 4W4NA 4DZ8A 5AW1B 3FFDB 4PJXF 1ZGLB 5D96C 5F3FA 3QUMH 3EYFB 3D2UB 4H4NA 1VHPA 3K81A 5ECJE 1A7PH 1AD9A 2ISDA 4AH2A 3LS4L 5EU4A 1HL9A 3KXFA 4JO1L 3BKJH 4FA7B 2VLRA 4ZBJA 1PYWA 4XOCA 3T09A 2YLHA 5G5DB 2P5WA 3QO0A 1UYWL 2NXYC 2ETWA 3G5VB 1L9TA 1KGIA 4JG1L 3N44F 3ZZQA 3MNWB 3AMKA 1CK0H 4HS8H 1U8KB 2AP2A 5DGQA 3RWIB 3Q6FA 5GRVK 3L4CA 3WKYA 1FL3B 1O9VA 1KGWA 3H0TA 2FE0A 2YMTA 2ZCKH 4X9BA 2FEDC 3QIWD 5BNXD 5TF0A 5LVEA 1F56A 2ZNWA 4CVWA 4XPHH 2B1HL 1U91A 2YA1A 4JUSA 4N1HB 1EDYA 4TNWK 3V8CA 1YNTA 4UOW1 3GI9H 4DZ8B 3L3JA 3OKLA 4E0RA 1QW8A 2XBTA 3WIAA 5LAXA 2Q3AA 3CLEL 4AH2B 1AD9B 5EU4B 3KXFB 3WKNA 1TZGL 5CEZE 3BHBB 4YFLI 3EJUA 2VLRB 3FFCE 1PYWB 3O4LA 4TUJA 5IQOA 2P5WB 3QO0B 1JPTL 4KDWA 4XO9A 1KELH 2VDRH 4M93C 5F6HJ 4YQXL 1BQKA 3DNKA 1EO8L 4FKHA 1NAMH 1URLA 4X6CA 1IGCL 5E4EC 4Q97A 3IPFA 2J44A 3BIAX 3CSBA 3Q6FB 2GK2A 4KNSA 3VQ2C 4F58L 1N5YL 5H37A 4AJWA 4AL8H 1W8EA 2OYPA 5D7SL 3WY4A 3VD2A 1NDGA 2DKUA 1SFHA 2DTMH 2HT2D 4PGDA 4IGBB 4XNYL 3H0TB 3GKWH 1GZHC 1KYOK 5I6PA 5ADOL 1AQDA 4FG6D 4LFHD 3LRLA 3FRPA 4Z3JA 2B0SH 1PKQA 1QUNA 1OWRM 4JRFA 1S46A 1U91B 4QXUL 3SDXF 3MODL 3LSOA 5C2BL 4WJKB 1C08A 4RMVA 1YNTB 4ODVH 3LXBA 5D6CA 3L3JB 3OKLB 4E0RB 1KYDA 4S1DC 4XX5A 4UV7H 5LAXB 3RRQA 3D48R 3GTNA 4TUKH 3WTTA 4EEEA 2QSCL 1BAGA 3DX1A 1AVAA 3NN8A 4TUJB 5F9WC 3O4LB 5JO5A 2IG2L 4KDVA 1PZ5A 3S98A 4L3EA 3T0DA 4MAYC 1U3JA 4WFHE 4X6CB 2CGZA 3D39A 1ID2A 4NNXA 4P46C 5IW6A 4FFWC 5SV3A 3T0EE 4AQ1A 5AVYB 3DX3A 1SBSL 4TVPL 4YSDA 4JW3A 4R5TA 3RY4A 1C9SA 5GGVH 2UUDH 1JZEA 2YXVA 3ARGD 4M3HA 1Z9SA 4UUJB 1AQDB 4CDHA 1E67A 1BZ8A 3FRPB 1DP0A 2EEBA 2Y72A 1PKQB 1QUNB 2R2EA 4L29A 5I6KA 2X4SA 4PJHF 2YZ8A 3FW6A 4XP5H 3SIKA 1X6NA 2DZEA 2WXHA 4QY8A 3MCG1 1UWXH 1L7IH 1MVYA 5KYYA 3LSOB 1BJMA 1C08B 2D0GA 4X4MA 4GS7C 1R3LA 5D6CB 3K8MA 1EO5A 4JANB 1JXDA 4KV5F 3Q44A 2BSDA 2X88A 3H85A 2HCZX 2LOEA 4HH9A 4C58B 1KYFA 3AABA 1RY7B 3JV6A 4K7PX 3NN8B 3SYAA 5JO5B 1M05A 1CD9B 1E50A 3WEOA 1FV1A 1PZ5B 5C1MB 4FQLL 2LU7A 4L3EB 3MGAA 4ACTA 5JXEA 5LGKA 1BG1A 3KPSD 5FM5O 5I1JL 5FO9A 2BX5A 3E2HC 5BUAA 4H8WC 1BZ9A 1GOGA 2ZXBA 3D39B 1JHLL 2WYTA 3NCJH 4Y1AA 3VRLF 5IW6B 1YNLH 3PABA 3QQDA 3LEYL 4AQ1B 1ESOA 2MKWA 2NPLX 1PLBA 3ARDD 2QKSA 2YEZB 3WS6C 5B39A 5EF3A 3H9SE 3ZDZF 2ITCA 4S0TD 2PF6A 1Z9SB 3IS1X 3EJYD 4QXGL 3VI3A 4OLZH 1R3JA 2B77A 4N28A 2BFVH 2K6ZA 4XTRD 1P7QD 5E24E 3QXUA 3CC5A 4LNRA 1A14H 5IFAH 3UGXA 2R2EB 2YSSB 3OTTA 4L29B 2X4SB 1OAXH 3ZXAC 2WQUA 3RWCA 1MIML 4QY8B 1X7TA 4QHMA 5I1IL 4YDIL 1HNYA 1SDYA 3UZEA 5KYYB 1Q72L 1R3LB 3O6ML 1OV8A 3PQYE 4PG2C 5A2KH 3IDXL 5CJBA 5TK2A 3OKKA 4PWIA 4JCWA 1LDPL 3HG0A 5IUSA 4HH9B 5DFAA 3ARVA 5EOQH 3PLYA 1FA4A 4LHUD 4FYSA 3G6DH 1X6LA 4EUPH 5ABDE 2EILB 3JV6B 2P47B 1M05B 3D2UD 4Z3TA 3TX4A 1FV1B 5JQ6H 1BXVA 3PFUA 4LBAA 4QRUA 1JNJA 3NJNA 3QBTB 1NGWA 2D7MA 4JRXA 5FO9B 2DJMA 3QUYA 4TUUA 1MCRA 1F8TH 1N8OE 1BZ9B 1U8OA 4Y1AB 4BELD 2NY1B 1TQTA 3PABB 3QQDB 1WFOA 2J21A 1MCWM 3RTLA 4NP9A 2VDOB 1CB4A 1Q9WA 2QHRH 4RFNB 2ITCB 4GAGH 2FGWH 3VI3B 2M83A 1R3JB 1MFNA 4UCFA 2XYBA 2UXFA 3CC5B 4LNRB 4PJ5E 5I1EL 3KW8A 2CJUL 1MFDL 3NIGB 3VFMA 3X2QB 4QHMB 1KIRA 4FNPA 3U83A 4JO8A 3HS9A 1DDTA 3GKZA 2YMXH 5AAWA 5AVVB 2O5NA 2VRQA 3V5KA 3JWOC 2E9WA 1SXAA 2RAMA 2ZX8A 4OD3L 3EF4A 4I3GA 3OKKB 4JGMA 2OX5B 2L8AA 3Q6GH 5GGSY 4E9SA 3I9GL 4UT7H 1U3YA 1DDHB 3U9PH 3WUWA 4KRMB 5BPPA 5T1JA 2AQ3A 5E1HB 4XR8C 4U31A 4XMLH 2CHXA 4MJ6A 1I9JL 1OK8A 1B6DA 3KXFD 4OGXL 4QRUB 2VLRD 4LCUA 3G5XA 1NGWB 5E94B 4JRXB 2P5WD 3QUYB 1U8OB 5AEAA 4GRMA 1AGBA 2NT1A 1E5CA 3N1PC 1YN6A 3ZDYF 3HAEG 1PJ9A 4S1SH 3DROA 4FFZH 4WI7A 1GMEA 4LLQA 1Q9WB 4UQCA 5CMAA 5IY5B 4HCIA 3BN9C 2OXGB 1OSPL 2QPFA 3D50A 1ZVNA 3REVA 3GBML 5DD3H 4YXKL 2F8VA 2RTTA 4JPVL 1HX0A 4KUCD 2EE0A 3A6OA 4OIIH 4AQEA 2Z1KA 2BSEA 2CZNA 3VFMB 2FX9L 1KIRB 2JTDA 2WLLA 1IKNC 1FNAA 3AU1A 5E99H 3V5KB 1MFAH 1GR7A 3FQUA 3GS4A 4ODSL 4JFDA 1J5CA 4F37F 5L6YL 5FYJH 3U79A 4K8RC 1E6OH 3EBGA 1JGIA 1YQVL 1CE6A 2ZWYA 3WUWB 4ZMTA 5D71H 1CGSH 4NX0A 4I9WE 1DJZA 4QHPA 1QRNA 4MJ6B 1GGIH 1LMKA 2QPEB 2VERN 4P23A 4EZMA 4LCIL 4LCUB 4CMMA 4S1QL 4QTFA 3O4LD 3IN2A 1AGBB 2EDEA 1MN4A 4N2AA 1YN6B 5K9JL 5JOEA 4OFIA 1MWAL 3DROB 2GI7A 4LLQB 3ZZLA 3FCGA 1N2RA 3C8KA 2W92A 3BCFA 5CMAB 4ERSH 2X42A 5DGRA 1EGJL 3REVB 1XH1A 2EQDA 2ZOWA 3FXIC 2BC4A 3ULSA 2DWSA 2ZG3A 2V2XA 3BUYA 4GBXA 3DOHA 1IBHA 1PG7L 4AQEB 2EH8H 3HMXH 3SPIA 2OZ4H 2ITFA 3QJTB 4X8XA 3KAAA 1HCYA 1YMME 1HEZA 1G9MC 2WLLB 4M61A 3ZPDA 2VO5A 1GHFL 3AU1B 1TETL 2AGJH 3I6LD 3FQUB 2HTLD 4BH8A 5DO2D 4PS4L 4LP4A 4JFDB 1IGFH 3F62A 5PAZA 4PJGF 1WHOA 2YHGA 3ZX1A 3CDYA 4JFYB 3ZQXA 1BZQK 2ZUQB 4OFPA 3SPJA 4OQTH 4YSEA 5FM5M 3TFKD 1L6PA 4AEIL 4X98A 1RU9L 5EUOE 1GYUA 2XKSA 2ZICA 3QEGL 1FN4A 5BS0A 5I30L 1MCJA 4WTXA 1QRNB 4G6AD 4P23B 3OAWA 4CMMB 2FB4H 3AY2A 2KLRA 2VR4A 4KZEH 1NUNB 2EDOA 1YUKB 4JKLA 1ZEAH 3FBKA 3TH3T 4L3ED 1VEOA 1UENA 2GPZA 4N6QA 1YEHL 1N2RB 3C8KB 3V4VH 2DQCH 2VAJA 2A9MH 4JPKL 3ZE2B 3D39D 5I0VA 5DK3A 1NCDL 4HLZG 5TE4L 2AQQA 1OAUH 5IQ7L 3NCEB 1OE2A 4OZFH 2YD7A 2BC4B 1CFSA 4FGMA 1T5WA 2V2XB 2YO3A 3BUYB 1XSIA 4GBXB 4JR9L 4AYFA 1CL7L 1DJHA 3CSFA 4ES8A 5JMOC 4UANA 1A4BA 3G6AB 1HAUA 4PY8J 4HOXA 3HG1A 3T8XA 3DC0A 1SEQH 2YKLH 5CD5C 4M61B 4MNGE 1HEZB 3L45A 1YEWA 3SQOH 1EPFA 3SPGA 4BH8B 2VW7A 5EA0L 4DP1X 1MWAA 1IBDA 5HHNA 4LDCA 5F0LB 4JDTL 2ZCHH 2X6AA 2BY1A 3EJRA 4JKMA 1NLBL 2IQAA 3ECUA 3LOWA 1MUJA 43CAB 4EBQL 4LU5L 5F44A 4X98B 4KOCA 3S4SB 2VLKB 4R7VA 5BS0B 1FN4B 2Y7SA 4PH8A 5LBGA 2XI9A 3IAQA 3HBGA 5AB9A 4G8FA 2HVJA 2ARJQ 2P43B 1A6TA 5KS9E 1H15A 4OM1L 2XIBA 1CDUA 3AS0A 4UMGA 3E3QE 5E6ZA 4P4RA 3NIDF 5DJ6A 3F85A 1JPGB 5CZXC 4Y1AD 2NY1D 1EJOL 1F11A 3S3CB 3ZZSA 1B9ZA 2GJPA 3GEFA 5JHBA 4MJ2A 2BSRA 2CK0H 1CFSB 1T5WB 4WEMB 1NPJA 4FTVA 2WZ5A 2IGFH 1JFQL 1KCSL 2IOMA 2ZJSH 3BPOC 3CX5J 3H4FA 3HG1B 3T8XB 3P3YA 4YHOH 1U8LA 3CZNA 2N7AA 3VFWA 3WJJA 4N3TA 5DC2A 1BVNP 2IVFC 1ZDSA 2FQFA 3VGEA 1QI4A 1MWAB 2XPYA 5DJ0A 5HHNB 3GK8H 3CHRA 2HG0A 3M1BB 3B5GA 2IQAB 2ED9A 3BZ4A 3V2AR 4N0CD 2Q76A 1OLZA 4OT1L 5D7IA 2V17L 5F1IB 2DM3A 4M62H 4ZW7A 3CSYA 2YQBA 1DZ0A 4P48A 3ARTA 2ZYSA 1E2VA 4G8FB 1I7UA 2HVJB 2C5DC 1A6TB 1H15B 1EEZA 3NGBB 1A4KB 2B39A 2OMVA 4Y16A 1L9SA 1AP2A 1OW0A 1A47A 3GPEA 4P4RB 1KGUA 4WEBL 5DJ6B 4F1ZA 4WFED 2BVOA 4JRXD 1DO5A 3QUYD 4GW5A 1C5DA 4TNVF 4TSAL 3X3GH 3ROLA 1K4DA 2KPWA 1P7HL 2BSRB 1IFRA 1VZGA 4FTVB 3VDAA 2CHNA 3TEYA 1H3PL 3ARZA 4DN3H 3KJ6L 1OAQL 2I27N 4LCCA 4NNYA 4U1GC 2QMJA 4GSDL 3BQVA 1C1EL 4I9XA 4ZFOL 1YYLL 2OL3A 5T3ZE 2MWCA 1AXTL 2AANA 3VGAB 3VXMA 4JRWA 5DJ0B 3F58H 4FQXA 2KS0A 4IBQA 4N90D 3FH5A 3Q5OA 2GJ6E 4HIIA 3HI1A 4O9HL 3BZ4B 5DHVA 2ZTBA 3H9HA 4I18C 2Q76B 5DS8A 1KC5H 3POCA 4O2FA 3AW5A 4G6FD 2X70A 2CUHA 4AGPA 4K9EH 1X7SA 1JL8A 4GKSA 4LARH 4U6YA 5C09E 3JZYA 3T2NL 2UUDK 1EEZB 2YD2A 1NIDA 2DQGL 1JSYA 2OMVB 1QBLH 4Y16B 1AP2B 1M6UA 3RUGF 1NMBH 2BVOB 4R7DA 4RX4A 4B9PA 4GW5B 4JFQA 1BBDH 4ZOCA 3QP3A 3ROLB 1K4DB 4NN6C 5F88A 2AAVA 2CBOA 5K5YA 4XAWH 1UWXK 1NKOA 3NAAH 3WFBL 1B4TA 4LCCB 3CFCH 2PW2A 4QXTA 4E41E 2DI8A 4G8IA 1AJ7H 2ZWLT 4PW4A 2UWEE 4CVXA 2BIMA 2OL3B 2I7OA 1DSFH 3U2IA 2BSED 3R1GH 1U9KA 1YECL 4OGYH 3RHWK 2Y2YA 4TQEL 5IFHL 4BZ2H 3RVVC 1CU4H 4FQXB 4MMXA 4Y5YC 5DHVB 3HI1B 4JFDD 3RKDD 1N0XH 3H9HB 4ZSOE 3PHSA 5DS8B 2MCPL 4O2FB 4DKFH 1R75A 2X70B 3FTXA 2IGTA 4TS6A 4PCTA 1JHTA 3MQIA 1OE1A 4GKSB 4KJPC 4LSQL 5I1AA 2PPEA 3INUL 4U6YB 2XTJD 2DLEA 1NGZB 1W72L 5CO1A 4ZFOA 4NFBA 1QRND 1M4KA 4V33A 5E9DA 3BAEH 1TTBA 5C6TL 1LP9E 2Z7WA 2B08A 4P23D 3IS0X 1PSKH 4JKPH 4JPQA 3BFWA 3QDJA 4HAFA 4R7DB 1J7VR 4H20H 2QQNH 4JFQB 2AXHA 5F88B 3CHSA 3FB6A 4GLRI 3T3MF 2Y7LA 5FF6A 2BHUA 1I9RL 2PW2B 4QXTB 1A9EA 3D34A 3KJ4B 4GBXD 4G8IB 1VDGA 4Z7OE 4Z95H 4CVXB 1IBGH 3D18A 3HFML 4L3AA 3WJLA 4F8NA 3KLHC 4RZKA 3A23A 3FTYA 5DJAA 3V6ZA 1QKZL 3IGFA 5E6YA 2CLVA 2PNDA 1OARH 2FO8A 1KJ3L 3E9TA 5ESQA 4MMXB 4AYEC 4NLAA 3QI9A 4HLJA 2G2RA 2VGLM 2JKXA 1DEEA 1UWFA 1ZVYA 2DQTL 5F3HA 2WIIA 1M9SA 2YLKA 5IR1B 1RERA 2AEIT 1KBGH 4OCWL 2GFBA 4OB5L 2IH3A 1HS6A 1WQVT 4JO4L 1JHTB 5E0FA 3BKCL 4OZ4A 3UP1A 1E4WL 1NC2A 5BS0D 5JHLL 3MBWA 3QJHB 3Q1SL 4ZFOB 4V1DE 5J8OA 3VWKC 5E9DB 2F19H 4L48A 3AM8A 5LLIC 2VISA 2YWYA 2BDNH 4DP7X 3QDJB 1BFTA 1G7QA 2YD6A 3PP4H 1FNLA 3OJMB 1I8LC 5FYLD 4YE4L 3G7TA 5BCAA 4QXVA 2NUTA 2LE9A 2LAAA 1I8KA 3FB6B 4LSTH 2ADFL 3F6IA 1NC4A 3NJGA 3EYVA 3DUUA 1A9EB 4A7UA 4JMNA 1IT9H 3LTVA 1DQQA 1FZMA 5ES4B 1RZJC 2BSCA 3D09A 1W72A 2VR9A 1GJUA 4F27A 3HG1D 5DJAB 3V6ZB 5FC9A 3VVWA 2CLVB 3ARFA 4TPRH 5IJKC 2QBWA 3S36H 5ESQB 3QI9B 4K2UL 3ZE1F 2CRZA 2G2RB 3FMGL 4NYLA 4KRLB 3JUZA 3OJDA 1DEEB 2YKKA 5F3HB 2WIIB 1OCZB 3DGDA 1K2DA 4NS0A 3SE8L 2GFBB 4FNLL 4IDLA 4MAZA 2IH3B 1TUPA 4Q2ZA 5FUCC 3WE6A 4OZ4B 4BK5C 1NC2B 4K23L 4X99A 4BXSV 3MBWB 4LL9A 2VXUL 2XQ0A 1P2CA 3VGFA 4AC2A 4M8QA 4WWKA 2LQRA 3E38A 5TE7L 1PLGL 3B9EA 1GCYA 4Q9RH 2NY5C 2OV0A 4JFEE 3RGVB 5I18L 2YA2A 4JQVC 1SOSA 4HHWA 1I8KB 5MENE 1NC4B 1HZHL 4XN7A 4Y5XA 3NFSH 2XZCH 2XZZA 3EYVB 4K3JL 3QZLA 4GUQA 3APCA 3DUUB 4C8XA 3JVGA 2GVYA 1ETJA 1FL6A 3BDYH 1FZMB 4FTVD 1OIOA 3VXUA 1I8AA 5JHLA 1W72B 4LF3A 1MRDH 2QELA 2P1YA 2ZUSA 3VWJC 1KJVA 2ZUXA 3EFOA 3F6LA 2GG1A 2ILLA 2PN5A 1B90A 1OM9A 1SNRA 3ARFB 1HYRC 3TT3L 5E8NA 3GSUA 3N43F 4MB1A 3OLIA 1DJXA 4F57H 3V4PA 2YR3A 2XQBL 4NYLB 3TEZA 3OJDB 2O30A 3FUHA 3D6GA 3IGKA 3HFFA 1RZ7H 1F86A 1PCXA 4XMPH 4Q2ZB 3WE6B 4OH2A 2BW4A 5C7ZA 3H7LA 1XGUA 4WFGD 2D0FA 5GGQH 4X99B 5B1KA 2L04A 3QEQA 1P2CB 2BZ7A 5DQDH 4M8QB 4WWKB 4YX2L 1NBZA 2NR6A 1M56B 1DZBA 3C5JB 4O51A 4U0QB 1HAWA 4JVWA 5BJTB 1LO3L 2ZOKA 3RB5A 4RCAA 1E43A 4HUWB 3RNKA 5TF1L 4UV4H 4Y16D 5C0RH 4MCZA 1YA5A 1OTUD 2V2TB 3RZWA 4Y5XB 3GXFA 2E7HA 4EI5D 3JV4A 1G84A 4C54A 2DD8L 2HFGH 2E86A 3AZUA 4FQIH 4LO9A 4WK0B 3U6XS 3EJQA 4G5ZH 1MCEA 4IHBA 2BH0A 1FL6B 3VXUB 3LCYA 4LF3B 2ADGA 1ZLWH 4QO1A 4ANXA 1KJVB 3EFOB 1RPUA 3RFZA 3IKKA 4OVVA 5IJCC 3AVEA 2G5RA 3EH2A 2VXTL 4IJTA 3GSUB 3GXTA 3MJ8A 4HJUA 1BECA 1J0IA 2J7LA 3V4PB 5AW7B 3VXMD 3GLEA 3LD8C 4TKWA 4LSRL 1I8UA 2Y06H 3MV8E 5DZVA 3KS0J 1ACXA 5E8PA 1XGUB 1A3QA 4K3DH 1XO8A 2CO7A 2XBZA 3QEQB 1PBYA 1UM4L 1ANUA 1JWMA 1NBZB 4TNEA 4Y1TA 4O51B 2ZOKB 5HDBE 1E28A 1HHIA 3AQDA 4QMEA 4Z7WF 1JGVL 4DP9X 1NUGA 4MCZB 1JIBA 1Z9MA 5GGTL 1YJDC 4RX4D 5INDA 4HKXA 4OIAA 3HMWH 2CK2A 3JV4B 4PWFA 4WJG3 3I6SA 4UTBH 1CGVA 5I9QB 4F7TB 4PRIE 3LDBB 2XV0A 1TDQA 4QO1B 1CFQA 3RFZB 3QNYA 4PWEA 3VFRA 1WAEA 2HA1A 3MLZH 4P06A 2HAZA 4JY6A 3V79C 3MJ8B 4K7FA 3D4ZA 4EOWL 1PZ3A 3L7EA 4GY4A 3CZEA 4XMKL 1UM6L 4M7ZC 4MSWA 4RQQA 5FGCE 4XWOC 4KZDL 1QPKA 4PJXE 3WEAA 3EYUL 4GPVA 2CO3A 3O2DA 4OD1L 5E8PB 1BQHA 5L2KA 5DXWA 1LO4H 3BFOA 5C9KA 5DJ8A 2CO7B 4E5XA 1AMYA 2ALAA 3MRQA 3EFFA 2EZ0C 4GKNA 5AVZB 1JWMB 3G9VA 5FYJE 3TPUA 2MOGA 2VR6A 1S7XA 2HLEB 4M43L 1RZ8A 3DXAE 4NKIL 32C2A 5A2LH 5DEZA 1MI5A 2G9HA 5CP7A 3FH8A 1E28B 1HHIB 1QFWL 4FKKA 4JRYE 4YH6A 5E9DD 2JKLA 3MPCA 4WUUA 4EIBA 4MDIA 2VITA 3QDJD 5B1BB 2F53A 2KUTA 3N85H 3ZUNC 4HKXB 2AJVL 1S3KL 3VFUA 2PYEE 1DBMH 1YQ2A 4N8UA 1M7UA 1CFQB 3D2TA 3QNYB 3VFRB 3V6OC 3N1FC 4FZ8L 2WOYA 4N20A 3O6LH 1J0JA 4JY6B 3GXPA 2NXZC 1QAWA 4NKQB 4K7FB 3U0WH 3GDBA 5L88H 1MXDA 2LHAA 3ARXA 1UZ6F 4WHCA 3RWEA 2G2PA 4XXDA 2CBTA 1ZXQA 3PNRB 4RQQB 4XNAA 5CZKA 3PWNA 1FC2D 3QI9D 4JO5A 1BQHB 5L2KB 2NDFA 3MCLH 1KZYA 3SKMA 3QUZB 3T04D 2F1AA 1L6XA 4JG0H 4JFZH 4O4YL 4E5XB 3MRQB 3EFFB 4GKNB 4OAWA 5I0YA 4W4OA 3TPUB 5DD5L 5JIPA 3Q06A 2IAAC 2BOLA 4MASA 1S7XB 1IGJA 1RZ8B 1NC2D 32C2B 4LMQI 1KCRL 2G9HB 5CP7B 2FH8A 5L7XL 1J8HA 3UG4A 1N8ZA 1ZE3C 5E23A 1G9HA 1KEMH 4WUUB 4X5XA 4MDIB 2VITB 3P3RA 4CMHB 2F53B 1U2YA 2EE6A 4HGMA 5F7LB 5AVTB 3GNMH 5D7LE 1JI2A 4P4KA 3FZUD 1J88A 2Z7YA 5F7HA 5GS1A 1RLWA 3AXLB 3GBNH 4KY1H 3VFUB 1TENA 4H0HB 3C5ZC 1MPAL 1Q9OA 3RILA 3TVMB 1NC4D 3TWYA 1GOHA 3X3FL 4ZG1A 4X9FA 4FZEH 4XBMA 4J23A 1UZ8A 4U1IA 1IKFL 5BRZE 4ELKA 2OMZA 4ZTOH 3VYOA 3RWEB 1NFAA 4J3XA 2ZIDA 3ARFD 1YC8A 2BOCA 4CGTA 3PWNB 4QT5A 1EXHA 4JHBA 4EF3A 3E6FA 2IV8A 1E7UA 1LD9A 2KERA 4HFWA 4F20A 2WIMA 3B9DA 3SKMB 3IU4H 2VERA 3O3BA 3EBIA 1CXFA 1AE6L 4PRPA 2H2SD 4OAWB 4N5UA 4WW2A 2AQPA 4EUPG 3S37L 2E7MA 2A9BA 1MFMA 1IGJB 3DPDA 3RVWD 4HKZA 4ETYA 4YHLH 5BZZA 1CXEA 5TPWL 1G7LA 4PM1A 1J8HB 1N8ZB 4FX5A 3O2WL 4WWKD 3BGFC 3BT2L 1OGAB 4X5XB 3L1EA 1NL0L 2WCSA 4FQ2H 5F7KC 1J18A 2YAOA 3D5OF 1C8QA 4P57A 5HGHA 2GKIA 1NCHA 2DYSB 3DJ9A 1FZJA 2GCYA 1DUZA 1R0AL 2DRUA 3UAJC 4U7MA 4OV5A 1Q9OB 3ZTNH 5GS0L 3UJTH 1T03H 2XPGA 3O41A 5T3XD 1BW8A 3LNFA 1ZLVH 3FTUA 4OKVA 4U1IB 5EU6E 5AG8A 5FYKL 4Z7VE 3KPPA 3WDJA 1GPOH 1UM5L 1QYGL 1W15A 2OMZB 4FI7A 5I74B 1DQVA 1IKOP 2BOCB 2R69H 3WNMA 3NH7H 4DK6A 4QT5B 3SB3A 5IB2A 2R1XA 4RWYH 4UILH 1LD9B 3MA7A 2WQWA 4HFWB 4KUCF 4J3SA 2F5BH 4R97C 4AKOA 3GMLB 3QJQB 1A7RH 3EZJB 3NT0A 2DWTA 3MYZA 4PRPB 4WW2B 4OF7A 2YK1L 5ID1B 4HKZB 2NY3C 2JCCA 1G7LB 3QEQD 4Y4FC 3U7WH 3FT0A 3GQFA 2IANE 2CDGA 1ORSB 5CP3H 1KTKE 2NR6D 1TQBB 1EQWA 3VRLE 2E9IA 3UTSE 4Z77A 4RBPH 4YWGL 1KCUL 1YNTF 4P57B 3L3KA 4J3BA 2P42B 1YEKL 3P69A 2GCYB 1DUZB 5GS2D 5INCA 3ZDZE 3O2VL 3W81A 4OV5B 3SD2A 3WIFA 4P9HL 1ZV2A 2XPGB 3O41B 5I6XB 1OEZW 4CL7A 5DK2A 4OKVB 3JT2A 4GKZB 5FO8A 3KPPB 1UEYA 2OMYA 2WP3T 2X1PA 3MTXA 5ALCH 4OJEH 3VD3A 1GCFA 1GIGL 1G9NL 1GGUA 3H7BA 1BD2E 2OSLA 2XX1A 1I3GL 5IB2B 2R1XB 3MA7B 4ILDA 5DYOA 3ZKSD 3MGTA 5F96H 4OGAC 5HI4D 5ID0A 3BQUA 5E9NA 1RZGB 4FLRA 4FMKA 1S7QA 2B16A 2H9GA 3QULA 4GP4B 4H44C 4CKQA 1HWGB 2F08A 2VL5A 3TO4A 3HG3A 3BIBX 4TQPA 2JCCB 4EVNA 2APFA 4LIQL 3SE9H 4G7VH 3S5LG 2CDGB 3UC2A 3ALPA 4ZZKA 3MRRA 2WZ0A 1I3VA 4M5SA 4Z77B 2VQTA 2DBLL 1KWKA 2QADC 3FULA 3MI6A 3L3KB 2KZKA 2MNUA 3L4ZA 5INCB 2GSGA 3DMMC 1VKXA 3WIFB 1BLIA 2QDVA 2FGZA 1K5WA 1D6VL 2YA0A 4JFHE 3VUAA 2K70A 2WXJA 1PFCA 1S3RA 4RLDA 5HJBA 5E70A 4DGYL 5EC2A 5KSAA 5FO8B 4CU8A 2OMYB 1ZHBA 2AZUA 2JB5L 2ZXQA 3MJ9A 1TQWA 3QUXA 2OSLB 1CGWA 1ECZA 1X5GA 2QV4A 3I3BA 2LABA 3MGTB 5EZJA 1UASA 5ID0B 3BQUB 4TTDC 5F93C 1IAIH 1X5JA 1S7QB 1F4WH 2H9GB 3QULB 2XWDA 3NPZB 4UQ3A 3TO4B 3BP4A 1GZPA 4JCLA 4EVNB 3MBEA 4OBSA 2ZE0A 1L6ZA 1MJUL 4P0DA 5L0QB 4YR6A 5C0CE 1WD8A 2YAQA 4L5FH 3MRRB 3L4VA 3U1SH 4M48H 3ZDYE 3EYSH 5DFTA 4CBZA 2QR0A 1MI5D 2LAGB 1CIUA 3K1KC 3V6OE 2AI0L 1MEXH 3Q48A 4ONOA 4EMZA 3BPCA 4N2DA 2GSGB 1PF3A 2F53D 4G7RB 4YHZH 1ZT7B 1RZKL 4HEME 4M6ML 3ZIMA 1VKXB 2DJUA 4X4ZA 4E36A 3FFCA 3ZDWA 4XNUH 3FQYA 4OZFG 4HW6A 5IT2H 4LLAA 4IRJC 1H6TA 1VGEH 5EC2B 3V10A 5KSAB 1SLUA 4XCCL 1Y7VA 3LNDA 2EDFA 1ZHBB 4W81A 4YDJA 4FEMA 3GJFH 3W57A 3MDJA 4XRCA 4POZD 2R59A 1CICC 3QUXB 5JW4R 4LEOA 2IMNA 2WAHA 3BKML 3MLXH 2YN5A 4HS3A 2P9RA 3KVQA 2YIHA 4EDWL 1UADC 1E5BA 3HAEA 4HIXL 5EZJB 2VXQL 4WSKA 4QJ3B 2D7QA 4WFFE 5D2LE 4DGIH 1NGXA 1AS8A 4DQOH 1J0HA 3QDMA 3AFLA 3FPYA 4YSTA 1N6QH 4UQ3B 4K7PH 4XWGH 3BP4B 1GZPB 3S0PA 3QZWA 3MBEB 4JO3L 3RX5A 3NIGF 4MRBA 4YR6B 1R1CA 3T08A 3IMWA 5TE6H 1FSKC 3CDZA 4E9RA 2QR0B 2H1XA 3H6JA 1J8HD 2YD4A 3KHQA 4L4VA 4U1MA 3BPCB 1ZLWK 4HJSA 3SN6N 3LKNA 4XAKD 3HTLX 5E4AA 4K5LA 1ETA1 3GSVA 5J6HA 3K5RA 4P4KD 5KBKA 1QSVA 1CR9H 2GT9A 1B88A 5BVPL 4I48A 2SODB 4MZ3A 3W11D 3FPXA 4L1DA 4RISH 2IGLA 1A6WL 2MIZA 1YEGH 3T0EA 4A6YH 1SPDA 4PJBA 1UCBL 4IKIA 4LEOB 4PJGE 5ISZE 4G9FA 5B1CA 4TNVK 3BVVA 1A4CA 4N8VB 3DIFB 1JPSL 2AITA 3KHOA 4R90H 4DF9A 4KI1A 3TL5A 1GS6X 5A2AA 2CXGA 2EEAA 1NGXB 4HCFA 3EW3B 3QDMB 3ZKMC 2CDEA 4LKCA 4NN5B 3RWDA 3QZWB 4WJ5B 2FDBP 4X7FC 5CJ8A 2AQTA 2QV2A 4JO2H 4R84A 4PRPD 4K71C 4WLCA 2F5AH 2IBGA 2EE9A 1IAKA 3CDZB 2K78A 1WWAX 1CZ8L 4R9HA 4LRIC 3L3IB 1JCKA 1VFOA 4HF5H 4HWBA 2NTFA 2YD9A 3ATFA 4L4VB 3IJYB 4U1MB 4V2BA 3ELQA 5DUJA 2V2WB 3MFFB 3GSVB 5J6HB 2X2YA 5E8EA 4A7SA 3J2PA 1G5GA 4RMWA 2J5LC 2ZUWA 2LT9A 2QGEA 1H8LA 3D08A 1I3UA 4I48B 4NQCE 2CCWA 4HWZA 4Y4KA 4NENA 3VTAA 2XWBA 2IC2A 5IROA 5B4MC 3FU6A 2CKNA 4LAQH 2ENYA 3UERA 3MC0A 1A8ZA 4MHHI 3T0EB 4NJ9H 2BZCA 4PJBB 3ES6A 4G9FB 4J12A 3IDGA 2HFTA 3H9SA 5E5RB 3HI5H 3KDMA 3SDCC 1HCVA 1JV2A 1D9KA 4LPWA 1Z6JT 1KT2A 2XSKA 4PP1C 2WN3A 2ZKXA 3FSAA 2CDEB 4LKCB 1KGCD 2VXSL 3E1ZA 4PB0L 5I8OL 3ZR5A 1WCQA 3AG3B 3RWDB 2ZSWA 2C7FA 3G5WA 1X5ZA 5I8KL 4KMTH 2EUZA 3K7UA 1IAKB 1OSZA 3N6YA 3WNOA 5CD3B 2XKUA 3PQYA 1IJ9A 1E4HA 5C0BE 5JW4M 3NIDE 5A7BA 3STZA 5HYEA 2JJWA 2NTFB 4LASL 1P5UA 5DEJA 4PIBA 2AQRA 3DETD 3L5XH 1UATA 2CGYA 2MPAH 3UOAB 2X7LA 4R4ND 3B9AA 3CXFA 3SPCA 3MCYA 5E8EB 1J5OL 3VFOA 2I5YL 3IDYC 3M8OH 5D4IA 1QOKA 3MACL 1E4JA 2ICWB 4HWZB 4Y4KB 1T0NA 3CBKB 4NENB 2HFEA 4OLXL 3HB3C 5DMIL 1FP5A 2XWBB 2Y1VA 4GT7A 2KHAA 1QHOA 5AFAA 2DQEL 1BVKA 4I0KA 5JIHA 3TJEL 3B2VL 2IDFA 3ES6B 2X3AA 3IDGB 15C8H 1EZUA 1WZKA 3IRCA 3NPSB 3KDMB 4LCYA 1P4BL 3IFLL 2NSXA 3OB0H 2EDTA 3ZE2F 1JV2B 3OR6A 1YYMH 1KT2B 4NB7A 1U3ZA 2BY2A 4CSTA 1SXNA 1TEFA 4PJ5A 5JTWA 4MS8D 1KTRL 1OCOB 4JGNA 3GUTA 2PCXA 2BP5M 3BQUD 4I4WA 2VKWA 1FORL 5I1KH 2ZSWB 1AMXA 1OT1A 2HWZH 1OSZB 3K8KA 3TO4D 1M2VB 3PQYB 4AENA 3STBA 3SQRA 4ZW3A 2JKRM 5AOMA 3STZB 4DCQB 2KDYA 1SYVA 5IWLC 1P5UB 2G3MA 5G2NA 3VD4A 1GYAA 5GZNC 2L7UA 2X7LB 5EIIG 3O4OB 1NCCH 4NUGL 1O7DC 1AZVA 1Z5HA 1NBQA 4FLSA 3VFOB 4NOFA 2QSTA 2WP3O 4IJ3B 3AWFA 4TXVB 4YAQA 1T0NB 2HFEB 1WGOA 1KY6A 4KMQA 4UQAA 5DYFA 5H37H 2EXWD 3WXVL 2IWFA 4N0RA 4U6VL 1AI1H 4YDZA 2B1OA 1BVKB 3LS4H 4XVUC 4JO1H 2X0UA 4PJIE 4QRFA 3GMOA 4LCYB 1WP6A 3IMVA 1UYWH 3DO7A 4HETA 5AZ2L 4HAGA 3OR6B 3QUXD 2BWDA 1NGYA 1S4IA 4HUCA 4N2KA 4WU7B 5E1IA 4NUJA 4QI3A 1PQZA 4PJ5B 2K6WA 1WIPA 2J1XA 4LDLB 3GUTB 3DSNA 4ALAH 2XWTB 1QZNA 3GSOB 2BNRB 1KXTA 4JFPA 5D96B 4I4WB 4B0MM 2VN3A 1YEEL 5E6IC 1PVHA 2BLFA 3T0BA 5HJ3B 1JZ2A