4AH6A

Human mitochondrial aspartyl-trna synthetase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
589
structure length
589
Chain Sequence
b'PEFSSFVVRTNTCGELRSSHLGQEVTLCGWIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ASPARTATE--TRNA LIGASE, MITOCHONDRIAL
publication title Thermodynamic Properties Distinguish Human Mitochondrial Aspartyl-tRNA Synthetase from Bacterial Homolog with Same 3D Architecture
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 117
structure length 589
sequence length 589
chains with identical sequence B, C, D
ec nomenclature ec 6.1.1.12: Aspartate--tRNA ligase.
pdb deposition date 2012-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N)
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
A PF02938 GAD GAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ah6A01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4ah6A02
3.30.1360.30 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 GAD-like domain 4ah6A03
2Q2IA 3CCVA 2E10A 4X66Q 3W5OA 1TWCH 1E7ZA 4XEOA 3GTGH 1OXUA 4K0KQ 4YRGA 3TQYA 2NVQH 3S1RH 1Q7YC 4IOCA 3HOUG 4OX9Q 4XTZA 3Q8DA 4POFA 1IBLQ 1YITA 1Y14B 4PHCA 4C3JH 2HIVA 1S72A 3WQZA 1E22A 2YU9H 3B6YA 4OWWB 3HOWG 2UXBQ 3M9BA 5IYBG 3UDGA 1K73C 1PH7A 1WFQA 2JA6H 3KDFA 2ZZEA 2DEQA 3CC7A 4A3DG 1J5EQ 3P8YA 1VQ6A 2AKWB 1PYBA 4R1JA 3T1YQ 2VQFL 2ZZGA 1C9OA 4PMWA 3PIOA 4DR3L 2DXUA 2EJGA 4RG1A 4K86A 2C7IA 1H4QA 2ARUA 4XEMA 2HIXA 3LC0A 3GTOH 4X62L 2D62A 2KHIA 2K75A 4UPAA 4Y52H 1YHBA 4BBRG 2NZHA 1LTLA 4GOPB 1HNZQ 3J80i 4OO1G 1YHQA 1E24A 4YRQA 2DTIA 4H02A 2WB1G 2I5MX 2DUDA 3RL6A 1E1OA 4CS2A 4UP9A 3HKSA 1NJ5A 4QJFA 2Z6KC 4BWAA 2DQ3A 4IPCA 3STBD 2Q2UA 1WOCA 4HJ9A 3PIPA 1SLJA 2KCMA 3PCOA 1X3EA 3TRZA 4A3FH 3H15A 2UU9Q 4A3GG 4HIMA 3V7CA 1I94L 4POGA 3DLLA 3HOVH 1VQDA 3M4OH 2Q7HA 2YYZA 1IL2A 2AMCB 2ZCEA 2NZOA 4DK3C 3TEGA 4AH6A 1JJCB 1IBMQ 2K14A 3K7AH 2VNUD 3IALA 4AQYQ 4OXPA 1BIAA 4DR2Q 4JI0L 2WAQE 1KMMA 4WJ4A 4TTVA 1SE8A 3CMQA 4YYEA 4DR1L 2VY3A 4R4TA 3SGIA 1FJGQ 3HFZA 4DV4L 5C4XG 4DR5L 4P71C 2BA0A 3QO5A 2B63G 1XMOQ 4AYBE 1HH2P 4JI5Q 4PZ7A 4O2DA 2DXTA 3RKWA 3RNUA 1HJPA 4LUVA 4A3LH 1NNHA 1FL0A 1A8VA 3FJPA 1G6PA 4L5SA 2ZINA 4HVCA 4Q6GA 3CPWA 3G1ZA 4LNQA 1NTGA 1YNXA 1VQKA 2Q5IA 2NVTH 1L2FA 3QO7A 3RR5A 5M5WH 1VQMA 2IHEA 4IJLA 2VUMH 1H95A 3J81i 4BA2I 4K87A 2YTVA 2I5LX 1GGMA 1V1QA 3U4VA 5HGQA 1PFSA 1NE3A 4HA8A 3HRKA 1RIQA 5C44G 4DV6L 4A3MG 5IYCG 5BR8L 5JEAJ 5IP9G 5IE8A 1LYLA 4LF9L 4EO4A 4HIOA 2E1HA 5IP7H 4HWRA 3TS0A 4XU3A 2PNHA 3J7A5 3BZCA 1XNRL 1WCMH 4LFAL 4LFBL 2K4KA 2HT1A 3FKIG 4DK6C 5C3EH 1Y1VH 4R4IA 4LFCL 2QGQA 3CC2A 2VQFQ 4A76A 5M3FH 3T1HQ 1R9TH 1BBWA 1GM5A 4DR7L 2I4NA 2R93H 1I50H 1KC8C 1Z9FA 4DR4Q 3CAMA 4WJ3M 2UXCL 4XU2A 4BY1G 4DR6L 5C0XG 2ZTDA 4K88A 3GDEA 5FLXc 2NVYH 4YY3Q 1NJ6A 3AYHB 3I4NH 3A74A 1Q12A 3A7UA 3G48A 3M3YH 1W2BA 1JJ2A 1QZGA 4UP7A 2R92H 3UDIA 3MXNB 1XJVA 1FGUA 1WYDA 2DZ9A 2PQAB 2Q7EA 3QNEA 2EWNA 4JI2L 1VQZA 3JAMc 2EJ9A 5M3MH 3F2DA 2ODRD 4H2XB 1GD7A 1QZHA 3H3VH 2ZNIA 2ZR2A 3HXUA 2EIFA 2RHQB 2JEAI 4MNOA 4DV1L 5FLMG 1W3SA 2UXDQ 3KYHC 1KMNA 5K1PA 4OP0A 4BBSG 1NYQA 2Z6KA 3IG2A 1HZBA 3RIRA 3RZOH 2I4LA 3RLOA 3GO5A 4B3TL 1TWFH 2JA5G 1CKMA 3M4PA 4JG2A 2CGHA 4PG3A 2Y0SG 3W1BA 2A19A 4LF4Q 1HXDA 4DR1Q 3UGTA 4JI7L 3NENA 3HOZH 2ARTA 5H1SE 4DV4Q 4DR5Q 5AJ3L 3PZCA 1L1OB 4KHPQ 4A3CH 2G4CA 1B7YA 1N34L 4NXMQ 4GNXB 4ZTUB 1QUQA 3GTJH 4DNIA 3I55A 1C0AA 5GAHC 2JA7H 1YZ6A 2ZT6A 2F4VL 4BW9A 3HXXA 4KHZA 2UUAL 3RKXA 2ZTCA 2IX1A 1K8GA 4BXXH 2EJFA 1X3FA 1VQGA 3PO3H 3H0GH 4XTXA 1S40A 3FP9A 4P71A 1PH9A 3U4ZA 4LF6L 1S3OA 1VS0A 1YI2A 3A5ZA 4XTWA 2E64A 3TEHB 4A75A 2DGYA 4LUZA 2ZJPA 4JCVE 2CWAA 4ME3A 4OWTB 3L2ZA 4OWXB 1XTDA 2D0PA 2CIMA 1VQBA 4QGUA 1PH2A 2XTIA 1WNLA 3AQQA 4TVAB 1PYSA 1Q1BA 4JI6L 3D0FA 3CCMA 3S1MH 3U58A 3CW2C 4DV6Q 5BR8Q 1X56A 3E0EA 1GKHA 5LMUL 4JI4Q 2DU5A 1SROA 1NMGA 2F3IA 2PI2A 4P72C 1KRSA 1PV4A 12ASA 2I0QA 3ZJYC 1X9NA 1EVKA 3PV0A 4YREA 4UP8A 3JC66 4UY8C 1CSQA 1BKBA 3I2ZA 1VQJA 3A0JA 1K3RA 1VQNA 3CF5A 4LF7L 4LUOA 1ATIA 1VQAA 4P3OA 2E2IH 1Y1WH 1EVLA 2ZXFA 1NMFA 4IFDI 4KQEA 3S2HH 4X5OA 2ZM6Q 1U5KA 4L5TA 4A93G 5JJLA 2R7ZG 3KDFB 3MEYA 1UE5A 1XMQQ 4YCWA 1AE2A 1Q81C 5K36G 1A0IA 1EIFA 3KLWA 1QF6A 2PI2E 4A3IG 1Q86C 2KCTA 1CKOA 11ASA 4X65Q 4R4QA 1G5IA 4L5RC 4KI0A 3HRIA 3NEMA 1G51A 1M1KC 1KHIA 2Q5HA 4DV1Q 5JJKA 3UGQA 3JAMi 2AHOB 2V1CC 5FJ8G 4A3KH 2JQOA 3HOXH 2C35B 3H3VI 3HXVA 4KR2A 2FXQA 5GAEC 1P8LA 3A7RA 4EQ5A 2AWOA 3HKZG 1QVCA 4B3TQ 1CKNA 1B70A 4P73A 4NXNL 5IYDH 4A3BH 3BU2A 1Q8KA 2HHHL 4JI3L 4XU1A 3GTLH 4JV5L 3PCOB 1PH6A 2OCEA 3TUPA 2F52A 2ZTEA 4DAMA 4YRIA 1SRUA 1JE5A 3U50C 1N34Q 1A62A 4O0AA 4H2YA 2ZNJA 3GD7A 3RN2A 1OXTA 4GKJL 3UE0A 2E2JH 2WFWA 2C8MA 1HZCA 4B3MQ 2UUAQ 1N32L 3REXA 1EWIA 1LUZA 3STBC 3S14H 4BY7H 4YRFA 4YHHQ 1KRTA 1ADJA 4TWAA 1IXRA 2QEXA 3F2CA 1YBYA 4LF8L 4HIKA 4LF6Q 4JI8L 3MF1A 4EX5A 3HOUH 4JBWA 2CKZB 4DUZQ 3G71A 4BA1I 2K50A 1VQ4A 3HFZB 1HZ9A 4DPGA 2DU7A 1EIYA 2LSSA 2VZAA 2R6GA 4KR3A 3V8JA 1YEZA 5F5WA 1K8AC 2E5LL 1TWHH 3HOYG 1PH1A 3I56A 2RCNA 4A3DH 3VBBA 1KOGA 4GKKL 1TWAH 5C4JH 2N8NA 1J6QA 1WCMG 2MQHA 4A3EH 3ERRA 2ATWA 1I5FA 3PF4A 4TQFA 4DV5L 3LSSA 3CD6A 2JA8G 4IFDG 4ZIBA 4A4IA 3BFMA 4XU0A 1USYC 3CP0A 1HNXL 2K5VA 3V7RA 1XNQL 2YV5A 3GTPH 4DUYL 3PUWA 4L5QA 3L4GA 1N36Q 1O7IA 3L2PA 1IBKQ 2ZT8A 3MF2A 4BBRH 4YRPA 1NJ8A 2E65A 4X64L 2JEBI 5GROA 3RUXA 5JEAG 1PH8A 4LF7Q 4YPFA 3V7SA 4ALPA 4IFDJ 4GS3A 4P72A 4Y7NH 2ZGWA 3WWVA 4PZ8A 3RLFA 1SERA 3CCRA 3RF1A 4HWSA 4RQFA 1QVGA 2EQSA 2AWNA 2ZIOA 4A3GH 3HXYA 1YJNA 1X55A 4QQBX 4MTNA 3K0XA 3ICEA 4CH3A 4DV0L 4G85A 1UE1A 1YVCA 1VQIA 2Z0SA 1B8AA 2L15A 3TREA 4DV2L 2I4OA 2ZZFA 2EL9A 1MJCA 1G291 4DQ2A 1NBWA 3W1GA 2A1AA 3CCSA 2QHSA 3KJOA 2IT1A 1YB3A 3HXWA 2UUBL 4CS4A 5GADC 2ZT5A 2P5IA 2WB1E 1WLEA 3IKMB 4DR3Q 4YROA 1NJ1A 4CH6A 1A63A 5C4XH 2VQEL 2B63H 3M4QA 1ADYA 3OTOL 4X62Q 1YFRA 4QY7A 2HHHQ 2JJQA 2RHSA 4HJ7A 2QHVA 4K0KL 2I4MA 4JV5Q 2OTLA 1M90C 5ELOA 2OWOA 2N78A 3RKYA 1X2HA 3UE1A 2LXKA 1Q82C 2CCZA 3KF6A 2Q2TA 3EN2A 2YTYA 5DLQE 1YIJA 4GKJQ 4OX9L 4P73C 4IPGA 1N32Q 4P74C 4YRJA 2PMFA 2JA9A 3RGLA 5GQOA 2B29A 1I94Q 4YCVA 1SETA 1SR3A 4G84A 2A8VA 2K5NA 4LF8Q 3RLNA 2ODRC 4HJ8A 4JI8Q 4QIWE 2PMZE 3PUYA 1T9HA 2ZTGA 1J5EL 3ULLA 2ZR3A 5C44H 1UWVA 4GLAC 2VL6A 4JI0Q 4A3MH 5IP9H 2IY5A 3T1YL 1K9MC 4P75C 3NETA 1B7YB 4HWOA 3RZDH 3HY1A 3VQVA 1N33L 1QUQB 2H5XA 4XIGS 4YRNA 3J80c 3S1NH 2ZIMA 3LGJA 3FKIH 2ZJQA 1NJ2A 2KENA 2HQLA 4LF5L 3AEVA 1X3GA 1HNZL 1VCIA 2EXDA 3A5ZB 3L0OA 1WQ7A 1YJWA 2BH8A 1Y1WG 2ALYB 4HJ5A 1VQFA 4BY1H 4C3HH 2CQOA 2BH2A 2ARSA 4C3IH 2KBNA 2P0LA 2ASBA 3S15H 4XTCS 4X64Q 1SESA 2YTXA 1EFWA 2UU9L 2ALYA 2VS1A 4YWLA 1YFTA 1PYSB 1TXYA 1USYA 4E51A 2Q2HA 1YFSA 5EAYA 4GLXA 4JBJA 4H2VA 2J3LA 3A7AA 1UEBA 4IJHA 3I4MH 4HJAA 1OXVA 2JA6G 3IKLA 1EOVA 4ZTZB 3KFUA 4DR2L 2WP8J 3PO2H 4H2SA 4YWMA 2OTJA 3CMAA 2B3GA 5FLMH 4DV0Q 4J15A 1AH9A 3CMEA 1HTTA 2K52A 1NY4A 3ULJA 4LF9Q 3L1AA 4BBSH 3VQWA 2MFIA 3AFPA 1PH5A 4DAYB 5LMNL 1EQQA 1XNRQ 4LFAQ 4LFBQ 4JBMA 4NB3A 3A5YA 1PH3A 4TVYA 2UUBQ 4LFCQ 2DTOA 4KLKA 1WJJA 4JI1L 1Q1EA 4JOIA 3J81j 4B3SL 2WAQG 3W3SA 4DR7Q 4CH5A 4RMFA 2VQEQ 2J3MA 2P8TA 5C53B 3OTOQ 4NPSA 1VQCA 2UXCQ 1IYJB 4DR6Q 4TQDA 3J81c 2E3CA 3K80C 1X2GA 2MO0A 3A5UA 2MNAA 4NCXA 4AYBG 3CCEA 3ERSX 2BA1A 1Z47A 4FDBA 4A3FG 3I4OA 4H2UA 1CUKA 2MO1A 3V8LA 4YRKA 3CPFA 4DKAC 4BY7G 1VQ9A 3HOVG 4H2TA 2JK8A 5JJIA 5KNNA 4JI2Q 1SMXA 2CJ9A 2JE6I 3KJPA 4P3PA 3S1QH 2Y0SE 1OTCA 4YRRA 1QVFA 3E9HA 2ZT7A 1Z7NA 2FYKA 4HWTA 5LMNW 1CKNB 1B70B 4CS3A 2CJBA 4DV3L 5IWAL 4XTUA 5C51B 1L0WA 3ULPA 2D6FC 3AFQA 3S2DH 4A3EG 1BVSA 1DGSA 1PH4A 3QTCA 4A3JH 4X6AH 1SFOH 1HR0L 1BIBA 3T1HL 4P74A 2QHUA 1J5WA 1N33Q 1TWGH 4A3LG 4JI7Q 3HXZA 2AKWA 4IPHA 4DR4L 5AJ3Q 1ASZA 3PSIA 4APVA 2GVAA 4YDQA 4LF5Q 3S17H 5M5YH 4YY3L 1FYFA 3G6EA 3S16H 4YP0A 1VQ8A 1NJIC 1EQRA 1VQOA 2F4VQ 2VUMG 3PUZA 1HNWL 1HC7A 4P75A 2Q7GA 4TVWA 2OQKA 1N8RC 3OD1A 4C2MH 2ZJRA 2IHFA 4DV7L 4GOPA 3F1ZA 3MEFA 4A93H 1EIYB 4Q15A 1XPUA 2R7ZH 4JYAL 1WPYA 2E41A 1VQHA 3EFSA 1SRYA 4OLFA 2NVXH 5C0XI 4GN5A 2R7FA 2UXDL 4OONA 3HOWH 4A3IH 1ZQ1C 2UUCL 3KOJA 3HFVA 1VQ5A 5IYBH 1E3PA 3D31A 3CCLA 5IP7G 3DSQA 3UDXA 1HR0W 5GAGC 5IY0A 2K5HA 4JI6Q 2AMCA 1SN8A 1L1OC 5C3EG 3A32A 3M85A 1JJCA 1Y1VG 3F2BA 3IRBA 5FJ8H 3NELA 5E7NA 5LMUQ 3L4GB 4YRSA 4GNXC 5M3FG 4LF4L 1QE0A 4WI1A 3R07A 4IOAA 3REUA 1I6HH 4YRCA 2R93G 3UH0A 5C52B 3PF5A 5LMNQ 4KHPL 2NN6I 5E3IA 1I3QH 1P16A 1V9PA 4NXML 3VQXA 1YGBA 4YWKA 3ER0A 1WQWA 4JI1Q 4B3SQ 3CC4A 3I4NG 4IPDA 4GN3B 3UDFA 3L7ZC 4YCUA 3UFGA 1OXXK 4GN4B 4PZ6A 3VDYA 3G4SA 2R92G 4HIDA 2DZCA 4B3RL 3E9IA 3RACA 2CWPA 4JBKA 2EAYA 1XPRA 2GN5A 2E5AA 5M3MG 5M5XH 3TS2A 1CSPA 1UE7A 4JOIC 1NYRA 2E2HH 1FVIA 4HWPA 1W66A 1E1TA 4JC0A 2DKGA 1G5HA 3HKZE 3RN5A 1EYGA 3F8TA 2ES2A 1JJGA 1D7QA 4IO9A 1KL9A 1K83H 3DM3A 4JI4L 3PUVA 1X65A 1MKHA 4DV3Q 5IWAQ 3HOYH 1WI5A 3HY0A 3PGZA 1OXSC 2DJZA 3BJUA 3HOZG 2RHSB 4H2WA 3LSQA 2DVEA 4A3CG 1H4VB 4NXNQ 3CCJA 5IT9c 1LM0A 2JA8H 1HR0Q 4X66L 3CCUA 3KF6B 2KHJA 4JI3Q 2JA7G 1D8LA 2DQ0A 2RF4A 4QL5A 4R4OA 1V43A 4BXXG 3GTMH 2CFMA 3PO3G 2ZM6L 3H0GG 2GVBA 1U0LA 1PA6A 4R4CA 1KXLA 1IBLL 1HNWQ 1BBUA 3OYYA 1XMQL 1VQLA 4GLVB 2QHTA 1PVOA 2UXBL 1H4TA 4LW1A 4DV7Q 1KQSA 3P8VA 1N9WA 3I4MG 2IY5B 4JYAQ 4X65L 4P3NA 5C0XJ 4RQEA 2R7DA 1KD1C 1RIPA 3PO2G 2PQAA 1C7YA 1YJ9A 2CJAA 3V8KA 2NN6G 5IYCH 3FHWA 2QA4A 2UUCQ 4CH4A 3M7NA 2DTHA 4H2XA 3P8TA 2E5LQ 2ID0A 2IX0A 2OQ0A 4WF2A 4XTVA 5ELNA 1UE6A 2RHQA 4GOPC 3A31A 1XPOA 4GKKQ 3PUXA 3EIVA 1KIXA 4DV5Q 5HY6A 1IZ6A 1JMCA 1HNXQ 1YHAA 3VQYA 4YRLA 1XNQQ 3GTQH 4DUYQ 4TQUS 1WU7A 3S24A 3QO8A 1JT8A 1KAWA 3K81C 2N49A 2I5HA 1L1OA 2VW9A 4B3ML 1EUJA 1MIUA 2E8GA 4GNXA 4YHHL 2N3SA 1PHJA 1RL2A 1AE3A 1MJEA 4B3RQ 3CCQA 1VQEA 3EBEA 4MZ9A 4OO1I 1X54A 1IBML 1K0RA 3BZKA 4DUZL 1Q46A 1X01A 3K7UC 1X6OA 3KF8B 1GO3E 4AQYL 3I7FA 2PMEA 2LXJA 3ICAA 3J7ZC 4YRTA 3GTKH 3HTZA 1H4SA 4YRMA 4XTYA 4A3KG 5J3BA 3TEHA 3HOXG 3OW2A 1VQ7A 4DV2Q 1FJGL 3NBHB 4RDXA 2DDZA 1XMOL 1VQPA 1Z7MA 4JI5L 4LWCA 3CXCA 2JA5H 5IYDG 4A3JG 4A3BG 4AIMA 1JB7A 2XGTA 3K8AA 4LNSA 4TVAA 2HNIA 1B76A 3CQZH 2D0OA 5K1XA 1GVPA 1HZAA 1N36L 1IBKL 4L87A 3EFRA 1ASYA
chains in the Genus database with same CATH superfamily
2Q2IA 3CCVA 1X31C 2E10A 4X66Q 2KCCA 3TTGA 4YFKA 3W5OA 1TWCH 1E7ZA 4XEOA 3GTGA 5JFEA 3O13A 1K83C 2BDNA 3GTGH 4KM8A 1OXUA 4K0KQ 1G6ZA 2NWGA 4YRGA 2M00A 3S1QB 2RCFA 3LPXA 3HOYC 3N3YA 3TQYA 4X3UA 3A8IA 2NVQH 1H9JA 5D14A 1DCPA 4XCHA 4OIQA 3S1RH 4EQOA 1TT2A 1Q7YC 4IOCA 3HOUG 5DM63 3Q22A 3R8BA 4A3KB 4OX9Q 4XTZA 2E2IK 2SEBD 1Y8NB 3Q8DA 4POFA 2JA8C 3S2HK 1IBLQ 1YITA 1Y14B 4PHCA 4C3JH 2HIVA 1S72A 4KJOA 3J80L 3WQZA 1SNCA 2GSNA 1EZ6A 1E22A 4F87A 3B6YA 2YU9H 4OWWB 3HOWG 3K59A 2UXBQ 4NDXA 2LKVA 3M9BA 4ODGA 1O80A 5IYBG 3UDGA 4FXKC 1K73C 1PH7A 4A3JB 3DM1A 4KD3A 1WFQA 4A3BB 3GEEA 3TFHA 3GTMC 2JA6H 1SFOB 3KDFA 5EGEA 4DDQA 4N9TA 3SK5A 1FD7D 2ZZEA 2DEQA 1V8QA 1O24A 1OO9B 3CC7A 2W7VA 4A3DG 1EY9A 3A54A 1GXDC 1J5EQ 3P8YA 3GTLB 1VQ6A 5KYLA 2AKWB 1ICFB 1PYBA 1JQYD 1SNMA 3J80E 4ZKBB 3VYSA 4R1JA 2A6ED 3LAJA 3S1QK 1JOQA 2KEEA 3T1YQ 2V6SA 2VQFL 2O4XA 2ZZGA 2L5TA 1C9OA 3AB9A 4PMWA 1CT1D 3PIOA 4DR3L 1STBA 5M5YB 2DXUA 2EJGA 1SE4A 4RG1A 4UHVA 4K86A 1TWGA 4CJ0B 2C7IA 1H4QA 1A2UA 2ICIA 3H3VD 2E2JB 3SK8A 2ARUA 4QJVA 1EY0A 4XEMA 2HIXA 2PNRC 3LC0A 2A6HC 4A3KK 3GTOH 4CKCA 3HOXK 4X62L 1CHQD 2D62A 2KHIA 2K75A 1QNKA 4UPAA 2XWBB 4HAEA 3P1HA 4Y52H 1YHBA 4BBRG 4N9PA 3CRKC 4WFN3 2NZHA 3KUPA 2F0KA 4KN7C 1LTLA 4F88A 4GOPB 1S5CD 1HNZQ 5IYCC 3TP7A 3J80i 4OO1G 1YHQA 1E24A 2EYOA 4YRQA 3HOUB 5IYDK 2DTIA 1S5DD 4H02A 4A3BK 4U673 2WB1G 2I5MX 1EY7A 1SFOK 3NE5B 2DUDA 2RA4A 1MGSA 1E1OA 2P5ZX 3RL6A 4CS2A 4UP9A 2ZFZA 2NVXB 3HKSA 5IOCA 1EQTA 1NJ5A 4QJFA 5ISRA 1O2FB 5FK9C 2Z6KC 4BWAA 2DQ3A 4IPCA 1BS2A 3GTLK 3STBD 3NK9A 2Q2UA 4R9WA 1PTOC 1WOCA 4HJ9A 1EIHA 1B3QA 4CDCC 3PIPA 3HOWB 1SLJA 3OPFA 2R7ZA 2KCMA 3Q6SA 1EK8A 4B9XA 3PCOA 1AEXA 1X3EA 1H9SA 3NWTA 3TRZA 4A3FH 1A2TA 1TWHB 3H15A 4KMHA 4GTLA 2UU9Q 1S5BD 4A3GG 1T5XD 2V4DA 4A3DB 2WAQL 1LTSD 3VYRA 4HIMA 1I94L 3V7CA 4POGA 2E2JK 3QX3A 3DLLA 3HOVH 1TWAB 1VQDA 3M4OH 4LJZA 2QDBA 3I73A 5C4JB 2Q7HA 1KQ4A 5I6YA 2YYZA 1IL2A 2AMCB 2ZCEA 4L6TB 4NKLA 2NZOA 1SDFA 4DK3C 3TEGA 2F0VA 4AH6A 3QB3A 1JJCB 2XCOA 2CVRA 1IBMQ 3GTQC 2K14A 2PZUA 3S14K 4BY7K 3K7AH 2VNUD 1RJTA 2B2UA 5HURA 3IALA 5CMDA 4AQYQ 1I6HB 3TDQA 1F9NA 4AYBL 4OXPA 1BIAA 4DR2Q 1XZPB 4JI0L 4H13C 3R2IA 3HKZB 1DD5A 2WAQE 3HOUK 5C3WA 4XQQA 3AU7A 1B4AA 1KMMA 3I70A 1EH1A 4WJ4A 4TTVA 3GTPB 3J81L 1SE8A 1D2BA 1HA6A 3CMQA 1JOEA 4YYEA 1EEID 3T02A 4BBRB 1B3AA 4KASA 4DR1L 2VY3A 2B39A 2Q8RE 3HOWK 4R4TA 3FRPB 3SGIA 1FJGQ 1O27A 1IW7C 1CM9A 1GOZA 4DV4L 5C4XG 3HFZA 4DR5L 4P71C 2BA0A 1HFGA 1EWHA 1BCPF 1SMYD 3QO5A 2B63G 5IYBK 1XMOQ 4AYBE 5IGFA 1I3QA 1TWHK 3AD7C 1HH2P 4JI5Q 1PFMA 4PZ7A 4O2DA 2DXTA 1FR3A 1LTID 3E0JA 3DWAA 4A3DK 2SOBA 3J81E 1Z7TA 3DWQA 4Y7NB 3RKWA 3RNUA 4O1NA 1TWAK 1HJPA 5C4JK 3GTKC 1JOOA 3OSOA 4A3EK 4LUVA 1ILPA 4A3LH 1NNHA 4ID6A 1LT3D 1IBAA 1K28A 4P5AA 3SZYA 1FL0A 3X3MA 1A8VA 3FJPA 1G6PA 4WORA 4ME5A 1EY8A 4LR2A 4L5SA 2ZINA 4HVCA 5KRUA 3BDOA 4A3GB 4Q6GA 1EU4A 2XVSA 3CPWA 3G1ZA 1DCOA 1VF5C 4LNQA 1NTGA 1YNXA 1VQKA 2Q5IA 3BVGA 1O78A 4HTHA 1JICA 2NVTH 4WILA 2E2HB 1L2FA 3QO7A 3RR5A 4ILWA 1A3VA 5M5WH 1VQMA 2KQ3A 2IHEA 3GTPK 1RCVD 2JA5C 1Y8OB 4UAIA 4HEDA 4IJLA 2VUMH 5E68A 1H95A 2IJ0A 4BBRK 1EEFD 1ENCA 3J81i 1QNUA 4BA2I 3ADAC 4BKWA 4KDDA 1AN8A 1GUWA 1HFNA 3PIO3 4K87A 2YTVA 2I5LX 1GGMA 3CQZC 1VLOA 1V1QA 4K8JA 3U4VA 2R61A 5HGQA 1EZ8A 3T01A 5DEHA 1PFSA 1NE3A 4HA8A 4G7HA 3HRKA 2RQXA 3HOYB 1RIQA 1UAPA 3UI2A 4Y7NK 3P20A 5I4DA 1PRTF 3MXPA 2WINB 4PMBA 1MBYA 4BWGB 5C44G 3EJIA 2MGSA 5C4XB 2K6AA 1TWCC 2L12A 2B63B 4DV6L 4A3MG 1M8AA 5IYCG 4QIWB 1K83A 3GTGC 2CH4A 5BR8L 5JEAJ 5IP9G 2PMZB 2L9HA 5IE8A 2VB2X 2OF1A 1LYLA 4A3GK 1PDQA 4LF9L 4EO4A 4HIOA 2E1HA 5IP7H 3NTHA 1X3QA 3E5SA 4HWRA 3TS0A 4L8JA 3IL8A 4XU3A 4EGVA 2NVQC 2PNHA 3J7A5 3S1RC 3D8GA 3BZCA 3OWEB 1WCMA 3HRZC 1XNRL 1WCMH 3BVMA 5C3XA 3D4DA 2F0HA 4LFAL 4LFBL 2BCOA 4LLGA 1NSNS 2EY2A 3OPOA 2K4KA 3SK6A 4I7AA 3FKIG 2HT1A 4DK6C 5C3EH 2FINB 1Y1VH 3TSSA 3KBGA 4R4IA 1LTAD 4LFCL 2B2YA 2QGQA 3CC2A 4C3JC 4IFDH 2VQFQ 4A76A 2F0QA 5M3FH 3T1HQ 1R9TA 2B8FA 1R9TH 4BLBA 1KTKA 5D3DA 1BBWA 2YU9C 2F0FA 1GM5A 2PQEA 4DR7L 5J22A 3CAGA 4ABNA 2I4NA 5C5LA 1UUPA 1I50H 1KC8C 1Z9FA 2R93H 4JVZA 4V0BA 1DONA 2F0OA 3T56B 3ERQA 4DR4Q 3NPPA 3GTMA 3CAMA 2JA6C 2ENBA 4WJ3M 2PA8D 4LVMA 2X6LA 4OIJA 4CHTB 2UXCL 4BY1G 4XU2A 4DR6L 4KJNA 5C0XG 2ZTDA 4K88A 1VH2A 4C3HG 3VR6A 3GDEA 5C4XK 4C3IG 1L0YB 3L3OC 1HTPA 5FLXc 2NVYH 4YY3Q 2B63K 1I4RA 2F0PA 1NJ6A 5IODA 3AYHB 1XXAA 5E4WC 5JOBA 3I4NH 2LFNA 1WOPA 5IOQA 3A74A 1Q12A 3A7UA 4KY6A 3G48A 1GHJA 1W2BA 3M3YH 3GDZA 2KVMA 1STHA 2WIIB 4MN3A 1JJ2A 1QZGA 4UP7A 1WQFA 4DNTB 4R8NA 2R92H 3UDIA 5EJWA 3MXNB 5C44B 1XJVA 1FGUA 1WYDA 2DZ9A 2PQAB 1STEA 4HMIA 3HEJA 2RH6A 2A6EA 4A3MB 2Q7EA 2X6GA 4WJWA 3QNEA 2EWNA 3GTOC 5I2XA 3TN2A 4JI2L 2GSUA 4Q5VA 1VQZA 1PJ6A 3JAMc 5L46A 2EJ9A 4Q4ZA 5M3MH 5CV5A 3F2DA 4DFAA 2ODRD 4H2XB 1GD7A 4Y52C 1QZHA 1JVIA 3H3VH 2ZNIA 2ZR2A 4C1NI 3HXUA 2F4IA 3QOJA 2EIFA 2RHQB 2JEAI 4MNOA 4DV1L 1FNWA 4QB4A 2CHBD 3S1NB 5FLMG 3K58A 1W3SA 2UXDQ 1QE6A 1LTGD 1DM0B 3KYHC 3FKIB 5KGUA 4PNYA 5LHY1 1KMNA 3VR2A 4PMCA 4U68A 5K1PA 1I4GA 5G3LD 4OP0A 4BBSG 1NYQA 3GEHA 4FXDA 1ENAA 2A73B 2Z6KA 1E0BA 3IG2A 1I6VA 1HZBA 4LVKA 1WOSA 3RIRA 3RZOH 2I4LA 3ERED 1B9NA 1TWFA 3RLOA 4YIJA 2EDGA 3GO5A 4B3TL 1X3PA 1TWFH 2JA5G 1GUNA 4A3FC 3GTQB 1CKMA 3M4PA 4JG2A 2I46A 2ZT9C 2CGHA 4BY1B 2BE5D 4ZYSA 4PG3A 3H3VL 2Y0SG 2L4NA 4C3HB 5DAUA 3W1BA 5C44K 2DJFC 4C3IB 2A19A 2K5QA 4LF4Q 3HOVC 5T1IA 3M4OC 1HXDA 3K57A 4DR1Q 3UGTA 4JI7L 4A3MK 1JB3A 4K5XA 3NENA 3HOZH 1ZYRA 5IP9K 2ARTA 5H1SE 4DV4Q 4BLAA 4DR5Q 5AJ3L 1MSHA 2QCPX 3CHBD 5KNBA 3PZCA 1PTOF 1L1OB 4KHPQ 3BDLA 4A3CH 3H91A 3RZDK 2G4CA 5D4DA 1B7YA 1N34L 4NXMQ 3K7AC 1LABA 4GNXB 4ZTUB 2B2UC 2L0CA 4KKTA 1QUQA 3GTJH 4DNIA 2F0SA 3V2TA 1O7LA 5CC4A 3I55A 1C0AA 5GAHC 3S1NK 2EY1A 2JA7H 1YZ6A 1JQWA 2ZT6A 2F4VL 4BW9A 4OHJA 3FKIK 3HXXA 2A5HA 1LTTD 4KHZA 3SK4A 2UUAL 3RKXA 4LAAA 2ZTCA 5CV6A 2IWHA 1CZWA 1C48A 2IX1A 1K8GA 4BXXH 2EJFA 1X3FA 2V6UA 1VQGA 3PO3H 4GTCA 1RF2D 3H0GH 3T13A 4XTXA 1S40A 5LL6X 3FP9A 1EYAA 4P71A 1PH9A 1LV9A 3U4ZA 3FHZA 4GZYA 4KY5A 4LF6L 4HSVA 1JC7A 1S3OA 4RGOS 1VS0A 4OINA 1YI2A 2A69C 3A5ZA 4XTWA 2CW0D 2E64A 4BY1K 2F1MA 2DNEA 4OEMB 4C3HK 4BBSB 3TEHB 4C3JG 4C3IK 2A74C 4A75A 2DGYA 4LUZA 4IN3A 2ZJPA 2F0LA 3GTKA 4JCVE 2CWAA 4ME3A 1Q90A 2IX3A 4A3LC 5IT9L 4OWTB 3L2ZA 2JA5B 4OWXB 1XTDA 1NUCA 4NW2A 2D0PA 2CIMA 4KY7A 1VQBA 4QGUA 2R3ZA 1PH2A 2Y0SB 3KLRA 4RHSA 2WB1D 2XTIA 2JP1A 4CBVA 1WNLA 3KLSX 2Z4HA 2K1BA 3AQQA 4TVAB 1PYSA 2NVTC 2XWJB 2EBBA 3CQZB 5C4HA 1Q1BA 3D4WA 3D0FA 4JI6L 3CCMA 1V1PA 3S1MH 3I4MK 1QB5D 3U58A 3CW2C 4DV6Q 2NN6H 2VUMC 5BR8Q 2RDFA 1X56A 3E0EA 1GKHA 5LMUL 1K8MA 5IT9E 4JI4Q 2DU5A 1SROA 1F2ZA 1G8ZD 1WQGA 2Z6BA 2B2VC 3PO2K 1NMGA 2F3IA 2PI2A 4K14A 4LMQD 4P72C 1F7VA 5FLMK 1KRSA 1PV4A 1JWUD 3GTGB 3R3OA 4ZQ3A 2I0QA 12ASA 1QWYA 3ZJYC 1X9NA 1EVKA 1D1KA 3PV0A 4YREA 3A56A 4QUCA 4UP8A 4QF4A 3SEBA 3JC66 1IL8A 2IW3A 4BBSK 4UY8C 1CSQA 1BKBA 3I2ZA 2J0TD 1VQJA 2NVQB 1TWCA 1KDAA 1TS3A 2E74C 2A68C 3A0JA 1K3RA 1AFPA 4KATA 4DAYA 1ISEA 1IS1A 1VQNA 3CF5A 2XRSD 4LF7L 4LUOA 5CGKA 1ATIA 1VQAA 5D65A 4QMGA 4FVMA 1Y1WA 3DUZA 5IP7C 2KUMA 4P3OA 2E2IH 3P75A 4C3JB 1Y1WH 2O5IC 1EVLA 2ZXFA 2D9UA 2KEDA 1NMFA 1AW7A 1YNND 4X3KA 4IFDI 4KQEA 3D6WA 3S2HH 4X5OA 2ZM6Q 3Q23A 2HQEA 1U5KA 4L5TA 4A93G 5JJLA 2LMCB 1WCMC 1INNA 2R7ZG 1WQHA 3HP3A 4LK1A 5C3EC 1SYFA 1Y1VC 4QIWD 1LACA 3I8ZA 2PMZD 3KDFB 2B2YC 3MEYA 1UE5A 1XMQQ 4YCWA 3S2DB 4G0WA 1R9TC 1AE2A 1TS2A 3WOEA 1Q81C 3QOLA 2F0EA 2YU9A 5K36G 1A0IA 1EIFA 2PZTA 3D3RA 3KLWA 1I4QA 4RAUC 2PI2E 1QF6A 2R93C 1I50C 4A3IG 1Q86C 1CA5A 2KCTA 1FYCA 1AZPA 1CKOA 2JA6A 5CHPA 5KNDA 3VA7A 2IL8A 3IFDA 11ASA 4X65Q 4R4QA 3KLSA 4C56C 4DA2A 1O7YA 1G5IA 1BJTA 4L5RC 5HL8A 2NVYC 4KI0A 1TWGB 3HRIA 3NEMA 3TP5A 1HTLD 1USMA 2ZXPA 2CFAA 1G51A 4QJVB 1M1KC 1KHIA 2Q5HA 3I4NC 4DV1Q 5JJKA 3UGQA 1EY6A 2WKDA 1H9MA 1GJXA 3M3YC 1U9RA 4HMJA 1LT4D 4QCLA 3JAMi 2SNMA 5FO9B 1IYUA 4CDFC 1XXBA 2AHOB 4K6LA 2V1CC 5FJ8G 4A3KH 2JQOA 1RODA 3NSWA 2R92C 3HOXH 3S17B 2C35B 3H3VI 3HXVA 3S16B 4KR2A 2FXQA 3MA2B 2WAQB 5GAEC 3AD9C 1P8LA 3A7RA 4JPBW 4EQ5A 2A6EC 2AWOA 3GTOA 3HKZG 1QVCA 1WTRA 4B3TQ 1CKNA 1B70A 2XCRB 4P73A 4NXNL 2QEJC 1F9PA 4CGYB 5IYDH 4A3BH 3OREA 2H4OA 3H3VC 3S2DK 3BU2A 2F0JA 4C2MB 1Q8KA 2HHHL 1EOTA 4JI3L 4M1UB 1TIID 2PYKA 4EQNA 4XU1A 4A93B 2K05A 3GTLH 4JV5L 2PA8L 2R7ZB 4RWSC 1SJHD 3PCOB 4IUUA 1PH6A 1H9SB 2Y3PA 4A3JK 4X6AK 2OCEA 4RCNA 3TUPA 2F52A 3V96A 2ZTEA 4DAMA 4YRIA 1SRUA 1CA6A 1JE5A 3MAQA 1HQRD 4GT9A 5I9OA 3U50C 3K5MA 1N34Q 4PV1C 1A62A 1TWGK 4MEXA 4O0AA 3HOVB 1I6VC 3K5OA 3M4OB 4H2YA 2ZNJA 3RZOC 1R4PB 5C5MA 3GD7A 3RN2A 1OXTA 4A3IB 3UE0A 2E2JH 4GKJL 1TWFC 1DD2A 3ND9A 1EFID 4Z9CB 2WFWA 4K5WA 4XQNA 2C8MA 1HZCA 4RKLA 5E3FA 5FO7B 4B3MQ 2UUAQ 1D5XC 4X3TA 1N32L 1ILQA 3REXA 3S17K 1EWIA 1HCZA 5FKAC 1LUZA 2SNSA 1NAPA 5M5YK 5C4ZA 3STBC 3S16K 1BCPB 3S14H 3SZZA 4BY7H 4YRFA 4YHHQ 1KRTA 1ADJA 4TWAA 3V05A 1IXRA 4KV6A 3TP6A 3URYA 3HOZC 2QEXA 1ZYRC 1VRQC 3F2CA 1YBYA 4LF8L 5K5PA 2XN9C 4HIKA 4LF6Q 4DAVA 3DMUA 4JI8L 3MF1A 2GAHC 4A3CC 4EX5A 3HOUH 4JBWA 4DGZA 2CKZB 4DUZQ 2NUCA 2NZ1D 3M4YA 4KK7A 4C1NK 1BUVT 3HGBA 4BA1I 3G71A 3GEIA 4C2MK 5IOSA 3A55A 3Q3QA 2K50A 3GTJC 3U9OA 1UV7A 3X3NA 4A93K 1VQ4A 4YFNA 1YNJD 1SYEA 3HFZB 2JA7C 1HZ9A 2R7ZK 4DPGA 1RKNA 2DU7A 1BDOA 4LOWA 1BR9A 1EIYA 2LSSA 3QG1A 2VZAA 2R6GA 1I3QB 1RTOA 4KR3A 3V8JA 1YEZA 4BXXC 5F5WA 1K8AC 2NVXK 2E5LL 2AUKA 1H9RA 1TWHH 2EJFC 5CR3A 3SDZA 3HOYG 1PH1A 5EQ0A 3I56A 3PO3C 2RCNA 3H0GC 5CV4A 2C9OA 3IPJA 4XYQA 2B2TC 4A3DH 3K5LA 3VBBA 1KOGA 4A3IK 2NB0A 3A8JA 1RU0A 4GKKL 2XRQD 1TWAH 5C4JH 4GZYC 2N8NA 1J6QA 1WCMG 1WTOA 2MQHA 3SXHA 4A3EH 3ERRA 2ATWA 2A69A 1I5FA 4V190 3PF4A 4TQFA 1T5EA 5M9OA 4DV5L 1O26A 3LSSA 3N6RA 2EPBA 3CD6A 2JA8G 4IFDG 4ZIBA 1QG7A 4K8IA 4A4IA 4CDDC 4KMAA 3BFMA 1JWSD 4XU0A 3EFXD 5BN5A 4DU9A 1SMYC 1USYC 3CP0A 3PQIA 1HNXL 1SNOA 4MEYA 3LAPA 2K5VA 3V7RA 1B4BA 1WTXA 2RSOA 4OIOA 5ELFA 1XNQL 1A3TA 3ND8A 1O2AA 1F9QA 5FJ8K 1PRTB 2YV5A 5M5XB 4XXEA 5JAVA 4DUYL 3GTPH 2DN8A 3PUWA 1ICWA 5FOBB 1SYDA 1DOMA 2EYJA 3E6ZX 4L5QA 3L4GA 1N36Q 1O7IA 3L2PA 3EQLC 3W2DA 1IBKQ 2ZT8A 3MF2A 1WORA 1I6HK 2OT2A 4BBRH 1RDPD 3JSTA 4OGQC 4LVIA 3A8KE 1J6VA 2WACA 4YRPA 3S1MC 1NJ8A 1TKWB 3VR3A 2E65A 2JH3A 1A6XA 4X64L 2JEBI 4OO1H 2VUMA 1I3QK 5GROA 1QCBD 3RUXA 5JPMC 5JEAG 3I4LA 1PH8A 4K6DA 4LF7Q 4YPFA 5IGBA 3V7SA 4ALPA 4HR7B 4IFDJ 4GS3A 2N88A 2B2VA 2RDHA 5CV8A 1M4VA 2BOSA 3FVQA 2Y0SD 1SNPA 4P72A 1O28A 4Y7NH 3T53B 2ZGWA 4H0LC 3WWVA 4PZ8A 3RLFA 1JWMD 1K83B 5IGGA 1SERA 3CCRA 2EYPA 3A8JE 3RF1A 4ZUJA 2ZXRA 4HWSA 4RQFA 1QVGA 3OOCA 2EQSA 4IALA 2AWNA 2ZIOA 4A3GH 3HXYA 2X69A 1YJNA 1X55A 4QQBX 4MTNA 1MD2D 2A68A 3K0XA 3ICEA 4KMDA 2FMCA 3OIPA 4RA8A 4CH3A 1WCMB 4DV0L 1XZQA 1E2VA 2HDMA 1Y8PB 1J8IA 2WB1L 1U4MA 5M5XK 1B1ZA 4G85A 3BDCA 1UE1A 1QILA 4CJ2C 3TFIA 2PW5A 1YVCA 4FO2A 2PPBC 2E2IC 1VQIA 2JA8B 2Z0SA 1Y1WC 2O5IA 1B8AA 2L15A 3TFJA 3TREA 3NXWA 4DV2L 1SNQA 2I4OA 2ZZFA 2EY6A 4G7ZA 3S2HC 1JE4A 1DOKA 1MJCA 3MFYA 3TMEA 1R9TB 2IPKD 2EL9A 5JVOA 4FP5D 2E2HK 1DYQA 1G291 2F0MA 4DQ2A 1NBWA 2PO4A 4XYOA 3W1GA 2A1AA 5EPJA 5LL6S 3T16A 3CCSA 2QHSA 3BYTB 4XLNA 1QOHA 3KJOA 2IT1A 1Y1VA 2NTSA 4LK1C 4KKUA 1YB3A 3GTMB 3HXWA 4DK0A 2UUBL 1VJEA 3SVMA 4CS4A 5GADC 2ZT5A 3OW7A 2P5IA 1XXCA 2WB1E 3G6JB 4MIUA 1ZKOA 3C46A 3MXUA 2LY7A 1ET9A 1WLEA 3IKMB 4DR3Q 2GAGC 4YROA 1ESRA 1ET6A 1NJ1A 2R93A 4CH6A 1A63A 1I50A 1K83K 5C4XH 3I4NB 3DEPA 2VQEL 2KCNA 5TMCA 2B63H 3M3YB 2NS6A 3OEPA 5I6WA 3M4QA 1SE2A 2CQAA 2Q8TA 1ADYA 3QR8A 3HOYK 3OTOL 3I90A 4X62Q 3W3AA 1TR5A 2AQ1B 1YFRA 2XNAC 3MMLB 4QY7A 2NVYA 1CZGA 1BBXC 3H09A 2HHHQ 2JJQA 3NTKA 2FQTA 3J7AV 2M2LA 3GP7A 4HSPA 2RHSA 1PJ5A 4HJ7A 2HCCA 4KKSA 2QHVA 4K0KL 3RUZA 4G57A 4JV5Q 2I4MA 2OTLA 1M90C 2Z9HA 5ELOA 4A3KC 2JA8K 2OWOA 1PFNA 2N78A 3RKYA 1HA5A 1JR0D 1X2HA 3HOXC 2R92A 3L4JA 1CFMA 1VMCA 3UE1A 1XX8A 2LXKA 1LO5D 4MHEA 1Q82C 2CCZA 3KF6A 2Q2TA 1O29A 3EN2A 4QIWL 2YTYA 1K3BC 1LTRD 5DLQE 1YIJA 4GKJQ 2PMZL 4OX9L 4NP5A 3GTMK 2Z8LA 4P73C 5IYDC 4IPGA 1DCZA 4A3BC 3Q24A 1ML0D 2DJGC 2Z4IA 4HN7A 1N32Q 1HPCA 4B08A 2FHTA 4P74C 4YRJA 2PMFA 3TP8A 2JA9A 3RGLA 1PTOB 2B29A 5GQOA 1F9RA 1I94Q 3GTLC 4YCVA 1TWFB 1SR3A 1SETA 4G84A 4K5VA 2A8VA 2K5NA 4LF8Q 3T00A 3RLNA 2ODRC 3BG3A 4HJ8A 4JI8Q 2XIWA 4QIWE 4RFBA 3C1EA 4KAWX 2PMZE 3PUYA 3L4KA 1T9HA 2ZTGA 1TU2B 1J5EL 3ULLA 2ZR3A 3GIRA 5C44H 5CV9A 3G7LA 1UWVA 3QO2A 1LLRD 1BF4A 2E2JC 2DY8A 4GLAC 2VL6A 4JI0Q 4A3MH 2QILA 3OHXC 5IP9H 5CV7A 2IY5A 4KB2A 3T1YL 1K9MC 4P75C 3NETA 4ZRZA 1B7YB 4ZKCB 3FOFA 3S14C 4HWOA 3RZDH 1B9MA 4BY7C 3L9AX 3HY1A 3VQVA 1A15A 1N33L 3LNNA 1QUQB 5L37A 2H5XA 3MQZA 5IYCK 1R4QB 2D5DA 4XIGS 1BO0A 3HG9A 1SJED 4YRNA 1EY5A 1NNXA 2H1EA 3J80c 5EBCA 3S1NH 3HOUC 2ZIMA 2BE5C 5JVG3 4XSXA 3TZUA 3LGJA 3FKIH 2ZJQA 1NJ2A 2EYHA 2HCIA 2KENA 2OEOA 2HQLA 4XLPA 4LF5L 3AEVA 3GTJA 2I07B 3Q0AA 2F0IA 1S5FD 4RHRA 2JA7A 1X3GA 1HNZL 1TWFK 1DJRD 1BCPD 4RGMA 2WKCA 1UNSA 5TJ3A 1VCIA 2EXZA 2EXDA 3AD8C 1W6KA 3BZDB 4JW0A 1CQVA 3A5ZB 3L0OA 1MI2A 1WQ7A 1TY2A 1SNDA 2O2LD 1YJWA 2BH8A 1Y1WG 1CK1A 1IE0A 2ALYB 1TWHC 4HJ5A 1VQFA 2E75C 4BY1H 1YNJA 5C0XH 3H0GA 4C3HH 2B2TA 1KDBA 2CQOA 2BH2A 4A3DC 2ARSA 3GTKB 4C3IH 2KBNA 4CJ1B 2P0LA 4FZBA 2EYLA 1TWAC 5C4JC 2ASBA 2C5CA 3S15H 4XTCS 4A3EC 1KLGD 4ZAIA 5IIFA 3BS1A 3GTQK 4X64Q 1SESA 3HKZD 2YTXA 1EFWA 1ENFA 4RKBA 5EKIA 2UU9L 1D6EC 3SR1A 2ALYA 4YG2A 5FO8B 2VS1A 2RBMA 4YWLA 1YFTA 1SMYA 1PYSB 1TXYA 2OXPA 1USYA 3A7LA 4KARA 4E51A 3S1MB 2Q2HA 3RMHA 1YFSA 5EAYA 5JJZA 1V1PB 4GLXA 1KAAA 4JBJA 2CW0C 4H2VA 2B8GA 2J3LA 3A7AA 4KMUC 1UEBA 4IJHA 2J7ZA 3I4MH 4FYDA 3GTPC 4HJAA 1OXVA 2JA6G 3MEHA 1G91A 5EGTA 5EGHA 3IKLA 4ZUIA 3EQLA 1EOVA 1HI9A 1LTBD 5DM73 3KFUA 4ZTZB 4BBRC 1XYIA 1CTMA 3VYUA 5E1FA 4DR2L 2WP8J 5D3IB 3PO2H 3OIQA 3AMUA 4H2SA 4YWMA 2OTJA 4CKEA 3CMAA 3FPPA 2B3GA 4KN4C 5FLMH 4DV0Q 4J15A 2K7VA 1AH9A 2K04A 3CMEA 4H7BA 1HTTA 2K52A 1NY4A 4OIKA 3ULJA 5FLXL 3KF8A 4LF9Q 3L1AA 4G0VA 1EQVA 1PRTD 4S3SA 4BBSH 2MJ8A 1UEAB 5CYUA 3SE0A 3GTKK 3VQWA 1HHVA 2MFIA 3AFPA 4Y7NC 1PH5A 4XDXA 2A8EA 1TWCB 1ZBSA 4DAYB 5LMNL 3HZXA 1EQQA 1XNRQ 2O5JC 5A2QL 4LFAQ 4LFBQ 4JBMA 4NB3A 3LWUA 3A5YA 1Y1WB 4I65A 1PH3A 4TVYA 2UUBQ 3I72A 3T4AC 4A3GC 4LFCQ 2DTOA 1SYCA 4KLKA 1WJJA 1XXGA 1Q1EA 2QKIC 4JOIA 4JI1L 3J81j 5FLXE 4B3SL 4G7OC 3S1MK 2F3WA 2WAQG 3S1RB 3W3SA 3NBHA 1WTQA 4O42A 3JAML 2VXWA 2JA5K 1HQMC 4DR7Q 4CH5A 4L63B 4RMFA 2VQEQ 2J3MA 4OL7A 4LVLA 1V1OA 2PPBA 2E2IA 2EOTA 2P8TA 5C6AA 5C53B 3OTOQ 4NPSA 4P5BA 1VQCA 5A2QE 2UXCQ 4G7ZC 1IYJB 4H44C 3LWEA 3J81c 4DR6Q 4TQDA 1I4PA 2E3CA 3K80C 1BXTA 1DXMA 1X2GA 3CQZK 2MO0A 2JXMB 2KJXA 3A5UA 2YU9B 4UDUC 2MNAA 4PAAA 4NCXA 4AYBG 1SYGA 1J6XA 2JSOA 2Z1CA 1J98A 3CCEA 4G0UA 4N8FA 3ERSX 2BA1A 3JAME 1Z47A 4FDBA 4A3FG 2JA6B 3I4OA 1O25A 1YNNC 2Y0SL 1TS5A 4H2UA 1CUKA 2MO1A 3BVZA 3H94A 1KNAA 3V8LA 3TZDA 5CBEE 4YRKA 3DEOA 3CPFA 4DKAC 4BY7G 2NYZD 1TWCK 3WODA 1VQ9A 3IKJA 1SYBA 1EYCA 3HOVG 2F0UA 1PZKD 2QDLA 5C4XC 3GTGK 2CFAB 4H2TA 5CJ9A 1LT5D 2JK8A 2B63C 1J9OA 5JJIA 4J6HA 3RD4A 1YCLA 5KNNA 4JI2Q 1Y1WK 1SMXA 1ZXOA 4K2LA 5IGEA 3NBIA 3HOXB 2CJ9A 2JE6I 3KJPA 4P3PA 3S1QH 1FNVA 4GTEA 2NVQK 1EL0A 1STNA 2Y0SE 1OTCA 4YRRA 1QVFA 3S1RK 3E9HA 3FEWX 2ZT7A 1Z7NA 2FYKA 4HWTA 3GTOB 5LMNW 1CKNB 3NQIA 1B70B 3C2PA 4CS3A 2CJBA 4DV3L 4C3JK 2GA4B 5IWAL 5E4XA 4XTUA 2Q8IB 5C51B 1L0WA 1VGXA 4RH6A 3ULPA 3VR5A 2D6FC 2YU9K 3AFQA 3S2DH 3C3LA 4OIPA 3MFGA 3HS0C 3DXJC 3OMCA 4A3EG 1BVSA 1DGSA 2JA6K 2MPMA 2RVLA 2A6HD 3QIAA 1PH4A 3QTCA 1GUTA 1SFOA 4MTKA 4A3JH 4X6AH 3T51B 1I4HA 1SFOH 1HR0L 1BIBA 3T1HL 4P74A 2QHUA 2DY7A 1J5WA 1F93A 4GTDA 3GTLA 4AYBB 1N33Q 1RHPA 1TWGH 2EJMA 2ICEC 4JI7Q 4A3LG 1VDZA 3HXZA 2B2WC 2AKWA 1CHPD 4I7ZC 3A8IE 4KB4A 4IPHA 1PZID 4DR4L 5AJ3Q 1ASZA 1F2LA 4A3FB 2XSCA 3GV6A 3PSIA 1MSGA 1W6JA 4APVA 3S14B 4BY7B 2DNCA 4P9SA 2F3VA 2GVAA 4YDQA 4KM9A 4X3SA 4G4KA 1SEBD 4LF5Q 1WOOA 3S17H 5M5YH 4YY3L 1FYFA 2XCQA 3BP8C 5C44C 3G6EA 4FF2A 3S16H 4YP0A 1C8CA 1VQ8A 3GTOK 2K28A 3MXGA 4A3MC 1NJIC 1PTOD 5IP9C 1EQRA 1VQOA 2F4VQ 2VUMG 4CDEC 1STAA 3PUZA 1B4OA 1HNWL 1HC7A 4P75A 2Q7GA 4Y52K 3K7AB 3G4AA 4TVWA 2AQ2B 3RZDC 2OQKA 4ULLA 1N8RC 3FOEA 3OD1A 3R93A 4C2MH 2ZJRA 2IHFA 4ZCKA 4DV7L 3F1ZA 4GOPA 3P7JA 4LVJA 3MEFA 5HGTA 4A93H 3S1NC 1EIYB 4Q15A 2BE5A 1SBBB 4K2KA 2EYMA 1XPUA 2R7ZH 3MHBA 3ZYYX 1ZYRD 4JYAL 1WPYA 3FKIC 1E2ZA 1VMPA 2E41A 3D4RA 1B44D 5BN3A 1VQHA 5EPLA 3EFSA 2NVXA 5G3LF 3J7AF 1SRYA 3A8KA 1EYDA 4OLFA 4KTAA 2NVXH 4J8QA 2EVBA 2QW7A 5C0XI 1AZQA 4KD4A 1TY0A 2PW7A 4GN5A 2R7FA 3H6MA 5J1ZA 5K36H 2EE1A 2TSSA 1U4PA 2FJ2A 2UXDL 4OONA 3HOWH 4A3EB 4JK1A 4A3IH 4A3FK 1BQQT 1IYVA 1Q3LA 1ZQ1C 2UUCL 4IUTA 1EIGA 3KOJA 3HFVA 1VQ5A 5IYBH 1E3PA 3D31A 3CCLA 1TWHA 5COYA 2G9HD 5IP7G 5F2DA 1IKMA 1NCVA 4RGTA 3DSQA 4BY1C 3UDXA 3FMCA 5EKLA 1NR4A 4C3HC 3HOVK 1YNJC 3M4OK 1HR0W 1B53A 4C3IC 5GAGC 5IGDA 1TWAA 5IY0A 4XQJA 3K0YA 5ELCA 3S15C 5KEEA 2K5HA 2GSOA 4JI6Q 5KYIA 5ELEA 1STYA 1IW7D 2AMCA 1SN8A 4C45A 2FFKB 1L1OC 5C3EG 3A32A 3M85A 1JJCA 1Y1VG 3F2BA 3K7AK 4DF7A 3IRBA 3D6CA 5FJ8H 1JCKB 3NELA 5E7NA 4DAPA 5LMUQ 4ZK9B 3L4GB 4IZ8A 1EI6A 4YRSA 4GNXC 5M3FG 4LF4L 1QE0A 4WI1A 4IUNA 2NVTB 3R07A 4IOAA 3BYYB 3REUA 5JPNC 1I6HH 1EY4A 4YRCA 3MTSA 1XZPA 4RCOA 5M5WB 2R93G 2CW0A 4IQZA 3UH0A 5C52B 4KMUA 3E3XA 3PF5A 5LMNQ 3FPUB 4CKBA 4KHPL 2VUMB 5TMFA 3I4MC 2NN6I 2WB1B 3GTPA 5E3IA 4KC6A 4P2CB 4TRDA 1CQFA 1I3QH 1P16A 1V9PA 4NXML 3K6OA 1U4RA 2RSNA 1YGBA 3VQXA 4YWKA 2F0DA 3ER0A 1WD1A 4EVOA 3PO2C 3KBXA 1WQWA 4JI1Q 4B3SQ 1II3A 1F2MA 3CC4A 3I4NG 4KN4A 1PZJD 5NUCA 1WIHA 5FLMC 4IPDA 4OELB 4GN3B 1ONLA 1LT6D 3UDFA 3L7ZC 4YCUA 3UFGA 3GQBA 4IURA 3K5NA 1OXXK 4GN4B 2PCFB 3NP8A 4PZ6A 3QWNA 3G4SA 4E6IA 3VDYA 4BBSC 2R92G 4HIDA 1KLUD 2DZCA 1ZXTA 4A3LK 3OWFA 4M8AA 4B3RL 1PYWD 3E9IA 3HKZL 2K33A 1XZQB 3RACA 2O5JA 1KDCA 2CWPA 4BS9A 1D5ZC 4JBKA 2EAYA 1XPRA 1KABA 2GN5A 5DNFA 5M3MG 2E5AA 5M5XH 1KNEA 4WRDA 3TS2A 1HXYD 2N55A 1J6WA 1CSPA 1UE7A 2NVTK 4G7OA 2KA7A 4MQ9A 4JOIC 5M5WK 2EY5A 2E2HA 2KECA 1NYRA 1HQMA 4TKOB 2E2HH 2VUMK 1FVIA 1E2WA 4HWPA 1W66A 1E1TA 2RDGA 4JC0A 2PHCB 1Q8IA 4XT3B 5C3EB 1G5HA 3EVQA 2DKGA 3HKZE 1Y1VB 3RN5A 1O7ZA 2J4XA 1EYGA 3F8TA 2NBFA 5M3FB 2ES2A 2F03A 5J39A 3IAYA 2VB3X 1CI3M 2R93B 1JJGA 1I50B 5IORA 1D7QA 4DXGA 4IO9A 3CKIB 1KL9A 1K83H 4HCSA 1B50A 1HUMA 2ZUFA 3DM3A 5I9PA 4JI4L 1AB4A 1YNNA 3PUVA 1X65A 4GFQA 1MKHA 3NWSA 4DV3Q 2K01A 2LS01 3AQOA 4NOIA 5IWAQ 3HOYH 1IHZA 1WI5A 3HY0A 1IQ0A 3PGZA 2NVYB 1FGBD 1Y69U 1OXSC 2DJZA 4HT4A 3BJUA 1DZ1A 3HOZG 2RHSB 2B63A 1GUGA 4H2WA 3PIP3 3LSQA 2DVEA 3GSIA 4A3CG 5IP7K 1EU3A 1H4VB 3V4GA 4NXNQ 3CCJA 3S1QC 5IT9c 1D5MC 2R92B 4LK0A 1LM0A 2JA8H 2D2CC 1WTWA 1K8OA 1BDFA 1HR0Q 4X66L 4J3NA 1F9SA 3CCUA 3KF6B 2KHJA 1RTNA 4JI3Q 1WCMK 1ZVUA 2JA7G 4DK1A 3ITPA 2FMMA 4IUPA 1D8LA 3N0CA 3KK7A 1WD0A 2DQ0A 5C3EK 2RF4A 4QL5A 1Y1VK 4R4OA 1WTPA 1V43A 5M3MB 1AP0A 4BXXG 3GTMH 5ELDA 5M3FK 3CRLC 2CFMA 2MHVA 1R9TK 1SXTA 1SAPA 3PO3G 2ZM6L 3H0GG 2GVBA 3S2DC 1IKLA 2R93K 3IFTA 1I50K 1U0LA 1BOSA 3DXJA 1PA6A 4R4CA 2SDFA 1KXLA 1PLFA 1Z6HA 1PMRA 2EYFA 3S9WA 3N0BA 4GTBA 5BN4A 3AH5A 5JEAH 4A3JC 2F0NA 1O2BA 1ZEQX 1IBLL 4X6AC 1HNWQ 1BBUA 1SFOC 3AQPA 3OYYA 1XMQL 1VQLA 4GLVB 2HDLA 2QHTA 1USOA 1V5VA 2NVYK 4OIRA 3RZOB 1PVOA 1DOLA 3NTIA 2EJGC 3I4NK 1TWGC 1GE9A 3WOFA 1WSVA 2UXBL 2B2WA 3EROA 1H4TA 4LW1A 3WDNA 4DV7Q 1JORA 2WAQD 3M3YK 2A6HA 1KQSA 3P8VA 1N9WA 3BUEA 4F7XA 2KWAA 3I4MG 4FM9A 3G4CA 4FF1A 2IY5B 4JYAQ 5EPKA 1I4XA 2R92K 4X65L 3CU7A 4P3NA 5C0XJ 3RZDB 4RQEA 4KHVA 4QUFA 1BNZA 1WVLA 2R7DA 3S17C 1STGA 3MXNA 1KD1C 1C4QA 1RIPA 3NQTA 3PO2G 2FQOA 3S16C 1K0SA 2PQAA 3HOZB 4KN7A 2ZUEA 1XWEA 1C7YA 2TMPA 1YJ9A 2CJAA 2NTTA 1WTVA 3V8KA 2NN6G 5IYCH 4AYBD 1EWCA 5M3MK 3FHWA 2QA4A 4FF4A 2UUCQ 1TVXA 4CH4A 3NUHA 3M7NA 1WTHA 4YFXA 1HUNA 3S0XA 2DTHA 4H2XA 3P8TA 2E5LQ 4HCEA 1PJ7A 2ID0A 2IX0A 2OQ0A 3GTJB 4WF2A 4C2MC 4XTVA 5ELNA 1UE6A 2RHQA 2JA7B 1PTOH 1HRJA 4GOPC 4A93C 1MHWC 3A31A 3I3CA 1XPOA 1BGWA 4GKKQ 4Q0FA 2L55A 2JN4A 2R7ZC 3PUXA 3EIVA 4DN4M 2CH4W 3J7YW 3FKIA 3M7GA 1KIXA 1XTCD 3MVVA 3R2TA 1F77A 1FNUA 3LX0A 4XT1B 5JVH3 5T1GA 4DV5Q 1G2SA 2NVXC 3PO3B 2F0GA 3RZOK 5HY6A 3H0GB 2RKSA 1IZ6A 3I91A 2K5DA 4ZH4A 3S15B 4TSSA 4LJZC 3HOWC 1JMCA 1HNXQ 1X32A 1A3UA 4A3IC 1YHAA 1G2TA 4JK1C 5IYBC 3VQYA 1QJOA 4YRLA 3GTQA 4R8IA 1XNQQ 1H9KA 1PFBA 3GTQH 4EQPA 4DUYQ 2G5DA 2RGRA 4RGNA 4TQUS 5I2YA 1B2TA 5AFWA 3VR4A 1WU7A 3S24A 2E76C 1TQOA 1BCPC 2QF7A 4FNFA 4F8MA 3QO8A 5TSSA 3HOZK 3PMFA 1JT8A 1KAWA 3K81C 1TS4A 2N49A 4A3CK 3I4MB 3A7AB 1GHKA 1SSOA 2I5HA 1L1OA 2VW9A 4B3ML 1EUJA 1MIUA 2E8GA 2L1BA 2KOLA 3MWYW 4ILDA 4DNRB 2A69D 4GNXA 3GTJK 2M9VA 1GUSA 4B9WA 4YHHL 2N3SA 3NHHA 1PHJA 3PO2B 2JA7K 1RL2A 1AE3A 2G9DA 5IGCA 1I6HC 1IW7A 1MJEA 4B3RQ 3CCQA 3HXAA 2KHSA 1VQEA 3EBEA 2V6TA 1RD9D 4MZ9A 2EZVA 4OO1I 4BXXK 1X54A 1IBML 1K0RA 3BZKA 4DUZL 1I3QC 1Q46A 1F2YA 3NUCA 1X01A 3K7UC 4XSZA 1X6OA 3KF8B 4IUVA 2K32A 3PO3K 3H0GK 1JOKA 1GO3E 2AQ3B 2AUJD 3ONAB 3I7FA 4AQYL 2PMEA 4LQYA 4M1XA 1DCHA 1VF7A 1L0XB 1S4ZA 2LXJA 3ICAA 3S15K 3C1FA 3MC0B 1YX2A 3J7ZC 3QJYA 4YRTA 3GTKH 3HTZA 1H4SA 2L11A 2ZXOA 4GTAA 1GUOA 4YRMA 1ESFA 3VYTA 3DHQA 5ELBA 4XTYA 4N8X1 4A3KG 1PXUA 2HUGA 4ZLTF 5J3BA 5KNCA 5EBDA 3TEHA 3HOXG 3OW2A 2PZWA 1VQ7A 3OMGA 4DV2Q 4J1MA 1FJGL 5CBAE 4IUQA 2MP1A 3NBHB 4FF3A 4RDXA 2BDOA 2DDZA 1XMOL 3TBIB 1VQPA 2JA5A 1WSRA 2E2DC 1Z7MA 4DXFA 4JI5L 4LWCA 5CORA 4NMZA 3MZ5A 3CXCA 2JA5H 1XPPA 1PRTC 5IYDG 2E2IB 5A35A 4A3JG 4PQXA 1NR2A 4A3BG 1U4LA 1F7UA 3SHLA 4AIMA 1SE3A 1JB7A 2K03A 3S2HB 2HD3A 4PABA 2XGTA 3FDTA 3K8AA 4FXGC 2JYOA 4LNSA 2HNIA 4TVAA 3F2UA 3CQZA 1D1IA 2WV6D 3GV3A 1B76A 2MUYA 2F0WA 2E2HC 3CQZH 2P5MA 4Q5SA 1S5ED 3DWPA 2K5WA 3U9SA 2A68D 5IOTA 2D0OA 5K1XA 1GVPA 4GTFA 3BP3A 5EKKA 1HZAA 3VA5A 1N36L 4G7HC 3N52A 1IBKL 2F0TA 3EFRA 4L87A 1ASYA 3EA6A 5KIXA
chains in the Genus database with same CATH topology
2Q2IA 3CCVA 2E10A 4X66Q 3W5OA 1TWCH 1E7ZA 4XEOA 3GTGH 1OXUA 4K0KQ 4YRGA 3TQYA 2NVQH 3S1RH 1Q7YC 4IOCA 3HOUG 4OX9Q 4XTZA 3Q8DA 4POFA 1IBLQ 1YITA 1Y14B 4PHCA 4C3JH 2HIVA 1S72A 3WQZA 1E22A 2YU9H 3B6YA 4OWWB 3HOWG 2UXBQ 3M9BA 5IYBG 3UDGA 1K73C 1PH7A 1WFQA 2JA6H 3KDFA 2ZZEA 2DEQA 3CC7A 4A3DG 1J5EQ 3P8YA 1VQ6A 2AKWB 1PYBA 4R1JA 3T1YQ 2VQFL 2ZZGA 1C9OA 4PMWA 3PIOA 4DR3L 2DXUA 2EJGA 4RG1A 4K86A 2C7IA 1H4QA 2ARUA 4XEMA 2HIXA 3LC0A 3GTOH 4X62L 2D62A 2KHIA 2K75A 4UPAA 4Y52H 1YHBA 4BBRG 2NZHA 1LTLA 4GOPB 1HNZQ 3J80i 4OO1G 1YHQA 1E24A 4YRQA 2DTIA 4H02A 2WB1G 2I5MX 2DUDA 3RL6A 1E1OA 4CS2A 4UP9A 3HKSA 1NJ5A 4QJFA 2Z6KC 4BWAA 2DQ3A 4IPCA 3STBD 2Q2UA 1WOCA 4HJ9A 3PIPA 1SLJA 2KCMA 3PCOA 1X3EA 3TRZA 4A3FH 3H15A 2UU9Q 4A3GG 4HIMA 3V7CA 1I94L 4POGA 3DLLA 3HOVH 1VQDA 3M4OH 2Q7HA 2YYZA 1IL2A 2AMCB 2ZCEA 2NZOA 4DK3C 3TEGA 4AH6A 1JJCB 1IBMQ 2K14A 3K7AH 2VNUD 3IALA 4AQYQ 4OXPA 1BIAA 4DR2Q 4JI0L 2WAQE 1KMMA 4WJ4A 4TTVA 1SE8A 3CMQA 4YYEA 4DR1L 2VY3A 4R4TA 3SGIA 1FJGQ 3HFZA 4DV4L 5C4XG 4DR5L 4P71C 2BA0A 3QO5A 2B63G 1XMOQ 4AYBE 1HH2P 4JI5Q 4PZ7A 4O2DA 2DXTA 3RKWA 3RNUA 1HJPA 4LUVA 4A3LH 1NNHA 1FL0A 1A8VA 3FJPA 1G6PA 4L5SA 2ZINA 4HVCA 4Q6GA 3CPWA 3G1ZA 4LNQA 1NTGA 1YNXA 1VQKA 2Q5IA 2NVTH 1L2FA 3QO7A 3RR5A 5M5WH 1VQMA 2IHEA 4IJLA 2VUMH 1H95A 3J81i 4BA2I 4K87A 2YTVA 2I5LX 1GGMA 1V1QA 3U4VA 5HGQA 1PFSA 1NE3A 4HA8A 3HRKA 1RIQA 5C44G 4DV6L 4A3MG 5IYCG 5BR8L 5JEAJ 5IP9G 5IE8A 1LYLA 4LF9L 4EO4A 4HIOA 2E1HA 5IP7H 4HWRA 3TS0A 4XU3A 2PNHA 3J7A5 3BZCA 1XNRL 1WCMH 4LFAL 4LFBL 2K4KA 2HT1A 3FKIG 4DK6C 5C3EH 1Y1VH 4R4IA 4LFCL 2QGQA 3CC2A 2VQFQ 4A76A 5M3FH 3T1HQ 1R9TH 1BBWA 1GM5A 4DR7L 2I4NA 2R93H 1I50H 1KC8C 1Z9FA 4DR4Q 3CAMA 4WJ3M 4LVMA 2UXCL 4XU2A 4BY1G 4DR6L 5C0XG 2ZTDA 4K88A 3GDEA 5FLXc 2NVYH 4YY3Q 1NJ6A 3AYHB 3I4NH 3A74A 1Q12A 3A7UA 3G48A 3M3YH 1W2BA 1JJ2A 1QZGA 4UP7A 2R92H 3UDIA 3MXNB 1XJVA 1FGUA 1WYDA 2DZ9A 2PQAB 2Q7EA 3QNEA 2EWNA 4JI2L 1VQZA 3JAMc 2EJ9A 5M3MH 3F2DA 2ODRD 4H2XB 1GD7A 1QZHA 3H3VH 2ZNIA 2ZR2A 3HXUA 2EIFA 2RHQB 2JEAI 4MNOA 4DV1L 5FLMG 1W3SA 2UXDQ 3KYHC 1KMNA 5K1PA 4OP0A 4BBSG 1NYQA 2Z6KA 3IG2A 1HZBA 4LVKA 3RIRA 3RZOH 2I4LA 3RLOA 3GO5A 4B3TL 1TWFH 2JA5G 1CKMA 3M4PA 4JG2A 2CGHA 4PG3A 2Y0SG 3W1BA 2A19A 4LF4Q 1HXDA 4DR1Q 3UGTA 4JI7L 3NENA 3HOZH 2ARTA 5H1SE 4DV4Q 4DR5Q 5AJ3L 3PZCA 1L1OB 4KHPQ 4A3CH 2G4CA 1B7YA 1N34L 4NXMQ 4GNXB 4ZTUB 1QUQA 3GTJH 4DNIA 3I55A 1C0AA 5GAHC 2JA7H 1YZ6A 2ZT6A 2F4VL 4BW9A 3HXXA 4KHZA 2UUAL 3RKXA 2ZTCA 2IX1A 1K8GA 4BXXH 2EJFA 1X3FA 1VQGA 3PO3H 3H0GH 4XTXA 1S40A 3FP9A 4P71A 1PH9A 3U4ZA 4LF6L 1S3OA 1VS0A 1YI2A 3A5ZA 4XTWA 2E64A 3TEHB 4A75A 2DGYA 4LUZA 2ZJPA 4JCVE 2CWAA 4ME3A 4OWTB 3L2ZA 4OWXB 1XTDA 2D0PA 2CIMA 1VQBA 4QGUA 1PH2A 2XTIA 1WNLA 3AQQA 4TVAB 1PYSA 1Q1BA 4JI6L 3D0FA 3CCMA 3S1MH 3U58A 3CW2C 4DV6Q 5BR8Q 1X56A 3E0EA 1GKHA 5LMUL 4JI4Q 2DU5A 1SROA 1NMGA 2F3IA 2PI2A 4P72C 1KRSA 1PV4A 12ASA 2I0QA 3ZJYC 1X9NA 1EVKA 3PV0A 4YREA 4UP8A 3JC66 4UY8C 1CSQA 1BKBA 3I2ZA 1VQJA 3A0JA 1K3RA 1VQNA 3CF5A 4LF7L 4LUOA 1ATIA 1VQAA 4P3OA 2E2IH 1Y1WH 1EVLA 2ZXFA 1NMFA 4IFDI 4KQEA 3S2HH 4X5OA 2ZM6Q 1U5KA 4L5TA 4A93G 5JJLA 2R7ZG 3KDFB 3MEYA 1UE5A 1XMQQ 4YCWA 1AE2A 1Q81C 5K36G 1A0IA 1EIFA 3KLWA 1QF6A 2PI2E 4A3IG 1Q86C 2KCTA 1CKOA 11ASA 4X65Q 4R4QA 1G5IA 4L5RC 4KI0A 3HRIA 3NEMA 1G51A 1M1KC 1KHIA 2Q5HA 4DV1Q 5JJKA 3UGQA 3JAMi 2AHOB 2V1CC 5FJ8G 4A3KH 2JQOA 3HOXH 2C35B 3H3VI 3HXVA 4KR2A 2FXQA 5GAEC 1P8LA 3A7RA 4EQ5A 2AWOA 3HKZG 1QVCA 4B3TQ 1CKNA 1B70A 4P73A 4NXNL 5IYDH 4A3BH 3BU2A 1Q8KA 2HHHL 4JI3L 4XU1A 3GTLH 4JV5L 3PCOB 1PH6A 2OCEA 3TUPA 2F52A 2ZTEA 4DAMA 4YRIA 1SRUA 1JE5A 3U50C 1N34Q 1A62A 4O0AA 4H2YA 2ZNJA 3GD7A 3RN2A 1OXTA 4GKJL 3UE0A 2E2JH 2WFWA 2C8MA 1HZCA 4B3MQ 2UUAQ 1N32L 3REXA 1EWIA 1LUZA 3STBC 3S14H 4BY7H 4YRFA 4YHHQ 1KRTA 1ADJA 4TWAA 1IXRA 2QEXA 3F2CA 1YBYA 4LF8L 4HIKA 4LF6Q 4JI8L 3MF1A 4EX5A 3HOUH 4JBWA 2CKZB 4DUZQ 3G71A 4BA1I 2K50A 1VQ4A 3HFZB 1HZ9A 4DPGA 2DU7A 1EIYA 2LSSA 2VZAA 2R6GA 4KR3A 3V8JA 1YEZA 5F5WA 1K8AC 2E5LL 1TWHH 3HOYG 1PH1A 3I56A 2RCNA 4A3DH 3VBBA 1KOGA 4GKKL 1TWAH 5C4JH 2N8NA 1J6QA 1WCMG 2MQHA 4A3EH 3ERRA 2ATWA 1I5FA 3PF4A 4TQFA 4DV5L 3LSSA 3CD6A 2JA8G 4IFDG 4ZIBA 4A4IA 3BFMA 4XU0A 1USYC 3CP0A 1HNXL 2K5VA 3V7RA 1XNQL 2YV5A 3GTPH 4DUYL 3PUWA 4L5QA 3L4GA 1N36Q 1O7IA 3L2PA 1IBKQ 2ZT8A 3MF2A 4BBRH 4LVIA 4YRPA 1NJ8A 2E65A 4X64L 2JEBI 5GROA 3RUXA 5JEAG 1PH8A 4LF7Q 4YPFA 3V7SA 4ALPA 4IFDJ 4GS3A 4P72A 4Y7NH 2ZGWA 3WWVA 4PZ8A 3RLFA 1SERA 3CCRA 3RF1A 4HWSA 4RQFA 1QVGA 2EQSA 2AWNA 2ZIOA 4A3GH 3HXYA 1YJNA 1X55A 4QQBX 4MTNA 3K0XA 3ICEA 4CH3A 4DV0L 4G85A 1UE1A 1YVCA 1VQIA 2Z0SA 1B8AA 2L15A 3TREA 4DV2L 2I4OA 2ZZFA 2EL9A 1MJCA 1G291 4DQ2A 1NBWA 3W1GA 2A1AA 3CCSA 2QHSA 3KJOA 2IT1A 1YB3A 3HXWA 2UUBL 4CS4A 5GADC 2ZT5A 2P5IA 2WB1E 1WLEA 3IKMB 4DR3Q 4YROA 1NJ1A 4CH6A 1A63A 5C4XH 2VQEL 2B63H 2NS6A 3M4QA 1ADYA 3OTOL 4X62Q 1YFRA 4QY7A 2HHHQ 2JJQA 2RHSA 4HJ7A 2QHVA 4K0KL 2I4MA 4JV5Q 2OTLA 1M90C 5ELOA 2OWOA 2N78A 3RKYA 1X2HA 3UE1A 2LXKA 1Q82C 2CCZA 3KF6A 2Q2TA 3EN2A 2YTYA 5DLQE 1YIJA 4GKJQ 4OX9L 4P73C 4IPGA 1N32Q 4P74C 4YRJA 2PMFA 2JA9A 3RGLA 5GQOA 2B29A 1I94Q 4YCVA 1SETA 1SR3A 4G84A 2A8VA 2K5NA 4LF8Q 3RLNA 2ODRC 4HJ8A 4JI8Q 4QIWE 2PMZE 3PUYA 1T9HA 2ZTGA 1J5EL 3ULLA 2ZR3A 5C44H 1UWVA 4GLAC 2VL6A 4JI0Q 4A3MH 5IP9H 2IY5A 3T1YL 1K9MC 4P75C 3NETA 1B7YB 4HWOA 3RZDH 3HY1A 3VQVA 1N33L 1QUQB 2H5XA 3MQZA 4XIGS 4YRNA 3J80c 3S1NH 2ZIMA 3LGJA 3FKIH 2ZJQA 1NJ2A 2KENA 2HQLA 4LF5L 3AEVA 1X3GA 1HNZL 1VCIA 2EXDA 3A5ZB 3L0OA 1WQ7A 1YJWA 2BH8A 1Y1WG 2ALYB 4HJ5A 1VQFA 4BY1H 4C3HH 2CQOA 2BH2A 2ARSA 4C3IH 2KBNA 2P0LA 2ASBA 3S15H 4XTCS 4X64Q 1SESA 2YTXA 1EFWA 2UU9L 2ALYA 2VS1A 4YWLA 1YFTA 1PYSB 1TXYA 1USYA 4E51A 2Q2HA 1YFSA 5EAYA 4GLXA 4JBJA 4H2VA 2J3LA 3A7AA 1UEBA 4IJHA 3I4MH 4HJAA 1OXVA 2JA6G 3IKLA 1EOVA 4ZTZB 3KFUA 4DR2L 2WP8J 3PO2H 4H2SA 4YWMA 2OTJA 3CMAA 2B3GA 5FLMH 4DV0Q 4J15A 1AH9A 3CMEA 1HTTA 2K52A 1NY4A 3ULJA 4LF9Q 3L1AA 4BBSH 3VQWA 2MFIA 3AFPA 1PH5A 2A8EA 4DAYB 5LMNL 1EQQA 1XNRQ 4LFAQ 4LFBQ 4JBMA 4NB3A 3A5YA 1PH3A 4TVYA 2UUBQ 4LFCQ 2DTOA 4KLKA 1WJJA 4JI1L 1Q1EA 4JOIA 3J81j 4B3SL 2WAQG 3W3SA 4DR7Q 4CH5A 4RMFA 2VQEQ 2J3MA 4LVLA 2P8TA 5C53B 3OTOQ 4NPSA 1VQCA 2UXCQ 1IYJB 4DR6Q 4TQDA 3J81c 2E3CA 3K80C 1X2GA 2MO0A 3A5UA 2MNAA 4NCXA 4AYBG 3CCEA 3ERSX 2BA1A 1Z47A 4FDBA 4A3FG 3I4OA 4H2UA 1CUKA 2MO1A 3V8LA 4YRKA 3CPFA 4DKAC 4BY7G 1VQ9A 3HOVG 4H2TA 2JK8A 5JJIA 5KNNA 4JI2Q 1SMXA 2CJ9A 2JE6I 3KJPA 4P3PA 3S1QH 2Y0SE 1OTCA 4YRRA 1QVFA 3E9HA 2ZT7A 1Z7NA 2FYKA 4HWTA 5LMNW 1CKNB 1B70B 4CS3A 2CJBA 4DV3L 5IWAL 4XTUA 5C51B 1L0WA 3ULPA 2D6FC 3AFQA 3S2DH 4A3EG 1BVSA 1DGSA 1PH4A 3QTCA 4A3JH 4X6AH 1SFOH 1HR0L 1BIBA 3T1HL 4P74A 2QHUA 1J5WA 1N33Q 1TWGH 4A3LG 4JI7Q 3HXZA 2AKWA 4IPHA 4DR4L 5AJ3Q 1ASZA 3PSIA 4APVA 2GVAA 4YDQA 4LF5Q 3S17H 5M5YH 4YY3L 1FYFA 3G6EA 3S16H 4YP0A 1VQ8A 1NJIC 1EQRA 1VQOA 2F4VQ 2VUMG 3PUZA 1HNWL 1HC7A 4P75A 2Q7GA 4TVWA 2OQKA 1N8RC 3OD1A 4C2MH 2ZJRA 2IHFA 4DV7L 4GOPA 3F1ZA 4LVJA 3MEFA 4A93H 1EIYB 4Q15A 1XPUA 2R7ZH 4JYAL 1WPYA 2E41A 1VQHA 3EFSA 1SRYA 4OLFA 2NVXH 5C0XI 4GN5A 2R7FA 2UXDL 4OONA 3HOWH 4A3IH 1ZQ1C 2UUCL 3KOJA 3HFVA 1VQ5A 5IYBH 1E3PA 3D31A 3CCLA 5IP7G 3DSQA 3UDXA 1HR0W 5GAGC 5IY0A 2K5HA 4JI6Q 2AMCA 1SN8A 1L1OC 5C3EG 3A32A 3M85A 1JJCA 1Y1VG 3F2BA 3IRBA 5FJ8H 3NELA 5E7NA 5LMUQ 3L4GB 4YRSA 4GNXC 5M3FG 4LF4L 1QE0A 4WI1A 3R07A 4IOAA 3REUA 1I6HH 4YRCA 2R93G 3UH0A 5C52B 3PF5A 5LMNQ 4KHPL 2NN6I 5E3IA 1I3QH 1P16A 1V9PA 4NXML 3VQXA 1YGBA 4YWKA 3ER0A 1WQWA 4JI1Q 4B3SQ 3CC4A 3I4NG 4IPDA 4GN3B 3UDFA 3L7ZC 4YCUA 3UFGA 1OXXK 4GN4B 4PZ6A 3VDYA 3G4SA 2R92G 4HIDA 2DZCA 4B3RL 3E9IA 3RACA 2CWPA 4JBKA 2EAYA 1XPRA 2GN5A 2E5AA 5M3MG 5M5XH 3TS2A 1CSPA 1UE7A 4JOIC 1NYRA 2E2HH 1FVIA 4HWPA 1W66A 1E1TA 4JC0A 2DKGA 1G5HA 3HKZE 3RN5A 1EYGA 3F8TA 2ES2A 1JJGA 1D7QA 4IO9A 1KL9A 1K83H 3DM3A 4JI4L 3PUVA 1X65A 1MKHA 4DV3Q 5IWAQ 3HOYH 1WI5A 3HY0A 3PGZA 4HT4A 1OXSC 2DJZA 3BJUA 3HOZG 2RHSB 4H2WA 3LSQA 2DVEA 4A3CG 1H4VB 4NXNQ 3CCJA 5IT9c 1LM0A 2JA8H 1HR0Q 4X66L 3CCUA 3KF6B 2KHJA 4JI3Q 2JA7G 1D8LA 2DQ0A 2RF4A 4QL5A 4R4OA 1V43A 4BXXG 3GTMH 2CFMA 3PO3G 2ZM6L 3H0GG 2GVBA 1U0LA 1PA6A 4R4CA 1KXLA 1IBLL 1HNWQ 1BBUA 3OYYA 1XMQL 1VQLA 4GLVB 2QHTA 1PVOA 2UXBL 1H4TA 4LW1A 4DV7Q 1KQSA 3P8VA 1N9WA 3I4MG 2IY5B 4JYAQ 4X65L 4P3NA 5C0XJ 4RQEA 2R7DA 1KD1C 1RIPA 3PO2G 2PQAA 1C7YA 1YJ9A 2CJAA 3V8KA 2NN6G 5IYCH 3FHWA 2QA4A 2UUCQ 4CH4A 3M7NA 2DTHA 4H2XA 3P8TA 2E5LQ 2ID0A 2IX0A 2OQ0A 4WF2A 4XTVA 5ELNA 1UE6A 2RHQA 4GOPC 3A31A 1XPOA 4GKKQ 3PUXA 3EIVA 1KIXA 4DV5Q 5HY6A 1IZ6A 1JMCA 1HNXQ 1YHAA 3VQYA 4YRLA 1XNQQ 3GTQH 4DUYQ 4TQUS 1WU7A 3S24A 3QO8A 1JT8A 1KAWA 3K81C 2N49A 2I5HA 1L1OA 2VW9A 4B3ML 1EUJA 1MIUA 2E8GA 4GNXA 4YHHL 2N3SA 1PHJA 1RL2A 1AE3A 1MJEA 4B3RQ 3CCQA 1VQEA 3EBEA 4MZ9A 4OO1I 1X54A 1IBML 1K0RA 3BZKA 4DUZL 1Q46A 1X01A 3K7UC 1X6OA 3KF8B 1GO3E 4AQYL 3I7FA 2PMEA 2LXJA 3ICAA 3J7ZC 4YRTA 3GTKH 3HTZA 1H4SA 4YRMA 4XTYA 4A3KG 5J3BA 3TEHA 3HOXG 3OW2A 1VQ7A 4DV2Q 1FJGL 3NBHB 4RDXA 2DDZA 1XMOL 1VQPA 1Z7MA 4JI5L 4LWCA 3CXCA 2JA5H 5IYDG 4A3JG 4A3BG 4AIMA 1JB7A 2XGTA 3K8AA 4LNSA 4TVAA 2HNIA 1B76A 3CQZH 2D0OA 5K1XA 1GVPA 1HZAA 1N36L 1IBKL 4L87A 3EFRA 1ASYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2I A;  3CCV A;  2E10 A;  4X66 Q;  3W5O A;  1TWC H;  1E7Z A;  4XEO A;  3GTG H;  1OXU A;  4K0K Q;  4YRG A;  3TQY A;  2NVQ H;  3S1R H;  1Q7Y C;  4IOC A;  3HOU G;  4OX9 Q;  4XTZ A;  3Q8D A;  4POF A;  1IBL Q;  1YIT A;  1Y14 B;  4PHC A;  4C3J H;  2HIV A;  1S72 A;  3WQZ A;  1E22 A;  2YU9 H;  3B6Y A;  4OWW B;  3HOW G;  2UXB Q;  3M9B A;  5IYB G;  3UDG A;  1K73 C;  1PH7 A;  1WFQ A;  2JA6 H;  3KDF A;  2ZZE A;  2DEQ A;  3CC7 A;  4A3D G;  1J5E Q;  3P8Y A;  1VQ6 A;  2AKW B;  1PYB A;  4R1J A;  3T1Y Q;  2VQF L;  2ZZG A;  1C9O A;  4PMW A;  3PIO A;  4DR3 L;  2DXU A;  2EJG A;  4RG1 A;  4K86 A;  2C7I A;  1H4Q A;  2ARU A;  4XEM A;  2HIX A;  3LC0 A;  3GTO H;  4X62 L;  2D62 A;  2KHI A;  2K75 A;  4UPA A;  4Y52 H;  1YHB A;  4BBR G;  2NZH A;  1LTL A;  4GOP B;  1HNZ Q;  3J80 i;  4OO1 G;  1YHQ A;  1E24 A;  4YRQ A;  2DTI A;  4H02 A;  2WB1 G;  2I5M X;  2DUD A;  3RL6 A;  1E1O A;  4CS2 A;  4UP9 A;  3HKS A;  1NJ5 A;  4QJF A;  2Z6K C;  4BWA A;  2DQ3 A;  4IPC A;  3STB D;  2Q2U A;  1WOC A;  4HJ9 A;  3PIP A;  1SLJ A;  2KCM A;  3PCO A;  1X3E A;  3TRZ A;  4A3F H;  3H15 A;  2UU9 Q;  4A3G G;  4HIM A;  3V7C A;  1I94 L;  4POG A;  3DLL A;  3HOV H;  1VQD A;  3M4O H;  2Q7H A;  2YYZ A;  1IL2 A;  2AMC B;  2ZCE A;  2NZO A;  4DK3 C;  3TEG A;  4AH6 A;  1JJC B;  1IBM Q;  2K14 A;  3K7A H;  2VNU D;  3IAL A;  4AQY Q;  4OXP A;  1BIA A;  4DR2 Q;  4JI0 L;  2WAQ E;  1KMM A;  4WJ4 A;  4TTV A;  1SE8 A;  3CMQ A;  4YYE A;  4DR1 L;  2VY3 A;  4R4T A;  3SGI A;  1FJG Q;  3HFZ A;  4DV4 L;  5C4X G;  4DR5 L;  4P71 C;  2BA0 A;  3QO5 A;  2B63 G;  1XMO Q;  4AYB E;  1HH2 P;  4JI5 Q;  4PZ7 A;  4O2D A;  2DXT A;  3RKW A;  3RNU A;  1HJP A;  4LUV A;  4A3L H;  1NNH A;  1FL0 A;  1A8V A;  3FJP A;  1G6P A;  4L5S A;  2ZIN A;  4HVC A;  4Q6G A;  3CPW A;  3G1Z A;  4LNQ A;  1NTG A;  1YNX A;  1VQK A;  2Q5I A;  2NVT H;  1L2F A;  3QO7 A;  3RR5 A;  5M5W H;  1VQM A;  2IHE A;  4IJL A;  2VUM H;  1H95 A;  3J81 i;  4BA2 I;  4K87 A;  2YTV A;  2I5L X;  1GGM A;  1V1Q A;  3U4V A;  5HGQ A;  1PFS A;  1NE3 A;  4HA8 A;  3HRK A;  1RIQ A;  5C44 G;  4DV6 L;  4A3M G;  5IYC G;  5BR8 L;  5JEA J;  5IP9 G;  5IE8 A;  1LYL A;  4LF9 L;  4EO4 A;  4HIO A;  2E1H A;  5IP7 H;  4HWR A;  3TS0 A;  4XU3 A;  2PNH A;  3J7A 5;  3BZC A;  1XNR L;  1WCM H;  4LFA L;  4LFB L;  2K4K A;  2HT1 A;  3FKI G;  4DK6 C;  5C3E H;  1Y1V H;  4R4I A;  4LFC L;  2QGQ A;  3CC2 A;  2VQF Q;  4A76 A;  5M3F H;  3T1H Q;  1R9T H;  1BBW A;  1GM5 A;  4DR7 L;  2I4N A;  2R93 H;  1I50 H;  1KC8 C;  1Z9F A;  4DR4 Q;  3CAM A;  4WJ3 M;  2UXC L;  4XU2 A;  4BY1 G;  4DR6 L;  5C0X G;  2ZTD A;  4K88 A;  3GDE A;  5FLX c;  2NVY H;  4YY3 Q;  1NJ6 A;  3AYH B;  3I4N H;  3A74 A;  1Q12 A;  3A7U A;  3G48 A;  3M3Y H;  1W2B A;  1JJ2 A;  1QZG A;  4UP7 A;  2R92 H;  3UDI A;  3MXN B;  1XJV A;  1FGU A;  1WYD A;  2DZ9 A;  2PQA B;  2Q7E A;  3QNE A;  2EWN A;  4JI2 L;  1VQZ A;  3JAM c;  2EJ9 A;  5M3M H;  3F2D A;  2ODR D;  4H2X B;  1GD7 A;  1QZH A;  3H3V H;  2ZNI A;  2ZR2 A;  3HXU A;  2EIF A;  2RHQ B;  2JEA I;  4MNO A;  4DV1 L;  5FLM G;  1W3S A;  2UXD Q;  3KYH C;  1KMN A;  5K1P A;  4OP0 A;  4BBS G;  1NYQ A;  2Z6K A;  3IG2 A;  1HZB A;  3RIR A;  3RZO H;  2I4L A;  3RLO A;  3GO5 A;  4B3T L;  1TWF H;  2JA5 G;  1CKM A;  3M4P A;  4JG2 A;  2CGH A;  4PG3 A;  2Y0S G;  3W1B A;  2A19 A;  4LF4 Q;  1HXD A;  4DR1 Q;  3UGT A;  4JI7 L;  3NEN A;  3HOZ H;  2ART A;  5H1S E;  4DV4 Q;  4DR5 Q;  5AJ3 L;  3PZC A;  1L1O B;  4KHP Q;  4A3C H;  2G4C A;  1B7Y A;  1N34 L;  4NXM Q;  4GNX B;  4ZTU B;  1QUQ A;  3GTJ H;  4DNI A;  3I55 A;  1C0A A;  5GAH C;  2JA7 H;  1YZ6 A;  2ZT6 A;  2F4V L;  4BW9 A;  3HXX A;  4KHZ A;  2UUA L;  3RKX A;  2ZTC A;  2IX1 A;  1K8G A;  4BXX H;  2EJF A;  1X3F A;  1VQG A;  3PO3 H;  3H0G H;  4XTX A;  1S40 A;  3FP9 A;  4P71 A;  1PH9 A;  3U4Z A;  4LF6 L;  1S3O A;  1VS0 A;  1YI2 A;  3A5Z A;  4XTW A;  2E64 A;  3TEH B;  4A75 A;  2DGY A;  4LUZ A;  2ZJP A;  4JCV E;  2CWA A;  4ME3 A;  4OWT B;  3L2Z A;  4OWX B;  1XTD A;  2D0P A;  2CIM A;  1VQB A;  4QGU A;  1PH2 A;  2XTI A;  1WNL A;  3AQQ A;  4TVA B;  1PYS A;  1Q1B A;  4JI6 L;  3D0F A;  3CCM A;  3S1M H;  3U58 A;  3CW2 C;  4DV6 Q;  5BR8 Q;  1X56 A;  3E0E A;  1GKH A;  5LMU L;  4JI4 Q;  2DU5 A;  1SRO A;  1NMG A;  2F3I A;  2PI2 A;  4P72 C;  1KRS A;  1PV4 A;  12AS A;  2I0Q A;  3ZJY C;  1X9N A;  1EVK A;  3PV0 A;  4YRE A;  4UP8 A;  3JC6 6;  4UY8 C;  1CSQ A;  1BKB A;  3I2Z A;  1VQJ A;  3A0J A;  1K3R A;  1VQN A;  3CF5 A;  4LF7 L;  4LUO A;  1ATI A;  1VQA A;  4P3O A;  2E2I H;  1Y1W H;  1EVL A;  2ZXF A;  1NMF A;  4IFD I;  4KQE A;  3S2H H;  4X5O A;  2ZM6 Q;  1U5K A;  4L5T A;  4A93 G;  5JJL A;  2R7Z G;  3KDF B;  3MEY A;  1UE5 A;  1XMQ Q;  4YCW A;  1AE2 A;  1Q81 C;  5K36 G;  1A0I A;  1EIF A;  3KLW A;  1QF6 A;  2PI2 E;  4A3I G;  1Q86 C;  2KCT A;  1CKO A;  11AS A;  4X65 Q;  4R4Q A;  1G5I A;  4L5R C;  4KI0 A;  3HRI A;  3NEM A;  1G51 A;  1M1K C;  1KHI A;  2Q5H A;  4DV1 Q;  5JJK A;  3UGQ A;  3JAM i;  2AHO B;  2V1C C;  5FJ8 G;  4A3K H;  2JQO A;  3HOX H;  2C35 B;  3H3V I;  3HXV A;  4KR2 A;  2FXQ A;  5GAE C;  1P8L A;  3A7R A;  4EQ5 A;  2AWO A;  3HKZ G;  1QVC A;  4B3T Q;  1CKN A;  1B70 A;  4P73 A;  4NXN L;  5IYD H;  4A3B H;  3BU2 A;  1Q8K A;  2HHH L;  4JI3 L;  4XU1 A;  3GTL H;  4JV5 L;  3PCO B;  1PH6 A;  2OCE A;  3TUP A;  2F52 A;  2ZTE A;  4DAM A;  4YRI A;  1SRU A;  1JE5 A;  3U50 C;  1N34 Q;  1A62 A;  4O0A A;  4H2Y A;  2ZNJ A;  3GD7 A;  3RN2 A;  1OXT A;  4GKJ L;  3UE0 A;  2E2J H;  2WFW A;  2C8M A;  1HZC A;  4B3M Q;  2UUA Q;  1N32 L;  3REX A;  1EWI A;  1LUZ A;  3STB C;  3S14 H;  4BY7 H;  4YRF A;  4YHH Q;  1KRT A;  1ADJ A;  4TWA A;  1IXR A;  2QEX A;  3F2C A;  1YBY A;  4LF8 L;  4HIK A;  4LF6 Q;  4JI8 L;  3MF1 A;  4EX5 A;  3HOU H;  4JBW A;  2CKZ B;  4DUZ Q;  3G71 A;  4BA1 I;  2K50 A;  1VQ4 A;  3HFZ B;  1HZ9 A;  4DPG A;  2DU7 A;  1EIY A;  2LSS A;  2VZA A;  2R6G A;  4KR3 A;  3V8J A;  1YEZ A;  5F5W A;  1K8A C;  2E5L L;  1TWH H;  3HOY G;  1PH1 A;  3I56 A;  2RCN A;  4A3D H;  3VBB A;  1KOG A;  4GKK L;  1TWA H;  5C4J H;  2N8N A;  1J6Q A;  1WCM G;  2MQH A;  4A3E H;  3ERR A;  2ATW A;  1I5F A;  3PF4 A;  4TQF A;  4DV5 L;  3LSS A;  3CD6 A;  2JA8 G;  4IFD G;  4ZIB A;  4A4I A;  3BFM A;  4XU0 A;  1USY C;  3CP0 A;  1HNX L;  2K5V A;  3V7R A;  1XNQ L;  2YV5 A;  3GTP H;  4DUY L;  3PUW A;  4L5Q A;  3L4G A;  1N36 Q;  1O7I A;  3L2P A;  1IBK Q;  2ZT8 A;  3MF2 A;  4BBR H;  4YRP A;  1NJ8 A;  2E65 A;  4X64 L;  2JEB I;  5GRO A;  3RUX A;  5JEA G;  1PH8 A;  4LF7 Q;  4YPF A;  3V7S A;  4ALP A;  4IFD J;  4GS3 A;  4P72 A;  4Y7N H;  2ZGW A;  3WWV A;  4PZ8 A;  3RLF A;  1SER A;  3CCR A;  3RF1 A;  4HWS A;  4RQF A;  1QVG A;  2EQS A;  2AWN A;  2ZIO A;  4A3G H;  3HXY A;  1YJN A;  1X55 A;  4QQB X;  4MTN A;  3K0X A;  3ICE A;  4CH3 A;  4DV0 L;  4G85 A;  1UE1 A;  1YVC A;  1VQI A;  2Z0S A;  1B8A A;  2L15 A;  3TRE A;  4DV2 L;  2I4O A;  2ZZF A;  2EL9 A;  1MJC A;  1G29 1;  4DQ2 A;  1NBW A;  3W1G A;  2A1A A;  3CCS A;  2QHS A;  3KJO A;  2IT1 A;  1YB3 A;  3HXW A;  2UUB L;  4CS4 A;  5GAD C;  2ZT5 A;  2P5I A;  2WB1 E;  1WLE A;  3IKM B;  4DR3 Q;  4YRO A;  1NJ1 A;  4CH6 A;  1A63 A;  5C4X H;  2VQE L;  2B63 H;  3M4Q A;  1ADY A;  3OTO L;  4X62 Q;  1YFR A;  4QY7 A;  2HHH Q;  2JJQ A;  2RHS A;  4HJ7 A;  2QHV A;  4K0K L;  2I4M A;  4JV5 Q;  2OTL A;  1M90 C;  5ELO A;  2OWO A;  2N78 A;  3RKY A;  1X2H A;  3UE1 A;  2LXK A;  1Q82 C;  2CCZ A;  3KF6 A;  2Q2T A;  3EN2 A;  2YTY A;  5DLQ E;  1YIJ A;  4GKJ Q;  4OX9 L;  4P73 C;  4IPG A;  1N32 Q;  4P74 C;  4YRJ A;  2PMF A;  2JA9 A;  3RGL A;  5GQO A;  2B29 A;  1I94 Q;  4YCV A;  1SET A;  1SR3 A;  4G84 A;  2A8V A;  2K5N A;  4LF8 Q;  3RLN A;  2ODR C;  4HJ8 A;  4JI8 Q;  4QIW E;  2PMZ E;  3PUY A;  1T9H A;  2ZTG A;  1J5E L;  3ULL A;  2ZR3 A;  5C44 H;  1UWV A;  4GLA C;  2VL6 A;  4JI0 Q;  4A3M H;  5IP9 H;  2IY5 A;  3T1Y L;  1K9M C;  4P75 C;  3NET A;  1B7Y B;  4HWO A;  3RZD H;  3HY1 A;  3VQV A;  1N33 L;  1QUQ B;  2H5X A;  4XIG S;  4YRN A;  3J80 c;  3S1N H;  2ZIM A;  3LGJ A;  3FKI H;  2ZJQ A;  1NJ2 A;  2KEN A;  2HQL A;  4LF5 L;  3AEV A;  1X3G A;  1HNZ L;  1VCI A;  2EXD A;  3A5Z B;  3L0O A;  1WQ7 A;  1YJW A;  2BH8 A;  1Y1W G;  2ALY B;  4HJ5 A;  1VQF A;  4BY1 H;  4C3H H;  2CQO A;  2BH2 A;  2ARS A;  4C3I H;  2KBN A;  2P0L A;  2ASB A;  3S15 H;  4XTC S;  4X64 Q;  1SES A;  2YTX A;  1EFW A;  2UU9 L;  2ALY A;  2VS1 A;  4YWL A;  1YFT A;  1PYS B;  1TXY A;  1USY A;  4E51 A;  2Q2H A;  1YFS A;  5EAY A;  4GLX A;  4JBJ A;  4H2V A;  2J3L A;  3A7A A;  1UEB A;  4IJH A;  3I4M H;  4HJA A;  1OXV A;  2JA6 G;  3IKL A;  1EOV A;  4ZTZ B;  3KFU A;  4DR2 L;  2WP8 J;  3PO2 H;  4H2S A;  4YWM A;  2OTJ A;  3CMA A;  2B3G A;  5FLM H;  4DV0 Q;  4J15 A;  1AH9 A;  3CME A;  1HTT A;  2K52 A;  1NY4 A;  3ULJ A;  4LF9 Q;  3L1A A;  4BBS H;  3VQW A;  2MFI A;  3AFP A;  1PH5 A;  4DAY B;  5LMN L;  1EQQ A;  1XNR Q;  4LFA Q;  4LFB Q;  4JBM A;  4NB3 A;  3A5Y A;  1PH3 A;  4TVY A;  2UUB Q;  4LFC Q;  2DTO A;  4KLK A;  1WJJ A;  4JI1 L;  1Q1E A;  4JOI A;  3J81 j;  4B3S L;  2WAQ G;  3W3S A;  4DR7 Q;  4CH5 A;  4RMF A;  2VQE Q;  2J3M A;  2P8T A;  5C53 B;  3OTO Q;  4NPS A;  1VQC A;  2UXC Q;  1IYJ B;  4DR6 Q;  4TQD A;  3J81 c;  2E3C A;  3K80 C;  1X2G A;  2MO0 A;  3A5U A;  2MNA A;  4NCX A;  4AYB G;  3CCE A;  3ERS X;  2BA1 A;  1Z47 A;  4FDB A;  4A3F G;  3I4O A;  4H2U A;  1CUK A;  2MO1 A;  3V8L A;  4YRK A;  3CPF A;  4DKA C;  4BY7 G;