4AH6A

Human mitochondrial aspartyl-trna synthetase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
589
structure length
589
Chain Sequence
PEFSSFVVRTNTCGELRSSHLGQEVTLCGWIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ASPARTATE--TRNA LIGASE, MITOCHONDRIAL
publication title Thermodynamic Properties Distinguish Human Mitochondrial Aspartyl-tRNA Synthetase from Bacterial Homolog with Same 3D Architecture
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 117
structure length 589
sequence length 589
chains with identical sequence B, C, D
ec nomenclature ec 6.1.1.12: Aspartate--tRNA ligase.
pdb deposition date 2012-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N)
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
A PF02938 GAD GAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ah6A01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4ah6A02
3.30.1360.30 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 GAD-like domain 4ah6A03
1CKNA 1EOVA 1QUQA 3U4ZA 2ATWA 2ZXFA 2ZT5A 2IY5A 3RLNA 4Y7NH 3S1QH 2R7DA 1N34L 4LF4L 2NVYH 1E22A 5FLXc 2E2HH 1EFWA 4YRJA 2ZNJA 1N33L 4XIGS 5JJIA 1H4VB 1WQ7A 2UXDL 4AIMA 1Q12A 3PUXA 2ZIMA 4A3GG 3PUZA 3W1BA 4BBSH 4YCVA 4DV0L 3CMQA 1G51A 3ICEA 2PNHA 4DR3Q 1EUJA 3EFSA 5IT9c 1JE5A 1NE3A 3HXXA 5JJLA 4X62L 5GADC 1YI2A 3CF5A 1Q1BA 3V7CA 4MTNA 2GVAA 3LGJA 3LSSA 1L1OA 4A3MH 3CP0A 3JC66 3IALA 1VQBA 2P0LA 4DUYL 2EXDA 3CCLA 3K7UC 2R92G 4A3KH 3HXYA 4DV2Q 4YWLA 3PIPA 1QVCA 3KDFA 4CH5A 3KF6B 4DV3Q 4BW9A 3GD7A 4JI4L 3LC0A 4DNIA 1BBUA 3DM3A 1UEBA 1YBYA 4YWKA 3OTOQ 1U5KA 4TVAA 2E5LL 1WQWA 2F4VL 4A3LG 4H2XA 2WAQE 1HJPA 1YHBA 2FXQA 4YRGA 3HOUH 4OO1G 2ZZGA 2JEBI 4DV1L 1VQ9A 4LFCQ 2EJGA 2C8MA 3T1HQ 2ZJRA 1GD7A 2I5MX 1KD1C 1XMOQ 4P75C 3REUA 4TQDA 4DV5Q 4YRCA 4YRKA 3HTZA 3HRKA 2ALYB 1VQIA 3TEHA 1HR0L 3S1MH 3M85A 4GNXC 4LF7L 3E9IA 1CKNB 3MEYA 1Q81C 4OWTB 3S24A 1XNRQ 1XPRA 2IY5B 3HXZA 4GKKQ 4DV4Q 4A3CH 4JI5Q 3W1GA 2VQFL 4HWSA 1NBWA 3PO3H 4K0KQ 2UXBQ 4JI6L 2UUCQ 1HC7A 3H3VI 2WFWA 2QGQA 3K8AA 4B3RQ 2Q2HA 4DUZQ 1X3FA 4TTVA 3PZCA 4YREA 2VUMG 4L5RC 4AQYL 4XU3A 3RZDH 3CD6A 1HNZQ 3F1ZA 3AFPA 2QHSA 2OTLA 3L1AA 5C52B 1N8RC 2RHQA 5C0XG 1N32Q 1EIYB 4B3MQ 4KHZA 1X2GA 3EN2A 4JBMA 3G4SA 4HVCA 4TWAA 3CCJA 1V9PA 4DQ2A 2KHIA 3A7AA 2JQOA 12ASA 4XTXA 2AHOB 1PH6A 4KI0A 2D6FC 4QIWE 1XPUA 4CS4A 1OXVA 5FLMH 4JI2Q 3KDFB 3UGTA 1K9MC 4UP7A 4HIKA 1VQLA 4C3JH 2LXJA 1N36L 3RKYA 4DR1Q 3J7ZC 4YHHQ 5IYCH 1VQOA 1QF6A 3FJPA 4DR3L 4H2XB 4L5QA 2CKZB 1K0RA 1PH2A 1SERA 2ZTGA 2P8TA 2DJZA 4KR3A 3I4OA 1A63A 3CC4A 4POFA 4BBRG 4GOPC 1EIFA 1PHJA 5IYBG 3TEHB 1B7YA 1WLEA 1IBLQ 1BVSA 2JEAI 4OXPA 3K7AH 5FJ8H 4DV2L 4K88A 3UDIA 1GM5A 4PMWA 2AKWB 1EVKA 3RIRA 5GAHC 3J81c 1VCIA 1WOCA 4DV3L 3PGZA 2F3IA 4YRNA 4BWAA 1VQFA 4X66Q 4UP9A 1ASYA 1WYDA 1Z9FA 2YTYA 4YRQA 5AJ3Q 3VDYA 3OTOL 2R93H 2Q5HA 3FKIH 1TWAH 4A3BH 1X55A 1YFTA 4K87A 3FHWA 2PQAA 1TXYA 3KOJA 4LFCL 3T1HL 1XMOL 4J15A 4DV5L 5H1SE 2WP8J 2ZZEA 2RHQB 2CQOA 1IBMQ 1KL9A 3IRBA 5BR8Q 2UU9Q 1XNRL 3CPWA 3M4QA 1ADYA 2YTVA 5JEAG 4DV4L 2ARTA 1TWCH 3GO5A 4JI5L 4QQBX 4IJLA 4A3GH 4TVYA 3F2DA 1P8LA 4K0KL 2UXBL 1PH5A 2UUCL 3V7RA 1G291 4DV7Q 4BXXG 3J81j 1CKMA 4B3RL 2Y0SE 4BA2I 4DUZL 2YTXA 1IXRA 5IP9G 1YITA 2CWPA 1HNZL 3W5OA 2MNAA 2C7IA 1JB7A 1M90C 1WCMG 1E1TA 4GN5A 5C3EG 1PH4A 2RF4A 2R92H 3AQQA 2YV5A 3BZKA 4DK3C 4AYBE 3ZJYC 2HQLA 2VL6A 4B3ML 1B7YB 2K52A 3RUXA 2ZR2A 2L15A 4EQ5A 3H0GG 2BH2A 1QVFA 4NXNQ 2NVXH 2GN5A 4Y52H 2DDZA 2CJAA 1Y1VG 4HWTA 3HKZE 4XTWA 4JI2L 4NB3A 4A3LH 2E3CA 3MF1A 1BIBA 3K81C 4A3FG 3D0FA 4JBJA 2JA7G 3B6YA 3S1NH 1YIJA 4C3IH 2ARSA 4DR1L 4YHHL 1YEZA 4HJAA 2FYKA 3M4OH 1B8AA 4KQEA 3G71A 1W3SA 3M4PA 1VQKA 3RLOA 5C4JH 1EWIA 2PQAB 1VQGA 4UY8C 1K83H 2DVEA 1TWFH 2QEXA 5J3BA 1UE6A 2MQHA 4H2UA 3KF6A 1USYC 4X6AH 1IBLL 4HA8A 1VQEA 3DLLA 1MJCA 1NJ5A 3H15A 1IBKQ 3KF8B 5C4XG 4KR2A 1I6HH 2AWNA 4E51A 1AE2A 1VQZA 3R07A 1N9WA 1UE5A 1KRSA 1SRUA 4X66L 2VUMH 3STBC 5AJ3L 3GTKH 3UDXA 3A5YA 3JAMi 2DXTA 2AMCB 4JG2A 2I4OA 2UUAL 3G6EA 3AYHB 1OXSC 1SLJA 3UGQA 3BU2A 1UE7A 4PZ7A 3A31A 2Z6KA 1Q86C 1EYGA 4P71C 2QHTA 3HOXG 3M7NA 5M5YH 2YU9H 1IBML 1X3EA 5BR8L 2UU9L 2XGTA 1NNHA 2OCEA 5IWAQ 2N49A 1HZCA 1YHAA 3HOZG 3CCVA 4JI8Q 1RIQA 1FJGQ 4XTVA 2IX1A 3TS0A 2DGYA 4A3DG 1NJ2A 3HFZB 4DV7L 4JI3Q 1X01A 3RZOH 2E41A 3K80C 1PVOA 4A3JG 1EIYA 4LF5Q 3ULPA 4BBRH 2NVTH 4OX9Q 5IYBH 4GN3B 3I56A 4PZ6A 2JA8G 2VNUD 3CMEA 4TVWA 1JJGA 3L7ZC 5ELNA 2EAYA 2R7ZG 2PMEA 3HKSA 4IPGA 4IFDG 4WF2A 1HXDA 4QJFA 1R9TH 3PCOA 3STBD 1BIAA 4NXNL 4UP8A 5F5WA 5C44G 2OTJA 2E2IH 2DU7A 4YRMA 1BBWA 3CCMA 3PUVA 2JJQA 4OP0A 4JI1Q 1KHIA 4NCXA 1GO3E 4X65Q 2J3MA 4JOIC 4RMFA 1VQJA 3UE1A 5LMUQ 1NYQA 3HXWA 4YRFA 5M3MG 3CCRA 2Q5IA 1ZQ1C 1DGSA 5GAEC 2CFMA 2EJFA 2AWOA 2AKWA 2HNIA 4P72C 4P74C 2Q2UA 3CMAA 2Z0SA 3KYHC 1AH9A 3WQZA 1HZ9A 1NY4A 3PV0A 4IPCA 3S2DH 2WB1E 4WI1A 2VW9A 2QHVA 2N78A 1IBKL 2I5HA 2ZT8A 3RL6A 3VBBA 4BXXH 3D31A 4YROA 1GVPA 4QGUA 1UE1A 1XTDA 3VQVA 5IP9H 4GS3A 4GOPB 1WCMH 4R4CA 2ZR3A 1G5HA 5C3EH 1H4SA 4LFAQ 4YRSA 3U4VA 1GGMA 1WPYA 4IOCA 2NN6G 5C53B 1H4QA 4YRTA 2ZT7A 3KFUA 2ID0A 4BY7G 1E7ZA 2I4NA 3H0GH 3GTOH 2ZIOA 3CW2C 3RKWA 3G48A 1Y1VH 2WAQG 1PH9A 1VQ6A 2LSSA 4P73A 3J80c 1X6OA 2ZCEA 2KBNA 3A7UA 1MKHA 4IO9A 3CXCA 3J7A5 1YVCA 5LMNQ 1UWVA 5IWAL 4A3FH 3PCOB 1QE0A 3EIVA 4O0AA 2JA7H 3M3YH 2E1HA 5M5WH 4JI8L 2CCZA 1NJIC 1ADJA 4QY7A 1VS0A 2V1CC 4JI3L 4A76A 3A5ZA 5E7NA 1KOGA 1VQHA 4WJ3M 3ICAA 1X3GA 1L2FA 3L0OA 4RQFA 1VQAA 4LF5L 4MZ9A 3TS2A 4OX9L 3Q8DA 3HOWG 3W3SA 3PO2G 1T9HA 2DUDA 3PUYA 2KHJA 5M3FG 2ES2A 2UUBQ 1HNWQ 5C4XH 2HHHQ 4EO4A 3I2ZA 1J6QA 3PIOA 2EL9A 2H5XA 3E9HA 1L1OC 1PYBA 3NENA 1PYSB 1YNXA 3E0EA 2EJ9A 4YY3Q 4A3EG 3FP9A 2B63G 1L0WA 1Y1WG 4XTCS 1FL0A 4YCUA 3HY0A 4JI1L 1J5EQ 3KLWA 1A8VA 5IYDG 3GTQH 2K4KA 1I50H 4JI0Q 5LMUL 2DEQA 4ZIBA 4DV6Q 4B3TQ 1LTLA 4KLKA 3REXA 3HOXH 2VZAA 1Z47A 5C51B 2JA5G 4CH6A 3S1RH 2KENA 4GKKL 2HIXA 4HJ7A 2DTIA 2CJ9A 4TQUS 1YJNA 4A93G 3K0XA 2K5VA 3U50C 3L4GB 4OO1I 2DU5A 3HOZH 5C0XJ 4DR7Q 4XU2A 2XTIA 4A3DH 5HY6A 2QHUA 2AMCA 3PO3G 1VQDA 4DPGA 3MEFA 2MO1A 2DZCA 1JJCA 1IZ6A 3L2PA 5E3IA 4IPHA 4A3JH 4HWRA 4BA1I 3I55A 2R7FA 1SN8A 5K36G 1BKBA 1CKOA 3A5ZB 3HFVA 1WU7A 1NYRA 2PMFA 1KMMA 1N32L 4GLXA 2JA8H 1KMNA 2PMZE 4LFAL 3V8KA 2JA9A 4DUYQ 1FGUA 3QO7A 2R7ZH 3HOYG 4YDQA 1QZHA 4JI7Q 2IX0A 4CH4A 5GROA 4HIMA 3QNEA 3CCQA 3RACA 4HJ5A 2BA1A 5C44H 2K75A 4H2WA 4P75A 5IP7G 1VQ5A 3AFQA 2E64A 4HIOA 1G6PA 2OQKA 3HFZA 5LMNL 3MXNB 4G85A 3RKXA 2E5LQ 2Q7HA 2ZM6Q 4AH6A 4GNXA 5C0XI 3RNUA 3F8TA 2DXUA 4L5TA 4CH3A 3NETA 4UPAA 2DQ0A 4WJ4A 5M3MH 1OXUA 4CS3A 1NMFA 4APVA 3M9BA 2VS1A 1FYFA 2ZGWA 3CQZH 3BJUA 4H02A 1TWGH 4DKAC 1JJ2A 4POGA 4NXMQ 1SETA 2VQEQ 3HOVG 3I4NG 2UUBL 3T1YQ 4R4OA 3RN2A 1HNWL 4LNQA 3NELA 2HHHL 2VQFQ 4LF8Q 4XEMA 1PA6A 5FJ8G 3IKMB 3LSQA 4YWMA 3ERRA 4NPSA 4YY3L 2N8NA 2I0QA 1E24A 1O7IA 1HR0W 2ZTDA 4AYBG 3G1ZA 2JA6G 2IT1A 1JJCB 3IG2A 1HNXQ 5JEAJ 1J5EL 1X65A 2NZHA 1X2HA 1Q7YC 4DAYB 1E3PA 2ZTEA 4JI0L 2LXKA 2BH8A 4BY7H 3HKZG 4DV6L 4B3TL 4YYEA 11ASA 3DSQA 3UH0A 1PH1A 2HIVA 1TWHH 5HGQA 1EQQA 1XNQQ 3GTJH 4RG1A 3HXVA 4XTZA 2UXCQ 4KHPQ 3J81i 1IL2A 2ZINA 1K3RA 1LYLA 4YRPA 4G84A 3I7FA 1OXTA 3V8JA 4DR5Q 4DR7L 4GOPA 4PZ8A 2K5HA 1QZGA 4LFBQ 4P3NA 2E10A 4DR4Q 1N36Q 2R6GA 4GNXB 4JV5Q 3EBEA 2JE6I 4GLVB 2K5NA 3CPFA 3HOWH 3P8TA 2ZT6A 3PO2H 1YFRA 2DTHA 5M3FH 2DKGA 3RGLA 2P5IA 3CAMA 5M5XH 3KJOA 3A0JA 3S15H 4LW1A 4JYAQ 4HJ8A 4GKJQ 3CC7A 2EWNA 1X9NA 4JI7L 1KIXA 3I4MG 4A3EH 3QO5A 2E5AA 2B63H 3HRIA 3TREA 2CJBA 1Y1WH 1SR3A 3GTPH 2I5LX 4HWOA 2CIMA 2B29A 1ATIA 2ZM6L 3OW2A 1KXLA 2KCMA 3F2BA 2ZTCA 4JBKA 5IYDH 2KCTA 4Q6GA 4PG3A 2DTOA 3S2HH 4LNSA 3HXUA 4A75A 2N3SA 2ASBA 3VQWA 3RF1A 4A3IG 2JA5H 2Q2IA 3PF5A 3V7SA 4DR6Q 2K50A 3UDGA 1IYJB 2A19A 1YGBA 4R1JA 1HZBA 4OWXB 1SFOH 1VQNA 3U58A 1S3OA 1FVIA 3UE0A 2A1AA 1I5FA 1QUQB 4A93H 4NXML 3ERSX 2J3LA 3L2ZA 1B70A 2VQEL 4LF6Q 4MNOA 3A5UA 1VQPA 1PYSA 2JK8A 3T1YL 5ELOA 4ZTZB 1KC8C 3BFMA 2D0OA 5IY0A 2B3GA 4DR2Q 2RHSA 4LF8L 4L87A 1NJ8A 2E65A 4EX5A 3ULLA 2DZ9A 3TUPA 3UFGA 3P8YA 1NMGA 3TRZA 1I94Q 1HTTA 1VQ4A 2ARUA 3BZCA 4YRIA 1VQ7A 3OYYA 1SESA 3V8LA 4BY1G 1HNXL 3HY1A 4XU1A 4LUOA 4X64Q 3SGIA 2VY3A 4XEOA 1C7YA 1X56A 1X54A 1W66A 3HOYH 2Q7GA 1CSQA 3CC2A 1L1OB 1I3QH 3L4GA 1JT8A 1CSPA 3UDFA 3RR5A 5IP7H 4OONA 1XNQL 5GAGC 5K1XA 4IPDA 2UXCL 4KHPL 3ULJA 3A74A 2Z6KC 4B3SQ 2CGHA 1XJVA 1WJJA 4LF9Q 1XPOA 1FJGL 4DR5L 1D8LA 2OQ0A 3AEVA 4BBSG 1PH7A 3VQYA 4LFBL 4TVAB 3H3VH 4YRRA 3JAMc 3GDEA 4DR4L 1USYA 4JV5L 2I4MA 5GQOA 3KJPA 2MFIA 3VQXA 4IFDJ 3GTGH 2E8GA 1S40A 5KNNA 1MIUA 4OLFA 5IE8A 1PH3A 2WB1G 3S16H 1PH8A 4JCVE 1XMQQ 1Z7NA 4A3MG 3HOVH 4JC0A 3I4NH 5DLQE 1YJWA 4GN4B 3WWVA 1GKHA 1P16A 3MF2A 4A3KG 1VQCA 5LMNW 4JYAL 4GKJL 3NEMA 1B70B 1EVLA 2MO0A 2PI2E 2ZZFA 2QA4A 2RHSB 2ZNIA 4P3OA 2JA6H 1YZ6A 1PV4A 4GLAC 1Q8KA 1H4TA 4P71A 4IJHA 4O2DA 2OWOA 1YJ9A 4X65L 4C2MH 3NBHB 2F52A 1NJ6A 3EFRA 4HWPA 2A8VA 2ODRC 3HOUG 2UUAQ 1SE8A 2BA0A 1D7QA 1WI5A 2IHEA 4YPFA 1YFSA 3TEGA 4IFDI 3RN5A 2NVQH 1N34Q 2ZJPA 4DR6L 3S17H 4LF4Q 1Y14B 2C35B 5JJKA 3S14H 1SMXA 4JBWA 1C9OA 4R4IA 1A62A 1N33Q 4P3PA 1J5WA 4LF6L 3CCSA 2UXDQ 4A3CG 4H2TA 4YP0A 3ER0A 1HZAA 1KAWA 3OD1A 4C3HH 2G4CA 4H2YA 4Q15A 4DV0Q 4DR2L 1HH2P 1LUZA 1Q46A 1V1QA 3QTCA 1B76A 4X62Q 3A32A 1Z7MA 1PFSA 1I94L 1W2BA 3GTMH 4XTUA 1SRYA 2Q7EA 1RL2A 3QO8A 2DQ3A 4QL5A 1MJEA 3CCUA 4X64L 1OTCA 1WNLA 2ZJQA 1KRTA 4HJ9A 2EQSA 2EIFA 4RDXA 2D62A 4LWCA 1S72A 3CCEA 2I4LA 1K8GA 1K73C 3I4MH 4LUVA 4DK6C 3PF4A 1Q1EA 4JI4Q 4ALPA 4JOIA 1U0LA 4LUZA 3PUWA 4R4QA 1V43A 4ME3A 4A4IA 2K14A 3GTLH 4K86A 4DAMA 5FLMG 1YHQA 2F4VQ 2HT1A 1C0AA 1CUKA 4B3SL 2PI2A 4LF9L 2ODRD 5K1PA 4L5SA 1NTGA 2NN6I 4P72A 4P74A 4DV1Q 4P73C 4HIDA 1E1OA 5IYCG 1LM0A 4A3IH 1EQRA 4H2SA 4IOAA 1HR0Q 4LF7Q 1AE3A 1ASZA 3IKLA 4XU0A 4FDBA 2D0PA 1XMQL 2GVBA 1OXXK 2Y0SG 1RIPA 1WFQA 1VQMA 4OWWB 1NJ1A 3RLFA 2Q2TA 3J80i 1K8AC 4CS2A 3F2CA 1JMCA 4JI6Q 2IHFA 5EAYA 1H95A 1G5IA 1SROA 2NZOA 4YCWA 3P8VA 2CWAA 1A0IA 4X5OA 3PSIA 4PHCA 4AQYQ 4RQEA 4XTYA 4BY1H 1Q82C 2R93G 4ZTUB 2YYZA 3FKIG 4H2VA 2E2JH 3TQYA 3A7RA 4A3BG 1QVGA 2RCNA 2ALYA 4TQFA 1M1KC 4YRLA 1VQ8A 1KQSA 1YB3A 4R4TA
chains in the Genus database with same CATH superfamily
1CKNA 1ESFA 1EOVA 1QUQA 3H94A 1D6EC 3U4ZA 1I4HA 3GTMK 2ATWA 4DXGA 3MA2B 4A3MC 2ZXFA 2ZT5A 2IY5A 2L4NA 3RLNA 1RDPD 4Y7NH 4G7OC 3S1QH 2R7DA 1DONA 2FINB 5IYBC 1N34L 5A35A 4A3KC 1VLOA 1GJXA 1F9RA 4LF4L 1LLRD 3H3VL 4ILWA 2NVYH 3SR1A 1E22A 1WIHA 5FLXc 4FVMA 2E2HH 5JOBA 5IOSA 1EFWA 4YRJA 2R92K 2JA6A 3HGBA 3K57A 2RA4A 2ZNJA 1N33L 5CV7A 4XIGS 5JJIA 1EQVA 1EY9A 1H4VB 2UXDL 1WQ7A 3GTQA 3HXAA 4AIMA 1Q12A 3PUXA 2ZIMA 4A3GG 4FF3A 3I4MK 3PUZA 3W1BA 1I50A 1EEID 4BBSH 2F3VA 4H7BA 1WTRA 4G7ZA 1R9TC 4YCVA 4DV0L 3CMQA 4ILDA 1F7UA 1G51A 3ICEA 2PNHA 2P5MA 4DR3Q 1EUJA 2O5JC 3EFSA 1SMYC 5IT9c 2NVXK 3MEHA 5F2DA 1JE5A 1NE3A 3GTLK 3HXXA 5JJLA 4FP5D 5JVH3 3SK8A 4X62L 5GADC 1S5ED 1YI2A 3MXGA 4MEXA 3CF5A 3HOUC 3D4WA 1Q1BA 4A3LK 1EOTA 3H0GB 3QO2A 1JOQA 1FGBD 4P2CB 3V7CA 2Q8IB 4MTNA 2GVAA 2F0FA 3LGJA 1L1OA 4KN4C 3LSSA 4HAEA 4A3MH 3GEHA 2F0UA 1LT4D 3CP0A 3JC66 3IALA 2V4DA 1VQBA 2P0LA 4DUYL 1C4QA 4RGOS 4RCNA 2EXDA 2F0DA 3CCLA 4V190 3K7UC 2R92G 3S1MC 4A3KH 3HXYA 1WQHA 4DV2Q 2GSNA 1IL8A 1BR9A 5IORA 5EPLA 4YWLA 3PIPA 2A6ED 4LQYA 2JA7B 1WOSA 2A69A 5IOCA 1QVCA 1ZXTA 5A2QL 4KN7A 1EZ8A 3AD9C 1SEBD 2XIWA 3MFYA 3QOJA 1PRTF 5COYA 3KDFA 4CH5A 3KF6B 4DV3Q 1Q8IA 4BW9A 3R2IA 3GD7A 5IODA 4JI4L 3LC0A 4XDXA 3TZDA 4DNIA 3OIPA 2RVLA 1BBUA 1WSVA 1YNNC 1MGSA 3DM3A 1UEBA 1YBYA 4YWKA 3OTOQ 1U5KA 4TVAA 3L3OC 1KNAA 2E5LL 1WQWA 3S2DC 2SDFA 4TSSA 4ZK9B 5C5LA 2F4VL 5CR3A 4A3LG 1KNEA 3LWEA 3T02A 4N9TA 1ILQA 4WRDA 4H2XA 4O42A 2WAQE 3GTGB 1SNQA 4H13C 1HJPA 4BXXC 1YHBA 2FXQA 1I6HK 5CBAE 5NUCA 4YRGA 3HOUH 2WB1D 4L8JA 4ZCKA 4OO1G 1B9MA 2ZZGA 1GUWA 2JEBI 2ZUFA 4DV1L 4KKUA 4C3IG 1VQ9A 4LFCQ 3S16B 2EJGA 2C8MA 3T1HQ 2ZJRA 1GD7A 2R7ZA 2I5MX 1T5EA 4J1MA 1KD1C 1XMOQ 4P75C 1BS2A 3CU7A 4TQDA 2F0SA 3REUA 3FPUB 4DV5Q 4IUNA 2EBBA 1STGA 2RSOA 3I4NB 1ZYRC 4YRCA 4YRKA 4KC6A 3HTZA 3HRKA 4BY1K 3N6RA 2ALYB 1VQIA 3GV6A 1HR0L 2D2CC 4KK7A 5JPMC 3M85A 3S1MH 3TEHA 4GNXC 1WCMC 1PDQA 3E9IA 4LF7L 3A56A 1CKNB 5C3EC 2Y3PA 1EU3A 4NOIA 3MEYA 2VB3X 1Q81C 3BYTB 4OWTB 3S24A 4C56C 1PYWD 2IX3A 1XPRA 5HURA 1XNRQ 1BCPC 1I4RA 3ERQA 2IY5B 3HXZA 3GTLA 4GKKQ 1SNPA 4DV4Q 1O2FB 1GUGA 4A3CH 1GXDC 4JI5Q 3W1GA 2VQFL 4HWSA 4LVMA 4H44C 1TQOA 1NBWA 3QG1A 3PO3H 4P5BA 4GZYC 3S1QK 2DN8A 4K0KQ 2I46A 2UXBQ 4JI6L 2JA6B 1BUVT 3FHZA 1HCZA 2UUCQ 4J6HA 2RDGA 2KVMA 1HC7A 3H3VI 1IW7A 1SMYD 2WFWA 2QGQA 4XLPA 3K8AA 3SK5A 2NVYK 2B2WC 2Z6BA 4C2MB 4B3RQ 2E2HK 2YU9K 4XT3B 1TWGA 2Q2HA 4DUZQ 1MD2D 3MWYW 1X3FA 4ID6A 4TTVA 3PZCA 4YREA 2VUMG 1PJ5A 2L1BA 4L5RC 5EGEA 3ND8A 4LAAA 2B2YC 1ENCA 1QCBD 4AQYL 4XU3A 3RZDH 1DCHA 4BBSK 3CD6A 1HNZQ 5M9OA 3F1ZA 2W7VA 1F9QA 3AFPA 3A54A 1PRTB 2QHSA 2OTLA 5CJ9A 2HQEA 1ZKOA 3L1AA 3O13A 5ELCA 3J80L 1I4GA 2NVQB 5C52B 1N8RC 3S17B 2RHQA 4KTAA 4U68A 5C0XG 1TS3A 1N32Q 2N55A 1LO5D 1EIYB 4B3MQ 1GUOA 4KHZA 1X2GA 3EN2A 1DYQA 3S14B 5D65A 1IQ0A 1PTOB 4JBMA 2SOBA 3G4SA 4HVCA 3N0BA 4TWAA 3CCJA 1D1IA 1F9PA 1V9PA 4E6IA 2J7ZA 4DQ2A 4A3MK 2KHIA 3DWPA 3A7AA 2JQOA 4C3HB 2JP1A 1YNND 3SHLA 2C9OA 12ASA 5IYBK 4XTXA 2AHOB 1PH6A 4RWSC 1XX8A 1U4MA 4KI0A 4QIWE 1AZPA 4A3KK 2D6FC 1XPUA 4CS4A 1OXVA 5FLMH 4JI2Q 3KDFB 3UGTA 1H9MA 1ICWA 3WOEA 1K9MC 4ZUIA 2PW7A 4UP7A 1W6JA 4HIKA 1B53A 1VQLA 4C3JH 4HR7B 1AEXA 3MAQA 1ISEA 1STYA 4IUVA 2LXJA 4WFN3 3GTMB 1N36L 3RKYA 4DR1Q 3J7ZC 4YHHQ 1XPPA 5IYCH 1VQOA 1QF6A 3FJPA 4DR3L 4H2XB 1ZYRD 4L5QA 1R9TK 2CKZB 2K7VA 4KD4A 1IKLA 1K0RA 1E0BA 1PH2A 1SERA 1TWAC 1EWCA 4A3BC 1XTCD 2ZTGA 2P8TA 2DJZA 4KR3A 1TWHA 3I4OA 2R7ZB 1VRQC 1A63A 2WACA 5T1GA 3K58A 1H9JA 3CC4A 1BCPD 4POFA 2CQAA 2KEDA 1WD0A 5TJ3A 4BBRG 3GTQC 3HOUK 2X69A 2G9HD 3VR5A 4GOPC 1EIFA 2NVYA 1PHJA 4JK1A 1Y69U 1F2MA 2E2HA 5IYBG 3TEHB 1HPCA 3I4MB 5I6WA 1B7YA 1EK8A 1WLEA 1IBLQ 2FQTA 1BVSA 1CQVA 3MXPA 1JOKA 2JEAI 4OXPA 3GQBA 3K7AH 1X3QA 2L9HA 1DOMA 4DXFA 1SE3A 5FJ8H 3SVMA 2JXMB 4DV2L 1IYVA 4K88A 3S1MK 3UDIA 1GM5A 4YIJA 4PMWA 3GTLB 2AKWB 1EVKA 3RIRA 4KY7A 1XXGA 2IPKD 2F0VA 3D3RA 5GAHC 3SDZA 1SYFA 3J81c 1VCIA 1WOCA 1QG7A 1D1KA 3PGZA 4DV3L 1PJ6A 1F2ZA 2F3IA 4YRNA 4BWAA 1VH2A 4A3GC 1VQFA 4X66Q 4A3CK 5LL6S 4UP9A 2F0HA 1ASYA 1WYDA 1TS2A 1Z9FA 2YTYA 4YRQA 5AJ3Q 3IKJA 3VDYA 3DHQA 3OTOL 2WAQL 5JVOA 3HOZC 2R93H 4MQ9A 5KNDA 4A3IB 3I72A 1RODA 2ICIA 4RAUC 1WTWA 5KIXA 2Q5HA 3K0YA 4NMZA 3FKIH 3S2DK 4KDDA 1TWAH 2OEOA 4A3BH 3M4YA 5I2XA 4M1XA 1X55A 4A3DC 3LPXA 2J0TD 1YFTA 1HQMC 1TT2A 4K87A 3D6CA 1BDFA 3FHWA 2PQAA 1TXYA 4BXXK 3KOJA 4LFCL 1B50A 3T1HL 1XMOL 4J15A 3MVVA 2Y0SD 3I90A 1S5FD 4DV5L 1LT6D 5H1SE 2DNEA 2WP8J 2ZZEA 1FNUA 2RHQB 1TS4A 1M4VA 4TKOB 4FXKC 1SDFA 2CQOA 2F0LA 2PCFB 1Y1WA 3GTPA 3K5MA 2JA8C 3ONAB 1IBMQ 1AZQA 1KL9A 1WCMK 3IRBA 1PFMA 1XZPA 5BR8Q 2UU9Q 3CHBD 3CPWA 1XNRL 2WKDA 3M4QA 3KF8A 5TMCA 1ADYA 1HI9A 2XWJB 2YTVA 3N3YA 1B4BA 5JEAG 4DV4L 2ARTA 3A7AB 1TWCH 1EFID 3GO5A 4JI5L 5KYLA 3S9WA 1CA6A 3NK9A 4QQBX 1DOLA 2PMZD 3I73A 4Q5VA 4IJLA 2A73B 4A3GH 4TVYA 4CJ2C 1SYEA 2CH4W 3F2DA 4Y52C 2J4XA 1TY0A 1P8LA 4QJVB 4K0KL 2UXBL 4JW0A 1PH5A 1CTMA 2UUCL 3V7RA 1G291 4KMAA 5C44C 3OW7A 2CW0C 1SYBA 4DV7Q 4BXXG 3J81j 1CKMA 1G91A 4PAAA 4ZYSA 4B3RL 1LTAD 2E2JB 2Y0SE 2PW5A 4BA2I 1R4PB 4CKEA 3S1NC 4DUZL 4CDDC 2YTXA 4DNRB 1IKMA 5IOTA 4KJNA 1IXRA 3URYA 5IP9G 2EZVA 4C3IC 4C3JK 3A8JE 1JOEA 2GSOA 1TS5A 1YITA 1II3A 2CWPA 3M4OC 1WTPA 1HNZL 1XXBA 3W5OA 2WAQB 1DCOA 4LOWA 2MNAA 3E5SA 2C7IA 1JB7A 1STHA 1M90C 4Y7NB 1WCMG 1XWEA 1E1TA 1TWHB 4F7XA 4GN5A 3S1QB 5C3EG 4Q4ZA 1PH4A 2RF4A 2R92H 4WORA 3AQQA 3KBGA 1IW7C 2YV5A 3BZKA 4OIJA 1IHZA 4DK3C 3U9OA 4AYBE 1A3TA 3ZJYC 1WVLA 2HQLA 2VL6A 2BCOA 3NQIA 4B3ML 2NVYB 3WOFA 3OIQA 4IUUA 4LVJA 3CQZC 1TWFC 2E2HB 4XYOA 2NB0A 1B7YB 2K52A 2M2LA 1WOOA 3RUXA 2HUGA 3C2PA 2KCNA 2ZR2A 2EYPA 3VR6A 5EKLA 1O28A 2L15A 4EQ5A 3H0GG 1DD2A 4QIWL 2BH2A 4X6AC 1S5BD 2F0OA 1QVFA 2K32A 2N88A 4L63B 2FHTA 5FKAC 4NXNQ 2NVXH 1WSRA 2GN5A 4Y52H 2DDZA 3TN2A 1SXTA 2AQ2B 1Y1VG 2CJAA 2XRSD 4HWTA 1B9NA 4ME5A 1PFNA 4KKSA 3HKZE 4K2KA 4XTWA 4M1UB 2GAHC 4JI2L 4NB3A 4A3LH 2EYMA 2E3CA 3MF1A 3BS1A 1BIBA 1CM9A 3K81C 4A3FG 4U673 3D0FA 4JBJA 4DFAA 2JA7G 3B6YA 3S1NH 4OO1H 2VUMC 1YIJA 4C3IH 2ARSA 4DR1L 5ELDA 3IFDA 4KMUA 4YHHL 2WKCA 1YEZA 4HJAA 2FYKA 2H1EA 3M4OH 3K6OA 1B8AA 1LTGD 1I3QA 4KQEA 3G71A 1K0SA 2KHSA 1O25A 2EDGA 1SYGA 1W3SA 2K33A 3M4PA 4B9WA 3C1EA 2R93K 1VQKA 3RLOA 5C4JH 1EWIA 2RDHA 3RD4A 2PQAB 1GOZA 1B2TA 1VQGA 3FKIK 4UY8C 5BN3A 1TWAK 3TZUA 1K83H 4A3BK 2EPBA 2DVEA 1TWFH 4GFQA 1J9OA 2XWBB 5KRUA 1CA5A 3VR3A 2QEXA 4ZRZA 5J3BA 1UE6A 2MQHA 4H2UA 3KF6A 3TDQA 1JORA 1USYC 4X6AH 1Y1WB 1IBLL 4HA8A 3P1HA 1VQEA 3DLLA 1XZPB 3DXJC 1MJCA 3KLRA 1NJ5A 3H15A 1IBKQ 3KF8B 4N8FA 5C4XG 4KR2A 1I6HH 4CKBA 2AWNA 4E51A 1DOKA 1AE2A 2CW0D 1VQZA 3TTGA 1TKWB 3HRZC 3R07A 1N9WA 1I4PA 1UE5A 2MUYA 3F2UA 3GTJC 2ZXOA 1ENFA 1KRSA 3R2TA 3HOUB 4K6DA 1ILPA 1SRUA 4QIWB 4X66L 1TWCK 4HSPA 2VUMH 2A6HA 4Z9CB 3STBC 1X3PA 1GUTA 3DM1A 5AJ3L 3GTKH 4A3GK 3D4DA 3I91A 3UDXA 5JAVA 3QJYA 3A5YA 4I65A 5D3DA 3JAMi 3G4AA 2DXTA 1PLFA 1QILA 2AMCB 4JG2A 5IGBA 2PZWA 1BO0A 4RFBA 2I4OA 2UUAL 1M8AA 3AYHB 3G6EA 1OXSC 3S1MB 1SLJA 5K5PA 3RZOC 4KJOA 5C0XH 3UGQA 3BU2A 1UE7A 1CZWA 4PZ7A 3FRPB 3PMFA 3A31A 4A3DK 4A93B 2PPBA 3A8JA 4IUPA 4BBRC 2NVTC 1YCLA 1LACA 2Z6KA 5C6AA 3TFJA 2D5DA 1Q86C 1EYGA 1A2TA 4P71C 2QHTA 3HOWC 3PO2C 3HOXG 2IL8A 1J6XA 3M7NA 1G8ZD 3N52A 5M5YH 3NTIA 3PO3B 2YU9H 5FOBB 1L0YB 2EOTA 1BBXC 1IBML 1X3EA 5BR8L 3BVZA 2UU9L 2XGTA 3BDOA 1EIHA 1VMPA 2OCEA 3C3LA 1NNHA 3JAME 5IWAQ 2F0MA 5G3LD 4CBVA 4KARA 3FKIA 2N49A 2F0IA 4WJWA 3SXHA 3J7AF 3K5LA 5CMDA 1D2BA 2O5IA 1HZCA 2I07B 5BN5A 1EIGA 1YHAA 1PZKD 3HOZG 5T1IA 3DEOA 1GHKA 1NNXA 3BVMA 3QOLA 4JI8Q 3CCVA 2EYHA 2Y0SL 4A3EC 1RIQA 2XNAC 2BE5C 3LWUA 4C1NK 3RZDB 1FJGQ 4XTVA 2E2IC 2B63C 1JB3A 4Y52K 1BDOA 2IX1A 3TS0A 2DGYA 3A55A 4A3DG 1NJ2A 3HFZB 4DV7L 3GTPC 4JI3Q 1X01A 2O4XA 3RZOH 2E41A 3QB3A 3K80C 3HG9A 2RKSA 5DM73 3OPFA 1LABA 1PVOA 4A3JG 1NCVA 3HOYB 3PIO3 1EIYA 3T56B 2QCPX 1WTOA 4LF5Q 1JCKB 3ULPA 4X3UA 2F0TA 3GEEA 1I3QB 1CFMA 1SSOA 4BBRH 5IYDC 3S1NK 5BN4A 2NVTH 1O27A 3E3XA 4OX9Q 4C3IK 5IYBH 4AYBL 3H6MA 4GN3B 1J8IA 2B2UC 3I56A 4PZ6A 3S2HC 3M4OK 2XN9C 2V6TA 4DGZA 1ESRA 2JA8G 3LAJA 2VNUD 4FYDA 1TWCA 3CMEA 1BF4A 4KM9A 1PXUA 4PMBA 2JA5C 4XT1B 5C4JK 3QWNA 3OMCA 4TVWA 2RQXA 3NUCA 1JJGA 5ELBA 1XXCA 1K83K 3L7ZC 1HFNA 4G7HA 5ELNA 2EAYA 2K28A 2R7ZG 1TWFK 3CQZK 2CFAA 1SFOC 2PMEA 3HKSA 4IPGA 4JPBW 1LTID 4IFDG 2FJ2A 2HDMA 4C3JB 4WF2A 1HXDA 1U9RA 1YNJA 4QJFA 3HKZL 3BG3A 1R9TH 3PCOA 1F9NA 3DWQA 3STBD 1BIAA 2F1MA 4NXNL 3X3NA 5D14A 4UP8A 3GTMA 5F5WA 1PTOF 4X6AK 2QDLA 5C44G 2OTJA 2E2IH 2DU7A 4YRMA 1BBWA 1KTKA 3CCMA 3PUVA 2JJQA 2B8FA 4OP0A 1SNOA 3LNNA 4JI1Q 1KHIA 4NCXA 1GO3E 1HTLD 4IZ8A 5CORA 2R92A 2XCQA 3ERED 4X65Q 2J3MA 5IP9C 4GTLA 2X6GA 4KASA 4JOIC 1A15A 3HOVB 1DZ1A 5DNFA 4RMFA 1VQJA 3UE1A 3AMUA 5LMUQ 1S5CD 1NYQA 2VUMK 3HXWA 5IIFA 1Q3LA 3OOCA 2Y0SB 4YRFA 5M3MG 1JE4A 4XSZA 3GTKK 2B2VA 3CCRA 4MN3A 2G5DA 1RF2D 2Q5IA 5JJZA 2EY6A 1DGSA 1ZQ1C 4UDUC 3K7AB 5GAEC 2CFMA 3SK6A 2EJFA 2KWAA 3W3AA 2AWOA 4Q0FA 2NVXA 4KM8A 2AKWA 2HNIA 4P72C 1DD5A 4P74C 2OF1A 1JC7A 5JEAH 2ZFZA 1EY8A 2PZTA 3FPPA 3CMAA 4PV1C 2Q2UA 2Z0SA 3KYHC 3H0GC 3GTOC 1AH9A 1QWYA 1KDBA 4AYBB 3WQZA 1HZ9A 2GSUA 1PJ7A 1NY4A 3PV0A 4IPCA 4K5VA 3S2DH 2WB1E 1CHPD 2B2TA 4WI1A 2VW9A 1Y1VC 1MBYA 2QHVA 2N78A 3T51B 2BE5D 4IALA 1IBKL 2I5HA 5M5YK 2ZT8A 1STEA 1USMA 2R93B 3K5OA 5E4XA 4X3TA 3RL6A 1F93A 5IP7C 3VBBA 3OPOA 4BXXH 3D31A 1J6VA 3FKIB 2Z8LA 1LV9A 4A3FC 1JWSD 4YROA 2JN4A 1GVPA 4LK1C 4A3BB 4QGUA 2JA7C 1UE1A 3FOEA 3CRKC 3M3YC 1XTDA 4J8QA 3H09A 3VQVA 3GTJK 3HKZB 5IP9H 1MSGA 4HMIA 4F87A 2KUMA 4GS3A 4LJZA 5IGDA 4GOPB 5L46A 1WQGA 1STBA 1WTVA 2AQ1B 2A68C 1WCMH 4R4CA 2ZR3A 1G5HA 5C3EH 2SEBD 1H4SA 2NWGA 5CV5A 3QR8A 4LFAQ 3H3VC 4IQZA 2OXPA 4IURA 1F2YA 5KGUA 1I6VA 4YRSA 3RZOK 2CHBD 3U4VA 1GGMA 2X6LA 2ZXPA 4IOCA 1WPYA 3EQLA 3GTGC 2NN6G 3EFXD 4K5WA 1A6XA 3BDLA 5C53B 4CKCA 1DCPA 5D3IB 1H4QA 4YRTA 3NWSA 4XQJA 2ZT7A 1GHJA 3D6WA 3JSTA 3KFUA 2ID0A 4BY7G 1D5MC 1E7ZA 1TWCB 3H0GH 3GTOH 2I4NA 4BBRK 1DM0B 2NVTK 4K8IA 2ZIOA 3SZYA 1EEFD 4A3GB 3G7LA 3CW2C 3RKWA 2G9DA 1MHWC 2NUCA 5EBDA 1RJTA 3G48A 4RGTA 1Y1VH 2WAQG 1EY4A 1PH9A 1VQ6A 4QJVA 2LSSA 4P73A 3JAML 3J80c 1G6ZA 5HL8A 5C4XC 1X6OA 2ZCEA 4KY6A 2KBNA 5EGHA 3A7UA 1MKHA 2CFAB 4IO9A 3GTKA 1CHQD 1VF7A 3CXCA 3J7A5 1YVCA 1WD1A 5LMNQ 1MI2A 1NR4A 1O78A 1UWVA 1SNCA 5IWAL 1JR0D 4A3FH 3PCOB 3NUHA 5M5XK 3EIVA 1QE0A 3NTHA 2XCRB 1U4PA 4O0AA 2JA7H 4GTAA 2NS6A 2KJXA 2HCCA 3GV3A 3M3YH 1XZQA 1INNA 2EY1A 4IUTA 2CVRA 2F0GA 1C8CA 2E1HA 5M5WH 1K28A 4JI8L 2CCZA 5E68A 1NJIC 1ADJA 4QY7A 1VS0A 2V1CC 4FF1A 4A3EK 3VYRA 1HA5A 2E2IK 4JI3L 4A76A 2ICEC 3OWFA 3A5ZA 2QW7A 2JA6C 2R92B 2K5QA 5E7NA 1KOGA 2MJ8A 1VQHA 3OSOA 4MIUA 4WJ3M 3ICAA 1X3GA 1L2FA 4ODGA 3L0OA 4RQFA 5KYIA 4C2MC 1VQAA 4LF5L 2A6EA 2YU9A 1FD7D 4MZ9A 1AFPA 1I50C 2EVBA 3LX0A 3TS2A 4OX9L 3Q8DA 4G7ZC 3HOWG 3W3SA 2O5IC 3PO2G 1T9HA 5IYDK 4PNYA 4FXGC 2DUDA 3PUYA 2F03A 2AUJD 2KHJA 3VA5A 3V2TA 5M3FG 1EY5A 3AU7A 3HOXC 2ES2A 2UUBQ 1X32A 2NVXB 1CK1A 1NAPA 3EVQA 1HNWQ 3S1RC 3S2HK 1PRTC 1SNMA 2DJGC 5C4XH 5IGEA 2EXZA 4DN4M 5EJWA 3A8IE 2KA7A 2HHHQ 4EO4A 2NVQC 3I2ZA 2V6UA 1J6QA 3PIOA 4OIKA 2MPMA 5C4HA 2JA5K 2A8EA 2EL9A 2H4OA 4KAWX 1Y8OB 2H5XA 1KAAA 2B8GA 3E9HA 1L1OC 1PYBA 1YX2A 1QOHA 3NENA 1PYSB 1YNXA 3E0EA 3MXNA 2Q8TA 3S1NB 2EJ9A 4YY3Q 1Q90A 4A3EG 2PZUA 5FO9B 3FP9A 1SJHD 1W6KA 1JWUD 3CKIB 2B63G 4CHTB 2K04A 3P75A 1STNA 1L0WA 1D5ZC 2EY2A 1Y1WG 3M4OB 4XTCS 4C3HC 2A68D 1FL0A 4YCUA 4G0WA 2F3WA 3FEWX 4G7OA 2A69C 3HY0A 3MTSA 4KN7C 3H3VD 4JI1L 5C4JB 5CV9A 5C3XA 3KLWA 1J5EQ 4A3JC 1A8VA 1ZEQX 2PYKA 4K8JA 1K83B 5IYDG 3GTQH 1NR2A 1TY2A 2K4KA 3HZXA 1EU4A 1I50H 1D5XC 4DAPA 2GAGC 4JI0Q 5C3WA 5LMUL 2DEQA 5IP9K 4BWGB 4ZIBA 3VR4A 5FLXE 4DV6Q 4B3TQ 1LTLA 3L4JA 4KLKA 3REXA 3FOFA 3HOXH 3OMGA 2VZAA 1Z47A 5C51B 1HQRD 2JA5G 4CH6A 4C1NI 3S1RH 5C3EK 1R9TA 1IS1A 2KENA 1KDCA 1I6HB 4GKKL 2Z9HA 2O5JA 2HIXA 4HJ7A 2E2DC 3K5NA 2DTIA 1SMYA 3TFHA 2CJ9A 4TQUS 3H91A 2EJGC 5JPNC 5ISRA 4KMHA 2WB1L 2R7ZC 1YJNA 1HHVA 4A93G 1UUPA 1TVXA 3NPPA 3K0XA 1FR3A 2K5VA 3U50C 5IT9E 2PA8D 3L4GB 1EYDA 4OO1I 2DU5A 3HOZH 3BZDB 3NQTA 4BY1B 3H0GK 4GTEA 3GTOK 5C0XJ 5L37A 3GTKB 4DR7Q 2GA4B 4HMJA 4XU2A 3HS0C 5FK9C 5CGKA 2K5WA 4KN4A 2XTIA 1Y1VK 1CT1D 4A3DH 2O2LD 3M7GA 5HY6A 2QHUA 4GTCA 2AMCA 3PO3G 3T01A 1VQDA 4DPGA 3X3MA 3SZZA 3MEFA 4EQPA 2MO1A 2DZCA 1EQTA 1LTSD 1XZQB 3KBXA 3GTLC 1JJCA 1IZ6A 3L2PA 1JWMD 5EGTA 4IPHA 5E3IA 3FMCA 4A3JH 1F7VA 4HWRA 4BA1I 4R8IA 3I55A 4A3FK 2JA7K 3I70A 2R7FA 4DF7A 3E6ZX 3Q3QA 3M3YK 3E0JA 1SN8A 2BOSA 5TSSA 5K36G 1BKBA 1CKOA 3A5ZB 3HFVA 3IL8A 4DAYA 5M5WK 1WU7A 1TU2B 3P7JA 4I7ZC 3NTKA 1NYRA 2PMFA 2F0PA 1KMMA 1N32L 4GLXA 2JA8H 1KMNA 1O80A 2PMZE 4LFAL 2L0CA 3V8KA 1HFGA 1PRTD 4LLGA 4A3IC 2YU9B 1YNNA 2JA9A 2HDLA 2RGRA 4DUYQ 1TWGC 4B9XA 5I4DA 2KEEA 1FGUA 4HT4A 4XYQA 2C5CA 2OT2A 4K2LA 3QO7A 2R7ZH 3GTGK 4FF4A 3HOYG 4YDQA 1QZHA 4JI7Q 1B4AA 1BXTA 4IFDH 5I9OA 4BBSB 2IX0A 4CH4A 1I4QA 5GROA 4HIMA 3GSIA 3QNEA 2FMCA 3SE0A 4OINA 3CCQA 3RACA 4HJ5A 1EL0A 4G4KA 2BA1A 2E75C 5C44H 1VF5C 2K75A 4H2WA 4P75A 3TMEA 5IP7G 1VQ5A 4KB4A 3AFQA 3A8IA 4NDXA 1PZJD 3G6JB 1F77A 3DMUA 2E64A 2A69D 1RKNA 2OQKA 4HIOA 1G6PA 3HFZA 1ZYRA 5C4XK 5LMNL 4OEMB 3MXNB 1XXAA 4G85A 1ZVUA 3RKXA 2M00A 2E5LQ 2WB1B 3NXWA 2ZM6Q 4AH6A 4GNXA 2Q7HA 1WCMA 5C0XI 1UV7A 3RNUA 1K8MA 3MFGA 4A3MB 3F8TA 2DXUA 4L5TA 4CH3A 4BBRB 3NETA 4UPAA 2NVTB 2DQ0A 1VMCA 4LVLA 4WJ4A 4RH6A 1LT3D 5M3MH 1HUNA 1OXUA 4CS3A 1NMFA 4A3KB 4APVA 3M9BA 2LY7A 2D9UA 2VS1A 4ULLA 1FYFA 4QF4A 3ADAC 1JVIA 1SAPA 2ZGWA 2RCFA 3CQZH 3KUPA 4GZYA 2A74C 2K6AA 5AFWA 1G2TA 3BJUA 2K05A 4H02A 1TWGH 5I6YA 2E2JC 1V1PA 4DKAC 1JJ2A 3GTQK 2B2WA 4C2MK 2QF7A 4POGA 5DAUA 2Q8RE 1E2VA 1PMRA 4CDEC 4CDFC 4NXMQ 1H9KA 1I50K 4BY7C 5JVG3 3Q23A 1SETA 4NP5A 2VQEQ 3HOVG 1B1ZA 1R9TB 3I4NG 2UUBL 3T1YQ 4R4OA 3D4RA 4RGNA 3RN2A 1HNWL 3HOXK 4LNQA 3NELA 2NTTA 3TP7A 1O7YA 4Y7NC 3S1QC 1TWHC 2HHHL 2VQFQ 3S1RK 4BS9A 2HCIA 4LF8Q 2M9VA 1PA6A 4V0BA 5FJ8G 4XEMA 5DM63 1H9RA 3IKMB 2NVYC 3LSQA 1JQWA 4JK1C 5CV6A 4YWMA 3ERRA 3GEIA 3BP8C 2E2HC 4NPSA 4OIOA 4YY3L 3NHHA 2N8NA 1A3UA 1AP0A 4CDCC 2I0QA 3KK7A 1E24A 1O7IA 1HR0W 2ZTDA 4AYBG 3G1ZA 5KNBA 1JOOA 1LT5D 4RA8A 4LVIA 3HOZK 3HP3A 5D4DA 1IW7D 1XYIA 5CYUA 2JA6G 2IT1A 1JJCB 4LR2A 3IG2A 2Z4IA 1CZGA 1HNXQ 5JEAJ 3FVQA 1O7LA 1RTOA 1J5EL 4GTDA 1X65A 2NZHA 2TSSA 1ICFB 1X2HA 2BDNA 4KKTA 5FLXL 4FZBA 4HCSA 2IW3A 2NN6H 1Q7YC 2JSOA 4DAYB 1E3PA 1ET9A 1WQFA 4EVOA 4YG2A 4A3JK 4OELB 2ZTEA 4JI0L 2LXKA 3BDCA 2BH8A 3W2DA 1F9SA 1TR5A 2QILA 4BY7H 3HKZG 4DV6L 4B3TL 4YYEA 3Q0AA 3AQOA 11ASA 2EE1A 3DSQA 3UH0A 3T4AC 1PH1A 1O24A 4FXDA 4LVKA 4RHRA 3S2DB 3EA6A 3GP7A 2F4IA 2JA8K 2HIVA 2DJFC 4LK0A 1B44D 1E2ZA 1TWHH 5HGQA 1EQQA 1XNQQ 2R93A 2Z1CA 5IT9L 4ZKBB 3GTJH 4RG1A 2E76C 3HXVA 4XTZA 3SEBA 3S15C 4Q5SA 4YFNA 2UXCQ 5CHPA 1O7ZA 1TWAA 5FO7B 4MHEA 4KHPQ 2LKVA 4YFXA 3J81i 1IL2A 2ZINA 1GE9A 1K3RA 2R7ZK 4XLNA 1LYLA 4YRPA 3AH5A 1S4ZA 2P5ZX 4G84A 3I7FA 4H0LC 1OXTA 3V8JA 4DR5Q 5CBEE 4C3HG 4OIRA 4DR7L 1IE0A 1O2AA 4KD3A 4GOPA 4PZ8A 2K5HA 1LTRD 3DEPA 1Y1WC 1QZGA 4LFBQ 4P3NA 2E10A 5C44K 4DR4Q 1N36Q 4RGMA 2R6GA 1WCMB 4GNXB 4JV5Q 2MP1A 4EQNA 5C3EB 3EBEA 3K59A 1IYUA 1Z6HA 2PHCB 5JFEA 2JE6I 5C5MA 2F0JA 1BCPB 5KEEA 4GLVB 4OIQA 3T53B 2WV6D 3G4CA 4GTFA 2PMZL 2K5NA 3CPFA 4ZAIA 3HOWH 3P8TA 2ZT6A 3ITPA 3PO2H 1SBBB 1YFRA 3GTOB 2DTHA 1SJED 1OO9B 2PA8L 1QJOA 5M3FH 2DKGA 5M3MK 3RGLA 2WAQD 2P5IA 3J81E 3CAMA 1Y1VB 5M5XH 1V1PB 3KJOA 4P9SA 2RBMA 3U9SA 3RUZA 2A5HA 3TFIA 4A3IK 2EY5A 3A0JA 3S15H 4LW1A 4JYAQ 4HJ8A 4GKJQ 3BYYB 3NWTA 1O29A 3CC7A 2EWNA 1TWGK 1X9NA 4A3FB 4A93C 2SNMA 4JI7L 1KIXA 1WTXA 4RHSA 3I4MG 5EPJA 1S5DD 4A3EH 1HQMA 3M3YB 3QO5A 2E5AA 2B63H 3HRIA 3IFTA 3TREA 5M5WB 4A3CC 2CJBA 1Y1WH 1SR3A 3GTPH 2I5LX 1EY7A 3AD8C 1ENAA 4HWOA 3OEPA 2CIMA 3PO3C 2B29A 3V96A 1STAA 4C45A 1EZ6A 1RD9D 5EQ0A 1ATIA 2PQEA 2ZM6L 3OW2A 1KXLA 2KCMA 3F2BA 2QEJC 2ZTCA 4JBKA 4L6TB 5IYDH 2L11A 2KCTA 4Q6GA 1EY6A 1I4XA 1K8OA 5FO8B 4O1NA 1ML0D 4PG3A 2DTOA 2K01A 1DCZA 3S2HH 4LNSA 3HXUA 5EBCA 3Q6SA 4A75A 3TP6A 2N3SA 2ASBA 4MEYA 4OHJA 3VQWA 3RF1A 4A3IG 1DXMA 3I4LA 2JA5H 3RZDC 2Q2IA 3PF5A 3V7SA 4DR6Q 1ZXOA 2FMMA 2K50A 3UDGA 1IYJB 2EYLA 5C4XB 2A19A 4BLBA 1YGBA 1QE6A 4K5XA 4R1JA 1HZBA 4OWXB 2SNSA 1SFOH 1VQNA 3U58A 1S3OA 1FVIA 2CW0A 3UE0A 1Y8PB 2A1AA 4KMUC 2EJMA 2E2JK 4CGYB 1I5FA 1QUQB 3HOYC 2PMZB 2TMPA 5I9PA 4A93H 4NXML 3ERSX 2J3LA 3L2ZA 1B70A 2VQEL 1I3QC 4LF6Q 4MNOA 3A5UA 1VQPA 3AB9A 1EY0A 1PYSA 4BY7K 2JK8A 3T1YL 5ELOA 4KB2A 4KV6A 4ZTZB 1KC8C 3DUZA 3BFMA 2D0OA 1UNSA 3HEJA 2BDOA 4BLAA 5IY0A 1TWAB 2B3GA 4DR2Q 3D8GA 1B3QA 2F0KA 2RHSA 4Y7NK 4X3SA 4LF8L 4L87A 1TWHK 1NJ8A 2E65A 4EX5A 2F0NA 3DWAA 1Y8NB 3ULLA 2DZ9A 3TUPA 4J3NA 5FLMC 3UFGA 3P8YA 3J7YW 3S0XA 1V1OA 4F8MA 3GTQB 1NMGA 1K83A 3TRZA 3NBHA 4IN3A 3MC0B 3CQZA 1I94Q 1TWFA 1I50B 1HTTA 5K36H 4C3JC 1VQ4A 2ARUA 4QIWD 5IOQA 3BZCA 1A3VA 3A7LA 4HCEA 4YRIA 1VQ7A 3OYYA 3QIAA 1SESA 3V8LA 4BY1G 4KHVA 1T5XD 1HNXL 3HY1A 4XU1A 2PNRC 4LUOA 3HOXB 5J22A 5IYCC 3I3CA 4ZKCB 2NZ1D 3S1RB 3LAPA 4G0VA 4X64Q 2F0QA 3SGIA 3Q24A 1R4QB 2VY3A 4IUQA 4N9PA 3EROA 4XEOA 2A6HC 1C7YA 1X56A 1X54A 4JVZA 3V05A 5ELEA 3MHBA 1W66A 4XCHA 3S16C 1B4OA 1C48A 3HOYH 2Q7GA 1CSQA 3CC2A 1L1OB 3OREA 1I3QH 3HOVC 1SNDA 3HOWK 1BQQT 4BKWA 3L4GA 3PO2K 3I4NC 4TRDA 2WINB 2VUMA 1JT8A 3ND9A 3HOZB 1CSPA 3UDFA 4CJ0B 3RR5A 5M3FK 1LTTD 5IP7H 2KOLA 5E1FA 4OONA 4R8NA 1HRJA 1ONLA 1XNQL 5GAGC 2PPBC 4A3DB 1V8QA 1WTHA 3VA7A 5K1XA 3K7AC 3BVGA 4OGQC 4IPDA 2UXCL 1UEAB 3KLSX 4KHPL 4QMGA 1SYDA 3ULJA 4ZH4A 3S15K 3A74A 3C46A 2Z6KC 4B3SQ 2CGHA 3WDNA 1XJVA 4A3JB 1WJJA 4LF9Q 4FF2A 1XPOA 1FJGL 1JQYD 4DR5L 4HSVA 3FDTA 4DDQA 1D8LA 1QB5D 2OQ0A 3AEVA 4FM9A 4BBSG 1EYAA 1PH7A 2DY8A 2B63K 3VQYA 4LFBL 4TVAB 5G3LF 3H3VH 4YRRA 3JAMc 3GDEA 4DR4L 3T13A 1USYA 1Y1WK 1RU0A 3GTPK 4JV5L 1J6WA 2JA8B 2I4MA 5CV4A 4DK1A 2K1BA 5GQOA 3KJPA 2MFIA 5ELFA 1HUMA 1KABA 4IFDJ 3GTGH 3VQXA 3DXJA 2R93C 2E8GA 1S40A 5KNNA 3GIRA 2HD3A 2WIIB 3FKIC 1MIUA 4OLFA 2FFKB 4X3KA 1HXYD 5C4ZA 5J39A 5IE8A 4OL7A 1PH3A 2KQ3A 2WB1G 2FQOA 1VDZA 3S16H 1PH8A 3J81L 2RH6A 2QDBA 4JCVE 1XMQQ 3NE5B 3GTJA 1Z7NA 4A3MG 3HOVH 2XRQD 4JC0A 3J7AV 1AB4A 3I4NH 5DLQE 1YJWA 4GN4B 2NBFA 3UI2A 3WWVA 1GKHA 1P16A 2QKIC 3MF2A 1K3BC 5C44B 4A3KG 3S17C 1CQFA 1VQCA 4HN7A 5LMNW 4JYAL 4GKJL 5J1ZA 4P5AA 3NEMA 2Z4HA 3T00A 1B70B 3S14C 1EVLA 1H9SA 3QX3A 2MO0A 1PTOC 3I8ZA 4PABA 1SFOK 4HTHA 4RKBA 4C3IB 2NYZD 4A93K 2PI2E 1KQ4A 2ZZFA 3PQIA 2QA4A 1TWCC 4NW2A 2RHSB 2XVSA 1LTBD 1L0XB 2ZNIA 4N8X1 4P3OA 4G57A 2JA6H 1YZ6A 5M3MB 1PV4A 2F0EA 4GLAC 2VXWA 1Q8KA 4R9WA 4P71A 1H4TA 3CAGA 4IJHA 3P20A 4XXEA 4O2DA 2OWOA 3L4KA 3OWEB 4PMCA 1YJ9A 4X65L 4QB4A 4G7HC 4RCOA 4C2MH 3PO3K 3NBHB 3CQZB 1TWFB 2F52A 1WTQA 4DU9A 1NJ6A 3EFRA 3IPJA 3MMLB 2KCCA 4DK0A 1AN8A 4HWPA 2A8VA 1YNJC 1TWGB 2ODRC 2IJ0A 3TP5A 2A6HD 3HOUG 2UUAQ 1SE8A 2BA0A 1D7QA 1WI5A 1EWHA 3GTMC 4F88A 2IHEA 4YPFA 2JH3A 1U4LA 2XSCA 1JICA 3TBIB 5CC4A 1U4RA 1YFSA 3R8BA 3TEGA 3N0CA 1IBAA 1F2LA 4IFDI 3RN5A 2NVQH 3TP8A 1N34Q 4QCLA 2ZJPA 4DR6L 1ZBSA 3S17H 4LF4Q 1Y14B 2C35B 1USOA 3RZDK 2BE5A 2E2IA 2B63A 4S3SA 2RDFA 2R92C 1CI3M 4ZLTF 5JJKA 1KDAA 2R61A 3VYSA 3S14H 4GTBA 1SE4A 1SMXA 4JBWA 1PTOH 1C9OA 4R4IA 1SE2A 2LS01 4QUFA 1MSHA 2VUMB 4GT9A 1A62A 1N33Q 3I4MC 4P3PA 4LF6L 1J5WA 3CCSA 2B2VC 3HOYK 2UXDQ 4A3CG 2LFNA 2NTSA 2EYOA 4H2TA 4YP0A 3ER0A 1HZAA 1KAWA 3OD1A 1I3QK 3T16A 4C3HH 4AYBD 1TIID 1V5VA 1WOPA 2G4CA 2E74C 4H2YA 4Q15A 2EJFC 4DV0Q 4DR2L 3A8KE 2NVXC 2B2UA 1X31C 5IP7K 1HH2P 4RKLA 1LUZA 1Q46A 1V1QA 4ZQ3A 3QTCA 1ET6A 2B39A 2MGSA 1B76A 5LHY1 3R3OA 1GUNA 4X62Q 1J98A 1QNUA 4A3LC 2JA5A 4KATA 3PIP3 5IGCA 2K03A 3A32A 4EGVA 1Z7MA 1PFSA 5FLMK 1I94L 4KY5A 1W2BA 3GTMH 4XTUA 2B2TC 1SRYA 2Q7EA 1RCVD 1RL2A 3QO8A 4M8AA 3HKZD 4QUCA 2L12A 1SFOA 4BY7B 1HA6A 2DQ3A 5M5YB 4QL5A 2VB2X 2L5TA 4DNTB 1MJEA 2RSNA 3CCUA 4X64L 5CV8A 1OTCA 4K6LA 3L9AX 5IYCK 1WNLA 2ZJQA 4OIPA 5EKIA 1KRTA 5I2YA 2EQSA 4HJ9A 5C4JC 2EIFA 3GTJB 2JYOA 4RDXA 2D62A 2F0WA 4LWCA 1PTOD 1S72A 4YFKA 3VYTA 3V4GA 4KMDA 3CCEA 1K83C 4LJZC 2ZT9C 5IGFA 2I4LA 1K8GA 1K73C 3I4MH 3S16K 5LL6X 1KLGD 3MZ5A 4LUVA 3BUEA 1E2WA 4DK6C 3PF4A 3AD7C 2AUKA 1Q1EA 4JI4Q 4DAVA 1EH1A 5A2QE 4ALPA 4JOIA 4PQXA 2K5DA 1U0LA 3BP3A 3HOVK 3I4NK 1G2SA 4LUZA 3VYUA 1VJEA 3PUWA 1I6VC 5HGTA 4R4QA 1H9SB 1RTNA 1O26A 1V43A 4ME3A 4A4IA 2K14A 2ZXRA 3GTLH 1B3AA 3EQLC 4NKLA 3RZOB 4K86A 4DAMA 5FLMG 1YHQA 2ZUEA 2F4VQ 4K14A 2HT1A 2EYJA 1I6HC 3K7AK 2MHVA 3NSWA 4XQNA 1C0AA 1CUKA 4B3SL 3VR2A 5FJ8K 1BJTA 1YNJD 2PI2A 1SYCA 4LF9L 2ODRD 2IWHA 5K1PA 3IAYA 4C3JG 2R3ZA 4L5SA 1KLUD 3CRLC 1NTGA 2NN6I 4P72A 1Z7TA 4P74A 2LMCB 4DV1Q 4FNFA 1GUSA 3HOWB 4P73C 3OHXC 4HIDA 3PO2B 1E1OA 5IYCG 4BY1C 3H0GA 3GTOA 4UHVA 5DEHA 1LM0A 4A3IH 3GTKC 5M3FB 5E4WC 2JA6K 1EQRA 4H2SA 2CH4A 3NBIA 4IOAA 3NP8A 2PO4A 1HR0Q 1Y1VA 3Q22A 3MQZA 5M5XB 3TSSA 5TMFA 4LF7Q 1BNZA 1BOSA 1EYCA 1AE3A 3S15B 1ASZA 3IKLA 1O2BA 4MTKA 4FDBA 4XU0A 2AQ3B 2DNCA 4EQOA 2ENBA 2D0PA 1XMQL 4XQQA 4LK1A 2GVBA 3ZYYX 1OXXK 5E3FA 2JA7A 2Y0SG 1RHPA 1BCPF 1DJRD 3RMHA 2DY7A 4LMQD 2B2YA 4A3EB 1RIPA 2E2IB 3SK4A 2B63B 2V6SA 3MXUA 1NUCA 1EI6A 3GDZA 1WFQA 1VQMA 4FO2A 4OWWB 1NJ1A 4DA2A 4UAIA 5KNCA 3WODA 3RLFA 2Q2TA 3J80i 1K8AC 3GTPB 4CS2A 5IGGA 4I7AA 4XSXA 3F2CA 1JMCA 2NVQK 4JI6Q 2XCOA 2IHFA 2A68A 5EPKA 3S17K 2A6EC 4WILA 2YU9C 5EAYA 2L55A 3C1FA 1H95A 1G5IA 3EJIA 3AQPA 1QNKA 3S14K 5EKKA 1SROA 2NZOA 1PZID 2KECA 4YCWA 1AW7A 3R93A 1UAPA 3P8VA 4ABNA 3GTGA 2CWAA 4BBSC 1HTPA 1A0IA 4G0UA 3S2HB 4X5OA 3PSIA 3A8KA 1FYCA 4CJ1B 4PHCA 2EYFA 1PFBA 4AQYQ 4RQEA 4XTYA 4C3HK 4BY1H 1VGXA 1Q82C 2R93G 4HEDA 1BGWA 4ZTUB 2JA5B 2YYZA 3KLSA 3FKIG 1A2UA 4H2VA 2E2JH 1NSNS 3TQYA 3A7RA 4A3BG 1QVGA 1WORA 1FNWA 2RCNA 2ALYA 4TQFA 1FNVA 1M1KC 1SFOB 4B08A 4YRLA 1VQ8A 1KQSA 1YB3A 4ZUJA 3J80E 4R4TA
chains in the Genus database with same CATH topology
1CKNA 1EOVA 1QUQA 3U4ZA 2ATWA 2ZXFA 2ZT5A 2IY5A 3RLNA 4Y7NH 3S1QH 2R7DA 1N34L 4LF4L 2NVYH 1E22A 5FLXc 2E2HH 1EFWA 4YRJA 2ZNJA 1N33L 4XIGS 5JJIA 1H4VB 1WQ7A 2UXDL 4AIMA 1Q12A 3PUXA 2ZIMA 4A3GG 3PUZA 3W1BA 4BBSH 4YCVA 4DV0L 3CMQA 1G51A 3ICEA 2PNHA 4DR3Q 1EUJA 3EFSA 5IT9c 1JE5A 1NE3A 3HXXA 5JJLA 4X62L 5GADC 1YI2A 3CF5A 1Q1BA 3V7CA 4MTNA 2GVAA 3LGJA 3LSSA 1L1OA 4A3MH 3CP0A 3JC66 3IALA 1VQBA 2P0LA 4DUYL 2EXDA 3CCLA 3K7UC 2R92G 4A3KH 3HXYA 4DV2Q 4YWLA 3PIPA 1QVCA 3KDFA 4CH5A 3KF6B 4DV3Q 4BW9A 3GD7A 4JI4L 3LC0A 4DNIA 1BBUA 3DM3A 1UEBA 1YBYA 4YWKA 3OTOQ 1U5KA 4TVAA 2E5LL 1WQWA 2F4VL 4A3LG 4H2XA 2WAQE 1HJPA 1YHBA 2FXQA 4YRGA 3HOUH 4OO1G 2ZZGA 2JEBI 4DV1L 1VQ9A 4LFCQ 2EJGA 2C8MA 3T1HQ 2ZJRA 1GD7A 2I5MX 1KD1C 1XMOQ 4P75C 3REUA 4TQDA 4DV5Q 4YRCA 4YRKA 3HTZA 3HRKA 2ALYB 1VQIA 3TEHA 1HR0L 3S1MH 3M85A 4GNXC 4LF7L 3E9IA 1CKNB 3MEYA 1Q81C 4OWTB 3S24A 1XNRQ 1XPRA 2IY5B 3HXZA 4GKKQ 4DV4Q 4A3CH 4JI5Q 3W1GA 2VQFL 4HWSA 4LVMA 1NBWA 3PO3H 4K0KQ 2UXBQ 4JI6L 2UUCQ 1HC7A 3H3VI 2WFWA 2QGQA 3K8AA 4B3RQ 2Q2HA 4DUZQ 1X3FA 4TTVA 3PZCA 4YREA 2VUMG 4L5RC 4AQYL 4XU3A 3RZDH 3CD6A 1HNZQ 3F1ZA 3AFPA 2QHSA 2OTLA 3L1AA 5C52B 1N8RC 2RHQA 5C0XG 1N32Q 1EIYB 4B3MQ 4KHZA 1X2GA 3EN2A 4JBMA 3G4SA 4HVCA 4TWAA 3CCJA 1V9PA 4DQ2A 2KHIA 3A7AA 2JQOA 12ASA 4XTXA 2AHOB 1PH6A 4KI0A 2D6FC 4QIWE 1XPUA 4CS4A 1OXVA 5FLMH 4JI2Q 3KDFB 3UGTA 1K9MC 4UP7A 4HIKA 1VQLA 4C3JH 2LXJA 1N36L 3RKYA 4DR1Q 3J7ZC 4YHHQ 5IYCH 1VQOA 1QF6A 3FJPA 4DR3L 4H2XB 4L5QA 2CKZB 1K0RA 1PH2A 1SERA 2ZTGA 2P8TA 2DJZA 4KR3A 3I4OA 1A63A 3CC4A 4POFA 4BBRG 4GOPC 1EIFA 1PHJA 5IYBG 3TEHB 1B7YA 1WLEA 1IBLQ 1BVSA 2JEAI 4OXPA 3K7AH 5FJ8H 4DV2L 4K88A 3UDIA 1GM5A 4PMWA 2AKWB 1EVKA 3RIRA 5GAHC 3J81c 1VCIA 1WOCA 4DV3L 3PGZA 2F3IA 4YRNA 4BWAA 1VQFA 4X66Q 4UP9A 1ASYA 1WYDA 1Z9FA 2YTYA 4YRQA 5AJ3Q 3VDYA 3OTOL 2R93H 2Q5HA 3FKIH 1TWAH 4A3BH 1X55A 1YFTA 4K87A 3FHWA 2PQAA 1TXYA 3KOJA 4LFCL 3T1HL 1XMOL 4J15A 4DV5L 5H1SE 2WP8J 2ZZEA 2RHQB 2CQOA 1IBMQ 1KL9A 3IRBA 5BR8Q 2UU9Q 1XNRL 3CPWA 3M4QA 1ADYA 2YTVA 5JEAG 4DV4L 2ARTA 1TWCH 3GO5A 4JI5L 4QQBX 4IJLA 4A3GH 4TVYA 3F2DA 1P8LA 4K0KL 2UXBL 1PH5A 2UUCL 3V7RA 1G291 4DV7Q 4BXXG 3J81j 1CKMA 4B3RL 2Y0SE 4BA2I 4DUZL 2YTXA 1IXRA 5IP9G 1YITA 2CWPA 1HNZL 3W5OA 2MNAA 2C7IA 1JB7A 1M90C 1WCMG 1E1TA 4GN5A 5C3EG 1PH4A 2RF4A 2R92H 3AQQA 2YV5A 3BZKA 4DK3C 4AYBE 3ZJYC 2HQLA 2VL6A 4B3ML 4LVJA 1B7YB 2K52A 3RUXA 2ZR2A 2L15A 4EQ5A 3H0GG 2BH2A 1QVFA 4NXNQ 2NVXH 2GN5A 4Y52H 2DDZA 2CJAA 1Y1VG 4HWTA 3HKZE 4XTWA 4JI2L 4NB3A 4A3LH 2E3CA 3MF1A 1BIBA 3K81C 4A3FG 3D0FA 4JBJA 2JA7G 3B6YA 3S1NH 1YIJA 4C3IH 2ARSA 4DR1L 4YHHL 1YEZA 4HJAA 2FYKA 3M4OH 1B8AA 4KQEA 3G71A 1W3SA 3M4PA 1VQKA 3RLOA 5C4JH 1EWIA 2PQAB 1VQGA 4UY8C 1K83H 2DVEA 1TWFH 2QEXA 5J3BA 1UE6A 2MQHA 4H2UA 3KF6A 1USYC 4X6AH 1IBLL 4HA8A 1VQEA 3DLLA 1MJCA 1NJ5A 3H15A 1IBKQ 3KF8B 5C4XG 4KR2A 1I6HH 2AWNA 4E51A 1AE2A 1VQZA 3R07A 1N9WA 1UE5A 1KRSA 1SRUA 4X66L 2VUMH 3STBC 5AJ3L 3GTKH 3UDXA 3A5YA 3JAMi 2DXTA 2AMCB 4JG2A 2I4OA 2UUAL 3G6EA 3AYHB 1OXSC 1SLJA 3UGQA 3BU2A 1UE7A 4PZ7A 3A31A 2Z6KA 1Q86C 1EYGA 4P71C 2QHTA 3HOXG 3M7NA 5M5YH 2YU9H 1IBML 1X3EA 5BR8L 2UU9L 2XGTA 1NNHA 2OCEA 5IWAQ 2N49A 1HZCA 1YHAA 3HOZG 3CCVA 4JI8Q 1RIQA 1FJGQ 4XTVA 2IX1A 3TS0A 2DGYA 4A3DG 1NJ2A 3HFZB 4DV7L 4JI3Q 1X01A 3RZOH 2E41A 3K80C 1PVOA 4A3JG 1EIYA 4LF5Q 3ULPA 4BBRH 2NVTH 4OX9Q 5IYBH 4GN3B 3I56A 4PZ6A 2JA8G 2VNUD 3CMEA 4TVWA 1JJGA 3L7ZC 5ELNA 2EAYA 2R7ZG 2PMEA 3HKSA 4IPGA 4IFDG 4WF2A 1HXDA 4QJFA 1R9TH 3PCOA 3STBD 1BIAA 4NXNL 4UP8A 5F5WA 5C44G 2OTJA 2E2IH 2DU7A 4YRMA 1BBWA 3CCMA 3PUVA 2JJQA 4OP0A 4JI1Q 1KHIA 4NCXA 1GO3E 4X65Q 2J3MA 4JOIC 4RMFA 1VQJA 3UE1A 5LMUQ 1NYQA 3HXWA 4YRFA 5M3MG 3CCRA 2Q5IA 1ZQ1C 1DGSA 5GAEC 2CFMA 2EJFA 2AWOA 2AKWA 2HNIA 4P72C 4P74C 2Q2UA 3CMAA 2Z0SA 3KYHC 1AH9A 3WQZA 1HZ9A 1NY4A 3PV0A 4IPCA 3S2DH 2WB1E 4WI1A 2VW9A 2QHVA 2N78A 1IBKL 2I5HA 2ZT8A 3RL6A 3VBBA 4BXXH 3D31A 4YROA 1GVPA 4QGUA 1UE1A 1XTDA 3VQVA 5IP9H 4GS3A 4GOPB 1WCMH 4R4CA 2ZR3A 1G5HA 5C3EH 1H4SA 4LFAQ 4YRSA 3U4VA 1GGMA 1WPYA 4IOCA 2NN6G 5C53B 1H4QA 4YRTA 2ZT7A 3KFUA 2ID0A 4BY7G 1E7ZA 2I4NA 3H0GH 3GTOH 2ZIOA 3CW2C 3RKWA 3G48A 1Y1VH 2WAQG 1PH9A 1VQ6A 2LSSA 4P73A 3J80c 1X6OA 2ZCEA 2KBNA 3A7UA 1MKHA 4IO9A 3CXCA 3J7A5 1YVCA 5LMNQ 1UWVA 5IWAL 4A3FH 3PCOB 1QE0A 3EIVA 4O0AA 2JA7H 2NS6A 3M3YH 2E1HA 5M5WH 4JI8L 2CCZA 1NJIC 1ADJA 4QY7A 1VS0A 2V1CC 4JI3L 4A76A 3A5ZA 5E7NA 1KOGA 1VQHA 4WJ3M 3ICAA 1X3GA 1L2FA 3L0OA 4RQFA 1VQAA 4LF5L 4MZ9A 3TS2A 4OX9L 3Q8DA 3HOWG 3W3SA 3PO2G 1T9HA 2DUDA 3PUYA 2KHJA 5M3FG 2ES2A 2UUBQ 1HNWQ 5C4XH 2HHHQ 4EO4A 3I2ZA 1J6QA 3PIOA 2A8EA 2EL9A 2H5XA 3E9HA 1L1OC 1PYBA 3NENA 1PYSB 1YNXA 3E0EA 2EJ9A 4YY3Q 4A3EG 3FP9A 2B63G 1L0WA 1Y1WG 4XTCS 1FL0A 4YCUA 3HY0A 4JI1L 1J5EQ 3KLWA 1A8VA 5IYDG 3GTQH 2K4KA 1I50H 4JI0Q 5LMUL 2DEQA 4ZIBA 4DV6Q 4B3TQ 1LTLA 4KLKA 3REXA 3HOXH 2VZAA 1Z47A 5C51B 2JA5G 4CH6A 3S1RH 2KENA 4GKKL 2HIXA 4HJ7A 2DTIA 2CJ9A 4TQUS 1YJNA 4A93G 3K0XA 2K5VA 3U50C 3L4GB 4OO1I 2DU5A 3HOZH 5C0XJ 4DR7Q 4XU2A 2XTIA 4A3DH 5HY6A 2QHUA 2AMCA 3PO3G 1VQDA 4DPGA 3MEFA 2MO1A 2DZCA 1JJCA 1IZ6A 3L2PA 5E3IA 4IPHA 4A3JH 4HWRA 4BA1I 3I55A 2R7FA 1SN8A 5K36G 1BKBA 1CKOA 3A5ZB 3HFVA 1WU7A 1NYRA 2PMFA 1KMMA 1N32L 4GLXA 2JA8H 1KMNA 2PMZE 4LFAL 3V8KA 2JA9A 4DUYQ 1FGUA 4HT4A 3QO7A 2R7ZH 3HOYG 4YDQA 1QZHA 4JI7Q 2IX0A 4CH4A 5GROA 4HIMA 3QNEA 3CCQA 3RACA 4HJ5A 2BA1A 5C44H 2K75A 4H2WA 4P75A 5IP7G 1VQ5A 3AFQA 2E64A 4HIOA 1G6PA 2OQKA 3HFZA 5LMNL 3MXNB 4G85A 3RKXA 2E5LQ 2Q7HA 2ZM6Q 4AH6A 4GNXA 5C0XI 3RNUA 3F8TA 2DXUA 4L5TA 4CH3A 3NETA 4UPAA 2DQ0A 4LVLA 4WJ4A 5M3MH 1OXUA 4CS3A 1NMFA 4APVA 3M9BA 2VS1A 1FYFA 2ZGWA 3CQZH 3BJUA 4H02A 1TWGH 4DKAC 1JJ2A 4POGA 4NXMQ 1SETA 2VQEQ 3HOVG 3I4NG 2UUBL 3T1YQ 4R4OA 3RN2A 1HNWL 4LNQA 3NELA 2HHHL 2VQFQ 4LF8Q 4XEMA 1PA6A 5FJ8G 3IKMB 3LSQA 4YWMA 3ERRA 4NPSA 4YY3L 2N8NA 2I0QA 1E24A 1O7IA 1HR0W 2ZTDA 4AYBG 3G1ZA 4LVIA 2JA6G 2IT1A 1JJCB 3IG2A 1HNXQ 5JEAJ 1J5EL 1X65A 2NZHA 1X2HA 1Q7YC 4DAYB 1E3PA 2ZTEA 4JI0L 2LXKA 2BH8A 4BY7H 3HKZG 4DV6L 4B3TL 4YYEA 11ASA 3DSQA 3UH0A 1PH1A 4LVKA 2HIVA 1TWHH 5HGQA 1EQQA 1XNQQ 3GTJH 4RG1A 3HXVA 4XTZA 2UXCQ 4KHPQ 3J81i 1IL2A 2ZINA 1K3RA 1LYLA 4YRPA 4G84A 3I7FA 1OXTA 3V8JA 4DR5Q 4DR7L 4GOPA 4PZ8A 2K5HA 1QZGA 4LFBQ 4P3NA 2E10A 4DR4Q 1N36Q 2R6GA 4GNXB 4JV5Q 3EBEA 2JE6I 4GLVB 2K5NA 3CPFA 3HOWH 3P8TA 2ZT6A 3PO2H 1YFRA 2DTHA 5M3FH 2DKGA 3RGLA 2P5IA 3CAMA 5M5XH 3KJOA 3A0JA 3S15H 4LW1A 4JYAQ 4HJ8A 4GKJQ 3CC7A 2EWNA 1X9NA 4JI7L 1KIXA 3I4MG 4A3EH 3QO5A 2E5AA 2B63H 3HRIA 3TREA 2CJBA 1Y1WH 1SR3A 3GTPH 2I5LX 4HWOA 2CIMA 2B29A 1ATIA 2ZM6L 3OW2A 1KXLA 2KCMA 3F2BA 2ZTCA 4JBKA 5IYDH 2KCTA 4Q6GA 4PG3A 2DTOA 3S2HH 4LNSA 3HXUA 4A75A 2N3SA 2ASBA 3VQWA 3RF1A 4A3IG 2JA5H 2Q2IA 3PF5A 3V7SA 4DR6Q 2K50A 3UDGA 1IYJB 2A19A 1YGBA 4R1JA 1HZBA 4OWXB 1SFOH 1VQNA 3U58A 1S3OA 1FVIA 3UE0A 2A1AA 1I5FA 1QUQB 4A93H 4NXML 3ERSX 2J3LA 3L2ZA 1B70A 2VQEL 4LF6Q 4MNOA 3A5UA 1VQPA 1PYSA 2JK8A 3T1YL 5ELOA 4ZTZB 1KC8C 3BFMA 2D0OA 5IY0A 2B3GA 4DR2Q 2RHSA 4LF8L 4L87A 1NJ8A 2E65A 4EX5A 3ULLA 2DZ9A 3TUPA 3UFGA 3P8YA 1NMGA 3TRZA 1I94Q 1HTTA 1VQ4A 2ARUA 3BZCA 4YRIA 1VQ7A 3OYYA 1SESA 3V8LA 4BY1G 1HNXL 3HY1A 4XU1A 4LUOA 4X64Q 3SGIA 2VY3A 4XEOA 1C7YA 1X56A 1X54A 1W66A 3HOYH 2Q7GA 1CSQA 3CC2A 1L1OB 1I3QH 3L4GA 1JT8A 1CSPA 3UDFA 3RR5A 5IP7H 4OONA 1XNQL 5GAGC 5K1XA 4IPDA 2UXCL 4KHPL 3ULJA 3A74A 2Z6KC 4B3SQ 2CGHA 1XJVA 1WJJA 4LF9Q 1XPOA 1FJGL 4DR5L 1D8LA 2OQ0A 3AEVA 4BBSG 1PH7A 3VQYA 4LFBL 4TVAB 3H3VH 4YRRA 3JAMc 3GDEA 4DR4L 1USYA 4JV5L 2I4MA 5GQOA 3KJPA 2MFIA 3VQXA 4IFDJ 3GTGH 2E8GA 1S40A 5KNNA 1MIUA 4OLFA 5IE8A 1PH3A 2WB1G 3S16H 1PH8A 4JCVE 1XMQQ 1Z7NA 4A3MG 3HOVH 4JC0A 3I4NH 5DLQE 1YJWA 4GN4B 3WWVA 1GKHA 1P16A 3MF2A 4A3KG 1VQCA 5LMNW 4JYAL 4GKJL 3NEMA 1B70B 1EVLA 2MO0A 2PI2E 2ZZFA 2QA4A 2RHSB 2ZNIA 4P3OA 2JA6H 1YZ6A 1PV4A 4GLAC 1Q8KA 1H4TA 4P71A 4IJHA 4O2DA 2OWOA 1YJ9A 4X65L 4C2MH 3NBHB 2F52A 1NJ6A 3EFRA 4HWPA 2A8VA 2ODRC 3HOUG 2UUAQ 1SE8A 2BA0A 1D7QA 1WI5A 2IHEA 4YPFA 1YFSA 3TEGA 4IFDI 3RN5A 2NVQH 1N34Q 2ZJPA 4DR6L 3S17H 4LF4Q 1Y14B 2C35B 5JJKA 3S14H 1SMXA 4JBWA 1C9OA 4R4IA 1A62A 1N33Q 4P3PA 1J5WA 4LF6L 3CCSA 2UXDQ 4A3CG 4H2TA 4YP0A 3ER0A 1HZAA 1KAWA 3OD1A 4C3HH 2G4CA 4H2YA 4Q15A 4DV0Q 4DR2L 1HH2P 1LUZA 1Q46A 1V1QA 3QTCA 1B76A 4X62Q 3A32A 1Z7MA 1PFSA 1I94L 1W2BA 3GTMH 4XTUA 1SRYA 2Q7EA 1RL2A 3QO8A 2DQ3A 4QL5A 1MJEA 3CCUA 4X64L 1OTCA 1WNLA 2ZJQA 1KRTA 4HJ9A 2EQSA 2EIFA 4RDXA 2D62A 4LWCA 1S72A 3CCEA 2I4LA 1K8GA 1K73C 3I4MH 4LUVA 4DK6C 3PF4A 1Q1EA 4JI4Q 4ALPA 4JOIA 1U0LA 4LUZA 3PUWA 4R4QA 1V43A 4ME3A 4A4IA 2K14A 3GTLH 4K86A 4DAMA 5FLMG 1YHQA 2F4VQ 2HT1A 1C0AA 1CUKA 4B3SL 2PI2A 4LF9L 2ODRD 5K1PA 4L5SA 1NTGA 2NN6I 4P72A 4P74A 4DV1Q 4P73C 4HIDA 1E1OA 5IYCG 1LM0A 4A3IH 1EQRA 4H2SA 4IOAA 1HR0Q 3MQZA 4LF7Q 1AE3A 1ASZA 3IKLA 4XU0A 4FDBA 2D0PA 1XMQL 2GVBA 1OXXK 2Y0SG 1RIPA 1WFQA 1VQMA 4OWWB 1NJ1A 3RLFA 2Q2TA 3J80i 1K8AC 4CS2A 3F2CA 1JMCA 4JI6Q 2IHFA 5EAYA 1H95A 1G5IA 1SROA 2NZOA 4YCWA 3P8VA 2CWAA 1A0IA 4X5OA 3PSIA 4PHCA 4AQYQ 4RQEA 4XTYA 4BY1H 1Q82C 2R93G 4ZTUB 2YYZA 3FKIG 4H2VA 2E2JH 3TQYA 3A7RA 4A3BG 1QVGA 2RCNA 2ALYA 4TQFA 1M1KC 4YRLA 1VQ8A 1KQSA 1YB3A 4R4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CKN A;  1EOV A;  1QUQ A;  3U4Z A;  2ATW A;  2ZXF A;  2ZT5 A;  2IY5 A;  3RLN A;  4Y7N H;  3S1Q H;  2R7D A;  1N34 L;  4LF4 L;  2NVY H;  1E22 A;  5FLX c;  2E2H H;  1EFW A;  4YRJ A;  2ZNJ A;  1N33 L;  4XIG S;  5JJI A;  1H4V B;  1WQ7 A;  2UXD L;  4AIM A;  1Q12 A;  3PUX A;  2ZIM A;  4A3G G;  3PUZ A;  3W1B A;  4BBS H;  4YCV A;  4DV0 L;  3CMQ A;  1G51 A;  3ICE A;  2PNH A;  4DR3 Q;  1EUJ A;  3EFS A;  5IT9 c;  1JE5 A;  1NE3 A;  3HXX A;  5JJL A;  4X62 L;  5GAD C;  1YI2 A;  3CF5 A;  1Q1B A;  3V7C A;  4MTN A;  2GVA A;  3LGJ A;  3LSS A;  1L1O A;  4A3M H;  3CP0 A;  3JC6 6;  3IAL A;  1VQB A;  2P0L A;  4DUY L;  2EXD A;  3CCL A;  3K7U C;  2R92 G;  4A3K H;  3HXY A;  4DV2 Q;  4YWL A;  3PIP A;  1QVC A;  3KDF A;  4CH5 A;  3KF6 B;  4DV3 Q;  4BW9 A;  3GD7 A;  4JI4 L;  3LC0 A;  4DNI A;  1BBU A;  3DM3 A;  1UEB A;  1YBY A;  4YWK A;  3OTO Q;  1U5K A;  4TVA A;  2E5L L;  1WQW A;  2F4V L;  4A3L G;  4H2X A;  2WAQ E;  1HJP A;  1YHB A;  2FXQ A;  4YRG A;  3HOU H;  4OO1 G;  2ZZG A;  2JEB I;  4DV1 L;  1VQ9 A;  4LFC Q;  2EJG A;  2C8M A;  3T1H Q;  2ZJR A;  1GD7 A;  2I5M X;  1KD1 C;  1XMO Q;  4P75 C;  3REU A;  4TQD A;  4DV5 Q;  4YRC A;  4YRK A;  3HTZ A;  3HRK A;  2ALY B;  1VQI A;  3TEH A;  1HR0 L;  3S1M H;  3M85 A;  4GNX C;  4LF7 L;  3E9I A;  1CKN B;  3MEY A;  1Q81 C;  4OWT B;  3S24 A;  1XNR Q;  1XPR A;  2IY5 B;  3HXZ A;  4GKK Q;  4DV4 Q;  4A3C H;  4JI5 Q;  3W1G A;  2VQF L;  4HWS A;  1NBW A;  3PO3 H;  4K0K Q;  2UXB Q;  4JI6 L;  2UUC Q;  1HC7 A;  3H3V I;  2WFW A;  2QGQ A;  3K8A A;  4B3R Q;  2Q2H A;  4DUZ Q;  1X3F A;  4TTV A;  3PZC A;  4YRE A;  2VUM G;  4L5R C;  4AQY L;  4XU3 A;  3RZD H;  3CD6 A;  1HNZ Q;  3F1Z A;  3AFP A;  2QHS A;  2OTL A;  3L1A A;  5C52 B;  1N8R C;  2RHQ A;  5C0X G;  1N32 Q;  1EIY B;  4B3M Q;  4KHZ A;  1X2G A;  3EN2 A;  4JBM A;  3G4S A;  4HVC A;  4TWA A;  3CCJ A;  1V9P A;  4DQ2 A;  2KHI A;  3A7A A;  2JQO A;  12AS A;  4XTX A;  2AHO B;  1PH6 A;  4KI0 A;  2D6F C;  4QIW E;  1XPU A;  4CS4 A;  1OXV A;  5FLM H;  4JI2 Q;  3KDF B;  3UGT A;  1K9M C;  4UP7 A;  4HIK A;  1VQL A;  4C3J H;  2LXJ A;  1N36 L;  3RKY A;  4DR1 Q;  3J7Z C;  4YHH Q;  5IYC H;  1VQO A;  1QF6 A;  3FJP A;  4DR3 L;  4H2X B;  4L5Q A;  2CKZ B;  1K0R A;  1PH2 A;  1SER A;  2ZTG A;  2P8T A;  2DJZ A;  4KR3 A;  3I4O A;  1A63 A;  3CC4 A;  4POF A;  4BBR G;  4GOP C;  1EIF A;  1PHJ A;  5IYB G;  3TEH B;  1B7Y A;  1WLE A;  1IBL Q;  1BVS A;  2JEA I;  4OXP A;  3K7A H;  5FJ8 H;  4DV2 L;  4K88 A;  3UDI A;  1GM5 A;  4PMW A;  2AKW B;  1EVK A;  3RIR A;  5GAH C;  3J81 c;  1VCI A;  1WOC A;  4DV3 L;  3PGZ A;  2F3I A;  4YRN A;  4BWA A;  1VQF A;  4X66 Q;  4UP9 A;  1ASY A;  1WYD A;  1Z9F A;  2YTY A;  4YRQ A;  5AJ3 Q;  3VDY A;  3OTO L;  2R93 H;  2Q5H A;  3FKI H;  1TWA H;  4A3B H;  1X55 A;  1YFT A;  4K87 A;  3FHW A;  2PQA A;  1TXY A;  3KOJ A;  4LFC L;  3T1H L;  1XMO L;  4J15 A;  4DV5 L;  5H1S E;  2WP8 J;  2ZZE A;  2RHQ B;  2CQO A;  1IBM Q;  1KL9 A;  3IRB A;  5BR8 Q;  2UU9 Q;  1XNR L;  3CPW A;  3M4Q A;  1ADY A;  2YTV A;  5JEA G;  4DV4 L;  2ART A;  1TWC H;  3GO5 A;  4JI5 L;  4QQB X;  4IJL A;  4A3G H;  4TVY A;  3F2D A;  1P8L A;  4K0K L;  2UXB L;  1PH5 A;  2UUC L;  3V7R A;  1G29 1;  4DV7 Q;  4BXX G;  3J81 j;  1CKM A;  4B3R L;  2Y0S E;  4BA2 I;  4DUZ L;  2YTX A;  1IXR A;  5IP9 G;  1YIT A;  2CWP A;  1HNZ L;  3W5O A;  2MNA A;  2C7I A;  1JB7 A;  1M90 C;  1WCM G;  1E1T A;  4GN5 A;  5C3E G;  1PH4 A;  2RF4 A;  2R92 H;  3AQQ A;  2YV5 A;  3BZK A;  4DK3 C;  4AYB E;  3ZJY C;  2HQL A;  2VL6 A;  4B3M L;  1B7Y B;  2K52 A;  3RUX A;  2ZR2 A;  2L15 A;  4EQ5 A;  3H0G G;  2BH2 A;  1QVF A;  4NXN Q;  2NVX H;  2GN5 A;  4Y52 H;  2DDZ A;  2CJA A;  1Y1V G;  4HWT A;  3HKZ E;  4XTW A;  4JI2 L;  4NB3 A;  4A3L H;  2E3C A;  3MF1 A;  1BIB A;  3K81 C;  4A3F G;  3D0F A;  4JBJ A;  2JA7 G;  3B6Y A;  3S1N H;  1YIJ A;  4C3I H;  2ARS A;  4DR1 L;  4YHH L;  1YEZ A;  4HJA A;  2FYK A;  3M4O H;  1B8A A;  4KQE A;  3G71 A;  1W3S A;  3M4P A;  1VQK A;  3RLO A;  5C4J H;  1EWI A;  2PQA B;  1VQG A;  4UY8 C;  1K83 H;  2DVE A;  1TWF H;  2QEX A;  5J3B A;  1UE6 A;  2MQH A;  4H2U A;  3KF6 A;  1USY C;  4X6A H;  1IBL L;  4HA8 A;  1VQE A;  3DLL A;  1MJC A;  1NJ5 A;  3H15 A;  1IBK Q;  3KF8 B;  5C4X G;  4KR2 A;  1I6H H;  2AWN A;  4E51 A;  1AE2 A;  1VQZ A;  3R07 A;  1N9W A;  1UE5 A;  1KRS A;  1SRU A;  4X66 L;  2VUM H;  3STB C;  5AJ3 L;  3GTK H;  3UDX A;  3A5Y A;  3JAM i;  2DXT A;  2AMC B;  4JG2 A;  2I4O A;  2UUA L;  3G6E A;  3AYH B;  1OXS C;  1SLJ A;  3UGQ A;  3BU2 A;  1UE7 A;  4PZ7 A;  3A31 A;  2Z6K A;  1Q86 C;  1EYG A;  4P71 C;  2QHT A;  3HOX G;  3M7N A;  5M5Y H;  2YU9 H;  1IBM L;  1X3E A;  5BR8 L;  2UU9 L;  2XGT A;  1NNH A;  2OCE A;  5IWA Q;  2N49 A;  1HZC A;  1YHA A;  3HOZ G;  3CCV A;  4JI8 Q;  1RIQ A;  1FJG Q;  4XTV A;  2IX1 A;  3TS0 A;  2DGY A;  4A3D G;  1NJ2 A;  3HFZ B;  4DV7 L;  4JI3 Q;  1X01 A;  3RZO H;  2E41 A;  3K80 C;  1PVO A;  4A3J G;  1EIY A;  4LF5 Q;  3ULP A;  4BBR H;  2NVT H;  4OX9 Q;  5IYB H;  4GN3 B;  3I56 A;  4PZ6 A;  2JA8 G;  2VNU D;  3CME A;  4TVW A;  1JJG A;  3L7Z C;  5ELN A;  2EAY A;  2R7Z G;  2PME A;  3HKS A;  4IPG A;  4IFD G;  4WF2 A;  1HXD A;  4QJF A;  1R9T H;  3PCO A;  3STB D;  1BIA A;  4NXN L;  4UP8 A;  5F5W A;  5C44 G;  2OTJ A;  2E2I H;  2DU7 A;  4YRM A;  1BBW A;  3CCM A;  3PUV A;  2JJQ A;  4OP0 A;  4JI1 Q;  1KHI A;  4NCX A;  1GO3 E;  4X65 Q;  2J3M A;  4JOI C;  4RMF A;  1VQJ A;  3UE1 A;  5LMU Q;  1NYQ A;  3HXW A;  4YRF A;  5M3M G;  3CCR A;  2Q5I A;  1ZQ1 C;  1DGS A;  5GAE C;  2CFM A;  2EJF A;  2AWO A;  2AKW A;  2HNI A;  4P72 C;  4P74 C;  2Q2U A;  3CMA A;  2Z0S A;  3KYH C;  1AH9 A;  3WQZ A;  1HZ9 A;  1NY4 A;  3PV0 A;  4IPC A;  3S2D H;  2WB1 E;  4WI1 A;  2VW9 A;  2QHV A;  2N78 A;  1IBK L;  2I5H A;  2ZT8 A;  3RL6 A;  3VBB A;  4BXX H;  3D31 A;  4YRO A;  1GVP A;  4QGU A;  1UE1 A;  1XTD A;  3VQV A;  5IP9 H;  4GS3 A;  4GOP B;  1WCM H;  4R4C A;  2ZR3 A;  1G5H A;  5C3E H;  1H4S A;  4LFA Q;  4YRS A;  3U4V A;  1GGM A;  1WPY A;  4IOC A;  2NN6 G;  5C53 B;  1H4Q A;  4YRT A;  2ZT7 A;  3KFU A;  2ID0 A;  4BY7 G;  1E7Z A;  2I4N A;  3H0G H;  3GTO H;  2ZIO A;  3CW2 C;  3RKW A;  3G48 A;  1Y1V H;  2WAQ G;  1PH9 A;  1VQ6 A;  2LSS A;  4P73 A;  3J80 c;  1X6O A;  2ZCE A;  2KBN A;  3A7U A;  1MKH A;  4IO9 A;  3CXC A;  3J7A 5;  1YVC A;  5LMN Q;  1UWV A;  5IWA L;  4A3F H;  3PCO B;  1QE0 A;  3EIV A;  4O0A A;  2JA7 H;  3M3Y H;  2E1H A;  5M5W H;  4JI8 L;  2CCZ A;  1NJI C;  1ADJ A;  4QY7 A;  1VS0 A;  2V1C C;  4JI3 L;  4A76 A;  3A5Z A;  5E7N A;  1KOG A;  1VQH A;  4WJ3 M;  3ICA A;  1X3G A;  1L2F A;  3L0O A;  4RQF A;  1VQA A;  4LF5 L;  4MZ9 A;  3TS2 A;  4OX9 L;  3Q8D A;  3HOW G;  3W3S A;  3PO2 G;  1T9H A;  2DUD A;  3PUY A;  2KHJ A;  5M3F G;  2ES2 A;  2UUB Q;  1HNW Q;  5C4X H;  2HHH Q;  4EO4 A;  3I2Z A;  1J6Q A;  3PIO A;  2EL9 A;  2H5X A;  3E9H A;  1L1O C;  1PYB A;  3NEN A;  1PYS B;  1YNX A;  3E0E A;  2EJ9 A;  4YY3 Q;  4A3E G;  3FP9 A;  2B63 G;  1L0W A;  1Y1W G;  4XTC S;  1FL0 A;  4YCU A;  3HY0 A;  4JI1 L;  1J5E Q;  3KLW A;  1A8V A;  5IYD G;  3GTQ H;  2K4K A;  1I50 H;  4JI0 Q;  5LMU L;  2DEQ A;  4ZIB A;  4DV6 Q;  4B3T Q;  1LTL A;  4KLK A;  3REX A;  3HOX H;  2VZA A;  1Z47 A;  5C51 B;  2JA5 G;  4CH6 A;  3S1R H;  2KEN A;  4GKK L;  2HIX A;  4HJ7 A;  2DTI A;  2CJ9 A;  4TQU S;  1YJN A;  4A93 G;  3K0X A;  2K5V A;  3U50 C;  3L4G B;  4OO1 I;  2DU5 A;  3HOZ H;  5C0X J;  4DR7 Q;  4XU2 A;  2XTI A;  4A3D H;  5HY6 A;  2QHU A;  2AMC A;  3PO3 G;  1VQD A;  4DPG A;  3MEF A;  2MO1 A;  2DZC A;  1JJC A;  1IZ6 A;  3L2P A;  5E3I A;  4IPH A;  4A3J H;  4HWR A;  4BA1 I;  3I55 A;  2R7F A;  1SN8 A;  5K36 G;  1BKB A;  1CKO A;  3A5Z B;  3HFV A;  1WU7 A;  1NYR A;  2PMF A;  1KMM A;  1N32 L;  4GLX A;  2JA8 H;  1KMN A;  2PMZ E;  4LFA L;  3V8K A;  2JA9 A;  4DUY Q;  1FGU A;  3QO7 A;  2R7Z H;  3HOY G;  4YDQ A;  1QZH A;  4JI7 Q;  2IX0 A;  4CH4 A;  5GRO A;  4HIM A;  3QNE A;  3CCQ A;  3RAC A;  4HJ5 A;  2BA1 A;  5C44 H;  2K75 A;  4H2W A;  4P75 A;  5IP7 G;  1VQ5 A;  3AFQ A;  2E64 A;  4HIO A;  1G6P A;  2OQK A;  3HFZ A;  5LMN L;  3MXN B;  4G85 A;  3RKX A;  2E5L Q;  2Q7H A;  2ZM6 Q;  4AH6 A;  4GNX A;  5C0X I;  3RNU A;  3F8T A;  2DXU A;  4L5T A;  4CH3 A;  3NET A;  4UPA A;  2DQ0 A;  4WJ4 A;  5M3M H;  1OXU A;  4CS3 A;  1NMF A;  4APV A;  3M9B A;  2VS1 A;  1FYF A;  2ZGW A;  3CQZ H;  3BJU A;  4H02 A;  1TWG H;  4DKA C;  1JJ2 A;  4POG A;  4NXM Q;  1SET A;  2VQE Q;  3HOV G;  3I4N G;  2UUB L;  3T1Y Q;  4R4O A;  3RN2 A;  1HNW L;  4LNQ A;  3NEL A;  2HHH L;  2VQF Q;  4LF8 Q;  4XEM A;  1PA6 A;  5FJ8 G;  3IKM B;  3LSQ A;  4YWM A;  3ERR A;  4NPS A;  4YY3 L;  2N8N A;  2I0Q A;  1E24 A;  1O7I A;  1HR0 W;  2ZTD A;  4AYB G;  3G1Z A;  2JA6 G;  2IT1 A;  1JJC B;  3IG2 A;  1HNX Q;  5JEA J;  1J5E L;  1X65 A;  2NZH A;  1X2H A;  1Q7Y C;  4DAY B;  1E3P A;  2ZTE A;  4JI0 L;  2LXK A;  2BH8 A;  4BY7 H;  3HKZ G;  4DV6 L;  4B3T L;  4YYE A;  11AS A;  3DSQ A;  3UH0 A;  1PH1 A;  2HIV A;  1TWH H;  5HGQ A;  1EQQ A;  1XNQ Q;  3GTJ H;  4RG1 A;  3HXV A;  4XTZ A;  2UXC Q;  4KHP Q;  3J81 i;  1IL2 A;  2ZIN A;  1K3R A;  1LYL A;  4YRP A;  4G84 A;  3I7F A;  1OXT A;  3V8J A;  4DR5 Q;  4DR7 L;  4GOP A;  4PZ8 A;  2K5H A;  1QZG A;  4LFB Q;  4P3N A;  2E10 A;  4DR4 Q;  1N36 Q;  2R6G A;  4GNX B;  4JV5 Q;  3EBE A;  2JE6 I;  4GLV B;  2K5N A;  3CPF A;  3HOW H;  3P8T A;  2ZT6 A;  3PO2 H;  1YFR A;  2DTH A;  5M3F H;  2DKG A;  3RGL A;  2P