4AH3A

Crystal structure of the holo omega-transaminase from chromobacterium violaceum
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
455
structure length
455
Chain Sequence
RTTSQWRELDAAHHLHPFTDTASLNQAGARVMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEELPFYNTFFKTTHPAVVELSSLLAEVTPAGFDRVFYTNSGSESVDTMIRMVRRYWDVQGKPEKKTLIGRWNGYHGSTIGGASLGGMKYMHEQGDLPIPGMAHIEQPWWYKHGKDMTPDEFGVVAARWLEEKILEIGADKVAAFVGEPIQGAGGVIVPPATYWPEIERICRKYDVLLVADEVICGFGRTGEWFGHQHFGFQPDLFTAAKGLSSGYLPIGAVFVGKRVAEGLIAGGDFNHGFTYSGHPVCAAVAHANVAALRDEGIVQRVKDDIGPYMQKRWRETFSRFEHVDDVRGVGMVQAFTLVKNKAKRELFPDFGEIGTLCRDIFFRNNLIMRACGDHIVSAPPLVMTRAEVDEMLAVAERCLEEFEQTLKARGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords OMEGA-TRANSAMINASE
publication title Structural Studies with Pseudomonas and Chromobacterium [Omega]-Aminotransferases Provide Insights Into Their Differing Substrate Specificity.
pubmed doi rcsb
source organism Chromobacterium violaceum
molecule tags Transferase
total genus 174
structure length 455
sequence length 455
chains with identical sequence B, C, D
ec nomenclature ec 2.6.1.18: Beta-alanine--pyruvate transaminase.
pdb deposition date 2012-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00202 Aminotran_3 Aminotransferase class-III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4ah3A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4ah3A01
1G7WA 4GDYA 5JAYA 8AATA 3OP7A 4ZDOA 4L0OA 2ZY3A 3DC1A 3EZ1A 1ASDA 3VK3A 2BI9A 5K8BA 4PFFA 1VJOA 3DYDA 3QM2A 3A9XA 4BA4A 1BQDA 2VGWA 1SZKA 2XBNA 2X3LA 5FT5A 1AHYA 3AENB 3FSLA 5HXXA 2D5YA 3BCXA 5M4BA 1Z3ZA 3IF2A 3BCAA 3VK4A 4M2JA 3RUYA 4A0FA 2R5CA 2DGMA 4ZM4A 1G4XA 2O1BA 2HUUA 3AEMA 3BV0A 3R9AA 4A0HA 1CJ0A 1H0CA 1I29A 3DR4A 1Y4IA 5EAAA 3PDBA 2VMYA 1ELUA 1AICA 4OBUA 4WXBA 3N0LA 3FVXA 3MAUA 3E6GA 1ASEA 3BC8A 4W91A 1VEFA 4AOAA 1S07A 4E3RA 2VMSA 2FN6A 3I5TA 3EZSA 3PDXA 1X28A 1BJWA 1YIZA 4RIZA 1D7SA 2HUIA 4TMRA 3AELA 2YKVA 1WKHA 1I41A 1QJ5A 4A0RA 3AOWA 3E9KA 4RLGA 2VMPA 3AV7A 1ZODA 1GBNA 3NUIA 3CQ4A 1AX4A 1BJOA 1BS0A 3H7FA 3JW9A 1RV3A 4ADBA 4R8DA 2GQNA 2VMTA 2Q7WA 1TOIA 2PB0A 3ASAA 3EIAA 2W8TA 4ATPA 3AENA 3EI9A 1JF9A 3K40A 3E2YA 4XJLA 1UU0A 2VIAA 2GMUA 2VI9A 2VLHA 3AEOA 1X29A 3FZ8A 2AY6A 3P1TA 1T3IA 4IYOB 4ZDLA 4DQ6A 4ZM3A 1D7RA 1SPAA 4WLHA 4ITGA 1N8PA 2OQXA 4JF1A 2DKJA 2ZUKA 4P3MA 4F5KA 1D7UA 4AZKA 1ARTA 2OKKA 1AHXA 3MKJA 5E3KA 3M5UA 1TARA 1BJ4A 1PFFA 1YAAA 1C0NA 3GR9A 1CQ7A 5HHYA 2DGLA 2DGKA 3FVUA 3DZZA 3I4JA 1OXOA 2Z1YA 3QBOA 4MQPA 3UE8A 5IWQA 2FYFA 4J8LA 4OYTA 3LVKA 4FFCA 2YRIA 4BHDA 4BMKA 1BT4A 4XEWA 2W7JA 4F4EA 2JJHA 3OKSA 2VGTA 2Z1ZA 2CANA 4F5JA 4IXOA 1M0PA 4RKCA 1PMOA 2OKJA 2YKXA 3A9ZA 5G0AA 1S08A 4GSAA 3AEJC 1KMKA 4J5UA 1ZOBA 1IAYA 4TV7A 1AHEA 4PFNA 4LW4A 3FKDA 3QPGA 1CL2A 4WB0B 4UHMA 3KGWA 4JEXA 4ZLVA 4H51A 3JU7A 2NMPA 1MDXA 1AJRA 2CB1A 2HOXA 1XEYA 1S0AA 3B1EA 3GZCA 3KE3A 4OCAA 4Y0DA 4WP0A 3BCBA 4OTLA 1JS3A 1M6SA 1GC4A 2HZPA 1LK9A 3JWAA 1I48A 1CQ6A 4EMYA 1J32A 4U1TA 4Q76A 1AAMA 1RV4A 1RVYA 4ZWVA 4KYOA 1UU2A 3GJUA 3JWBA 3DU4A 4LC3A 1LKCA 3II0A 3NDNA 3P6KA 1GC3A 3TFUA 1X0MA 3KKIA 3W1JA 3QGUA 2R5CB 2W8JA 2YHKA 4IX8A 5LH9A 3AEJA 1C7NA 1AIAA 1ECXA 5DX5A 4CXRA 1AJSA 1ASMA 2JJFA 5DJ1A 3FCRA 1TOGA 3PDBB 4JEWA 4LW2A 3FDBA 4ITXA 4A00A 1S09A 4A6UA 5F9SA 2BWPA 3R4TA 3FDDA 1C7GA 4WBTA 1IVRA 1EJIA 3JZLA 5M46A 4WYDA 5G4IA 3UWCA 2C44A 3USFA 3K28A 2VMZA 2YCNA 4LNMA 1ORDA 4JEYA 2VGZA 4KAMA 3AATA 2CY8A 1LW4A 2BI1A 2VMVA 1AMAA 2EPJA 3ACZA 4RM1A 3FZ7A 3LVLB 2YCPA 4W1XA 2BIEA 2BWOA 3VP6A 1BJOB 1CL1A 4F5IA 5FT6A 4XJOA 1AY5A 4W5KA 1OXPA 5EUDA 3PIUA 1D2FA 1IJIA 1DJ9A 2HOYA 2QA3A 3WY7A 4HVKA 3CAIA 1Z7DA 2VMWA 2JJGA 3H14A 1M0QA 4OT8A 1YJYA 1ASNA 3A2BA 1U08A 4GE7A 2RFVA 4PVFA 1GC0A 4HF8A 4N0WA 2AY3A 4OC9A 3MAFB 3ZRRA 1D7VA 5EAVA 4ZDPA 1PMMA 1C4KA 1KL1A 3FFRA 1SVVA 1WYUB 2YRRA 4AH3A 4K2IA 1AKBA 1MLZA 3B8XA 1W7MA 3DXWA 5E5IA 4MGRA 4JF0A 1BQAA 1ELQA 3NRAA 4OBVA 1FG3A 2OGAA 3EI5A 3TATA 1W7NA 4ATQA 4ISYA 4WYCA 1UKJA 3GBXA 5EIGA 2GSAA 3EIBA 3CQ6A 1OATA 5FT8A 3LVJA 4ZASA 3HMUA 1GDEA 2V0YA 4WYAA 1IAXA 1LC8A 1TATA 2DKBA 4JE5A 2HORA 3VK2A 1O61A 1SZSA 2E54A 2W7IA 1B4XA 3N75A 1CS1A 3HL2A 4BA5A 3B1CA 4CBSA 2AEUA 4E1OA 2FNUA 4XJMA 9AATA 4XJPA 2VMQA 5G2PA 4TN4A 2W7KA 2VGVA 2XH1A 1UU1A 3KGXA 1PG8A 1IUGA 4O6ZA 2X5FA 1WYVA 5DB5A 1YIYA 1KMJA 1YOOA 1AMSA 1WKGA 2OATA 2JJEA 1MGVA 3PAAA 2YCTA 4B9BA 1V2DA 3MAFA 3VAXA 3E77A 3WKSA 1ASFA 2AY8A 2YOBA 3WKRA 1P3WA 2CJGA 1B9IA 1ARHA 5D95A 4QGRA 4ADDA 3BB8A 1WYUA 1W3UA 5FT4A 4RAEA 4ADEA 1M32A 4AO9A 4R5ZA 1V72A 2D7ZA 1QZ9A 2W7MA 1AJSB 2F8JA 2ZP7A 3T32A 1B5PA 2AY4A 3BN1A 4JE5D 3ATHA 2VMUA 1QITA 3JTXA 2EO5A 3LY1A 4W1WA 1B9HA 2R2NA 1AHGA 4IXSA 4XQ2A 4CBRA 1RVUA 2AY5A 3B1DA 4MSOA 3ZRQA 1YJSA 1AAWA 1DJUA 4IXZA 3FQ8A 3FZ6A 3HT4A 3W1HA 4F5MA 2AY7A 2JGTA 4F5LA 2VLFA 3RCHB 3F9TA 2R0TA 4ZWMA 2C81A 4IY7A 1ASGA 5I92A 3GWPA 1AKAA 4GE9A 4ZAHA 1JS6A 1M4NA 3NYUA 1TASA 2CSTA 2W8WA 3G8MA 4GE4A 4Y0HA 3ELPA 4ZSYA 2HP1A 3TQXA 2VGSA 3MEBA 3G7QA 1LW5A 2Z9UA 3PA9A 3RQ1A 2AY2A 4GEBA 4MKKA 1DFOA 3D6KA 4OMAA 1VP4A 4K2BA 2QB2A 3DXVA 2EZ1A 3RBFA 2WK9A 2X5DA 4LNJA 2QB3A 3LWSA 5AX8A 3NU8A 4UHOA 1ASAA 3BWNC 3E2ZB 2BI2A 3NYSA 1CZCA 5M4DA 1QJ3A 3RI6A 2QLRA 1OHYA 1KKPA 1DGEA 2CJHA 4I8AA 1GCKA 4UOYA 2ZSLA 4ZSWA 4CVQA 3PD6A 4EU1A 5EQCA 2JG2A 2BI3A 1DGDA 1G7XA 1KL2A 4EFFA 4P7YA 5EIGB 2CTZA 3RCHA 1O4SA 5G4JA 1MLYA 3MC6C 3L44A 3CBFA 4ADCA 1LS3A 1MAQA 2BWNA 4MKJA 4F5HA 3GSBA 3DRDA 2Z9WA 4WLJA 3EI8A 1CZEA 1ZC9A 3F6TA 3VOMA 1FG7A 1I43A 4JEVA 3LVMA 4A6TA 2VMOA 1O69A 4LNLA 1WYVB 4RKDA 5TF5A 3BWNA 2HOZA 4A72A 4Y0IA 5BJ4A 1ASLA 4Q75A 2CFBA 4AO4A 1O62A 1W23A 3B46A 1IX7A 2EH6A 4EB7A 4W1VA 1TPLA 3E2ZA 1E5FA 1WYTA 3FVSA 5J8QA 1SZUA 1BKGA 5M49A 3FQAA 3FRKA 2AY1A 2CINA 4WXGA 3MADA 2ZY5A 1LC7A 2Z61A 3NX3A 4E3QA 3HVYA 4EB5A 1B8GA 1QIRA 2W7DA 1JG8A 2GMSA 3MC6A 1AY8A 2BIAA 5EFSA 2ZYJA 2R5EA 2DR1A 4RJ0A 4WD2A 4WYFA 1ARSA 2W7FA 2DOUA 3NTJA 1SFFA 1GEXA 2X8UA 4E77A 3A8UX 4R5FA 2VGUA 1YJZA 2W7LA 3QI6A 4XK1A 2W7HA 1IX8A 3QN6A 2C7TA 2V1PA 1W7LA 1EQBA 1YNUA 2FQ6A 1N31A 1MDZA 4Q6RA 4AZJA 2VI8A 4F5GA 2ZY4A 2W7EA 3PJ0A 3I16A 4Q31A 1DKAA 3ASBA 3ZZKA 2VYCA 2QBTA 5D5SA 4XAUA 2BIGA 2FNIA 2W8UA 4RJYA 5DJ9A 2D63A 4JEZA 4BQ0A 3GETA 4MY5A 3WLXA 1ARGA 1SF2A 1X2AA 1IX6A 1AKCA 4M2KA 3F0HA 2CH2A 3FD0A 2ZY2A 2E7IA 2G6WA 4N0BA 1G4VA 1GC2A 1V2FA 3HLMA 4K2MA 4UQVA 3NNKA 3PPLA 2CH1A 3K7YA 1FC4A 2C0RA 1MAPA 3BS8A 4A6RA 1S06A 1M7YA 1CQ8A 1KKJA 3HDOA 2TPLA 4MQQA 2Z67A 3GZDC 3G0TA 3TCMA 4UHNA 3ELEA 3LG0A 1B5OA 1QGNA 5EUEA 1QISA 1ARIA 2YKUA 1GD9A 2AATA 3HQTA 3WX9A 5C6UA 3ECDA 3W1IA 2VIBA 3EI7A 3PD6B 1XI9A 5G09A 1OHVA 2WKAA 2PB2A 3EUCA 2BHXA 4B98A 3TFTA 2O0RA 1TOKA 2EZ2A 2WK7A 4WXFA 1WSTA 3ZRPA 2CJDA 1AHFA 2JISA 1AMQA 2EGYA 3HBXA 3RBLA 5BJ3A 2W7GA 4IW7A 1EG5A 1M0OA 1MDOA 2PO3A 2BKWA 2ZSMA 4FL0A 3WGBA 2AY9A 4DBCA 3WCNA 1OHWA 2D61A 3WZFA 7AATA 3IHJA 5LHAA 4CXQA 4MQRA 3N5MA 1BW0A 3CQ5A 3NYTA 4PIWA 3WCOA 1LC5A 2D66A 1AY4A 1GEWA 2GB3A 3GZDA 5G2QA 2Z9XA 2O7CA 3LV2A 3A9YA 1N2TA 3ZZJA 4W8IA 3MBBA 2D65A 2W8VA 3DR7A 4A0GA 1IBJA 3WGCA 1BJNA 2AEVA 2ORDA 1WYTB 4RITA 4F5FA 4IYOA 1AMRA 2FM1A 2BYLA 3L8AA 4U2HA 2HUFA 5F8VA 1ASCA 2Z9VA 3NU7A 4R2NA 4DGTA 5HDMA 4KXKA 3QHXA 2BI5A 1TOEA 2E7JA 3COGA 4GRXA 1C7OA 1GEYA 1DTYA 1H1CA 3AOVA 3ISLA 5EUNA 2VMRA 2E7UA 3NUBA 3UAKA 2OGEA 2VMNA 3FTBA 2VMXA 4NOGA 3DODA 1TOJA 2Z20A 4M2MA 5E4ZA 3FQ7A 2WK8A 2BYJA 3EI6A 1J04A 1E5EA 3FFHA 4WYGA 1AIBA 2ZC0A 2D64A 3BWOA 3Q8NA 2QMAA 2D7YA 2HP2A 1ASBA 3AEMC 3PGYA 1M0NA 2YKYA 3AEPA 1C9CA 1DJEA 2ZJGA 3E2FA 4WB0A 1V2EA 4WYEA
chains in the Genus database with same CATH superfamily
1G7WA 4GDYA 5JAYA 8AATA 3OP7A 4ZDOA 4L0OA 2ZY3A 3DC1A 3EZ1A 1ASDA 3VK3A 2BI9A 5K8BA 4PFFA 1VJOA 3DYDA 3QM2A 3A9XA 4BA4A 1BQDA 2VGWA 1SZKA 2XBNA 2X3LA 5FT5A 1AHYA 3AENB 3FSLA 5HXXA 4H63Q 2D5YA 3BCXA 5M4BA 1Z3ZA 3IF2A 3BCAA 2EYQA 3VK4A 4M2JA 3RUYA 4A0FA 2R5CA 2DGMA 4ZM4A 1G4XA 2O1BA 2HUUA 3AEMA 3BV0A 3R9AA 4A0HA 1CJ0A 1H0CA 1I29A 3DR4A 1Y4IA 5EAAA 3PDBA 2VMYA 1ELUA 1AICA 4OBUA 4WXBA 3N0LA 3FVXA 3MAUA 3E6GA 1ASEA 3BC8A 4W91A 1VEFA 4AOAA 1S07A 4E3RA 2VMSA 2FN6A 3I5TA 3EZSA 3PDXA 1X28A 1BJWA 1YIZA 4RIZA 1D7SA 4K05A 2HUIA 4TMRA 3AELA 2YKVA 1WKHA 1I41A 1QJ5A 4A0RA 3AOWA 3E9KA 4RLGA 2VMPA 3AV7A 1ZODA 1GBNA 3NUIA 3CQ4A 1AX4A 1BJOA 1BS0A 3H7FA 3JW9A 1RV3A 4ADBA 4R8DA 2GQNA 2VMTA 2Q7WA 1TOIA 2PB0A 3ASAA 3EIAA 2W8TA 4ATPA 3AENA 3EI9A 1JF9A 3K40A 3E2YA 4XJLA 1UU0A 2VIAA 2GMUA 2VI9A 2VLHA 3AEOA 1X29A 3FZ8A 2AY6A 3P1TA 1T3IA 4IYOB 4ZDLA 4DQ6A 4ZM3A 1D7RA 1SPAA 4WLHA 4ITGA 1N8PA 2OQXA 4JF1A 2DKJA 2ZUKA 4P3MA 4F5KA 2G7JA 1D7UA 4AZKA 1ARTA 2OKKA 1AHXA 3MKJA 5E3KA 3M5UA 1TARA 1BJ4A 1PFFA 1YAAA 1C0NA 3GR9A 1CQ7A 5HHYA 2DGLA 2DGKA 3FVUA 3DZZA 3I4JA 1OXOA 2Z1YA 3QBOA 4MQPA 3UE8A 5IWQA 2FYFA 4J8LA 4OYTA 3LVKA 4FFCA 2YRIA 4BHDA 4BMKA 1BT4A 4XEWA 2W7JA 4F4EA 2JJHA 3OKSA 2VGTA 2Z1ZA 2CANA 4F5JA 4IXOA 1M0PA 4RKCA 1PMOA 2OKJA 2YKXA 3A9ZA 5G0AA 1S08A 4GSAA 3AEJC 1KMKA 4J5UA 1ZOBA 1IAYA 4TV7A 1AHEA 4PFNA 4LW4A 3FKDA 3QPGA 1CL2A 4WB0B 4UHMA 3KGWA 4JEXA 4ZLVA 4H51A 3JU7A 2NMPA 1MDXA 1AJRA 2CB1A 2HOXA 1XEYA 1S0AA 3B1EA 3GZCA 3KE3A 4OCAA 4Y0DA 4WP0A 3BCBA 4OTLA 1JS3A 1M6SA 1GC4A 2HZPA 1LK9A 3JWAA 1I48A 1CQ6A 4EMYA 1J32A 4U1TA 4Q76A 1AAMA 1RV4A 1RVYA 4ZWVA 4KYOA 1UU2A 3GJUA 3JWBA 3DU4A 4LC3A 1LKCA 3II0A 3NDNA 3P6KA 1GC3A 3TFUA 1X0MA 3KKIA 3W1JA 3QGUA 2R5CB 2W8JA 2YHKA 4IX8A 5LH9A 3AEJA 1C7NA 1AIAA 1ECXA 5DX5A 4CXRA 1AJSA 1ASMA 2JJFA 5DJ1A 3FCRA 1TOGA 3PDBB 4JEWA 4LW2A 3FDBA 4ITXA 4A00A 1S09A 4A6UA 5F9SA 2BWPA 3R4TA 3FDDA 1C7GA 4WBTA 1IVRA 1EJIA 3JZLA 5M46A 4WYDA 5G4IA 3UWCA 2C44A 3USFA 3K28A 2VMZA 2YCNA 4LNMA 1ORDA 4JEYA 2VGZA 4KAMA 3AATA 2CY8A 1LW4A 2BI1A 2VMVA 1AMAA 2EPJA 3ACZA 4RM1A 3FZ7A 3LVLB 2YCPA 4W1XA 2BIEA 2BWOA 3VP6A 1BJOB 1CL1A 4F5IA 5FT6A 4XJOA 1AY5A 4W5KA 1OXPA 5EUDA 3PIUA 1D2FA 1IJIA 1DJ9A 2HOYA 2QA3A 3WY7A 4HVKA 3CAIA 1Z7DA 2VMWA 2JJGA 3H14A 1M0QA 4OT8A 1YJYA 1ASNA 3A2BA 1U08A 4GE7A 2RFVA 3N7NA 4PVFA 1GC0A 4HF8A 4N0WA 2AY3A 4OC9A 3MAFB 3ZRRA 1D7VA 5EAVA 4ZDPA 1PMMA 1C4KA 1KL1A 3FFRA 5KTBA 1SVVA 1WYUB 2YRRA 4AH3A 4K2IA 1AKBA 1MLZA 3B8XA 1W7MA 3DXWA 5E5IA 4MGRA 4JF0A 1BQAA 1ELQA 3NRAA 4OBVA 1FG3A 2KFPA 2OGAA 3EI5A 3TATA 1W7NA 4ATQA 4ISYA 4WYCA 1UKJA 3GBXA 5EIGA 2GSAA 3EIBA 3CQ6A 1OATA 5FT8A 3LVJA 4ZASA 3HMUA 1GDEA 2V0YA 4WYAA 1IAXA 1LC8A 1TATA 2DKBA 4JE5A 2HORA 3VK2A 1O61A 1SZSA 2E54A 2W7IA 1B4XA 3N75A 1CS1A 3HL2A 4BA5A 3B1CA 4CBSA 2AEUA 4E1OA 2FNUA 4XJMA 9AATA 4XJPA 2VMQA 5G2PA 4TN4A 2W7KA 2VGVA 2XH1A 1UU1A 3KGXA 1PG8A 1IUGA 4O6ZA 2X5FA 1WYVA 5DB5A 1YIYA 1KMJA 1YOOA 1AMSA 1WKGA 2OATA 2JJEA 1MGVA 3PAAA 2YCTA 4B9BA 1V2DA 3MAFA 3VAXA 3E77A 3WKSA 1ASFA 2AY8A 2YOBA 3WKRA 1P3WA 2CJGA 1B9IA 1ARHA 5D95A 4QGRA 4ADDA 3BB8A 1WYUA 1W3UA 5FT4A 4RAEA 4ADEA 1M32A 4AO9A 4R5ZA 1V72A 2D7ZA 1QZ9A 2W7MA 1AJSB 2F8JA 2ZP7A 3T32A 1B5PA 2AY4A 3BN1A 4JE5D 3N4RA 3ATHA 2VMUA 3N4XA 1QITA 3JTXA 2EO5A 3LY1A 4W1WA 1B9HA 2R2NA 1AHGA 4IXSA 4XQ2A 4CBRA 1RVUA 2AY5A 3B1DA 4MSOA 3ZRQA 1YJSA 1AAWA 1DJUA 4IXZA 3FQ8A 3FZ6A 3HT4A 3W1HA 4F5MA 2AY7A 2JGTA 4F5LA 2VLFA 3RCHB 3F9TA 2R0TA 4ZWMA 2C81A 4IY7A 1ASGA 5I92A 3GWPA 1AKAA 4GE9A 2QSRA 4ZAHA 1JS6A 1M4NA 3NYUA 1TASA 2CSTA 2WB6A 2W8WA 3G8MA 4GE4A 4Y0HA 3ELPA 4ZSYA 2HP1A 3TQXA 2VGSA 3MEBA 3G7QA 1LW5A 2Z9UA 3PA9A 3RQ1A 2AY2A 4GEBA 4MKKA 1DFOA 3D6KA 4OMAA 1VP4A 4K2BA 2QB2A 3DXVA 2EZ1A 3RBFA 2WK9A 2X5DA 4LNJA 2QB3A 3LWSA 5AX8A 3NU8A 4UHOA 1ASAA 3BWNC 3E2ZB 2BI2A 3NYSA 1CZCA 5M4DA 1QJ3A 3RI6A 2QLRA 1OHYA 1KKPA 1DGEA 2CJHA 4I8AA 1GCKA 4UOYA 2ZSLA 4ZSWA 4CVQA 3PD6A 4EU1A 5EQCA 2JG2A 2BI3A 1DGDA 1G7XA 1KL2A 4EFFA 4P7YA 5EIGB 2CTZA 3RCHA 1O4SA 5G4JA 1MLYA 3MC6C 3L44A 3CBFA 4ADCA 1LS3A 1MAQA 2BWNA 4MKJA 4F5HA 3GSBA 3DRDA 2Z9WA 4WLJA 3EI8A 1CZEA 1ZC9A 1KAFA 3F6TA 3VOMA 1FG7A 1I43A 4JEVA 3LVMA 4A6TA 2VMOA 1O69A 4LNLA 1WYVB 4RKDA 5TF5A 3BWNA 2HOZA 4A72A 4Y0IA 5BJ4A 1ASLA 4Q75A 2CFBA 4AO4A 1O62A 1W23A 3B46A 1IX7A 2EH6A 4EB7A 4W1VA 1TPLA 3E2ZA 1E5FA 1WYTA 3FVSA 5J8QA 1SZUA 1BKGA 5M49A 3FQAA 3FRKA 2AY1A 2CINA 4WXGA 3MADA 2ZY5A 1LC7A 2Z61A 3NX3A 4E3QA 3HVYA 4EB5A 1B8GA 1QIRA 2W7DA 1JG8A 2GMSA 3MC6A 1AY8A 2BIAA 5EFSA 2ZYJA 2R5EA 2A1VA 2DR1A 4RJ0A 4WD2A 4WYFA 1ARSA 2W7FA 2DOUA 3NTJA 3N4SA 1SFFA 1GEXA 2X8UA 4E77A 3A8UX 4R5FA 2VGUA 1YJZA 2W7LA 3QI6A 4XK1A 2W7HA 1IX8A 3QN6A 2C7TA 2V1PA 1W7LA 1EQBA 1YNUA 2FQ6A 1N31A 1MDZA 4Q6RA 4AZJA 2VI8A 4F5GA 2ZY4A 2W7EA 3PJ0A 3I16A 4Q31A 1DKAA 3ASBA 3ZZKA 2VYCA 2QBTA 5D5SA 4XAUA 2BIGA 2FNIA 2W8UA 4RJYA 3H9XA 5DJ9A 2D63A 4JEZA 4BQ0A 3GETA 4MY5A 3WLXA 1ARGA 1SF2A 1X2AA 1IX6A 1AKCA 4M2KA 3F0HA 2CH2A 3FD0A 2ZY2A 2E7IA 2G6WA 4N0BA 1G4VA 1GC2A 1V2FA 3HLMA 4K2MA 4UQVA 3NNKA 3PPLA 2CH1A 3K7YA 1FC4A 2C0RA 1MAPA 3BS8A 4A6RA 1S06A 1M7YA 1CQ8A 1KKJA 3HDOA 2TPLA 4MQQA 2Z67A 3GZDC 3G0TA 3TCMA 4UHNA 3ELEA 3LG0A 1B5OA 1QGNA 5EUEA 1QISA 1ARIA 2YKUA 1GD9A 2AATA 3HQTA 3WX9A 5C6UA 3ECDA 3W1IA 2VIBA 3EI7A 3PD6B 1XI9A 5G09A 1OHVA 2WKAA 2PB2A 3EUCA 2BHXA 4B98A 3TFTA 2O0RA 1TOKA 2EZ2A 2WK7A 4WXFA 1WSTA 3ZRPA 2CJDA 1AHFA 2JISA 1AMQA 2EGYA 3HBXA 3RBLA 5BJ3A 2W7GA 4IW7A 1EG5A 1M0OA 1MDOA 2PO3A 2BKWA 2ZSMA 4FL0A 3WGBA 2AY9A 4DBCA 3WCNA 1OHWA 2D61A 3WZFA 7AATA 3IHJA 5LHAA 4CXQA 4MQRA 3N5MA 1BW0A 3CQ5A 3NYTA 4PIWA 3WCOA 1LC5A 2D66A 1AY4A 1GEWA 2GB3A 3GZDA 5G2QA 2Z9XA 2O7CA 3LV2A 3A9YA 1N2TA 3ZZJA 4W8IA 3MBBA 2D65A 2W8VA 3DR7A 4A0GA 1IBJA 3WGCA 1BJNA 2AEVA 2ORDA 1WYTB 4RITA 4F5FA 4IYOA 1AMRA 2FM1A 2BYLA 3L8AA 4U2HA 2HUFA 5F8VA 1ASCA 2Z9VA 3NU7A 4R2NA 4DGTA 5HDMA 4KXKA 3QHXA 2BI5A 1TOEA 2E7JA 3COGA 4GRXA 1C7OA 1GEYA 1DTYA 1H1CA 3AOVA 3ISLA 5EUNA 2VMRA 2E7UA 3NUBA 3UAKA 2OGEA 2VMNA 3FTBA 2VMXA 4NOGA 3DODA 1TOJA 2Z20A 4M2MA 5E4ZA 3FQ7A 2WK8A 2BYJA 3EI6A 1J04A 1E5EA 3FFHA 4WYGA 1AIBA 2ZC0A 2D64A 3BWOA 3Q8NA 2QMAA 2D7YA 2HP2A 1ASBA 3AEMC 3PGYA 2FKIA 1M0NA 2YKYA 3AEPA 1C9CA 1DJEA 2ZJGA 3E2FA 4WB0A 1V2EA 4WYEA
chains in the Genus database with same CATH topology
1G7WA 4GDYA 5JAYA 8AATA 3OP7A 4ZDOA 4L0OA 2ZY3A 3DC1A 3EZ1A 1ASDA 3VK3A 2BI9A 5K8BA 4PFFA 1VJOA 3DYDA 3QM2A 3A9XA 4BA4A 1BQDA 2VGWA 1SZKA 2XBNA 2X3LA 5FT5A 1AHYA 3AENB 3FSLA 5HXXA 4H63Q 2D5YA 3BCXA 5M4BA 1Z3ZA 3IF2A 3BCAA 2EYQA 3VK4A 4M2JA 3RUYA 4A0FA 2R5CA 2DGMA 4ZM4A 1G4XA 2O1BA 2HUUA 3AEMA 3BV0A 3R9AA 4A0HA 1CJ0A 1H0CA 1I29A 3DR4A 1Y4IA 5EAAA 3PDBA 2VMYA 1ELUA 1AICA 4OBUA 4WXBA 3N0LA 3FVXA 3MAUA 3E6GA 1ASEA 3BC8A 4W91A 1VEFA 4AOAA 1S07A 4E3RA 2VMSA 2FN6A 3I5TA 3EZSA 3PDXA 1X28A 1BJWA 1YIZA 4RIZA 1D7SA 4K05A 2HUIA 4TMRA 3AELA 2YKVA 1WKHA 1I41A 1QJ5A 4A0RA 3AOWA 3E9KA 4RLGA 2VMPA 3AV7A 1ZODA 1GBNA 3NUIA 3CQ4A 1AX4A 1BJOA 1BS0A 3H7FA 3JW9A 1RV3A 4ADBA 4R8DA 2GQNA 2VMTA 2Q7WA 1TOIA 2PB0A 3ASAA 3EIAA 2W8TA 4ATPA 3AENA 3EI9A 1JF9A 3K40A 3E2YA 4XJLA 1UU0A 2VIAA 2GMUA 2VI9A 2VLHA 3AEOA 1X29A 3FZ8A 2AY6A 3P1TA 1T3IA 4IYOB 4ZDLA 4DQ6A 4ZM3A 1D7RA 1SPAA 4WLHA 4ITGA 1N8PA 2OQXA 4JF1A 2DKJA 2ZUKA 4P3MA 4F5KA 2G7JA 1D7UA 4AZKA 1ARTA 2OKKA 1AHXA 3MKJA 5E3KA 3M5UA 1TARA 1BJ4A 1PFFA 1YAAA 1C0NA 3GR9A 1CQ7A 5HHYA 2DGLA 2DGKA 3FVUA 3DZZA 3I4JA 1OXOA 2Z1YA 3QBOA 4MQPA 3UE8A 5IWQA 2FYFA 4J8LA 4OYTA 3LVKA 4FFCA 2YRIA 4BHDA 4BMKA 1BT4A 4XEWA 2W7JA 4F4EA 2JJHA 3OKSA 2VGTA 2Z1ZA 2CANA 4F5JA 4IXOA 1M0PA 4RKCA 1PMOA 2OKJA 2YKXA 3A9ZA 5G0AA 1S08A 4GSAA 3AEJC 1KMKA 4J5UA 1ZOBA 1IAYA 4TV7A 1AHEA 4PFNA 4LW4A 3FKDA 3QPGA 1CL2A 4WB0B 4UHMA 3KGWA 4JEXA 4ZLVA 4H51A 3JU7A 2NMPA 1MDXA 1AJRA 2CB1A 2HOXA 1XEYA 1S0AA 3B1EA 3GZCA 3KE3A 4OCAA 4Y0DA 4WP0A 3BCBA 4OTLA 1JS3A 1M6SA 1GC4A 2HZPA 1LK9A 3JWAA 1I48A 1CQ6A 4EMYA 1J32A 4U1TA 4Q76A 1AAMA 1RV4A 1RVYA 4ZWVA 4KYOA 1UU2A 3GJUA 3JWBA 3DU4A 4LC3A 1LKCA 3II0A 3NDNA 3P6KA 1GC3A 3TFUA 1X0MA 3KKIA 3W1JA 3QGUA 2R5CB 2W8JA 2YHKA 4IX8A 5LH9A 3AEJA 1C7NA 1AIAA 1ECXA 5DX5A 4CXRA 1AJSA 1ASMA 2JJFA 5DJ1A 3FCRA 1TOGA 3PDBB 4JEWA 4LW2A 3FDBA 4ITXA 4A00A 1S09A 4A6UA 5F9SA 2BWPA 3R4TA 3FDDA 1C7GA 4WBTA 1IVRA 1EJIA 3JZLA 5M46A 4WYDA 5G4IA 3UWCA 2C44A 3USFA 3K28A 2VMZA 2YCNA 4LNMA 1ORDA 4JEYA 2VGZA 4KAMA 3AATA 2CY8A 1LW4A 2BI1A 2VMVA 1AMAA 2EPJA 3ACZA 4RM1A 3FZ7A 3LVLB 2YCPA 4W1XA 2BIEA 2BWOA 3VP6A 1BJOB 1CL1A 4F5IA 5FT6A 4XJOA 1AY5A 4W5KA 1OXPA 5EUDA 3PIUA 1D2FA 1IJIA 1DJ9A 2HOYA 2QA3A 3WY7A 4HVKA 3CAIA 1Z7DA 2VMWA 2JJGA 3H14A 1M0QA 4OT8A 1YJYA 1ASNA 3A2BA 1U08A 4GE7A 2RFVA 3N7NA 4PVFA 1GC0A 4HF8A 4N0WA 2AY3A 4OC9A 3MAFB 3ZRRA 1D7VA 5EAVA 4ZDPA 1PMMA 1C4KA 1KL1A 3FFRA 5KTBA 1SVVA 1WYUB 2YRRA 4AH3A 4K2IA 1AKBA 1MLZA 3B8XA 1W7MA 3DXWA 5E5IA 4MGRA 4JF0A 1BQAA 1ELQA 3NRAA 4OBVA 1FG3A 2KFPA 2OGAA 3EI5A 3TATA 1W7NA 4ATQA 4ISYA 4WYCA 1UKJA 3GBXA 5EIGA 2GSAA 3EIBA 3CQ6A 1OATA 5FT8A 3LVJA 4ZASA 3HMUA 1GDEA 2V0YA 4WYAA 1IAXA 1LC8A 1TATA 2DKBA 4JE5A 2HORA 3VK2A 1O61A 1SZSA 2E54A 2W7IA 1B4XA 3N75A 1CS1A 3HL2A 4BA5A 3B1CA 4CBSA 2AEUA 4E1OA 2FNUA 4XJMA 9AATA 4XJPA 2VMQA 5G2PA 4TN4A 2W7KA 2VGVA 2XH1A 1UU1A 3KGXA 1PG8A 1IUGA 4O6ZA 2X5FA 1WYVA 5DB5A 1YIYA 1KMJA 1YOOA 1AMSA 1WKGA 2OATA 2JJEA 1MGVA 3PAAA 2YCTA 4B9BA 1V2DA 3MAFA 3VAXA 3E77A 3WKSA 1ASFA 2AY8A 2YOBA 3WKRA 1P3WA 2CJGA 1B9IA 1ARHA 5D95A 4QGRA 4ADDA 3BB8A 1WYUA 1W3UA 5FT4A 4RAEA 4ADEA 1M32A 4AO9A 4R5ZA 1V72A 2D7ZA 1QZ9A 2W7MA 1AJSB 2F8JA 2ZP7A 3T32A 1B5PA 2AY4A 3BN1A 4JE5D 3N4RA 3ATHA 2VMUA 3N4XA 1QITA 3JTXA 2EO5A 3LY1A 4W1WA 1B9HA 2R2NA 1AHGA 4IXSA 4XQ2A 4CBRA 1RVUA 2AY5A 3B1DA 4MSOA 3ZRQA 1YJSA 1AAWA 1DJUA 4IXZA 3FQ8A 3FZ6A 3HT4A 3W1HA 4F5MA 2AY7A 2JGTA 4F5LA 2VLFA 3RCHB 3F9TA 2R0TA 4ZWMA 2C81A 4IY7A 1ASGA 5I92A 3GWPA 1AKAA 4GE9A 2QSRA 4ZAHA 1JS6A 1M4NA 3NYUA 1TASA 2CSTA 2WB6A 2W8WA 3G8MA 4GE4A 4Y0HA 3ELPA 4ZSYA 2HP1A 3TQXA 2VGSA 3MEBA 3G7QA 1LW5A 2Z9UA 3PA9A 3RQ1A 2AY2A 4GEBA 4MKKA 1DFOA 3D6KA 4OMAA 1VP4A 4K2BA 2QB2A 3DXVA 2EZ1A 3RBFA 2WK9A 2X5DA 4LNJA 2QB3A 3LWSA 5AX8A 3NU8A 4UHOA 1ASAA 3BWNC 3E2ZB 2BI2A 3NYSA 1CZCA 5M4DA 1QJ3A 3RI6A 2QLRA 1OHYA 1KKPA 1DGEA 2CJHA 4I8AA 1GCKA 4UOYA 2ZSLA 4ZSWA 4CVQA 3PD6A 4EU1A 5EQCA 2JG2A 2BI3A 1DGDA 1G7XA 1KL2A 4EFFA 4P7YA 5EIGB 2CTZA 3RCHA 1O4SA 5G4JA 1MLYA 3MC6C 3L44A 3CBFA 4ADCA 1LS3A 1MAQA 2BWNA 4MKJA 4F5HA 3GSBA 3DRDA 2Z9WA 4WLJA 3EI8A 1CZEA 1ZC9A 3F6TA 3VOMA 1FG7A 1I43A 4JEVA 3LVMA 4A6TA 2VMOA 1O69A 4LNLA 1WYVB 4RKDA 5TF5A 3BWNA 2HOZA 4A72A 4Y0IA 5BJ4A 1ASLA 4Q75A 2CFBA 4AO4A 1O62A 1W23A 3B46A 1IX7A 2EH6A 4EB7A 4W1VA 1TPLA 3E2ZA 1E5FA 1WYTA 3FVSA 5J8QA 1SZUA 1BKGA 5M49A 3FQAA 3FRKA 2AY1A 2CINA 4WXGA 3MADA 2ZY5A 1LC7A 2Z61A 3NX3A 4E3QA 3HVYA 4EB5A 1B8GA 1QIRA 2W7DA 1JG8A 2GMSA 3MC6A 1AY8A 2BIAA 5EFSA 2ZYJA 2R5EA 2A1VA 2DR1A 4RJ0A 4WD2A 4WYFA 1ARSA 2W7FA 2DOUA 3NTJA 3N4SA 1SFFA 1GEXA 2X8UA 4E77A 3A8UX 4R5FA 2VGUA 1YJZA 2W7LA 3QI6A 4XK1A 2W7HA 1IX8A 3QN6A 2C7TA 2V1PA 1W7LA 1EQBA 1YNUA 2FQ6A 1N31A 1MDZA 4Q6RA 4AZJA 2VI8A 4F5GA 2ZY4A 2W7EA 3PJ0A 3I16A 4Q31A 1DKAA 3ASBA 3ZZKA 2VYCA 2QBTA 5D5SA 4XAUA 2BIGA 2FNIA 2W8UA 4RJYA 3H9XA 5DJ9A 2D63A 4JEZA 4BQ0A 3GETA 4MY5A 3WLXA 1ARGA 1SF2A 1X2AA 1IX6A 1AKCA 4M2KA 3F0HA 2CH2A 3FD0A 2ZY2A 2E7IA 2G6WA 4N0BA 1G4VA 1GC2A 1V2FA 3HLMA 4K2MA 4UQVA 3NNKA 3PPLA 2CH1A 3K7YA 1FC4A 2C0RA 1MAPA 3BS8A 4A6RA 1S06A 1M7YA 1CQ8A 1KKJA 3HDOA 2TPLA 4MQQA 2Z67A 3GZDC 3G0TA 3TCMA 4UHNA 3ELEA 3LG0A 1B5OA 1QGNA 5EUEA 1QISA 1ARIA 2YKUA 1GD9A 2AATA 3HQTA 3WX9A 5C6UA 3ECDA 3W1IA 2VIBA 3EI7A 3PD6B 1XI9A 5G09A 1OHVA 2WKAA 2PB2A 3EUCA 2BHXA 4B98A 3TFTA 2O0RA 1TOKA 2EZ2A 2WK7A 4WXFA 1WSTA 3ZRPA 2CJDA 1AHFA 2JISA 1AMQA 2EGYA 3HBXA 3RBLA 5BJ3A 2W7GA 4IW7A 1EG5A 1M0OA 1MDOA 2PO3A 2BKWA 2ZSMA 4FL0A 3WGBA 2AY9A 4DBCA 3WCNA 1OHWA 2D61A 3WZFA 7AATA 3IHJA 5LHAA 4CXQA 4MQRA 3N5MA 1BW0A 3CQ5A 3NYTA 4PIWA 3WCOA 1LC5A 2D66A 1AY4A 1GEWA 2GB3A 3GZDA 5G2QA 2Z9XA 2O7CA 3LV2A 3A9YA 1N2TA 3ZZJA 4W8IA 3MBBA 2D65A 2W8VA 3DR7A 4A0GA 1IBJA 3WGCA 1BJNA 2AEVA 2ORDA 1WYTB 4RITA 4F5FA 4IYOA 1AMRA 2FM1A 2BYLA 3L8AA 4U2HA 2HUFA 5F8VA 1ASCA 2Z9VA 3NU7A 4R2NA 4DGTA 5HDMA 4KXKA 3QHXA 2BI5A 1TOEA 2E7JA 3COGA 4GRXA 1C7OA 1GEYA 1DTYA 1H1CA 3AOVA 3ISLA 5EUNA 2VMRA 2E7UA 3NUBA 3UAKA 2OGEA 2VMNA 3FTBA 2VMXA 4NOGA 3DODA 1TOJA 2Z20A 4M2MA 5E4ZA 3FQ7A 2WK8A 2BYJA 3EI6A 1J04A 1E5EA 3FFHA 4WYGA 1AIBA 2ZC0A 2D64A 3BWOA 3Q8NA 2QMAA 2D7YA 2HP2A 1ASBA 3AEMC 3PGYA 2FKIA 1M0NA 2YKYA 3AEPA 1C9CA 1DJEA 2ZJGA 3E2FA 4WB0A 1V2EA 4WYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G7W A;  4GDY A;  5JAY A;  8AAT A;  3OP7 A;  4ZDO A;  4L0O A;  2ZY3 A;  3DC1 A;  3EZ1 A;  1ASD A;  3VK3 A;  2BI9 A;  5K8B A;  4PFF A;  1VJO A;  3DYD A;  3QM2 A;  3A9X A;  4BA4 A;  1BQD A;  2VGW A;  1SZK A;  2XBN A;  2X3L A;  5FT5 A;  1AHY A;  3AEN B;  3FSL A;  5HXX A;  2D5Y A;  3BCX A;  5M4B A;  1Z3Z A;  3IF2 A;  3BCA A;  3VK4 A;  4M2J A;  3RUY A;  4A0F A;  2R5C A;  2DGM A;  4ZM4 A;  1G4X A;  2O1B A;  2HUU A;  3AEM A;  3BV0 A;  3R9A A;  4A0H A;  1CJ0 A;  1H0C A;  1I29 A;  3DR4 A;  1Y4I A;  5EAA A;  3PDB A;  2VMY A;  1ELU A;  1AIC A;  4OBU A;  4WXB A;  3N0L A;  3FVX A;  3MAU A;  3E6G A;  1ASE A;  3BC8 A;  4W91 A;  1VEF A;  4AOA A;  1S07 A;  4E3R A;  2VMS A;  2FN6 A;  3I5T A;  3EZS A;  3PDX A;  1X28 A;  1BJW A;  1YIZ A;  4RIZ A;  1D7S A;  2HUI A;  4TMR A;  3AEL A;  2YKV A;  1WKH A;  1I41 A;  1QJ5 A;  4A0R A;  3AOW A;  3E9K A;  4RLG A;  2VMP A;  3AV7 A;  1ZOD A;  1GBN A;  3NUI A;  3CQ4 A;  1AX4 A;  1BJO A;  1BS0 A;  3H7F A;  3JW9 A;  1RV3 A;  4ADB A;  4R8D A;  2GQN A;  2VMT A;  2Q7W A;  1TOI A;  2PB0 A;  3ASA A;  3EIA A;  2W8T A;  4ATP A;  3AEN A;  3EI9 A;  1JF9 A;  3K40 A;  3E2Y A;  4XJL A;  1UU0 A;  2VIA A;  2GMU A;  2VI9 A;  2VLH A;  3AEO A;  1X29 A;  3FZ8 A;  2AY6 A;  3P1T A;  1T3I A;  4IYO B;  4ZDL A;  4DQ6 A;  4ZM3 A;  1D7R A;  1SPA A;  4WLH A;  4ITG A;  1N8P A;  2OQX A;  4JF1 A;  2DKJ A;  2ZUK A;  4P3M A;  4F5K A;  1D7U A;  4AZK A;  1ART A;  2OKK A;  1AHX A;  3MKJ A;  5E3K A;  3M5U A;  1TAR A;  1BJ4 A;  1PFF A;  1YAA A;  1C0N A;  3GR9 A;  1CQ7 A;  5HHY A;  2DGL A;  2DGK A;  3FVU A;  3DZZ A;  3I4J A;  1OXO A;  2Z1Y A;  3QBO A;  4MQP A;  3UE8 A;  5IWQ A;  2FYF A;  4J8L A;  4OYT A;  3LVK A;  4FFC A;  2YRI A;  4BHD A;  4BMK A;  1BT4 A;  4XEW A;  2W7J A;  4F4E A;  2JJH A;  3OKS A;  2VGT A;  2Z1Z A;  2CAN A;  4F5J A;  4IXO A;  1M0P A;  4RKC A;  1PMO A;  2OKJ A;  2YKX A;  3A9Z A;  5G0A A;  1S08 A;  4GSA A;  3AEJ C;  1KMK A;  4J5U A;  1ZOB A;  1IAY A;  4TV7 A;  1AHE A;  4PFN A;  4LW4 A;  3FKD A;  3QPG A;  1CL2 A;  4WB0 B;  4UHM A;  3KGW A;  4JEX A;  4ZLV A;  4H51 A;  3JU7 A;  2NMP A;  1MDX A;  1AJR A;  2CB1 A;  2HOX A;  1XEY A;  1S0A A;  3B1E A;  3GZC A;  3KE3 A;  4OCA A;  4Y0D A;  4WP0 A;  3BCB A;  4OTL A;  1JS3 A;  1M6S A;  1GC4 A;  2HZP A;  1LK9 A;  3JWA A;  1I48 A;  1CQ6 A;  4EMY A;  1J32 A;  4U1T A;  4Q76 A;  1AAM A;  1RV4 A;  1RVY A;  4ZWV A;  4KYO A;  1UU2 A;  3GJU A;  3JWB A;  3DU4 A;  4LC3 A;  1LKC A;  3II0 A;  3NDN A;  3P6K A;  1GC3 A;  3TFU A;  1X0M A;  3KKI A;  3W1J A;  3QGU A;  2R5C B;  2W8J A;  2YHK A;  4IX8 A;  5LH9 A;  3AEJ A;  1C7N A;  1AIA A;  1ECX A;  5DX5 A;  4CXR A;  1AJS A;  1ASM A;  2JJF A;  5DJ1 A;  3FCR A;  1TOG A;  3PDB B;  4JEW A;  4LW2 A;  3FDB A;  4ITX A;  4A00 A;  1S09 A;  4A6U A;  5F9S A;  2BWP A;  3R4T A;  3FDD A;  1C7G A;  4WBT A;  1IVR A;  1EJI A;  3JZL A;  5M46 A;  4WYD A;  5G4I A;  3UWC A;  2C44 A;  3USF A;  3K28 A;  2VMZ A;  2YCN A;  4LNM A;  1ORD A;  4JEY A;  2VGZ A;  4KAM A;  3AAT A;  2CY8 A;  1LW4 A;  2BI1 A;  2VMV A;  1AMA A;  2EPJ A;  3ACZ A;  4RM1 A;  3FZ7 A;  3LVL B;  2YCP A;  4W1X A;  2BIE A;  2BWO A;  3VP6 A;  1BJO B;  1CL1 A;  4F5I A;  5FT6 A;  4XJO A;  1AY5 A;  4W5K A;  1OXP A;  5EUD A;  3PIU A;  1D2F A;  1IJI A;  1DJ9 A;  2HOY A;  2QA3 A;  3WY7 A;  4HVK A;  3CAI A;  1Z7D A;  2VMW A;  2JJG A;  3H14 A;  1M0Q A;  4OT8 A;  1YJY A;  1ASN A;  3A2B A;  1U08 A;  4GE7 A;  2RFV A;  4PVF A;  1GC0 A;  4HF8 A;  4N0W A;  2AY3 A;  4OC9 A;  3MAF B;  3ZRR A;  1D7V A;  5EAV A;  4ZDP A;  1PMM A;  1C4K A;  1KL1 A;  3FFR A;  1SVV A;  1WYU B;  2YRR A;  4AH3 A;  4K2I A;  1AKB A;  1MLZ A;  3B8X A;  1W7M A;  3DXW A;  5E5I A;  4MGR A;  4JF0 A;  1BQA A;  1ELQ A;  3NRA A;  4OBV A;  1FG3 A;  2OGA A;  3EI5 A;  3TAT A;  1W7N A;  4ATQ A;  4ISY A;  4WYC A;  1UKJ A;  3GBX A;  5EIG A;  2GSA A;  3EIB A;  3CQ6 A;  1OAT A;  5FT8 A;  3LVJ A;  4ZAS A;  3HMU A;  1GDE A;  2V0Y A;  4WYA A;  1IAX A;  1LC8 A;  1TAT A;  2DKB A;  4JE5 A;  2HOR A;  3VK2 A;  1O61 A;  1SZS A;  2E54 A;  2W7I A;  1B4X A;  3N75 A;  1CS1 A;  3HL2 A;  4BA5 A;  3B1C A;  4CBS A;  2AEU A;  4E1O A;  2FNU A;  4XJM A;  9AAT A;  4XJP A;  2VMQ A;  5G2P A;  4TN4 A;  2W7K A;  2VGV A;  2XH1 A;  1UU1 A;  3KGX A;  1PG8 A;  1IUG A;  4O6Z A;  2X5F A;  1WYV A;  5DB5 A;  1YIY A;  1KMJ A;  1YOO A;  1AMS A;  1WKG A;  2OAT A;  2JJE A;  1MGV A;  3PAA A;  2YCT A;  4B9B A;  1V2D A;  3MAF A;  3VAX A;  3E77 A;  3WKS A;  1ASF A;  2AY8 A;  2YOB A;  3WKR A;  1P3W A;  2CJG A;  1B9I A;  1ARH A;  5D95 A;  4QGR A;  4ADD A;  3BB8 A;  1WYU A;  1W3U A;  5FT4 A;  4RAE A;  4ADE A;  1M32 A;  4AO9 A;  4R5Z A;  1V72 A;  2D7Z A;  1QZ9 A;  2W7M A;  1AJS B;  2F8J A;  2ZP7 A;  3T32 A;  1B5P A;  2AY4 A;  3BN1 A;  4JE5 D;  3ATH A;  2VMU A;  1QIT A;  3JTX A;  2EO5 A;  3LY1 A;  4W1W A;  1B9H A;  2R2N A;  1AHG A;  4IXS A;  4XQ2 A;  4CBR A;  1RVU A;  2AY5 A;  3B1D A;  4MSO A;  3ZRQ A;  1YJS A;  1AAW A;  1DJU A;  4IXZ A;  3FQ8 A;  3FZ6 A;  3HT4 A;  3W1H A;  4F5M A;  2AY7 A;  2JGT A;  4F5L A;  2VLF A;  3RCH B;  3F9T A;  2R0T A;  4ZWM A;  2C81 A;  4IY7 A;  1ASG A;  5I92 A;  3GWP A;  1AKA A;  4GE9 A;  4ZAH A;  1JS6 A;  1M4N A;  3NYU A;  1TAS A;  2CST A;  2W8W A;  3G8M A;  4GE4 A;  4Y0H A;  3ELP A;  4ZSY A;  2HP1 A;  3TQX A;  2VGS A;  3MEB A;  3G7Q A;  1LW5 A;  2Z9U A;  3PA9 A;  3RQ1 A;  2AY2 A;  4GEB A;  4MKK A;  1DFO A;  3D6K A;  4OMA A;  1VP4 A;  4K2B A;  2QB2 A;  3DXV A;  2EZ1 A;  3RBF A;  2WK9 A;  2X5D A;  4LNJ A;  2QB3 A;  3LWS A;  5AX8 A;  3NU8 A;  4UHO A;  1ASA A;  3BWN C;  3E2Z B;  2BI2 A;  3NYS A;  1CZC A;  5M4D A;  1QJ3 A;  3RI6 A;  2QLR A;  1OHY A;  1KKP A;  1DGE A;  2CJH A;  4I8A A;  1GCK A;  4UOY A;  2ZSL A;  4ZSW A;  4CVQ A;  3PD6 A;  4EU1 A;  5EQC A;  2JG2 A;  2BI3 A;  1DGD A;  1G7X A;  1KL2 A;  4EFF A;  4P7Y A;  5EIG B;  2CTZ A;  3RCH A;  1O4S A;  5G4J A;  1MLY A;  3MC6 C;  3L44 A;  3CBF A;  4ADC A;  1LS3 A;  1MAQ A;  2BWN A;  4MKJ A;  4F5H A;  3GSB A;  3DRD A;  2Z9W A;  4WLJ A;  3EI8 A;  1CZE A;  1ZC9 A;  3F6T A;  3VOM A;  1FG7 A;  1I43 A;  4JEV A;  3LVM A;  4A6T A;  2VMO A;  1O69 A;  4LNL A;  1WYV B;  4RKD A;  5TF5 A;  3BWN A;  2HOZ A;  4A72 A;  4Y0I A;  5BJ4 A;  1ASL A;  4Q75 A;  2CFB A;  4AO4 A;  1O62 A;  1W23 A;  3B46 A;  1IX7 A;  2EH6 A;  4EB7 A;  4W1V A;  1TPL A;  3E2Z A;  1E5F A;  1WYT A;  3FVS A;  5J8Q A;  1SZU A;  1BKG A;  5M49 A;  3FQA A;  3FRK A;  2AY1 A;  2CIN A;  4WXG A;  3MAD A;  2ZY5 A;  1LC7 A;  2Z61 A;  3NX3 A;  4E3Q A;  3HVY A;  4EB5 A;  1B8G A;  1QIR A;  2W7D A;  1JG8 A;  2GMS A;  3MC6 A;  1AY8 A;  2BIA A;  5EFS A;  2ZYJ A;  2R5E A;  2DR1 A;  4RJ0 A;  4WD2 A;  4WYF A;  1ARS A;  2W7F A;  2DOU A;  3NTJ A;  1SFF A;  1GEX A;  2X8U A;  4E77 A;  3A8U X;  4R5F A;  2VGU A;  1YJZ A;  2W7L A;  3QI6 A;  4XK1 A;  2W7H A;  1IX8 A;  3QN6 A;  2C7T A;  2V1P A;  1W7L A;  1EQB A;  1YNU A;  2FQ6 A;  1N31 A;  1MDZ A;  4Q6R A;  4AZJ A;  2VI8 A;  4F5G A;  2ZY4 A;  2W7E A;  3PJ0 A;  3I16 A;  4Q31 A;  1DKA A;  3ASB A;  3ZZK A;  2VYC A;  2QBT A;  5D5S A;  4XAU A;  2BIG A;  2FNI A;  2W8U A;  4RJY A;  5DJ9 A;  2D63 A;  4JEZ A;  4BQ0 A;  3GET A;  4MY5 A;  3WLX A;  1ARG A;  1SF2 A;  1X2A A;  1IX6 A;  1AKC A;  4M2K A;  3F0H A;  2CH2 A;  3FD0 A;  2ZY2 A;  2E7I A;  2G6W A;  4N0B A;  1G4V A;  1GC2 A;  1V2F A;  3HLM A;  4K2M A;  4UQV A;  3NNK A;  3PPL A;  2CH1 A;  3K7Y A;  1FC4 A;  2C0R A;  1MAP A;  3BS8 A;  4A6R A;  1S06 A;  1M7Y A;  1CQ8 A;  1KKJ A;  3HDO A;  2TPL A;  4MQQ A;  2Z67 A;  3GZD C;  3G0T A;  3TCM A;  4UHN A;  3ELE A;  3LG0 A;  1B5O A;  1QGN A;  5EUE A;  1QIS A;  1ARI A;  2YKU A;  1GD9 A;  2AAT A;  3HQT A;  3WX9 A;  5C6U A;  3ECD A;  3W1I A;  2VIB A;  3EI7 A;  3PD6 B;  1XI9 A;  5G09 A;  1OHV A;  2WKA A;  2PB2 A;  3EUC A;  2BHX A;  4B98 A;  3TFT A;  2O0R A;  1TOK A;  2EZ2 A;  2WK7 A;  4WXF A;  1WST A;  3ZRP A;  2CJD A;  1AHF A;  2JIS A;  1AMQ A;  2EGY A;  3HBX A;  3RBL A;  5BJ3 A;  2W7G A;  4IW7 A;  1EG5 A;  1M0O A;  1MDO A;  2PO3 A;  2BKW A;  2ZSM A;  4FL0 A;  3WGB A;  2AY9 A;  4DBC A;  3WCN A;  1OHW A;  2D61 A;  3WZF A;  7AAT A;  3IHJ A;  5LHA A;  4CXQ A;  4MQR A;  3N5M A;  1BW0 A;  3CQ5 A;  3NYT A;  4PIW A;  3WCO A;  1LC5 A;  2D66 A;  1AY4 A;  1GEW A;  2GB3 A;  3GZD A;  5G2Q A;  2Z9X A;  2O7C A;  3LV2 A;  3A9Y A;  1N2T A;  3ZZJ A;  4W8I A;  3MBB A;  2D65 A;  2W8V A;  3DR7 A;  4A0G A;  1IBJ A;  3WGC A;  1BJN A;  2AEV A;  2ORD A;  1WYT B;  4RIT A;  4F5F A;  4IYO A;  1AMR A;  2FM1 A;  2BYL A;  3L8A A;  4U2H A;  2HUF A;  5F8V A;  1ASC A;  2Z9V A;  3NU7 A;  4R2N A;  4DGT A;  5HDM A;  4KXK A;  3QHX A;  2BI5 A;  1TOE A;  2E7J A;  3COG A;  4GRX A;  1C7O A;  1GEY A;  1DTY A;  1H1C A;  3AOV A;  3ISL A;  5EUN A;  2VMR A;  2E7U A;  3NUB A;  3UAK A;  2OGE A;  2VMN A;  3FTB A;  2VMX A;  4NOG A;  3DOD A;  1TOJ A;  2Z20 A;  4M2M A;  5E4Z A;  3FQ7 A;  2WK8 A;  2BYJ A;  3EI6 A;  1J04 A;  1E5E A;  3FFH A;  4WYG A;  1AIB A;  2ZC0 A;  2D64 A;  3BWO A;  3Q8N A;  2QMA A;  2D7Y A;  2HP2 A;  1ASB A;  3AEM C;  3PGY A;  1M0N A;  2YKY A;  3AEP A;  1C9C A;  1DJE A;  2ZJG A;  3E2F A;  4WB0 A;  1V2E A;  4WYE A; 
#chains in the Genus database with same CATH topology
 1G7W A;  4GDY A;  5JAY A;  8AAT A;  3OP7 A;  4ZDO A;  4L0O A;  2ZY3 A;  3DC1 A;  3EZ1 A;  1ASD A;  3VK3 A;  2BI9 A;  5K8B A;  4PFF A;  1VJO A;  3DYD A;  3QM2 A;  3A9X A;  4BA4 A;  1BQD A;  2VGW A;  1SZK A;  2XBN A;  2X3L A;  5FT5 A;  1AHY A;  3AEN B;  3FSL A;  5HXX A;  4H63 Q;  2D5Y A;  3BCX A;  5M4B A;  1Z3Z A;  3IF2 A;  3BCA A;  2EYQ A;  3VK4 A;  4M2J A;  3RUY A;  4A0F A;  2R5C A;  2DGM A;  4ZM4 A;  1G4X A;  2O1B A;  2HUU A;  3AEM A;  3BV0 A;  3R9A A;  4A0H A;  1CJ0 A;  1H0C A;  1I29 A;  3DR4 A;  1Y4I A;  5EAA A;  3PDB A;  2VMY A;  1ELU A;  1AIC A;  4OBU A;  4WXB A;  3N0L A;  3FVX A;  3MAU A;  3E6G A;  1ASE A;  3BC8 A;  4W91 A;  1VEF A;  4AOA A;  1S07 A;  4E3R A;  2VMS A;  2FN6 A;  3I5T A;  3EZS A;  3PDX A;  1X28 A;  1BJW A;  1YIZ A;  4RIZ A;  1D7S A;  4K05 A;  2HUI A;  4TMR A;  3AEL A;  2YKV A;  1WKH A;  1I41 A;  1QJ5 A;  4A0R A;  3AOW A;  3E9K A;  4RLG A;  2VMP A;  3AV7 A;  1ZOD A;  1GBN A;  3NUI A;  3CQ4 A;  1AX4 A;  1BJO A;  1BS0 A;  3H7F A;  3JW9 A;  1RV3 A;  4ADB A;  4R8D A;  2GQN A;  2VMT A;  2Q7W A;  1TOI A;  2PB0 A;  3ASA A;  3EIA A;  2W8T A;  4ATP A;  3AEN A;  3EI9 A;  1JF9 A;  3K40 A;  3E2Y A;  4XJL A;  1UU0 A;  2VIA A;  2GMU A;  2VI9 A;  2VLH A;  3AEO A;  1X29 A;  3FZ8 A;  2AY6 A;  3P1T A;  1T3I A;  4IYO B;  4ZDL A;  4DQ6 A;  4ZM3 A;  1D7R A;  1SPA A;  4WLH A;  4ITG A;  1N8P A;  2OQX A;  4JF1 A;  2DKJ A;  2ZUK A;  4P3M A;  4F5K A;  2G7J A;  1D7U A;  4AZK A;  1ART A;  2OKK A;  1AHX A;  3MKJ A;  5E3K A;  3M5U A;  1TAR A;  1BJ4 A;  1PFF A;  1YAA A;  1C0N A;  3GR9 A;  1CQ7 A;  5HHY A;  2DGL A;  2DGK A;  3FVU A;  3DZZ A;  3I4J A;  1OXO A;  2Z1Y A;  3QBO A;  4MQP A;  3UE8 A;  5IWQ A;  2FYF A;  4J8L A;  4OYT A;  3LVK A;  4FFC A;  2YRI A;  4BHD A;  4BMK A;  1BT4 A;  4XEW A;  2W7J A;  4F4E A;  2JJH A;  3OKS A;  2VGT A;  2Z1Z A;  2CAN A;  4F5J A;  4IXO A;  1M0P A;  4RKC A;  1PMO A;  2OKJ A;  2YKX A;  3A9Z A;  5G0A A;  1S08 A;  4GSA A;  3AEJ C;  1KMK A;  4J5U A;  1ZOB A;  1IAY A;  4TV7 A;  1AHE A;  4PFN A;  4LW4 A;  3FKD A;  3QPG A;  1CL2 A;  4WB0 B;  4UHM A;  3KGW A;  4JEX A;  4ZLV A;  4H51 A;  3JU7 A;  2NMP A;  1MDX A;  1AJR A;  2CB1 A;  2HOX A;  1XEY A;  1S0A A;  3B1E A;  3GZC A;  3KE3 A;  4OCA A;  4Y0D A;  4WP0 A;  3BCB A;  4OTL A;  1JS3 A;  1M6S A;  1GC4 A;  2HZP A;  1LK9 A;  3JWA A;  1I48 A;  1CQ6 A;  4EMY A;  1J32 A;  4U1T A;  4Q76 A;  1AAM A;  1RV4 A;  1RVY A;  4ZWV A;  4KYO A;  1UU2 A;  3GJU A;  3JWB A;  3DU4 A;  4LC3 A;  1LKC A;  3II0 A;  3NDN A;  3P6K A;  1GC3 A;  3TFU A;  1X0M A;  3KKI A;  3W1J A;  3QGU A;  2R5C B;  2W8J A;  2YHK A;  4IX8 A;  5LH9 A;  3AEJ A;  1C7N A;  1AIA A;  1ECX A;  5DX5 A;  4CXR A;  1AJS A;  1ASM A;  2JJF A;  5DJ1 A;  3FCR A;  1TOG A;  3PDB B;  4JEW A;  4LW2 A;  3FDB A;  4ITX A;  4A00 A;  1S09 A;  4A6U A;  5F9S A;  2BWP A;  3R4T A;  3FDD A;  1C7G A;  4WBT A;  1IVR A;  1EJI A;  3JZL A;  5M46 A;  4WYD A;  5G4I A;  3UWC A;  2C44 A;  3USF A;  3K28 A;  2VMZ A;  2YCN A;  4LNM A;  1ORD A;  4JEY A;  2VGZ A;  4KAM A;  3AAT A;  2CY8 A;  1LW4 A;  2BI1 A;  2VMV A;  1AMA A;  2EPJ A;  3ACZ A;  4RM1 A;  3FZ7 A;  3LVL B;  2YCP A;  4W1X A;  2BIE A;  2BWO A;  3VP6 A;  1BJO B;  1CL1 A;  4F5I A;  5FT6 A;  4XJO A;  1AY5 A;  4W5K A;  1OXP A;  5EUD A;  3PIU A;  1D2F A;  1IJI A;  1DJ9 A;  2HOY A;  2QA3 A;  3WY7 A;  4HVK A;  3CAI A;  1Z7D A;  2VMW A;  2JJG A;  3H14 A;  1M0Q A;  4OT8 A;  1YJY A;  1ASN A;  3A2B A;  1U08 A;  4GE7 A;  2RFV A;  3N7N A;  4PVF A;  1GC0 A;  4HF8 A;  4N0W A;  2AY3 A;  4OC9 A;  3MAF B;  3ZRR A;  1D7V A;  5EAV A;  4ZDP A;  1PMM A;  1C4K A;  1KL1 A;  3FFR A;  5KTB A;  1SVV A;  1WYU B;  2YRR A;  4AH3 A;  4K2I A;  1AKB A;  1MLZ A;  3B8X A;  1W7M A;  3DXW A;  5E5I A;  4MGR A;  4JF0 A;  1BQA A;  1ELQ A;  3NRA A;  4OBV A;  1FG3 A;  2KFP A;  2OGA A;  3EI5 A;  3TAT A;  1W7N A;  4ATQ A;  4ISY A;  4WYC A;  1UKJ A;  3GBX A;  5EIG A;  2GSA A;  3EIB A;  3CQ6 A;  1OAT A;  5FT8 A;  3LVJ A;  4ZAS A;  3HMU A;  1GDE A;  2V0Y A;  4WYA A;  1IAX A;  1LC8 A;  1TAT A;  2DKB A;  4JE5 A;  2HOR A;  3VK2 A;  1O61 A;  1SZS A;  2E54 A;  2W7I A;  1B4X A;  3N75 A;  1CS1 A;  3HL2 A;  4BA5 A;  3B1C A;  4CBS A;  2AEU A;  4E1O A;  2FNU A;  4XJM A;  9AAT A;  4XJP A;  2VMQ A;  5G2P A;  4TN4 A;  2W7K A;  2VGV A;  2XH1 A;  1UU1 A;  3KGX A;  1PG8 A;  1IUG A;  4O6Z A;  2X5F A;  1WYV A;  5DB5 A;  1YIY A;  1KMJ A;  1YOO A;  1AMS A;  1WKG A;  2OAT A;  2JJE A;  1MGV A;  3PAA A;  2YCT A;  4B9B A;  1V2D A;  3MAF A;  3VAX A;  3E77 A;  3WKS A;  1ASF A;  2AY8 A;  2YOB A;  3WKR A;  1P3W A;  2CJG A;  1B9I A;  1ARH A;  5D95 A;  4QGR A;  4ADD A;  3BB8 A;  1WYU A;  1W3U A;  5FT4 A;  4RAE A;  4ADE A;  1M32 A;  4AO9 A;  4R5Z A;  1V72 A;  2D7Z A;  1QZ9 A;  2W7M A;  1AJS B;  2F8J A;  2ZP7 A;  3T32 A;  1B5P A;  2AY4 A;  3BN1 A;  4JE5 D;  3N4R A;  3ATH A;  2VMU A;  3N4X A;  1QIT A;  3JTX A;  2EO5 A;  3LY1 A;  4W1W A;  1B9H A;  2R2N A;  1AHG A;  4IXS A;  4XQ2 A;  4CBR A;  1RVU A;  2AY5 A;  3B1D A;  4MSO A;  3ZRQ A;  1YJS A;  1AAW A;  1DJU A;  4IXZ A;  3FQ8 A;  3FZ6 A;  3HT4 A;  3W1H A;  4F5M A;  2AY7 A;  2JGT A;  4F5L A;  2VLF A;  3RCH B;  3F9T A;  2R0T A;  4ZWM A;  2C81 A;  4IY7 A;  1ASG A;  5I92 A;  3GWP A;  1AKA A;  4GE9 A;  2QSR A;  4ZAH A;  1JS6 A;  1M4N A;  3NYU A;  1TAS A;  2CST A;  2WB6 A;  2W8W A;  3G8M A;  4GE4 A;  4Y0H A;  3ELP A;  4ZSY A;  2HP1 A;  3TQX A;  2VGS A;  3MEB A;  3G7Q A;  1LW5 A;  2Z9U A;  3PA9 A;  3RQ1 A;  2AY2 A;  4GEB A;  4MKK A;  1DFO A;  3D6K A;  4OMA A;  1VP4 A;  4K2B A;  2QB2 A;  3DXV A;  2EZ1 A;  3RBF A;  2WK9 A;  2X5D A;  4LNJ A;  2QB3 A;  3LWS A;  5AX8 A;  3NU8 A;  4UHO A;  1ASA A;  3BWN C;  3E2Z B;  2BI2 A;  3NYS A;  1CZC A;  5M4D A;  1QJ3 A;  3RI6 A;  2QLR A;  1OHY A;  1KKP A;  1DGE A;  2CJH A;  4I8A A;  1GCK A;  4UOY A;  2ZSL A;  4ZSW A;  4CVQ A;  3PD6 A;  4EU1 A;  5EQC A;  2JG2 A;  2BI3 A;  1DGD A;  1G7X A;  1KL2 A;  4EFF A;  4P7Y A;  5EIG B;  2CTZ A;  3RCH A;  1O4S A;  5G4J A;  1MLY A;  3MC6 C;  3L44 A;  3CBF A;  4ADC A;  1LS3 A;  1MAQ A;  2BWN A;  4MKJ A;  4F5H A;  3GSB A;  3DRD A;  2Z9W A;  4WLJ A;  3EI8 A;  1CZE A;  1ZC9 A;  1KAF A;  3F6T A;  3VOM A;  1FG7 A;  1I43 A;  4JEV A;  3LVM A;  4A6T A;  2VMO A;  1O69 A;  4LNL A;  1WYV B;  4RKD A;  5TF5 A;  3BWN A;  2HOZ A;  4A72 A;  4Y0I A;  5BJ4 A;  1ASL A;  4Q75 A;  2CFB A;  4AO4 A;  1O62 A;  1W23 A;  3B46 A;  1IX7 A;  2EH6 A;  4EB7 A;  4W1V A;  1TPL A;  3E2Z A;  1E5F A;  1WYT A;  3FVS A;  5J8Q A;  1SZU A;  1BKG A;  5M49 A;  3FQA A;  3FRK A;  2AY1 A;  2CIN A;  4WXG A;  3MAD A;  2ZY5 A;  1LC7 A;  2Z61 A;  3NX3 A;  4E3Q A;  3HVY A;  4EB5 A;  1B8G A;  1QIR A;  2W7D A;  1JG8 A;  2GMS A;  3MC6 A;  1AY8 A;  2BIA A;  5EFS A;  2ZYJ A;  2R5E A;  2A1V A;  2DR1 A;  4RJ0 A;  4WD2 A;  4WYF A;  1ARS A;  2W7F A;  2DOU A;  3NTJ A;  3N4S A;  1SFF A;  1GEX A;  2X8U A;  4E77 A;  3A8U X;  4R5F A;  2VGU A;  1YJZ A;  2W7L A;  3QI6 A;  4XK1 A;  2W7H A;  1IX8 A;  3QN6 A;  2C7T A;  2V1P A;  1W7L A;  1EQB A;  1YNU A;  2FQ6 A;  1N31 A;  1MDZ A;  4Q6R A;  4AZJ A;  2VI8 A;  4F5G A;  2ZY4 A;  2W7E A;  3PJ0 A;  3I16 A;  4Q31 A;  1DKA A;  3ASB A;  3ZZK A;  2VYC A;  2QBT A;  5D5S A;  4XAU A;  2BIG A;  2FNI A;  2W8U A;  4RJY A;  3H9X A;  5DJ9 A;  2D63 A;  4JEZ A;  4BQ0 A;  3GET A;  4MY5 A;  3WLX A;  1ARG A;  1SF2 A;  1X2A A;  1IX6 A;  1AKC A;  4M2K A;  3F0H A;  2CH2 A;  3FD0 A;  2ZY2 A;  2E7I A;  2G6W A;  4N0B A;  1G4V A;  1GC2 A;  1V2F A;  3HLM A;  4K2M A;  4UQV A;  3NNK A;  3PPL A;  2CH1 A;  3K7Y A;  1FC4 A;  2C0R A;  1MAP A;  3BS8 A;  4A6R A;  1S06 A;  1M7Y A;  1CQ8 A;  1KKJ A;  3HDO A;  2TPL A;  4MQQ A;  2Z67 A;  3GZD C;  3G0T A;  3TCM A;  4UHN A;  3ELE A;  3LG0 A;  1B5O A;  1QGN A;  5EUE A;  1QIS A;  1ARI A;  2YKU A;  1GD9 A;  2AAT A;  3HQT A;  3WX9 A;  5C6U A;  3ECD A;  3W1I A;  2VIB A;  3EI7 A;  3PD6 B;  1XI9 A;  5G09 A;  1OHV A;  2WKA A;  2PB2 A;  3EUC A;  2BHX A;  4B98 A;  3TFT A;  2O0R A;  1TOK A;  2EZ2 A;  2WK7 A;  4WXF A;  1WST A;  3ZRP A;  2CJD A;  1AHF A;  2JIS A;  1AMQ A;  2EGY A;  3HBX A;  3RBL A;  5BJ3 A;  2W7G A;  4IW7 A;  1EG5 A;  1M0O A;  1MDO A;  2PO3 A;  2BKW A;  2ZSM A;  4FL0 A;  3WGB A;  2AY9 A;  4DBC A;  3WCN A;  1OHW A;  2D61 A;  3WZF A;  7AAT A;  3IHJ A;  5LHA A;  4CXQ A;  4MQR A;  3N5M A;  1BW0 A;  3CQ5 A;  3NYT A;  4PIW A;  3WCO A;  1LC5 A;  2D66 A;  1AY4 A;  1GEW A;  2GB3 A;  3GZD A;  5G2Q A;  2Z9X A;  2O7C A;  3LV2 A;  3A9Y A;  1N2T A;  3ZZJ A;  4W8I A;  3MBB A;  2D65 A;  2W8V A;  3DR7 A;  4A0G A;  1IBJ A;  3WGC A;  1BJN A;  2AEV A;  2ORD A;  1WYT B;  4RIT A;  4F5F A;  4IYO A;  1AMR A;  2FM1 A;  2BYL A;  3L8A A;  4U2H A;  2HUF A;  5F8V A;  1ASC A;  2Z9V A;  3NU7 A;  4R2N A;  4DGT A;  5HDM A;  4KXK A;  3QHX A;  2BI5 A;  1TOE A;  2E7J A;  3COG A;  4GRX A;  1C7O A;  1GEY A;  1DTY A;  1H1C A;  3AOV A;  3ISL A;  5EUN A;  2VMR A;  2E7U A;  3NUB A;  3UAK A;  2OGE A;  2VMN A;  3FTB A;  2VMX A;  4NOG A;  3DOD A;  1TOJ A;  2Z20 A;  4M2M A;  5E4Z A;  3FQ7 A;  2WK8 A;  2BYJ A;  3EI6 A;  1J04 A;  1E5E A;  3FFH A;  4WYG A;  1AIB A;  2ZC0 A;  2D64 A;  3BWO A;  3Q8N A;  2QMA A;  2D7Y A;  2HP2 A;  1ASB A;  3AEM C;  3PGY A;  2FKI A;  1M0N A;  2YKY A;  3AEP A;  1C9C A;  1DJE A;  2ZJG A;  3E2F A;  4WB0 A;  1V2E A;  4WYE A; 
#chains in the Genus database with same CATH homology
 1G7W A;  4GDY A;  5JAY A;  8AAT A;  3OP7 A;  4ZDO A;  4L0O A;  2ZY3 A;  3DC1 A;  3EZ1 A;  1ASD A;  3VK3 A;  2BI9 A;  5K8B A;  4PFF A;  1VJO A;  3DYD A;  3QM2 A;  3A9X A;  4BA4 A;  1BQD A;  2VGW A;  1SZK A;  2XBN A;  2X3L A;  5FT5 A;  1AHY A;  3AEN B;  3FSL A;  5HXX A;  4H63 Q;  2D5Y A;  3BCX A;  5M4B A;  1Z3Z A;  3IF2 A;  3BCA A;  2EYQ A;  3VK4 A;  4M2J A;  3RUY A;  4A0F A;  2R5C A;  2DGM A;  4ZM4 A;  1G4X A;  2O1B A;  2HUU A;  3AEM A;  3BV0 A;  3R9A A;  4A0H A;  1CJ0 A;  1H0C A;  1I29 A;  3DR4 A;  1Y4I A;  5EAA A;  3PDB A;  2VMY A;  1ELU A;  1AIC A;  4OBU A;  4WXB A;  3N0L A;  3FVX A;  3MAU A;  3E6G A;  1ASE A;  3BC8 A;  4W91 A;  1VEF A;  4AOA A;  1S07 A;  4E3R A;  2VMS A;  2FN6 A;  3I5T A;  3EZS A;  3PDX A;  1X28 A;  1BJW A;  1YIZ A;  4RIZ A;  1D7S A;  4K05 A;  2HUI A;  4TMR A;  3AEL A;  2YKV A;  1WKH A;  1I41 A;  1QJ5 A;  4A0R A;  3AOW A;  3E9K A;  4RLG A;  2VMP A;  3AV7 A;  1ZOD A;  1GBN A;  3NUI A;  3CQ4 A;  1AX4 A;  1BJO A;  1BS0 A;  3H7F A;  3JW9 A;  1RV3 A;  4ADB A;  4R8D A;  2GQN A;  2VMT A;  2Q7W A;  1TOI A;  2PB0 A;  3ASA A;  3EIA A;  2W8T A;  4ATP A;  3AEN A;  3EI9 A;  1JF9 A;  3K40 A;  3E2Y A;  4XJL A;  1UU0 A;  2VIA A;  2GMU A;  2VI9 A;  2VLH A;  3AEO A;  1X29 A;  3FZ8 A;  2AY6 A;  3P1T A;  1T3I A;  4IYO B;  4ZDL A;  4DQ6 A;  4ZM3 A;  1D7R A;  1SPA A;  4WLH A;  4ITG A;  1N8P A;  2OQX A;  4JF1 A;  2DKJ A;  2ZUK A;  4P3M A;  4F5K A;  2G7J A;  1D7U A;  4AZK A;  1ART A;  2OKK A;  1AHX A;  3MKJ A;  5E3K A;  3M5U A;  1TAR A;  1BJ4 A;  1PFF A;  1YAA A;  1C0N A;  3GR9 A;  1CQ7 A;  5HHY A;  2DGL A;  2DGK A;  3FVU A;  3DZZ A;  3I4J A;  1OXO A;  2Z1Y A;  3QBO A;  4MQP A;  3UE8 A;  5IWQ A;  2FYF A;  4J8L A;  4OYT A;  3LVK A;  4FFC A;  2YRI A;  4BHD A;  4BMK A;  1BT4 A;  4XEW A;  2W7J A;  4F4E A;  2JJH A;  3OKS A;  2VGT A;  2Z1Z A;  2CAN A;  4F5J A;  4IXO A;  1M0P A;  4RKC A;  1PMO A;  2OKJ A;  2YKX A;  3A9Z A;  5G0A A;  1S08 A;  4GSA A;  3AEJ C;  1KMK A;  4J5U A;  1ZOB A;  1IAY A;  4TV7 A;  1AHE A;  4PFN A;  4LW4 A;  3FKD A;  3QPG A;  1CL2 A;  4WB0 B;  4UHM A;  3KGW A;  4JEX A;  4ZLV A;  4H51 A;  3JU7 A;  2NMP A;  1MDX A;  1AJR A;  2CB1 A;  2HOX A;  1XEY A;  1S0A A;  3B1E A;  3GZC A;  3KE3 A;  4OCA A;  4Y0D A;  4WP0 A;  3BCB A;  4OTL A;  1JS3 A;  1M6S A;  1GC4 A;  2HZP A;  1LK9 A;  3JWA A;  1I48 A;  1CQ6 A;  4EMY A;  1J32 A;  4U1T A;  4Q76 A;  1AAM A;  1RV4 A;  1RVY A;  4ZWV A;  4KYO A;  1UU2 A;  3GJU A;  3JWB A;  3DU4 A;  4LC3 A;  1LKC A;  3II0 A;  3NDN A;  3P6K A;  1GC3 A;  3TFU A;  1X0M A;  3KKI A;  3W1J A;  3QGU A;  2R5C B;  2W8J A;  2YHK A;  4IX8 A;  5LH9 A;  3AEJ A;  1C7N A;  1AIA A;  1ECX A;  5DX5 A;  4CXR A;  1AJS A;  1ASM A;  2JJF A;  5DJ1 A;  3FCR A;  1TOG A;  3PDB B;  4JEW A;  4LW2 A;  3FDB A;  4ITX A;  4A00 A;  1S09 A;  4A6U A;  5F9S A;  2BWP A;  3R4T A;  3FDD A;  1C7G A;  4WBT A;  1IVR A;  1EJI A;  3JZL A;  5M46 A;  4WYD A;  5G4I A;  3UWC A;  2C44 A;  3USF A;  3K28 A;  2VMZ A;  2YCN A;  4LNM A;  1ORD A;  4JEY A;  2VGZ A;  4KAM A;  3AAT A;  2CY8 A;  1LW4 A;  2BI1 A;  2VMV A;  1AMA A;  2EPJ A;  3ACZ A;  4RM1 A;  3FZ7 A;  3LVL B;  2YCP A;  4W1X A;  2BIE A;  2BWO A;  3VP6 A;  1BJO B;  1CL1 A;  4F5I A;  5FT6 A;  4XJO A;  1AY5 A;  4W5K A;  1OXP A;  5EUD A;  3PIU A;  1D2F A;  1IJI A;  1DJ9 A;  2HOY A;  2QA3 A;  3WY7 A;  4HVK A;  3CAI A;  1Z7D A;  2VMW A;  2JJG A;  3H14 A;  1M0Q A;  4OT8 A;  1YJY A;  1ASN A;  3A2B A;  1U08 A;  4GE7 A;  2RFV A;  3N7N A;  4PVF A;  1GC0 A;  4HF8 A;  4N0W A;  2AY3 A;  4OC9 A;  3MAF B;  3ZRR A;  1D7V A;  5EAV A;  4ZDP A;  1PMM A;  1C4K A;  1KL1 A;  3FFR A;  5KTB A;  1SVV A;  1WYU B;  2YRR A;  4AH3 A;  4K2I A;  1AKB A;  1MLZ A;  3B8X A;  1W7M A;  3DXW A;  5E5I A;  4MGR A;  4JF0 A;  1BQA A;  1ELQ A;  3NRA A;  4OBV A;  1FG3 A;  2KFP A;  2OGA A;  3EI5 A;  3TAT A;  1W7N A;  4ATQ A;  4ISY A;  4WYC A;  1UKJ A;  3GBX A;  5EIG A;  2GSA A;  3EIB A;  3CQ6 A;  1OAT A;  5FT8 A;  3LVJ A;  4ZAS A;  3HMU A;  1GDE A;  2V0Y A;  4WYA A;  1IAX A;  1LC8 A;  1TAT A;  2DKB A;  4JE5 A;  2HOR A;  3VK2 A;  1O61 A;  1SZS A;  2E54 A;  2W7I A;  1B4X A;  3N75 A;  1CS1 A;  3HL2 A;  4BA5 A;  3B1C A;  4CBS A;  2AEU A;  4E1O A;  2FNU A;  4XJM A;  9AAT A;  4XJP A;  2VMQ A;  5G2P A;  4TN4 A;  2W7K A;  2VGV A;  2XH1 A;  1UU1 A;  3KGX A;  1PG8 A;  1IUG A;  4O6Z A;  2X5F A;  1WYV A;  5DB5 A;  1YIY A;  1KMJ A;  1YOO A;  1AMS A;  1WKG A;  2OAT A;  2JJE A;  1MGV A;  3PAA A;  2YCT A;  4B9B A;  1V2D A;  3MAF A;  3VAX A;  3E77 A;  3WKS A;  1ASF A;  2AY8 A;  2YOB A;  3WKR A;  1P3W A;  2CJG A;  1B9I A;  1ARH A;  5D95 A;  4QGR A;  4ADD A;  3BB8 A;  1WYU A;  1W3U A;  5FT4 A;  4RAE A;  4ADE A;  1M32 A;  4AO9 A;  4R5Z A;  1V72 A;  2D7Z A;  1QZ9 A;  2W7M A;  1AJS B;  2F8J A;  2ZP7 A;  3T32 A;  1B5P A;  2AY4 A;  3BN1 A;  4JE5 D;  3N4R A;  3ATH A;  2VMU A;  3N4X A;  1QIT A;  3JTX A;  2EO5 A;  3LY1 A;  4W1W A;  1B9H A;  2R2N A;  1AHG A;  4IXS A;  4XQ2 A;  4CBR A;  1RVU A;  2AY5 A;  3B1D A;  4MSO A;  3ZRQ A;  1YJS A;  1AAW A;  1DJU A;  4IXZ A;  3FQ8 A;  3FZ6 A;  3HT4 A;  3W1H A;  4F5M A;  2AY7 A;  2JGT A;  4F5L A;  2VLF A;  3RCH B;  3F9T A;  2R0T A;  4ZWM A;  2C81 A;  4IY7 A;  1ASG A;  5I92 A;  3GWP A;  1AKA A;  4GE9 A;  2QSR A;  4ZAH A;  1JS6 A;  1M4N A;  3NYU A;  1TAS A;  2CST A;  2WB6 A;  2W8W A;  3G8M A;  4GE4 A;  4Y0H A;  3ELP A;  4ZSY A;  2HP1 A;  3TQX A;  2VGS A;  3MEB A;  3G7Q A;  1LW5 A;  2Z9U A;  3PA9 A;  3RQ1 A;  2AY2 A;  4GEB A;  4MKK A;  1DFO A;  3D6K A;  4OMA A;  1VP4 A;  4K2B A;  2QB2 A;  3DXV A;  2EZ1 A;  3RBF A;  2WK9 A;  2X5D A;  4LNJ A;  2QB3 A;  3LWS A;  5AX8 A;  3NU8 A;  4UHO A;  1ASA A;  3BWN C;  3E2Z B;  2BI2 A;  3NYS A;  1CZC A;  5M4D A;  1QJ3 A;  3RI6 A;  2QLR A;  1OHY A;  1KKP A;  1DGE A;  2CJH A;  4I8A A;  1GCK A;  4UOY A;  2ZSL A;  4ZSW A;  4CVQ A;  3PD6 A;  4EU1 A;  5EQC A;  2JG2 A;  2BI3 A;  1DGD A;  1G7X A;  1KL2 A;  4EFF A;  4P7Y A;  5EIG B;  2CTZ A;  3RCH A;  1O4S A;  5G4J A;  1MLY A;  3MC6 C;  3L44 A;  3CBF A;  4ADC A;  1LS3 A;  1MAQ A;  2BWN A;  4MKJ A;  4F5H A;  3GSB A;  3DRD A;  2Z9W A;  4WLJ A;  3EI8 A;  1CZE A;  1ZC9 A;  3F6T A;  3VOM A;  1FG7 A;  1I43 A;  4JEV A;  3LVM A;  4A6T A;  2VMO A;  1O69 A;  4LNL A;  1WYV B;  4RKD A;  5TF5 A;  3BWN A;  2HOZ A;  4A72 A;  4Y0I A;  5BJ4 A;  1ASL A;  4Q75 A;  2CFB A;  4AO4 A;  1O62 A;  1W23 A;  3B46 A;  1IX7 A;  2EH6 A;  4EB7 A;  4W1V A;  1TPL A;  3E2Z A;  1E5F A;  1WYT A;  3FVS A;  5J8Q A;  1SZU A;  1BKG A;  5M49 A;  3FQA A;  3FRK A;  2AY1 A;  2CIN A;  4WXG A;  3MAD A;  2ZY5 A;  1LC7 A;  2Z61 A;  3NX3 A;  4E3Q A;  3HVY A;  4EB5 A;  1B8G A;  1QIR A;  2W7D A;  1JG8 A;  2GMS A;  3MC6 A;  1AY8 A;  2BIA A;  5EFS A;  2ZYJ A;  2R5E A;  2A1V A;  2DR1 A;  4RJ0 A;  4WD2 A;  4WYF A;  1ARS A;  2W7F A;  2DOU A;  3NTJ A;  3N4S A;  1SFF A;  1GEX A;  2X8U A;  4E77 A;  3A8U X;  4R5F A;  2VGU A;  1YJZ A;  2W7L A;  3QI6 A;  4XK1 A;  2W7H A;  1IX8 A;  3QN6 A;  2C7T A;  2V1P A;  1W7L A;  1EQB A;  1YNU A;  2FQ6 A;  1N31 A;  1MDZ A;  4Q6R A;  4AZJ A;  2VI8 A;  4F5G A;  2ZY4 A;  2W7E A;  3PJ0 A;  3I16 A;  4Q31 A;  1DKA A;  3ASB A;  3ZZK A;  2VYC A;  2QBT A;  5D5S A;  4XAU A;  2BIG A;  2FNI A;  2W8U A;  4RJY A;  3H9X A;  5DJ9 A;  2D63 A;  4JEZ A;  4BQ0 A;  3GET A;  4MY5 A;  3WLX A;  1ARG A;  1SF2 A;  1X2A A;  1IX6 A;  1AKC A;  4M2K A;  3F0H A;  2CH2 A;  3FD0 A;  2ZY2 A;  2E7I A;  2G6W A;  4N0B A;  1G4V A;  1GC2 A;  1V2F A;  3HLM A;  4K2M A;  4UQV A;  3NNK A;  3PPL A;  2CH1 A;  3K7Y A;  1FC4 A;  2C0R A;  1MAP A;  3BS8 A;  4A6R A;  1S06 A;  1M7Y A;  1CQ8 A;  1KKJ A;  3HDO A;  2TPL A;  4MQQ A;  2Z67 A;  3GZD C;  3G0T A;  3TCM A;  4UHN A;  3ELE A;  3LG0 A;  1B5O A;  1QGN A;  5EUE A;  1QIS A;  1ARI A;  2YKU A;  1GD9 A;  2AAT A;  3HQT A;  3WX9 A;  5C6U A;  3ECD A;  3W1I A;  2VIB A;  3EI7 A;  3PD6 B;  1XI9 A;  5G09 A;  1OHV A;  2WKA A;  2PB2 A;  3EUC A;  2BHX A;  4B98 A;  3TFT A;  2O0R A;  1TOK A;  2EZ2 A;  2WK7 A;  4WXF A;  1WST A;  3ZRP A;  2CJD A;  1AHF A;  2JIS A;  1AMQ A;  2EGY A;  3HBX A;  3RBL A;  5BJ3 A;  2W7G A;  4IW7 A;  1EG5 A;  1M0O A;  1MDO A;  2PO3 A;  2BKW A;  2ZSM A;  4FL0 A;  3WGB A;  2AY9 A;  4DBC A;  3WCN A;  1OHW A;  2D61 A;  3WZF A;  7AAT A;  3IHJ A;  5LHA A;  4CXQ A;  4MQR A;  3N5M A;  1BW0 A;  3CQ5 A;  3NYT A;  4PIW A;  3WCO A;  1LC5 A;  2D66 A;  1AY4 A;  1GEW A;  2GB3 A;  3GZD A;  5G2Q A;  2Z9X A;  2O7C A;  3LV2 A;  3A9Y A;  1N2T A;  3ZZJ A;  4W8I A;  3MBB A;  2D65 A;  2W8V A;  3DR7 A;  4A0G A;  1IBJ A;  3WGC A;  1BJN A;  2AEV A;  2ORD A;  1WYT B;  4RIT A;  4F5F A;  4IYO A;  1AMR A;  2FM1 A;  2BYL A;  3L8A A;  4U2H A;  2HUF A;  5F8V A;  1ASC A;  2Z9V A;  3NU7 A;  4R2N A;  4DGT A;  5HDM A;  4KXK A;  3QHX A;  2BI5 A;  1TOE A;  2E7J A;  3COG A;  4GRX A;  1C7O A;  1GEY A;  1DTY A;  1H1C A;  3AOV A;  3ISL A;  5EUN A;  2VMR A;  2E7U A;  3NUB A;  3UAK A;  2OGE A;  2VMN A;  3FTB A;  2VMX A;  4NOG A;  3DOD A;  1TOJ A;  2Z20 A;  4M2M A;  5E4Z A;  3FQ7 A;  2WK8 A;  2BYJ A;  3EI6 A;  1J04 A;  1E5E A;  3FFH A;  4WYG A;  1AIB A;  2ZC0 A;  2D64 A;  3BWO A;  3Q8N A;  2QMA A;  2D7Y A;  2HP2 A;  1ASB A;  3AEM C;  3PGY A;  2FKI A;  1M0N A;  2YKY A;  3AEP A;  1C9C A;  1DJE A;  2ZJG A;  3E2F A;  4WB0 A;  1V2E A;  4WYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...