4AH6A

Human mitochondrial aspartyl-trna synthetase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
589
structure length
589
Chain Sequence
PEFSSFVVRTNTCGELRSSHLGQEVTLCGWIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Thermodynamic Properties Distinguish Human Mitochondrial Aspartyl-tRNA Synthetase from Bacterial Homolog with Same 3D Architecture
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords ASPARTATE--TRNA LIGASE, MITOCHONDRIAL
total genus 117
structure length 589
sequence length 589
chains with identical sequence B, C, D
ec nomenclature ec 6.1.1.12: Aspartate--tRNA ligase.
pdb deposition date 2012-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N)
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
A PF02938 GAD GAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ah6A01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4ah6A02
3.30.1360.30 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 GAD-like domain 4ah6A03
2K4KA 4XU2A 3HY0A 4JV5L 2HIVA 4BBRG 2PI2A 2VNUD 3W5OA 2WAQG 2UUBL 4LFBL 1D8LA 2NVTH 2XTIA 3S2DH 4IJLA 1JMCA 3EIVA 1NMFA 4YY3L 3T1HQ 1L1OA 1J5EL 1VQBA 3HOWH 4DK6C 4DR4L 1SRYA 1UEBA 2B63H 1X01A 2VZAA 1L1OB 3M85A 2VUMG 3MF1A 4IPDA 5F5WA 4DR6Q 2ZJQA 2OWOA 3V8LA 4C3HH 2ZT5A 3G1ZA 1PYSA 3V7RA 4B3RQ 3I4OA 3CCSA 2P5IA 1WPYA 4LF5L 3PCOB 4APVA 4OX9L 2ZZGA 2ZXFA 1HR0Q 2UXBQ 2MO1A 3RLNA 1Z9FA 1VQGA 3CP0A 3A74A 3S14H 3B6YA 4R1JA 4A3CG 4HJ5A 4GKKL 1YB3A 5LMNL 2F52A 3HFVA 2EJFA 2AMCA 2I5LX 3K7UC 2ZZFA 2DUDA 2DKGA 3PO3G 1R9TH 5C44G 3STBD 2IY5A 3KDFA 5C4XH 4JI7L 4A4IA 1Q1BA 4O0AA 4BBSG 1IBML 2E41A 1QF6A 4A3MG 2HQLA 2E1HA 1HNZL 1N9WA 1CKOA 4UP9A 2IY5B 1XPRA 4WJ3M 4OO1G 1J6QA 1SLJA 3M4PA 1X9NA 3I4MG 1B70B 1L1OC 2E8GA 4A3MH 3BU2A 3S1MH 1YFRA 4L87A 1NNHA 2CJ9A 2DDZA 4AQYQ 1X2GA 4LWCA 2KHIA 1S72A 3S2HH 1C7YA 4A3EH 5K1XA 1WU7A 3I2ZA 1YEZA 3RLFA 3NELA 1PH7A 2Q2UA 1BBWA 2R93G 1IL2A 1GM5A 1TWFH 1KMMA 1SN8A 4UP8A 1B8AA 4LFCL 1SROA 2V1CC 2PQAA 3I55A 2JEAI 1EIYA 1GGMA 3OYYA 3V8JA 5LMUL 3CMAA 5C52B 2RHQB 3VQVA 2A1AA 4DNIA 3H3VI 1HJPA 4OX9Q 1G51A 4X64Q 2YTYA 4GLAC 3T1YQ 1XNQL 3TREA 4HVCA 1E7ZA 1HZBA 4QY7A 3VQYA 2C35B 4DR3Q 4JBKA 3A31A 4OONA 2LXKA 2OCEA 4BBRH 5M5YH 3HY1A 3KJPA 5LMUQ 2CWAA 1C9OA 1VQOA 1KC8C 2ODRC 3A5ZB 1Q1EA 2CQOA 1HZ9A 2R92G 1S3OA 2QHUA 4MTNA 3GO5A 2JA7H 3A5ZA 4XIGS 2ARUA 4YRJA 1VQNA 4TVAB 3CPFA 1BIAA 4DV3Q 3U50C 4RDXA 5JJLA 1LYLA 4TQDA 4KI0A 4OO1I 2GN5A 2ZM6L 3L4GB 4TQFA 3PIOA 3LGJA 2AMCB 1JJCB 3PUYA 3F1ZA 3KFUA 5IYDG 2JA5H 4HIOA 1E1TA 1KRTA 2CJAA 1B7YB 4LUOA 1K8GA 2EJGA 2ZM6Q 3CC4A 1XNRQ 1USYC 4LW1A 2JA5G 1E22A 3CMQA 2BH8A 4DKAC 3RUXA 1EVLA 1J5EQ 5IT9c 2ZTEA 1WJJA 4DR2L 3RKXA 3HFZB 1JE5A 5H1SE 4JI8L 3S15H 2E10A 4IFDJ 2Q2HA 1VQAA 4P3NA 3S17H 1KRSA 5IY0A 3P8TA 1HH2P 2UUAL 2UUAQ 4YRFA 5IP9H 4DV4L 4YRIA 3STBC 4X5OA 2N49A 4DUYL 4NB3A 4YYEA 3QO7A 4A3LH 4A76A 2F4VQ 4HWOA 4DR7L 3Q8DA 1OXUA 5E3IA 1WYDA 1YJNA 3HOXG 3TS0A 2ZCEA 2EL9A 3A5UA 2ZIOA 2WB1E 4HIDA 3M9BA 2Z6KA 3UDIA 3W3SA 3PUZA 5C0XG 2MFIA 3UH0A 2Y0SE 2CFMA 4YRTA 3RR5A 3EBEA 1EQQA 4XU3A 1I50H 1YHQA 1NMGA 4BXXH 3DLLA 2DU7A 1KIXA 1HXDA 1V9PA 2I4LA 4YRLA 1EWIA 3TEHB 1OXVA 4RQEA 1Y1WH 1H4TA 4H2WA 4JI2Q 1H95A 2UUCL 4K88A 3F8TA 1YJ9A 4YRMA 3ERSX 4A3KH 1Q46A 4DAMA 4MZ9A 3NENA 2E65A 1NJ8A 3FJPA 4JI5Q 4OWWB 2ZR2A 3K0XA 3QO8A 4H2VA 3OTOL 3I4MH 2ZJRA 3G6EA 1PYBA 3HOZG 1X6OA 5M3MH 3DSQA 1BKBA 1MIUA 3GTGH 3W1GA 1NJ5A 4O2DA 4DV5Q 4BW9A 3CCVA 3HOVG 1PH3A 5C4XG 4TVAA 1VQHA 3S24A 4AYBE 4PZ7A 1EFWA 3L4GA 1JT8A 3V7SA 3OW2A 2FXQA 1VQKA 4J15A 2ZNIA 2EQSA 4A3GH 1VQ5A 4UPAA 4P71A 3RNUA 3CQZH 2CJBA 3MXNB 4BBSH 1EIYB 2E64A 1OXTA 1N32Q 4R4OA 3CC2A 4CS2A 4YCVA 4IJHA 1EVKA 3F2BA 2NZHA 1J5WA 3RF1A 4KQEA 2YTXA 2E3CA 3CCMA 3AQQA 4GLVB 3AEVA 3S1QH 1KQSA 1UWVA 2JQOA 1UE1A 2ES2A 2DEQA 2I5HA 2JA6H 2ZZEA 1PH8A 4XTCS 1Q81C 4JI7Q 1LTLA 1VQCA 1VCIA 3M3YH 2QHVA 4H2YA 4YRSA 2UXCL 1HNWL 2GVAA 2KCMA 2J3LA 3A7UA 2VW9A 4LFAL 2L15A 5LMNQ 4FDBA 4JI6L 4KLKA 1SFOH 4CH5A 3RLOA 4JI3L 4NXML 1HZAA 3KF6B 4B3TL 3A0JA 2JEBI 4DV4Q 5ELOA 2UXDQ 2AHOB 4DAYB 2A19A 1I94L 1O7IA 5C0XI 1P8LA 4JI4Q 5GQOA 4YRQA 2ARSA 5BR8Q 4DV1Q 3L1AA 1E1OA 1HR0L 2UXBL 3RN2A 4NXMQ 2QA4A 1U5KA 2DU5A 4P73A 5M5XH 4JBMA 5IP7G 2ZR3A 3I4NG 1WI5A 4LF4Q 4DUYQ 4LUVA 5M3FH 1VQ9A 2G4CA 3AFPA 2ASBA 1Z47A 3PIPA 3HXVA 4K0KL 1IXRA 2IHFA 5M3FG 1Y14B 1WLEA 4K87A 1X3GA 4H2XA 4A3DG 3AYHB 4X66Q 3I4NH 1G291 4NXNQ 4YHHQ 4IFDG 3VQXA 2VQFL 3A32A 1OXXK 2I4NA 1ZQ1C 4GLXA 4LF9Q 2R6GA 1VQPA 3IALA 2ZIMA 1HC7A 2ZGWA 2DZCA 5C0XJ 1CUKA 4GOPC 4A93G 3TQYA 2BA0A 3ULLA 4C2MH 2KENA 3OTOQ 2ZT7A 1K3RA 5C51B 4HJ7A 3UGQA 1WCMG 4P73C 1K8AC 3CAMA 3HTZA 1QVFA 4LF9L 4BXXG 1WNLA 3ICAA 1X3EA 1CKMA 1YFTA 4R4TA 4YP0A 4YROA 2DTIA 4A3IH 4LNSA 4P74C 4DV2L 2PQAB 3HOYG 3KYHC 2DTOA 4HA8A 1N36Q 1QE0A 1D7QA 2HHHQ 2Z0SA 3HOXH 1IBMQ 3BZKA 1JB7A 2FYKA 2QHSA 1MKHA 3CCQA 4OWXB 3KF6A 3CW2C 4GNXC 4DPGA 4A3LG 2OQKA 4B3ML 1CKNB 3KLWA 4ZTZB 1QVCA 3JAMi 1PVOA 4X65L 1K73C 1PYSB 1CKNA 4YPFA 3DM3A 2PMZE 4LUZA 4XEOA 2JK8A 4LF6L 3HXXA 4YWLA 2Q2IA 4GN3B 5GAHC 4R4QA 1Z7NA 4A3GG 2DXUA 1KAWA 4A3FG 1JJ2A 4B3SQ 4DQ2A 2QGQA 4TTVA 4R4IA 3PF5A 1NBWA 4CS3A 5GAGC 1AE2A 3A7RA 3HOUG 2IHEA 5IYDH 2Q7GA 4QL5A 4P72C 4IOCA 4L5TA 4H02A 4WJ4A 4Q6GA 2ZINA 4PHCA 3HKSA 1N33Q 1HR0W 4JI3Q 4BY1G 3UGTA 2NN6I 3IRBA 1NYRA 3HOZH 3J81i 11ASA 4LF4L 3U4VA 3GTLH 2WFWA 1W3SA 3G48A 1X65A 4Y52H 1B70A 2K50A 4DR4Q 4DR2Q 2A8VA 4A75A 4GS3A 1I3QH 3I7FA 2ODRD 5K1PA 3E0EA 2EJ9A 1Y1WG 5FLMH 4A3IG 5C4JH 3UE1A 3CD6A 1WFQA 1Y1VH 3NBHB 3J7A5 4ZTUB 1XMQQ 1PV4A 1FJGL 4JCVE 1PFSA 1YHAA 1IBKL 3HOYH 3HXWA 1YITA 4KR3A 1TXYA 2LXJA 4AYBG 1SMXA 3F2DA 2D62A 4A3JH 3RIRA 4GKJL 5JJIA 4DV0L 2DQ3A 5IYCG 4OLFA 5IP9G 2ATWA 3CXCA 2EXDA 2YU9H 3LSQA 1UE6A 1GKHA 1P16A 1Q8KA 1NJ2A 4TWAA 4EQ5A 1IBLQ 4JYAL 4JI4L 4X62L 3D31A 2ZTCA 3F2CA 4B3MQ 2PNHA 2R7ZG 4YCUA 1NJ6A 3PUVA 3S1NH 2R93H 1XNQQ 2K52A 12ASA 4QJFA 4X6AH 2P0LA 4BY7G 1PH9A 4XTVA 1X2HA 1W66A 4XEMA 4DV2Q 1B76A 5HY6A 1HNWQ 2RHSA 1CSPA 1YNXA 4JV5Q 2J3MA 3ERRA 4P3OA 2B29A 5FLMG 4YHHL 1PH4A 4TVWA 1X55A 1YIJA 4CH6A 4BWAA 4XTZA 4PG3A 3RZDH 1KHIA 5EAYA 4H2TA 4DV7L 1JJCA 1X54A 3EN2A 4IPHA 2CCZA 2MO0A 1BIBA 3TRZA 4JBJA 5GROA 2D0PA 1PHJA 2N3SA 3K80C 1PH6A 3V8KA 4G85A 1I5FA 4QIWE 1VQLA 1G5IA 4P72A 3CCLA 4IPGA 3ZJYC 1VS0A 4BY1H 1A63A 4OXPA 3GDEA 1KL9A 5IE8A 5C44H 5JEAJ 1N34L 4QGUA 3K7AH 1IYJB 3HOUH 4LF8L 1MJEA 2ZTGA 2VUMH 3KOJA 4DV1L 1QUQB 4LF7Q 2B63G 4DV0Q 2NVYH 1V1QA 1YHBA 4XU1A 4JI1Q 1Q82C 5IYBG 3CCJA 1L0WA 4XTUA 1XPOA 4RMFA 1TWGH 3HRKA 1IBLL 4JYAQ 1C0AA 1EIFA 3P8VA 4DUZQ 4HWPA 4LF8Q 1X3FA 4C3JH 3PSIA 3VQWA 4P75C 2K75A 4YRCA 3S16H 3GTMH 1VQFA 2IX0A 2ID0A 5IYCH 4KHPL 1ASYA 1VQ7A 2Q5HA 5KNNA 2C8MA 2B3GA 3U4ZA 2EIFA 1I94Q 3GD7A 2JJQA 3RGLA 1VQDA 1K83H 1T9HA 4DV6Q 4H2UA 3V7CA 1BVSA 3HXYA 1WCMH 2AWOA 4DR1L 2BH2A 1G6PA 5C53B 4K0KQ 4JI0L 4JC0A 3S1RH 2CWPA 4LFAQ 4DV3L 1A8VA 4PZ8A 1YZ6A 3GTOH 5C3EG 3W1BA 5J3BA 3KDFB 2F3IA 1XMQL 4EO4A 2ZNJA 3T1HL 1H4VB 4YCWA 4YY3Q 5JEAG 1VQIA 1YJWA 1YVCA 2DVEA 3WWVA 4DR1Q 2Q7HA 1H4QA 1KD1C 3RZOH 2ALYA 4DV6L 4CH4A 4OWTB 1SESA 4TQUS 3FKIG 2D0OA 1VQ8A 3M4OH 4BA2I 1VQEA 1K9MC 2UUBQ 3FKIH 1PH5A 3PF4A 2QHTA 3A7AA 2CKZB 4C3IH 3K8AA 4GN5A 4GOPB 1YI2A 1Z7MA 3GTKH 1OTCA 3GTPH 4IO9A 2NZOA 3VDYA 1N32L 2RHSB 2K5HA 3RKYA 3PO3H 5HGQA 3VBBA 1GD7A 2KHJA 4KHPQ 3R07A 1OXSC 2OTJA 3L2ZA 1TWCH 4P71C 2C7IA 3J81j 3REXA 2HHHL 5IP7H 1XPUA 2MNAA 3G71A 5K36G 2H5XA 4RG1A 2R7FA 3M7NA 3NETA 2IX1A 4DR3L 2PI2E 3L2PA 1RL2A 3AFQA 4P75A 3L7ZC 2I4MA 3UDFA 1M1KC 2OTLA 3OD1A 4LF7L 4XTWA 4YDQA 1HZCA 3I56A 4K86A 3PO2G 5IYBH 3TUPA 1U0LA 1XMOQ 3H3VH 4TVYA 1IBKQ 3H15A 2UXCQ 1QUQA 1QZHA 1GO3E 4UP7A 4YREA 3CMEA 4CS4A 4A3BG 5IWAQ 4JOIC 5E7NA 2F4VL 3M4QA 4L5SA 3SGIA 4X64L 3WQZA 2VQEL 1HTTA 4YRPA 4DK3C 3PZCA 3RKWA 1N33L 4YWKA 1VQ4A 3PUWA 2YYZA 1N34Q 3D0FA 4JG2A 5M3MG 3LC0A 5M5WH 1SR3A 3TEGA 3QTCA 4IFDI 3IKLA 1KXLA 4XTYA 2K5VA 4E51A 1N8RC 1ADJA 1RIPA 3FHWA 2DJZA 2VS1A 2BA1A 4H2SA 2EAYA 3TS2A 3REUA 2VL6A 4A3KG 1SRUA 2HIXA 4POGA 1MJCA 2JA8G 2DTHA 3PV0A 4NCXA 1IZ6A 2ZT6A 1Q12A 3NEMA 2Q7EA 2HT1A 1XNRL 4BY7H 1KOGA 1RIQA 4IOAA 3PUXA 1NYQA 2IT1A 2VQFQ 3J80i 1NJ1A 1TWHH 3HXZA 2WAQE 3HOVH 5GADC 4WF2A 1EOVA 4QQBX 3ULPA 4JI0Q 1NJIC 2P8TA 4YRGA 1JJGA 4GNXA 2UXDL 1NY4A 2D6FC 4NPSA 2VY3A 2E5LQ 4H2XB 5FJ8H 3G4SA 4PZ6A 2DGYA 2LSSA 4JBWA 4HIKA 4G84A 2JA9A 2I5MX 1E3PA 2JA7G 3UFGA 1LUZA 2WB1G 1AH9A 2ZT8A 1K0RA 4GOPA 3CCRA 3U58A 2R7ZH 2YV5A 3GTQH 1PH2A 4HJ9A 2GVBA 4P74A 1XTDA 2N8NA 1TWAH 1I6HH 3EFSA 2XGTA 1FJGQ 2Z6KC 1NE3A 4HJAA 1FGUA 3IKMB 4JOIA 1FYFA 5AJ3L 2E2IH 4KHZA 1GVPA 3BZCA 4YRRA 4ME3A 2UU9L 3MF2A 1A0IA 4DV7Q 3RL6A 2VQEQ 2NN6G 4Y7NH 3FP9A 1EQRA 2JA6G 1VQ6A 4HIMA 4XU0A 3K81C 1EYGA 5AJ3Q 4HWTA 1Q7YC 2AKWB 1SETA 4DR7Q 3RN5A 2Q2TA 5JJKA 3IG2A 1S40A 3T1YL 3ER0A 4YWMA 2K14A 1B7YA 1HNXQ 4POFA 2EWNA 2RF4A 4LFBQ 5FJ8G 1WQWA 3JAMc 3UDGA 3H0GG 4NXNL 4A3CH 4DV5L 4RQFA 3MEFA 2R92H 3BJUA 2N78A 4L5QA 4DR5Q 5DLQE 3QNEA 2AWNA 1X56A 4MNOA 3H0GH 2QEXA 4JI6Q 2WP8J 2NVQH 1N36L 4DUZL 4PMWA 3RACA 1QVGA 1AE3A 4A3FH 3CCUA 3HKZE 2KCTA 3J7ZC 4OP0A 4UY8C 3MEYA 3J81c 2MQHA 3BFMA 4X62Q 2RHQA 4AH6A 4BA1I 1VQJA 4JI5L 3HRIA 4HJ8A 1NTGA 5LMNW 1QZGA 2PMFA 2ZTDA 3CF5A 3HKZG 3CPWA 1PH1A 4B3RL 2CIMA 3QO5A 4X65Q 4GN4B 1W2BA 4GKJQ 3HOWG 2ZJPA 4GNXB 1FL0A 4LNQA 3PO2H 3EFRA 2RCNA 2E5LL 4A3EG 3E9HA 4A3BH 4GKKQ 1ATIA 4ALPA 1Q86C 4R4CA 2I4OA 2UU9Q 4Q15A 4YRNA 4LF6Q 1KMNA 4DR5L 3TEHA 2E5AA 4HWSA 4A3JG 2HNIA 1E24A 1SERA 2CGHA 4P3PA 5ELNA 1WQ7A 2ARTA 3PCOA 1H4SA 2PMEA 2NVXH 3E9IA 3KJOA 2YTVA 5GAEC 3L0OA 1HNXL 1YGBA 1M90C 1VQMA 1Y1VG 1HNZQ 1PA6A 4ZIBA 4LFCQ 2DXTA 1UE7A 3GTJH 4HWRA 5IWAL 4DR6L 1UE5A 4A93H 4JI2L 2K5NA 3CCEA 4CH3A 2JA8H 1SE8A 3ULJA 1YBYA 5BR8L 1DGSA 2DQ0A 4IPCA 4JI1L 3HXUA 2Q5IA 3PGZA 3J80c 3A5YA 2R7DA 2DZ9A 2AKWA 2Y0SG 3CC7A 4AQYL 4B3SL 1ADYA 1USYA 4JI8Q 4WI1A 3ICEA 2ALYB 1FVIA 1VQZA 1L2FA 4A3DH 3LSSA 1YFSA 1G5HA 1V43A 1ASZA 4XTXA 1XMOL 1LM0A 3UE0A 3P8YA 3UDXA 2E2HH 4YRKA 1BBUA 2E2JH 2JE6I 4B3TQ 5C3EH 4KR2A 1XJVA 1EUJA 1A62A 1CSQA 4X66L 2UUCQ 4AIMA 4EX5A 4LF5Q 2OQ0A 3HFZA 5FLXc 3KF8B 1WOCA 2KBNA 4L5RC 3JC66 2I0QA
chains in the Genus database with same CATH superfamily
2K4KA 3FDTA 4XU2A 3I91A 3HY0A 1PJ5A 5ELFA 3TDQA 1R9TB 4JV5L 2HIVA 3R8BA 1WD1A 4BBRG 3KF8A 2PI2A 1U4LA 2Z9HA 3W5OA 2WAQG 2VNUD 2UUBL 4LFBL 3SK4A 3FHZA 1D8LA 1I3QC 1Q8IA 4QIWL 2NVTH 3TFJA 1UV7A 2XTIA 1LABA 3WOEA 3K59A 3S2DH 1ZVUA 2Q8IB 4IJLA 1JMCA 2SEBD 5C3EC 2NZ1D 3EIVA 1TWGC 3IPJA 3DM1A 4BY1K 3I4MB 1B50A 1NMFA 3GV6A 1MGSA 4YY3L 1EY5A 3BDCA 3S16B 4A3DB 2WB1B 4HMIA 2F0NA 3T1HQ 3VYRA 4FXDA 1L1OA 2XCQA 1EH1A 1J5EL 1VQBA 3HOWH 2JA7B 4DK6C 3MQZA 4DR4L 2ICEC 2KECA 1NAPA 1SRYA 5IP7C 5IGBA 2P5ZX 1A6XA 4GTFA 1UEBA 4C3JC 2B63H 4G0WA 1X01A 3TFHA 3MFGA 2VZAA 3DWPA 1AN8A 1L1OB 3M85A 4HCSA 2VUMG 3MF1A 4IPDA 5F5WA 2GSUA 4DR6Q 2JA6C 2ZJQA 2OWOA 3V8LA 4C3HH 2ZT5A 3G1ZA 1PYSA 1TWCK 3J7AV 4B3RQ 3I4OA 2X6LA 2SOBA 3V7RA 3CCSA 1I6HC 1JCKB 2P5IA 1WPYA 2F0QA 1EOTA 5C3EB 1HUMA 4LF5L 3H0GC 3OHXC 3PCOB 5CV5A 4APVA 1VMCA 5FKAC 4OX9L 2ZZGA 2JA6K 2ZXFA 2F03A 3ERQA 3G4AA 3ONAB 4DAVA 4KKTA 1HR0Q 2UXBQ 1F9PA 1QE6A 4YG2A 2A6EA 1NSNS 1JOKA 2MO1A 3RLNA 1AB4A 2NVQC 1Z9FA 1VQGA 4TSSA 1AZQA 3CP0A 3A74A 3S14H 3B6YA 4LOWA 3G6JB 2HUGA 3K6OA 4R1JA 4C3HB 4A3CG 4NMZA 4HJ5A 3DEPA 4A3KK 3SR1A 3H3VC 5CV8A 4GKKL 5C3XA 4Y7NC 3MXGA 3GTGA 5ELCA 1YB3A 5LMNL 2F52A 3HFVA 2EJFA 2AMCA 3CKIB 1STGA 2I5LX 5IGDA 3K7UC 2TSSA 3MXUA 4NDXA 2ZZFA 2DUDA 2EJGC 2DKGA 4LVKA 3IL8A 3A56A 1QILA 2NVQB 3K5OA 2NVXB 3PO3G 1WTVA 5IYBK 1R9TH 1I50K 5A2QL 5C44G 1XZPA 3STBD 3H0GK 1Y1VK 2F0UA 2B2TA 1LT6D 4CKBA 2IY5A 3KDFA 5C4XH 4JI7L 4ZUJA 1QCBD 4A4IA 1Q1BA 4O0AA 4BBSG 5FJ8K 1IBML 2E41A 1QF6A 5EKIA 4A3MG 2HQLA 2E1HA 1HNZL 1N9WA 3AMUA 4ZH4A 1CKOA 4UP9A 5CV9A 2IY5B 4X3KA 2O2LD 2F0IA 1K28A 1XPRA 3GTLB 2PZTA 5BN5A 4WJ3M 2EYJA 4OO1G 1AEXA 1J6QA 4OO1H 1GE9A 1SLJA 3M4PA 1X9NA 4LVMA 3I4MG 4KATA 1B70B 3H3VD 1L1OC 4CBVA 4RAUC 4ZAIA 2EXZA 2E8GA 4A3MH 3G7LA 1D5XC 3GTKB 1ISEA 3VYSA 3BU2A 4V190 3S1MH 1GJXA 2OF1A 3S17B 4JK1A 2B2UC 1YFRA 4L87A 4QJVA 3GTGK 1NNHA 1DOKA 4N8FA 3C3LA 2F0LA 4GZYA 2CJ9A 2DDZA 3CAGA 4AQYQ 3UI2A 1X2GA 4IUUA 4A3KC 4LWCA 4C3IC 2KHIA 1S72A 1FNVA 3H94A 5TSSA 1AFPA 1SFOA 2I46A 1IE0A 3S2HH 3I4MK 3EVQA 1C7YA 3H0GA 1WSVA 1A2TA 4A3EH 1BNZA 1DM0B 5K1XA 4I7AA 4RHRA 3NE5B 3M3YC 1SDFA 2E74C 3FRPB 1H9JA 1S4ZA 4GTBA 1WU7A 3I2ZA 1YEZA 4XXEA 1WTRA 3RLFA 1WOSA 1YNNC 3NELA 4MQ9A 2QILA 1ENAA 2PZUA 1SNMA 1PH7A 3SHLA 2Q2UA 1BBWA 2R93G 3A8IA 1IL2A 1GM5A 1TWFH 1H9RA 1KMMA 2EBBA 1NUCA 1K3BC 1SN8A 1EIGA 4BBSK 4CDDC 4UP8A 1B8AA 4LFCL 1SROA 2V1CC 2Y0SB 1CTMA 2PQAA 2QEJC 4RKBA 4OELB 4KY7A 3I55A 4RFBA 5DM73 2L5TA 4DXFA 2JEAI 1EIYA 1CA6A 1GGMA 3OYYA 2F0KA 3V8JA 4X3TA 2M2LA 5LMUL 5E68A 5NUCA 3CMAA 5C52B 2B63C 1WTWA 2RHQB 2FINB 1I50A 3VQVA 2A1AA 4DNIA 2F0PA 3H3VI 1I6VA 2WAQD 1HJPA 3TZDA 3SEBA 4RH6A 5IYDK 4OX9Q 1G51A 2CW0D 4OEMB 1R4QB 2YTYA 3DWAA 4X64Q 4GLAC 5TMCA 2XRQD 3T1YQ 1XNQL 3RZDK 3TREA 3EJIA 4HVCA 1E7ZA 1HZBA 5JAVA 2F4IA 4QY7A 2RBMA 1GXDC 1USMA 4IN3A 5EGHA 3VQYA 2C35B 4H0LC 4DR3Q 4JBKA 1BBXC 3TP6A 3A31A 2P5MA 2EYFA 4OONA 1Q90A 2LXKA 1J98A 3J81E 2OEOA 2OCEA 2DY7A 5G3LD 2NVTB 4R9WA 5D65A 2A5HA 2IWHA 4BBRH 5M5YH 3HY1A 3KJPA 5LMUQ 2XRSD 2CWAA 1T5XD 1QWYA 2R7ZC 4RCNA 1Z7TA 1C9OA 1VQOA 1KC8C 2ODRC 3A5ZB 4CJ0B 4LJZC 1Q1EA 4K5VA 3RMHA 4KMHA 3S1QC 1NNXA 1PTOC 2CQOA 2QCPX 2EDGA 3M4OC 1HZ9A 2R92G 1K83B 2RVLA 1LLRD 1S3OA 3HKZB 2QHUA 4MTNA 3GO5A 2JA7H 3A5ZA 1IW7D 4XIGS 1JE4A 2A74C 2JSOA 5C5MA 3S1RB 2ARUA 4YRJA 1ZYRA 2PNRC 3NTKA 1TWFB 4ILWA 1VQNA 4TVAB 3GTOB 3CPFA 1BIAA 4DV3Q 1KQ4A 1XXCA 1G8ZD 1F2ZA 3U50C 1PYWD 2NS6A 4RDXA 1LYLA 5JJLA 4TQDA 4KI0A 3HZXA 4OO1I 1SE2A 2GN5A 2ZM6L 3L4GB 4TQFA 2JH3A 1TY0A 1KNAA 4DDQA 3PIOA 3LGJA 1IL8A 5IGCA 3E3XA 2E2HA 2AMCB 1JJCB 5CMDA 5M3MB 4EVOA 4ABNA 4ZLTF 2A6EC 2SNSA 2TMPA 3I4NC 2G5DA 4KM8A 3PUYA 2CW0C 1XZPB 1Y1WC 3F1ZA 5IODA 2E2HB 3KFUA 5IYDG 2JA5H 3KLRA 4HIOA 1E1TA 1KRTA 3FPPA 2CJAA 2L0CA 1GHKA 1X31C 3TN2A 1Y1VC 3H6MA 3M4OB 1B7YB 2EPBA 4LUOA 2B2WA 1U4MA 1A3TA 3KLSX 1SJED 4C3IB 5LL6S 3Q0AA 1K8GA 2EJGA 3DXJA 3EQLC 1DOMA 3SK5A 2ZM6Q 3CC4A 1O80A 1XNRQ 1F2YA 1USYC 3TSSA 4LW1A 2NVYA 2JA5G 1E22A 2NTSA 3CMQA 2BH8A 4DKAC 4KKUA 4BBSB 3HP3A 2PMZB 2NN6H 1EVLA 5I9OA 2F0WA 3RUXA 1WQFA 1I4PA 3S16K 1J5EQ 5CBEE 5IT9c 2ZTEA 3OW7A 4A3DK 1HA5A 1WJJA 1Y8NB 4L63B 5I6WA 4DR2L 4N9TA 3SZYA 3RKXA 3HFZB 2JXMB 4A3JC 4K5WA 2R61A 2V6UA 2PQEA 1JE5A 5H1SE 3TMEA 4JI8L 1DXMA 1U9RA 5E4XA 2EY5A 3S15H 2G9DA 4QMGA 3V96A 4RGNA 2E10A 4BKWA 4IFDJ 1EEFD 2Q2HA 1VQAA 5KNCA 4P3NA 3RZDB 3OREA 3S17H 3HOZK 3RZOC 1KRSA 1TWCB 5IY0A 3P8TA 4I7ZC 3I3CA 2K28A 2B2UA 2V4DA 1HH2P 3J7YW 2UUAQ 2UUAL 4GTAA 4YRFA 1EYCA 1MSGA 5IP9H 3S1NB 4DV4L 4X6AK 3J7AF 1C48A 4OIQA 3M3YB 3NPPA 2NVTK 4YRIA 5IOTA 3STBC 1GUSA 4X5OA 2N49A 1JOQA 1O2AA 4P2CB 3MHBA 4DUYL 4NB3A 2O5JC 4YYEA 3QO7A 3HOXC 3P20A 4A3KB 4C3HK 3OWFA 4A3LH 5EGEA 3FVQA 4A76A 2F4VQ 1WOOA 1QNUA 4HWOA 1B4BA 4DR7L 4TRDA 3Q8DA 1OXUA 4XQJA 5E3IA 1SMYC 4Q5VA 4EQNA 1WYDA 1GUOA 2QF7A 1TWHK 3MFYA 1YJNA 3MAQA 3HOXG 3TS0A 2ZCEA 1F2MA 2EL9A 3H0GB 3A5UA 2ZIOA 2WB1E 3GV3A 4HIDA 2B2WC 3M9BA 2Z6KA 3ITPA 3UDIA 3W3SA 4K8JA 3F2UA 3DXJC 3GTJK 1LTAD 3PUZA 3PIO3 5C0XH 4M8AA 4A93K 4ZK9B 5C0XG 2MFIA 2SNMA 3UH0A 2Y0SE 3MA2B 2CFMA 1WCMC 3TP7A 4YRTA 2KQ3A 1STEA 3RR5A 1R9TA 4Q4ZA 4P9SA 3EBEA 1E2WA 1EQQA 2A6HD 2Q8RE 4XU3A 1I50H 2PO4A 3AU7A 3GTKK 4C1NI 1NMGA 1YHQA 3DLLA 4FF3A 4BXXH 4A93C 1KTKA 1TY2A 1IYVA 3I4MC 4FNFA 2HQEA 4WRDA 3QIAA 4A3LC 2DU7A 2QDBA 1KIXA 1HXDA 4BY1B 1F9QA 4NW2A 1LO5D 1V9PA 2I4LA 4YRLA 2V6TA 1EWIA 1EY6A 3TEHB 1HHVA 1OXVA 4RQEA 1Y1WH 1H4TA 4H2WA 2A69A 1I4GA 1TS2A 4JI2Q 1H95A 4LAAA 2UUCL 4K88A 3F8TA 1YJ9A 5CJ9A 5M5XK 3HOVC 1JWUD 1V1PA 4YRMA 1RU0A 3ERSX 5CV7A 4A3KH 2VB2X 1AZPA 1Q46A 5JEAH 1U4PA 3KBGA 4FO2A 2NWGA 4DAMA 3R3OA 3NENA 4MZ9A 1NCVA 1SXTA 2RGRA 4K2KA 3M4YA 2B2TC 2E65A 2JA6B 2FMCA 1NJ8A 3FJPA 4JI5Q 4OWWB 2ZR2A 3K0XA 3QO8A 4H2VA 4DF7A 1EZ6A 4RKLA 3OTOL 3S2HK 3I4MH 2ZJRA 3G6EA 1PYBA 2B63A 1BCPF 3HOZG 1X6OA 5M3MH 1WTQA 3DSQA 1BKBA 1MIUA 1F9SA 2PYKA 3GTGH 1VJEA 3W1GA 1NJ5A 4O2DA 2VXWA 4DV5Q 2AUKA 4LVLA 1BCPB 4BW9A 2EZVA 3CCVA 3HOVG 3KK7A 4JVZA 4IUNA 4MIUA 1X3QA 3OMGA 1PH3A 5C4XG 4TVAA 3GTOA 1LTTD 1VQHA 1STYA 3S24A 4C3JB 4AYBE 4PZ7A 1I6VC 1XTCD 2Y3PA 1EFWA 3L4GA 1JT8A 2F0VA 2A68C 1VLOA 4EGVA 4NP5A 1TQOA 3V7SA 2RSNA 4L6TB 3OW2A 1R9TC 3N6RA 2FXQA 3S16C 4WFN3 1VQKA 4J15A 4CKCA 2L1BA 5HGTA 2ZNIA 4KMAA 5C4XC 1II3A 2EQSA 1HI9A 1TKWB 4A3GH 1VQ5A 4DU9A 4UPAA 4P71A 2AUJD 3GTLK 5I9PA 3RNUA 3N3YA 3CQZH 1SYEA 1LTGD 3VYTA 2CJBA 3MXNB 2KOLA 1MD2D 4K6DA 1XYIA 4BBSH 1QOHA 5DNFA 1EIYB 1VMPA 2E64A 1OXTA 1HPCA 3HOWK 1N32Q 4R4OA 3CC2A 4A93B 4CS2A 3HKZD 2R7ZA 5LHY1 3D6CA 4YCVA 1BS2A 4FF1A 4IJHA 1EVKA 3S17K 3ERED 3F2BA 2NZHA 2R93B 1J5WA 3RF1A 4KQEA 2YTXA 2E3CA 3CCMA 4MEXA 1WCMB 3AQQA 3S1RK 4GLVB 3AEVA 3S1QH 2YU9C 1RTNA 2F0FA 1KQSA 4GTEA 1TWFK 4MHEA 5IOSA 1UWVA 2JQOA 2FHTA 5FK9C 5BN3A 4BBRK 5M5YK 2JA8K 2R93A 1UUPA 5EJWA 1UE1A 2ES2A 1HCZA 1S5ED 3PMFA 2B2VA 2DEQA 2I5HA 2JA6H 1G2TA 2ZZEA 1YX2A 4IZ8A 3K7AB 3I4LA 1L0YB 1PH8A 1B3QA 4XTCS 1Q81C 1F9NA 3R2TA 4JI7Q 3S1RC 1LTLA 3ND8A 1ESFA 1VQCA 1LT4D 1YNJA 1VCIA 3M3YH 1Y69U 2QHVA 4H2YA 4KKSA 5F2DA 4YRSA 2UXCL 4XCHA 1HNWL 1FYCA 3OSOA 2GVAA 4BBSC 4KN4C 2KCMA 2J3LA 3A7UA 4U68A 1RF2D 2VW9A 4LFAL 2L15A 3M4OK 4GTDA 4KY6A 5LMNQ 1JORA 4FDBA 1DZ1A 3QB3A 4ODGA 4DNTB 3HEJA 3A8IE 1A15A 4KLKA 1SFOH 4JI6L 3GEEA 4CH5A 4MN3A 3R93A 3NUCA 1RJTA 3RLOA 3EQLA 4JI3L 4NXML 4KARA 1HZAA 3KF6B 2JYOA 4IUQA 4B3TL 3A0JA 3S2HB 4CDEC 4NKLA 2JEBI 2Z4HA 2RDGA 5ELOA 4DV4Q 2UXDQ 2RQXA 3I4NB 1WSRA 2AHOB 1IHZA 4DAYB 2A19A 3A8JE 1I94L 1O7IA 2IPKD 1P8LA 5C0XI 3C2PA 4JI4Q 5GQOA 2L12A 4YRQA 3D3RA 1H9SB 2ARSA 5IYCC 5BR8Q 4DV1Q 4LK1A 4BWGB 2K7VA 3LWUA 3L1AA 1E2ZA 1E1OA 3S1MK 4LVIA 1HR0L 2UXBL 3RN2A 4NXMQ 1TIID 2QA4A 1H9SA 4OGQC 1PFBA 1U5KA 4C2MB 1PTOD 3PO2K 2DU5A 5CORA 1RTOA 1XXGA 1Y1WK 3S1NK 2NVYB 4P73A 2M9VA 2MJ8A 5HURA 5IGEA 5M5XH 5IP7G 4JBMA 2ZR3A 3I4NG 1WI5A 2IX3A 3L4JA 3S1MC 4LF4Q 1VRQC 2CVRA 4DUYQ 1B2TA 4LUVA 1XZQB 2A69C 3LAPA 4NOIA 1STNA 1D1IA 2XCRB 5M3FH 3S15B 4G0UA 1VQ9A 2NBFA 3HOWB 2G4CA 1XXAA 3AFPA 4LR2A 1ET6A 3J81L 2O5JA 1HRJA 1ET9A 2DY8A 2B63B 2ASBA 1SJHD 4A3EB 1IW7C 3HG9A 3L9AX 2J7ZA 4FVMA 5CGKA 2R93K 1Z47A 4QF4A 2R92B 3PIPA 1MBYA 3HXVA 4K0KL 1IXRA 2JA5B 1X32A 1VF7A 1XPPA 1TWCA 3T01A 2IHFA 1B9NA 2A6HC 5M3FG 1Y14B 1WLEA 4K87A 5M3MK 4BBRB 5M5YB 1X3GA 4ZUIA 3MVVA 4H2XA 4A3DG 4HMJA 1O26A 4XSXA 3AYHB 4X66Q 1SYCA 3I4NH 3VYUA 1G291 4NXNQ 4YHHQ 4XDXA 3U9SA 4IFDG 4MTKA 3VQXA 3U9OA 1H9KA 4RA8A 2VQFL 3A32A 1OXXK 3GTQC 2I4NA 1ZQ1C 3MXPA 4Q0FA 4GLXA 4LF9Q 3DWQA 2R6GA 4B9XA 3G4CA 4A3IC 3PQIA 1VQPA 2KJXA 5BN4A 4F87A 3IALA 2ZIMA 4XT3B 1HC7A 2ZGWA 2DZCA 2R7ZB 3JAML 5C0XJ 3NHHA 1CUKA 2IL8A 5KEEA 3GTPC 2EJMA 4GOPC 2E2IA 3TFIA 4BLAA 4GTLA 1O25A 4A93G 4BXXC 1EZ8A 5JJZA 1O24A 5IORA 3TQYA 2BA0A 3ULLA 4C2MH 2KENA 3OTOQ 2ZT7A 4A3GB 1O2BA 1SYFA 1K3RA 5C51B 4O1NA 3EFXD 4HJ7A 4PABA 3UGQA 1WCMG 4P73C 3GTPK 1K8AC 5C4ZA 3CAMA 3HTZA 1VH2A 2XCOA 4G7OC 1QVFA 3E0JA 4LF9L 4BXXG 1WNLA 3A8JA 2R3ZA 5C4JC 1EY8A 1HXYD 3NWTA 3ICAA 1X3EA 4KD3A 3S17C 1CKMA 1YFTA 2F0JA 4X3UA 3HOUK 4R4TA 1XWEA 4YP0A 4YROA 2DTIA 5EPKA 4PNYA 2KEEA 1EU3A 4A3IH 4LNSA 4P74C 4IUPA 4DV2L 2JA7C 2WAQL 2PQAB 2PMZL 1ENCA 3ZYYX 2E2JB 3HOYG 3RUZA 3BUEA 3KYHC 5C3WA 2DTOA 1RCVD 1N36Q 2A6ED 2DNEA 4TKOB 1QE0A 1D7QA 2NVYK 2HHHQ 2OXPA 3CRLC 3FKIB 1WCMA 2Z0SA 3HOXH 1IBMQ 1GUNA 3BZKA 1JB7A 1T5EA 4P5BA 2FYKA 2QHSA 1MKHA 3CCQA 1O7ZA 4OWXB 1SFOK 1TWHB 3KF6A 3CW2C 4GNXC 4DPGA 4A3LG 1TWAA 2OQKA 2F3WA 4CHTB 4A3EK 4B3ML 4FP5D 5JPNC 1CKNB 1SE4A 3KLWA 4ZTZB 2CFAB 3BP8C 1QVCA 1F7UA 3JAMi 1PVOA 4X65L 2QKIC 1KABA 3TP8A 4XSZA 5KRUA 1K73C 1PZKD 3V4GA 1PYSB 2JA5K 1BF4A 1I4HA 4DFAA 1LT5D 3AQPA 1CKNA 4YPFA 3DM3A 1WORA 2PMZE 4LUZA 1UAPA 5E3FA 4XEOA 2JK8A 4LF6L 3HXXA 1OO9B 4YWLA 2Q2IA 2NB0A 3BYTB 4GN3B 5GAHC 4R4QA 1Z7NA 4A3GG 2DXUA 1KAWA 1TS5A 4A3FG 1JJ2A 4B3SQ 3S14B 4DQ2A 2QGQA 4TTVA 1O27A 1JVIA 4H44C 4R4IA 3MC0B 3PF5A 1I50C 1NBWA 4CS3A 2EJFC 5GAGC 3VA5A 1AE2A 1WCMK 1SAPA 3A7RA 2E2JC 2B2YA 3X3NA 5IOQA 3HOUG 4X6AC 3SE0A 1DCHA 5ELBA 2E75C 1IYUA 4GTCA 2IHEA 1XXBA 5IYDH 2Q7GA 3T00A 4QL5A 4AYBB 3I8ZA 3S14C 4P72C 4IOCA 4L5TA 3I70A 3DEOA 1ZEQX 4H02A 4WJ4A 1ESRA 2ZINA 4Q6GA 1TWAK 1PRTD 4PHCA 4JK1C 3HKSA 1N33Q 2RH6A 5C6AA 1HR0W 4JI3Q 4BY1G 2E2DC 3UGTA 4KMDA 2NN6I 1V1PB 2K32A 3IRBA 4DXGA 1NYRA 3KBXA 4GZYC 3HOZH 3J81i 5EBCA 11ASA 4LF4L 3S0XA 1O29A 4A3GK 2EYPA 3U4VA 5KNBA 1Y8PB 3GTLH 4CJ2C 2WFWA 1I4RA 2FQOA 3TZUA 4OIRA 4A3LK 1W3SA 1JB3A 3HOXB 2NUCA 3BYYB 3AH5A 1PXUA 3G48A 5EPLA 1JQWA 1X65A 5M3FB 4ILDA 3K58A 4Y52H 2JA6A 1FGBD 1E0BA 1LTBD 1B70A 2AQ1B 5FOBB 5CYUA 1S5BD 3GTJC 2K50A 4DR4Q 4DR2Q 2A8VA 4A75A 3TTGA 4GS3A 1I3QH 2E2IC 4G7HA 2VUMK 3I7FA 1PFNA 2D2CC 2ODRD 2KWAA 3OWEB 4KD4A 5K1PA 4LVJA 3E0EA 3NTIA 5D3IB 2EJ9A 1Y1WG 5IYBC 3TP5A 5FLXE 5FLMH 4A3IG 1O2FB 5C4JH 4HT4A 2EOTA 3UE1A 4BY7B 4K5XA 3PO2C 2F0MA 1B3AA 3CD6A 1RD9D 5EBDA 1WFQA 2PMZD 1Y1VH 3O13A 3NBHB 3ND9A 4K8IA 3J7A5 4ZTUB 1XMQQ 3D6WA 2NVXK 3BP3A 1PV4A 1STBA 1SNPA 1FJGL 4JCVE 3SXHA 1PFSA 4C2MK 1YHAA 1IBKL 3HOYH 3HXWA 1YITA 4KR3A 1TXYA 2LXJA 2RDHA 1YNJD 1NR2A 4AYBG 2WACA 2NVYC 1SMXA 3GP7A 4OIJA 3F2DA 2ENBA 2D62A 1LTSD 4A3JH 3IFTA 3RIRA 4GKJL 3HGBA 5JJIA 3BDOA 4DV0L 2DQ3A 5IYCG 1PRTF 4OLFA 3D4RA 5IP9G 2ATWA 4KB2A 3P75A 3CXCA 5K36H 4KDDA 1CT1D 2EXDA 4HEDA 1WTPA 1TWCC 4R8IA 2YU9H 3LSQA 1UE6A 2EY6A 1GKHA 2LMCB 3VR4A 1WVLA 3VR2A 1SYGA 5FO8B 1P16A 1Q8KA 1NJ2A 4TWAA 3V05A 4EQ5A 1IBLQ 4JYAL 3AQOA 4F88A 4R8NA 4XT1B 1CZGA 4X62L 4JI4L 3GTQB 3D31A 2ZTCA 1WQGA 5IP9C 3A8KE 3F2CA 1TWAC 4B3MQ 4Z9CB 2KEDA 4FYDA 2NTTA 2A6HA 2PNHA 1TWAB 3K0YA 4YCUA 1X3PA 2R7ZG 1NJ6A 3PUVA 2KHSA 4KJOA 1WD0A 3S1NH 2K01A 2GSNA 5D4DA 3NXWA 3R2IA 2KUMA 1ICWA 2R93H 5IP9K 1XNQQ 2K52A 12ASA 2JA8C 4QJFA 3MZ5A 1KAAA 4X6AH 1CK1A 5KGUA 2P0LA 4BY7G 1BR9A 1SMYD 4X3SA 1PH9A 1X2HA 4XTVA 3LX0A 1W66A 4OIPA 5M3FK 3OIQA 4QIWB 4XEMA 3S9WA 2K6AA 2R92A 4DV2Q 2GAHC 2FMMA 1B76A 5HY6A 5G3LF 1HNWQ 2RHSA 3C1FA 3JAME 1CSPA 3FKIA 1YNXA 4JV5Q 1SE3A 2J3MA 3ERRA 4P3OA 3I4NK 3HOWC 2IJ0A 2B29A 5FLMG 4YHHL 1PH4A 4TVWA 3RZOK 1SNQA 1X55A 1YIJA 4CH6A 4RGOS 3K7AC 5L46A 4OIKA 1M4VA 4BWAA 2PPBC 4XTZA 4PG3A 3QR8A 3N52A 3RZDH 1KHIA 5EAYA 1MHWC 2BE5A 3LWEA 4IUVA 3J80L 4H2TA 3T51B 1O7LA 4DV7L 1JJCA 4Y7NK 4S3SA 3NQIA 1X54A 3EN2A 1F7VA 4IPHA 1DCOA 3TBIB 4C2MC 2CCZA 1CZWA 5A35A 2MO0A 3D8GA 2WINB 3EROA 1BIBA 4BY7K 1QG7A 4JBJA 5GROA 3TRZA 3GTMA 2D0PA 1PHJA 2N3SA 3K80C 3EA6A 4UDUC 1PH6A 2ZUFA 3V8KA 5M9OA 4G85A 1FD7D 1I5FA 4U673 2K04A 1ILPA 1VGXA 1TS3A 4QIWE 2GSOA 3FOEA 1ZYRD 1VQLA 3GTMB 1JR0D 5COYA 1G5IA 4P72A 4V0BA 4BS9A 3GSIA 3CCLA 3S1QB 3RD4A 2Y0SD 4IPGA 3ZJYC 1VS0A 1XZQA 4BY1H 1A63A 1SEBD 1JICA 1JOEA 2JA7K 4OXPA 3GDEA 5JOBA 2H1EA 2XIWA 4A3BC 1KL9A 2Z6BA 5IE8A 5C44H 3OMCA 5JEAJ 1N34L 5IP7K 3BVGA 4QGUA 3K7AH 4Y52K 1IYJB 2JN4A 4P5AA 2R92K 5KNDA 1ML0D 3HOUH 1RKNA 4JW0A 1QB5D 3IFDA 5CV4A 1QJOA 2VB3X 4WORA 4LF8L 1MJEA 2ZTGA 2CH4W 3SK6A 2K5WA 3VR5A 3LPXA 1LACA 3KOJA 4DV1L 2VUMH 3NUHA 1QUQB 4LF7Q 2XN9C 2B63G 3GTJA 4DV0Q 2NVYH 1V1QA 1YHBA 4XU1A 4JI1Q 4DA2A 1Q82C 5IYBG 4J1MA 3CCJA 3NBHA 1L0WA 4XTUA 1XPOA 2GA4B 3GTGC 4RMFA 2X6GA 3MXNA 3FMCA 1TWGH 3HRKA 1IKLA 2N55A 4G57A 2L4NA 3C1EA 1BXTA 1SBBB 4G7ZC 1IBLL 4JYAQ 1C0AA 1INNA 3CQZA 3FPUB 1J9OA 1EIFA 3P8VA 3S14K 4I65A 1PFMA 2A8EA 5KYLA 5C4JB 1WTHA 4DUZQ 4HWPA 2Z4IA 4LF8Q 1X3FA 4UHVA 5IIFA 2NVQK 1VDZA 2A68D 2BE5D 2R7ZK 4C3JH 2F3VA 2XSCA 3PSIA 3VQWA 4P75C 1EQVA 4AYBD 2K75A 4YRCA 3S16H 3GTMH 2B2YC 1VQFA 2IX0A 2ID0A 3BDLA 1IBAA 5IYCH 2Q8TA 2BCOA 4KHPL 4OHJA 2XVSA 2M00A 3SDZA 1XX8A 3GTPB 1KLUD 2GAGC 1ZBSA 1ASYA 1VQ7A 2Q5HA 1CHQD 1VF5C 1Q3LA 4A3IB 5KNNA 2C8MA 4UAIA 2B3GA 3K5LA 3U4ZA 1HQMA 2EIFA 2EY1A 1I94Q 5C44B 5M5WK 3HOUB 3WODA 3GD7A 4RHSA 3PO3B 1WTOA 1UEAB 2JJQA 1PTOF 3RGLA 2KCNA 4XQNA 1VQDA 1K83H 2V6SA 1T9HA 2EYMA 1J6VA 1S5FD 1DD5A 5ISRA 2N88A 4IQZA 4DV6Q 4H2UA 3WDNA 1GOZA 3V7CA 2E2JK 1I6HK 1PLFA 3CU7A 1A3VA 3FKIC 1BVSA 3HXYA 2YU9A 3MMLB 1WCMH 2AWOA 4DR1L 2BH2A 1TU2B 1G6PA 5C53B 4K0KQ 1ILQA 4JI0L 5JPMC 4KASA 1EWCA 2ZXPA 2E2IK 4JC0A 4CGYB 3S1RH 2CWPA 3S1QK 1PZJD 4LFAQ 2F0SA 4DV3L 4KC6A 1A8VA 4PZ8A 1YZ6A 3V2TA 3GTOH 4G4KA 1F77A 3Q23A 2C5CA 5C3EG 3W1BA 5IT9L 5EPJA 1YNJC 5J3BA 3X3MA 3T53B 3KDFB 2F3IA 2ZT9C 1DJRD 1XMQL 3KUPA 3T1HL 2A73B 1HTLD 2ZNJA 4EO4A 2PPBA 1EI6A 3S15C 1H4VB 4YCWA 4YY3Q 5JEAG 1VQIA 1YJWA 1YVCA 3MTSA 2DVEA 2PW5A 3WWVA 3I72A 4DR1Q 2Q7HA 1H4QA 2RDFA 4A3MC 4OL7A 5IGGA 1KD1C 1CHPD 3T16A 3RZOH 3A7AB 2ALYA 4DV6L 1EL0A 1SNDA 4OWTB 1SESA 4CH4A 4KTAA 1O28A 3NP8A 2XWBB 4BY1C 4TQUS 3FKIG 2D0OA 3BVMA 4ULLA 1VQ8A 4Q5SA 3M4OH 1TS4A 1B9MA 1DOLA 4BA2I 1RDPD 1F9RA 1VQEA 1K9MC 2UUBQ 1STAA 2PW7A 1EY7A 3FKIH 1PH5A 3PF4A 5D3DA 4DK0A 3WOFA 2QHTA 3A7AA 5HL8A 2CKZB 2RCFA 4C3IH 1B1ZA 3K8AA 3E6ZX 4GN5A 4GOPB 1YI2A 2XNAC 1Z7MA 3GTKH 3HOYC 1OTCA 4A3BB 3GTPH 4IO9A 2F0DA 1GUGA 1BQQT 4QJVB 2NZOA 3VDYA 3FEWX 2HD3A 1PRTC 1WTXA 4HAEA 3SK8A 1N32L 2AQ3B 2RHSB 2K5HA 3RKYA 3PO3H 4C45A 5HGQA 4PMCA 3VBBA 4QUCA 5C4JK 3S2DC 3FOFA 1GD7A 5AFWA 2KHJA 4K2LA 4KHPQ 4C3IG 3R07A 1RODA 1OXSC 1LTRD 2OTJA 3T02A 5IYDC 4G7HC 2JA5A 4C3HG 3PIP3 3L2ZA 1TWCH 4P71C 3MEHA 1E2VA 2C7IA 3J81j 2LKVA 3REXA 2HHHL 5IP7H 3HS0C 5C4HA 1JOOA 5M5XB 5FLMK 1JQYD 3HOXK 1YNNA 1XPUA 1CM9A 2MNAA 1KDAA 4KN7C 3G71A 5K36G 2H5XA 4RG1A 2YU9K 2R7FA 4YFXA 4A3IK 4JPBW 1L0XB 4C3JG 4Y52C 4A3GC 3M7NA 5JFEA 2R92C 1PJ6A 3NETA 1NR4A 4A3JK 2IX1A 4DR3L 2PI2E 4F7XA 1SNCA 1PJ7A 3L2PA 1PDQA 1RL2A 2C9OA 3AFQA 4P75A 2VUMB 3CQZC 2E2HC 2F0TA 3L7ZC 2I4MA 3PO3C 3UDFA 1M1KC 2OTLA 3OD1A 5TMFA 3AD9C 4LF7L 4XTWA 4KHVA 4YDQA 1HZCA 2B2VC 2MPMA 2J0TD 3I56A 3HXAA 2XWJB 3LAJA 3RZOB 4K86A 4J6HA 3PO2G 5IYBH 3QOJA 1AP0A 3TUPA 2D5DA 4HSPA 1U0LA 1XMOQ 2EYHA 1EYDA 4HN7A 3H3VH 2E2HK 4TVYA 1IBKQ 3H15A 1CA5A 2WKCA 1DCZA 4C3JK 2UXCQ 1SYBA 1QUQA 1QZHA 4KN4A 1GO3E 4UP7A 3A7LA 3M7GA 3OIPA 4CDCC 4YREA 1S5CD 1PMRA 3CMEA 3RZDC 4CS4A 4A3BG 5ELEA 3C46A 4DGZA 5IWAQ 4JOIC 5E7NA 3NTHA 2F4VL 1PTOB 5IYCK 3AB9A 1GHJA 5EGTA 3M4QA 4L5SA 3SGIA 4X64L 1BDOA 3WQZA 4QIWD 2VQEL 4XYOA 1HTTA 3Q3QA 4YRPA 5I2XA 4DK3C 3PZCA 3RKWA 2NVTC 5C5LA 1N33L 4YWKA 1VQ4A 2HCCA 3PUWA 1FNWA 2YYZA 1V1OA 1N34Q 5KYIA 3D0FA 4JG2A 5M3MG 1HUNA 3LC0A 5M5WH 1SFOC 3NK9A 1JWMD 1TR5A 1RHPA 1SR3A 3TEGA 3QTCA 2BDNA 2A69D 4G7ZA 1HFNA 2MUYA 4A3BK 1J6WA 3P7JA 5J39A 2F0EA 1KLGD 4LMQD 3NBIA 4IFDI 3IKLA 3HOZB 1KXLA 4XTYA 1B4OA 1TWHA 1D2BA 2K5VA 4E51A 1C8CA 1EY4A 1N8RC 3QOLA 3HOZC 2JA8B 1QNKA 1ADJA 5JVG3 1RIPA 5E4WC 4LJZA 3FHWA 2DJZA 2VS1A 2BA1A 4H2SA 2EAYA 2CFAA 3TS2A 2F0OA 3REUA 3M3YK 2VL6A 4A3KG 4A3CK 2E76C 4ZKCB 1JC7A 1B44D 1EU4A 1SRUA 2HIXA 4KY5A 1EWHA 4DNRB 4POGA 1MJCA 2BE5C 2JP1A 2PA8L 2JA8G 2DTHA 5T1GA 1I4XA 3QX3A 2F0GA 1B53A 4RGTA 3PV0A 4NCXA 1D6EC 1IZ6A 2ZT6A 1Q12A 3NWSA 3NEMA 1SSOA 2Q7EA 2HT1A 1XNRL 3IAYA 4QB4A 1PRTB 4BY7H 2FJ2A 1KOGA 5I2YA 2YU9B 1CI3M 1TWFC 2ZFZA 2B8FA 1RIQA 2KA7A 4IOAA 3PUXA 3L3OC 3H3VL 4B9WA 1NYQA 2IT1A 2O4XA 4XLNA 2VQFQ 1W6JA 3J80i 1NJ1A 1TWHH 3HXZA 4KK7A 2WAQE 3HOVH 3GTJB 5GADC 4WF2A 3D4WA 1EOVA 3HRZC 4QQBX 4A3FK 3ULPA 2FQTA 4JI0Q 4ZQ3A 1NJIC 1EIHA 2P8TA 4KM9A 4YRGA 4Y7NB 1LT3D 1JJGA 4GNXA 2UXDL 1NY4A 2D6FC 2HDMA 4NPSA 2MHVA 1HQRD 2VY3A 3NQTA 2E5LQ 4H2XB 5FJ8H 3G4SA 4PZ6A 2DGYA 2LSSA 4JBWA 4HIKA 1M8AA 4G84A 3CQZB 2JA9A 3HOYK 2I5MX 1E3PA 1G2SA 2JA7G 4FXGC 3UFGA 1LUZA 1R9TK 2LS01 4CKEA 3GTMK 3T56B 2WB1G 1CQFA 1AH9A 1EFID 5JVOA 4G7OA 4PMBA 2ZT8A 3AD8C 4EQOA 3PO2B 2CW0A 2B39A 4BY7C 1K0RA 1I6HB 1O7YA 1BCPC 3SZZA 2WKDA 4A3MK 2EYOA 4GOPA 1ZYRC 3CCRA 3U58A 2R7ZH 1EYAA 1IKMA 4WILA 2YV5A 5IOCA 3GTQH 1FNUA 1PH2A 3OEPA 4HJ9A 2CHBD 1ICFB 4L8JA 3KLSA 2GVBA 4WJWA 2ZXRA 2E2IB 4XQQA 2F0HA 4PAAA 4P74A 2JA7A 1Y8OB 4RWSC 3W3AA 1XTDA 2N8NA 4IALA 2KVMA 2PCFB 1IQ0A 3HOUC 1KDCA 2DNCA 1TWAH 2ZXOA 4ZCKA 1B4AA 2RSOA 1ZXTA 3N0BA 4LK0A 3CHBD 1TWGB 1I6HH 2PA8D 3EFSA 2XGTA 2KCCA 2EY2A 1FJGQ 1K8OA 1Y1VA 2Z6KC 1NE3A 4HJAA 2PZWA 1FGUA 3IKMB 4JOIA 1USOA 5EKLA 5C4XB 1FYFA 1J6XA 5T1IA 2DJFC 4LQYA 5AJ3L 1TWGA 3HOVB 1Y1WA 2E2IH 2K5DA 4N9PA 4KHZA 2Z1CA 1GVPA 1SNOA 2OT2A 2WB1D 2SDFA 2O5IA 3BZCA 3GQBA 4YRRA 4ME3A 5DAUA 1JWSD 4C56C 3Q24A 2UU9L 1K83A 3N0CA 3OOCA 5I4DA 1UNSA 4C1NK 1O78A 3MF2A 1D5ZC 1A0IA 2BDOA 5FLXL 4DV7Q 4YIJA 2VQEQ 2NN6G 1D5MC 1PZID 4Y7NH 3RL6A 4M1XA 2VUMA 5CC4A 3FP9A 1EQRA 4ZRZA 2JA6G 1MI2A 1VQ6A 2MGSA 3QWNA 4HIMA 4HR7B 3K57A 4DK1A 1TT2A 1W6KA 1ONLA 4XU0A 2EYLA 3GTKC 5ELDA 4PQXA 4OIOA 3K81C 1LV9A 3S2DK 1EYGA 4IURA 5AJ3Q 3GTPA 3MWYW 4HWTA 1G6ZA 4QCLA 1Z6HA 1Q7YC 1LTID 2AKWB 4CDFC 3GEHA 1SETA 4IUTA 4DR7Q 3RN5A 4FXKC 2LY7A 2Q2TA 5JJKA 3IG2A 1SMYA 1S40A 4QUFA 2CQAA 3GTLA 3T1YL 3ER0A 5M5WB 5C44K 4YWMA 4LLGA 1F93A 2K14A 1B7YA 1HNXQ 3PO3K 5EQ0A 4POFA 5KIXA 4FM9A 2NYZD 3A54A 2EWNA 2K1BA 2RF4A 1I3QB 2AQ2B 3VA7A 4LFBQ 3K5NA 3HKZL 2WIIB 4KN7A 2NVXC 2K05A 5FJ8G 1ENFA 1WQWA 1TWHC 3L4KA 3JAMc 3UDGA 3SVMA 5C44C 1I3QA 3H0GG 4NXNL 4A3CH 1D1KA 5IGFA 4DV5L 2X69A 3K7AK 4RQFA 3MEFA 1BO0A 2R92H 4A3MB 3BJUA 4C3HC 2N78A 4L5QA 3OPOA 3Q22A 4DR5Q 5DLQE 4KMUA 2WV6D 3QNEA 1IS1A 2Z8LA 3FKIK 2AWNA 3GTOC 1YNND 1A3UA 1X56A 4ZKBB 4MNOA 3S1NC 3H0GH 4HCEA 4O42A 5CV6A 1EY0A 1ZKOA 4HTHA 2QEXA 1WOPA 4JI6Q 2WP8J 4KJNA 2NVQH 1N36L 1BJTA 4DUZL 5J1ZA 1I4QA 4PMWA 5C3EK 3RACA 1TWGK 4K6LA 1QVGA 2JA5C 1AE3A 1U4RA 4A3FH 4OINA 2RKSA 3CCUA 3HKZE 5DM63 2ICIA 2KCTA 3T4AC 5J22A 1HFGA 5A2QE 3J7ZC 3A8KA 4BXXK 4OP0A 5C4XK 4UY8C 3MEYA 1K0SA 3H09A 3J81c 4YFKA 2LFNA 2MQHA 4EQPA 3QJYA 4A3DC 3BFMA 4X62Q 4KB4A 3GDZA 2RHQA 4AH6A 4BA1I 1GUTA 1VQJA 5FO7B 4JI5L 1ZXOA 1V8QA 5EKKA 3HRIA 4HJ8A 3QO2A 1NTGA 2H4OA 3IKJA 5LMNW 3T13A 1QZGA 2PMFA 2ZTDA 1H9MA 3CF5A 3HKZG 3S1MB 4ID6A 3CPWA 3AD7C 1PH1A 2W7VA 4B3RL 2CIMA 1Y1VB 2K5QA 3QO5A 2L55A 4X65Q 4GN4B 1W2BA 4GKJQ 3HOWG 4H7BA 1K8MA 2ZJPA 5CR3A 4GNXB 3BVZA 1FL0A 5FO9B 1Y1WB 3I90A 1CQVA 3E5SA 3JSTA 4LNQA 4RCOA 3PO2H 4RGMA 4K14A 3EFRA 2RCNA 3GIRA 5E1FA 2E5LL 4H13C 1HTPA 1J8IA 4A3EG 2A68A 1K83C 3E9HA 3BG3A 1A2UA 4A3BH 3S15K 1TVXA 4GKKQ 1ATIA 4ALPA 2L9HA 3BS1A 1Q86C 4A3JB 4AYBL 4FF4A 2B63K 4R4CA 4DN4M 2O5IC 2I4OA 2UU9Q 5D14A 1DONA 4BLBA 2BOSA 1MSHA 3S2HC 1I3QK 3GTGB 4XLPA 4A3EC 4Q15A 4YRNA 4GFQA 1AW7A 4LF6Q 1KMNA 3I73A 2VUMC 4DR5L 3TEHA 3GTOK 2ZUEA 2E5AA 1YCLA 4DAYA 4HWSA 1BGWA 4A3JG 1G91A 4B08A 5L37A 3J80E 2HNIA 2I07B 3W2DA 1E24A 2DJGC 4A3FB 1SERA 4GT9A 1R4PB 2CGHA 4DAPA 2EVBA 2FFKB 4P3PA 5ELNA 3NSWA 3GTQA 2Y0SL 1WQ7A 3K5MA 2ARTA 3PCOA 1STHA 3P1HA 1H4SA 2PMEA 2D9UA 2NVXH 3E9IA 3CQZK 3KJOA 2YTVA 2L11A 5GAEC 3L0OA 1HNXL 1YGBA 1F2LA 1EQTA 4HA8A 1M90C 1VQMA 2G9HD 4A3CC 1Y1VG 5LL6X 1GUWA 2QW7A 2K33A 3DUZA 1HNZQ 1PA6A 4ZIBA 4LFCQ 4CJ1B 4C3IK 1WIHA 2DXTA 3CRKC 1UE7A 2F1MA 1WQHA 3GTJH 3GTMC 3QG1A 4HWRA 5IWAL 4DR6L 1UE5A 4XYQA 5I6YA 4A93H 4JI2L 2K5NA 3CCEA 4FZBA 2R93C 4CH3A 2JA8H 2PHCB 1CFMA 1SE8A 3ULJA 3OPFA 1YBYA 3DHQA 5BR8L 1DGSA 2DN8A 2DQ0A 1BCPD 4IPCA 3H91A 1S5DD 5TJ3A 4JI1L 2WAQB 5IT9E 3HXUA 5FLMC 1IW7A 1BOSA 4M1UB 2Q5IA 1C4QA 3PGZA 4BBRC 1TWFA 5DEHA 3J80c 1DCPA 3URYA 3A5YA 4A3FC 4IFDH 1HQMC 2R7DA 2NVXA 2DZ9A 4J3NA 2Y0SG 3CC7A 4AQYL 4B3SL 4ME5A 1ADYA 2AKWA 1PTOH 4KV6A 3VR3A 1USYA 3ADAC 4JI8Q 1KDBA 2CH4A 4KAWX 4WI1A 3GTQK 2J4XA 3VR6A 2MP1A 1EK8A 3ICEA 2ALYB 1FVIA 3HOVK 1VQZA 1L2FA 4A3DH 4YFNA 3LSSA 1YFSA 1G5HA 2WB1L 1V43A 1ASZA 4G0VA 4XTXA 1XMOL 1LM0A 3UE0A 3P8YA 4FF2A 3UDXA 4KMUC 1K83K 2E2HH 4E6IA 4YRKA 1BBUA 1KNEA 1V5VA 2E2JH 1SFOB 5CBAE 2QDLA 2JE6I 1I50B 4B3TQ 2HCIA 5C3EH 4KR2A 1EEID 3GTKA 2RA4A 5CHPA 1FR3A 2K03A 3GEIA 1XJVA 1BDFA 3BZDB 1EUJA 1A62A 2IW3A 1CSQA 4X66L 1HA6A 1EY9A 3D4DA 2UUCQ 2EE1A 1SYDA 1DD2A 3LNNA 3S2DB 2B8GA 4AIMA 4EX5A 4LF5Q 2OQ0A 4J8QA 4F8MA 3DMUA 3HFZA 2HDLA 4HSVA 3GTLC 5FLXc 5JVH3 4MEYA 4ZYSA 3Q6SA 4LK1C 3KF8B 1WOCA 2KBNA 4N8X1 4PV1C 1BUVT 4L5RC 5K5PA 3A55A 3JC66 1DYQA 3HOYB 2I0QA
chains in the Genus database with same CATH topology
2K4KA 4XU2A 3HY0A 4JV5L 2HIVA 4BBRG 2PI2A 2VNUD 3W5OA 2WAQG 2UUBL 4LFBL 1D8LA 2NVTH 2XTIA 3S2DH 4IJLA 1JMCA 3EIVA 1NMFA 4YY3L 3T1HQ 1L1OA 1J5EL 1VQBA 3HOWH 4DK6C 3MQZA 4DR4L 1SRYA 1UEBA 2B63H 1X01A 2VZAA 1L1OB 3M85A 2VUMG 3MF1A 4IPDA 5F5WA 4DR6Q 2ZJQA 2OWOA 3V8LA 4C3HH 2ZT5A 3G1ZA 1PYSA 3V7RA 4B3RQ 3I4OA 3CCSA 2P5IA 1WPYA 4LF5L 3PCOB 4APVA 4OX9L 2ZZGA 2ZXFA 1HR0Q 2UXBQ 2MO1A 3RLNA 1Z9FA 1VQGA 3CP0A 3A74A 3S14H 3B6YA 4R1JA 4A3CG 4HJ5A 4GKKL 1YB3A 5LMNL 2F52A 3HFVA 2EJFA 2AMCA 2I5LX 3K7UC 2ZZFA 2DUDA 2DKGA 4LVKA 3PO3G 1R9TH 5C44G 3STBD 2IY5A 3KDFA 5C4XH 4JI7L 4A4IA 1Q1BA 4O0AA 4BBSG 1IBML 2E41A 1QF6A 4A3MG 2HQLA 2E1HA 1HNZL 1N9WA 1CKOA 4UP9A 2IY5B 1XPRA 4WJ3M 4OO1G 1J6QA 1SLJA 3M4PA 1X9NA 4LVMA 3I4MG 1B70B 1L1OC 2E8GA 4A3MH 3BU2A 3S1MH 1YFRA 4L87A 1NNHA 2CJ9A 2DDZA 4AQYQ 1X2GA 4LWCA 2KHIA 1S72A 3S2HH 1C7YA 4A3EH 5K1XA 1WU7A 3I2ZA 1YEZA 3RLFA 3NELA 1PH7A 2Q2UA 1BBWA 2R93G 1IL2A 1GM5A 1TWFH 1KMMA 1SN8A 4UP8A 1B8AA 4LFCL 1SROA 2V1CC 2PQAA 3I55A 2JEAI 1EIYA 1GGMA 3OYYA 3V8JA 5LMUL 3CMAA 5C52B 2RHQB 3VQVA 2A1AA 4DNIA 3H3VI 1HJPA 4OX9Q 1G51A 4X64Q 2YTYA 4GLAC 3T1YQ 1XNQL 3TREA 4HVCA 1E7ZA 1HZBA 4QY7A 3VQYA 2C35B 4DR3Q 4JBKA 3A31A 4OONA 2LXKA 2OCEA 4BBRH 5M5YH 3HY1A 3KJPA 5LMUQ 2CWAA 1C9OA 1VQOA 1KC8C 2ODRC 3A5ZB 1Q1EA 2CQOA 1HZ9A 2R92G 1S3OA 2QHUA 4MTNA 3GO5A 2JA7H 3A5ZA 4XIGS 2ARUA 4YRJA 1VQNA 4TVAB 3CPFA 1BIAA 4DV3Q 3U50C 4RDXA 2NS6A 5JJLA 1LYLA 4TQDA 4KI0A 4OO1I 2GN5A 2ZM6L 3L4GB 4TQFA 3PIOA 3LGJA 2AMCB 1JJCB 3PUYA 3F1ZA 3KFUA 5IYDG 2JA5H 4HIOA 1E1TA 1KRTA 2CJAA 1B7YB 4LUOA 1K8GA 2EJGA 2ZM6Q 3CC4A 1XNRQ 1USYC 4LW1A 2JA5G 1E22A 3CMQA 2BH8A 4DKAC 3RUXA 1EVLA 1J5EQ 5IT9c 2ZTEA 1WJJA 4DR2L 3RKXA 3HFZB 1JE5A 5H1SE 4JI8L 3S15H 2E10A 4IFDJ 2Q2HA 1VQAA 4P3NA 3S17H 1KRSA 5IY0A 3P8TA 1HH2P 2UUAL 2UUAQ 4YRFA 5IP9H 4DV4L 4YRIA 3STBC 4X5OA 2N49A 4DUYL 4NB3A 4YYEA 3QO7A 4A3LH 4A76A 2F4VQ 4HWOA 4DR7L 3Q8DA 1OXUA 5E3IA 1WYDA 1YJNA 3HOXG 3TS0A 2ZCEA 2EL9A 3A5UA 2ZIOA 2WB1E 4HIDA 3M9BA 2Z6KA 3UDIA 3W3SA 3PUZA 5C0XG 2MFIA 3UH0A 2Y0SE 2CFMA 4YRTA 3RR5A 3EBEA 1EQQA 4XU3A 1I50H 1YHQA 1NMGA 4BXXH 3DLLA 2DU7A 1KIXA 1HXDA 1V9PA 2I4LA 4YRLA 1EWIA 3TEHB 1OXVA 4RQEA 1Y1WH 1H4TA 4H2WA 4JI2Q 1H95A 2UUCL 4K88A 3F8TA 1YJ9A 4YRMA 3ERSX 4A3KH 1Q46A 4DAMA 4MZ9A 3NENA 2E65A 1NJ8A 3FJPA 4JI5Q 4OWWB 2ZR2A 3K0XA 3QO8A 4H2VA 3OTOL 3I4MH 2ZJRA 3G6EA 1PYBA 3HOZG 1X6OA 5M3MH 3DSQA 1BKBA 1MIUA 3GTGH 3W1GA 1NJ5A 4O2DA 4DV5Q 4LVLA 4BW9A 3CCVA 3HOVG 1PH3A 5C4XG 4TVAA 1VQHA 3S24A 4AYBE 4PZ7A 1EFWA 3L4GA 1JT8A 3V7SA 3OW2A 2FXQA 1VQKA 4J15A 2ZNIA 2EQSA 4A3GH 1VQ5A 4UPAA 4P71A 3RNUA 3CQZH 2CJBA 3MXNB 4BBSH 1EIYB 2E64A 1OXTA 1N32Q 4R4OA 3CC2A 4CS2A 4YCVA 4IJHA 1EVKA 3F2BA 2NZHA 1J5WA 3RF1A 4KQEA 2YTXA 2E3CA 3CCMA 3AQQA 4GLVB 3AEVA 3S1QH 1KQSA 1UWVA 2JQOA 1UE1A 2ES2A 2DEQA 2I5HA 2JA6H 2ZZEA 1PH8A 4XTCS 1Q81C 4JI7Q 1LTLA 1VQCA 1VCIA 3M3YH 2QHVA 4H2YA 4YRSA 2UXCL 1HNWL 2GVAA 2KCMA 2J3LA 3A7UA 2VW9A 4LFAL 2L15A 5LMNQ 4FDBA 4JI6L 4KLKA 1SFOH 4CH5A 3RLOA 4JI3L 4NXML 1HZAA 3KF6B 4B3TL 3A0JA 2JEBI 4DV4Q 5ELOA 2UXDQ 2AHOB 4DAYB 2A19A 1I94L 1O7IA 5C0XI 1P8LA 4JI4Q 5GQOA 4YRQA 2ARSA 5BR8Q 4DV1Q 3L1AA 1E1OA 4LVIA 1HR0L 2UXBL 3RN2A 4NXMQ 2QA4A 1U5KA 2DU5A 4P73A 5M5XH 4JBMA 5IP7G 2ZR3A 3I4NG 1WI5A 4LF4Q 4DUYQ 4LUVA 5M3FH 1VQ9A 2G4CA 3AFPA 2ASBA 1Z47A 3PIPA 3HXVA 4K0KL 1IXRA 2IHFA 5M3FG 1Y14B 1WLEA 4K87A 1X3GA 4H2XA 4A3DG 3AYHB 4X66Q 3I4NH 1G291 4NXNQ 4YHHQ 4IFDG 3VQXA 2VQFL 3A32A 1OXXK 2I4NA 1ZQ1C 4GLXA 4LF9Q 2R6GA 1VQPA 3IALA 2ZIMA 1HC7A 2ZGWA 2DZCA 5C0XJ 1CUKA 4GOPC 4A93G 3TQYA 2BA0A 3ULLA 4C2MH 2KENA 3OTOQ 2ZT7A 1K3RA 5C51B 4HJ7A 3UGQA 1WCMG 4P73C 1K8AC 3CAMA 3HTZA 1QVFA 4LF9L 4BXXG 1WNLA 3ICAA 1X3EA 1CKMA 1YFTA 4R4TA 4YP0A 4YROA 2DTIA 4A3IH 4LNSA 4P74C 4DV2L 2PQAB 3HOYG 3KYHC 2DTOA 4HA8A 1N36Q 1QE0A 1D7QA 2HHHQ 2Z0SA 3HOXH 1IBMQ 3BZKA 1JB7A 2FYKA 2QHSA 1MKHA 3CCQA 4OWXB 3KF6A 3CW2C 4GNXC 4DPGA 4A3LG 2OQKA 4B3ML 1CKNB 3KLWA 4ZTZB 1QVCA 3JAMi 1PVOA 4X65L 1K73C 1PYSB 1CKNA 4YPFA 3DM3A 2PMZE 4LUZA 4XEOA 2JK8A 4LF6L 3HXXA 4YWLA 2Q2IA 4GN3B 5GAHC 4R4QA 1Z7NA 4A3GG 2DXUA 1KAWA 4A3FG 1JJ2A 4B3SQ 4DQ2A 2QGQA 4TTVA 4R4IA 3PF5A 1NBWA 4CS3A 5GAGC 1AE2A 3A7RA 3HOUG 2IHEA 5IYDH 2Q7GA 4QL5A 4P72C 4IOCA 4L5TA 4H02A 4WJ4A 4Q6GA 2ZINA 4PHCA 3HKSA 1N33Q 1HR0W 4JI3Q 4BY1G 3UGTA 2NN6I 3IRBA 1NYRA 3HOZH 3J81i 11ASA 4LF4L 3U4VA 3GTLH 2WFWA 1W3SA 3G48A 1X65A 4Y52H 1B70A 2K50A 4DR4Q 4DR2Q 2A8VA 4A75A 4GS3A 1I3QH 3I7FA 2ODRD 5K1PA 4LVJA 3E0EA 2EJ9A 1Y1WG 5FLMH 4A3IG 5C4JH 4HT4A 3UE1A 3CD6A 1WFQA 1Y1VH 3NBHB 3J7A5 4ZTUB 1XMQQ 1PV4A 1FJGL 4JCVE 1PFSA 1YHAA 1IBKL 3HOYH 3HXWA 1YITA 4KR3A 1TXYA 2LXJA 4AYBG 1SMXA 3F2DA 2D62A 4A3JH 3RIRA 4GKJL 5JJIA 4DV0L 2DQ3A 5IYCG 4OLFA 5IP9G 2ATWA 3CXCA 2EXDA 2YU9H 3LSQA 1UE6A 1GKHA 1P16A 1Q8KA 1NJ2A 4TWAA 4EQ5A 1IBLQ 4JYAL 4JI4L 4X62L 3D31A 2ZTCA 3F2CA 4B3MQ 2PNHA 2R7ZG 4YCUA 1NJ6A 3PUVA 3S1NH 2R93H 1XNQQ 2K52A 12ASA 4QJFA 4X6AH 2P0LA 4BY7G 1PH9A 4XTVA 1X2HA 1W66A 4XEMA 4DV2Q 1B76A 5HY6A 1HNWQ 2RHSA 1CSPA 1YNXA 4JV5Q 2J3MA 3ERRA 4P3OA 2B29A 5FLMG 4YHHL 1PH4A 4TVWA 1X55A 1YIJA 4CH6A 4BWAA 4XTZA 4PG3A 3RZDH 1KHIA 5EAYA 4H2TA 4DV7L 1JJCA 1X54A 3EN2A 4IPHA 2CCZA 2MO0A 1BIBA 3TRZA 4JBJA 5GROA 2D0PA 1PHJA 2N3SA 3K80C 1PH6A 3V8KA 4G85A 1I5FA 4QIWE 1VQLA 1G5IA 4P72A 3CCLA 4IPGA 3ZJYC 1VS0A 4BY1H 1A63A 4OXPA 3GDEA 1KL9A 5IE8A 5C44H 5JEAJ 1N34L 4QGUA 3K7AH 1IYJB 3HOUH 4LF8L 1MJEA 2ZTGA 2VUMH 3KOJA 4DV1L 1QUQB 4LF7Q 2B63G 4DV0Q 2NVYH 1V1QA 1YHBA 4XU1A 4JI1Q 1Q82C 5IYBG 3CCJA 1L0WA 4XTUA 1XPOA 4RMFA 1TWGH 3HRKA 1IBLL 4JYAQ 1C0AA 1EIFA 3P8VA 2A8EA 4DUZQ 4HWPA 4LF8Q 1X3FA 4C3JH 3PSIA 3VQWA 4P75C 2K75A 4YRCA 3S16H 3GTMH 1VQFA 2IX0A 2ID0A 5IYCH 4KHPL 1ASYA 1VQ7A 2Q5HA 5KNNA 2C8MA 2B3GA 3U4ZA 2EIFA 1I94Q 3GD7A 2JJQA 3RGLA 1VQDA 1K83H 1T9HA 4DV6Q 4H2UA 3V7CA 1BVSA 3HXYA 1WCMH 2AWOA 4DR1L 2BH2A 1G6PA 5C53B 4K0KQ 4JI0L 4JC0A 3S1RH 2CWPA 4LFAQ 4DV3L 1A8VA 4PZ8A 1YZ6A 3GTOH 5C3EG 3W1BA 5J3BA 3KDFB 2F3IA 1XMQL 4EO4A 2ZNJA 3T1HL 1H4VB 4YCWA 4YY3Q 5JEAG 1VQIA 1YJWA 1YVCA 2DVEA 3WWVA 4DR1Q 2Q7HA 1H4QA 1KD1C 3RZOH 2ALYA 4DV6L 4CH4A 4OWTB 1SESA 4TQUS 3FKIG 2D0OA 1VQ8A 3M4OH 4BA2I 1VQEA 1K9MC 2UUBQ 3FKIH 1PH5A 3PF4A 2QHTA 3A7AA 2CKZB 4C3IH 3K8AA 4GN5A 4GOPB 1YI2A 1Z7MA 3GTKH 1OTCA 3GTPH 4IO9A 2NZOA 3VDYA 1N32L 2RHSB 2K5HA 3RKYA 3PO3H 5HGQA 3VBBA 1GD7A 2KHJA 4KHPQ 3R07A 1OXSC 2OTJA 3L2ZA 1TWCH 4P71C 2C7IA 3J81j 3REXA 2HHHL 5IP7H 1XPUA 2MNAA 3G71A 5K36G 2H5XA 4RG1A 2R7FA 3M7NA 3NETA 2IX1A 4DR3L 2PI2E 3L2PA 1RL2A 3AFQA 4P75A 3L7ZC 2I4MA 3UDFA 1M1KC 2OTLA 3OD1A 4LF7L 4XTWA 4YDQA 1HZCA 3I56A 4K86A 3PO2G 5IYBH 3TUPA 1U0LA 1XMOQ 3H3VH 4TVYA 1IBKQ 3H15A 2UXCQ 1QUQA 1QZHA 1GO3E 4UP7A 4YREA 3CMEA 4CS4A 4A3BG 5IWAQ 4JOIC 5E7NA 2F4VL 3M4QA 4L5SA 3SGIA 4X64L 3WQZA 2VQEL 1HTTA 4YRPA 4DK3C 3PZCA 3RKWA 1N33L 4YWKA 1VQ4A 3PUWA 2YYZA 1N34Q 3D0FA 4JG2A 5M3MG 3LC0A 5M5WH 1SR3A 3TEGA 3QTCA 4IFDI 3IKLA 1KXLA 4XTYA 2K5VA 4E51A 1N8RC 1ADJA 1RIPA 3FHWA 2DJZA 2VS1A 2BA1A 4H2SA 2EAYA 3TS2A 3REUA 2VL6A 4A3KG 1SRUA 2HIXA 4POGA 1MJCA 2JA8G 2DTHA 3PV0A 4NCXA 1IZ6A 2ZT6A 1Q12A 3NEMA 2Q7EA 2HT1A 1XNRL 4BY7H 1KOGA 1RIQA 4IOAA 3PUXA 1NYQA 2IT1A 2VQFQ 3J80i 1NJ1A 1TWHH 3HXZA 2WAQE 3HOVH 5GADC 4WF2A 1EOVA 4QQBX 3ULPA 4JI0Q 1NJIC 2P8TA 4YRGA 1JJGA 4GNXA 2UXDL 1NY4A 2D6FC 4NPSA 2VY3A 2E5LQ 4H2XB 5FJ8H 3G4SA 4PZ6A 2DGYA 2LSSA 4JBWA 4HIKA 4G84A 2JA9A 2I5MX 1E3PA 2JA7G 3UFGA 1LUZA 2WB1G 1AH9A 2ZT8A 1K0RA 4GOPA 3CCRA 3U58A 2R7ZH 2YV5A 3GTQH 1PH2A 4HJ9A 2GVBA 4P74A 1XTDA 2N8NA 1TWAH 1I6HH 3EFSA 2XGTA 1FJGQ 2Z6KC 1NE3A 4HJAA 1FGUA 3IKMB 4JOIA 1FYFA 5AJ3L 2E2IH 4KHZA 1GVPA 3BZCA 4YRRA 4ME3A 2UU9L 3MF2A 1A0IA 4DV7Q 3RL6A 2VQEQ 2NN6G 4Y7NH 3FP9A 1EQRA 2JA6G 1VQ6A 4HIMA 4XU0A 3K81C 1EYGA 5AJ3Q 4HWTA 1Q7YC 2AKWB 1SETA 4DR7Q 3RN5A 2Q2TA 5JJKA 3IG2A 1S40A 3T1YL 3ER0A 4YWMA 2K14A 1B7YA 1HNXQ 4POFA 2EWNA 2RF4A 4LFBQ 5FJ8G 1WQWA 3JAMc 3UDGA 3H0GG 4NXNL 4A3CH 4DV5L 4RQFA 3MEFA 2R92H 3BJUA 2N78A 4L5QA 4DR5Q 5DLQE 3QNEA 2AWNA 1X56A 4MNOA 3H0GH 2QEXA 4JI6Q 2WP8J 2NVQH 1N36L 4DUZL 4PMWA 3RACA 1QVGA 1AE3A 4A3FH 3CCUA 3HKZE 2KCTA 3J7ZC 4OP0A 4UY8C 3MEYA 3J81c 2MQHA 3BFMA 4X62Q 2RHQA 4AH6A 4BA1I 1VQJA 4JI5L 3HRIA 4HJ8A 1NTGA 5LMNW 1QZGA 2PMFA 2ZTDA 3CF5A 3HKZG 3CPWA 1PH1A 4B3RL 2CIMA 3QO5A 4X65Q 4GN4B 1W2BA 4GKJQ 3HOWG 2ZJPA 4GNXB 1FL0A 4LNQA 3PO2H 3EFRA 2RCNA 2E5LL 4A3EG 3E9HA 4A3BH 4GKKQ 1ATIA 4ALPA 1Q86C 4R4CA 2I4OA 2UU9Q 4Q15A 4YRNA 4LF6Q 1KMNA 4DR5L 3TEHA 2E5AA 4HWSA 4A3JG 2HNIA 1E24A 1SERA 2CGHA 4P3PA 5ELNA 1WQ7A 2ARTA 3PCOA 1H4SA 2PMEA 2NVXH 3E9IA 3KJOA 2YTVA 5GAEC 3L0OA 1HNXL 1YGBA 1M90C 1VQMA 1Y1VG 1HNZQ 1PA6A 4ZIBA 4LFCQ 2DXTA 1UE7A 3GTJH 4HWRA 5IWAL 4DR6L 1UE5A 4A93H 4JI2L 2K5NA 3CCEA 4CH3A 2JA8H 1SE8A 3ULJA 1YBYA 5BR8L 1DGSA 2DQ0A 4IPCA 4JI1L 3HXUA 2Q5IA 3PGZA 3J80c 3A5YA 2R7DA 2DZ9A 2AKWA 2Y0SG 3CC7A 4AQYL 4B3SL 1ADYA 1USYA 4JI8Q 4WI1A 3ICEA 2ALYB 1FVIA 1VQZA 1L2FA 4A3DH 3LSSA 1YFSA 1G5HA 1V43A 1ASZA 4XTXA 1XMOL 1LM0A 3UE0A 3P8YA 3UDXA 2E2HH 4YRKA 1BBUA 2E2JH 2JE6I 4B3TQ 5C3EH 4KR2A 1XJVA 1EUJA 1A62A 1CSQA 4X66L 2UUCQ 4AIMA 4EX5A 4LF5Q 2OQ0A 3HFZA 5FLXc 3KF8B 1WOCA 2KBNA 4L5RC 3JC66 2I0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K4K A;  4XU2 A;  3HY0 A;  4JV5 L;  2HIV A;  4BBR G;  2PI2 A;  2VNU D;  3W5O A;  2WAQ G;  2UUB L;  4LFB L;  1D8L A;  2NVT H;  2XTI A;  3S2D H;  4IJL A;  1JMC A;  3EIV A;  1NMF A;  4YY3 L;  3T1H Q;  1L1O A;  1J5E L;  1VQB A;  3HOW H;  4DK6 C;  4DR4 L;  1SRY A;  1UEB A;  2B63 H;  1X01 A;  2VZA A;  1L1O B;  3M85 A;  2VUM G;  3MF1 A;  4IPD A;  5F5W A;  4DR6 Q;  2ZJQ A;  2OWO A;  3V8L A;  4C3H H;  2ZT5 A;  3G1Z A;  1PYS A;  3V7R A;  4B3R Q;  3I4O A;  3CCS A;  2P5I A;  1WPY A;  4LF5 L;  3PCO B;  4APV A;  4OX9 L;  2ZZG A;  2ZXF A;  1HR0 Q;  2UXB Q;  2MO1 A;  3RLN A;  1Z9F A;  1VQG A;  3CP0 A;  3A74 A;  3S14 H;  3B6Y A;  4R1J A;  4A3C G;  4HJ5 A;  4GKK L;  1YB3 A;  5LMN L;  2F52 A;  3HFV A;  2EJF A;  2AMC A;  2I5L X;  3K7U C;  2ZZF A;  2DUD A;  2DKG A;  3PO3 G;  1R9T H;  5C44 G;  3STB D;  2IY5 A;  3KDF A;  5C4X H;  4JI7 L;  4A4I A;  1Q1B A;  4O0A A;  4BBS G;  1IBM L;  2E41 A;  1QF6 A;  4A3M G;  2HQL A;  2E1H A;  1HNZ L;  1N9W A;  1CKO A;  4UP9 A;  2IY5 B;  1XPR A;  4WJ3 M;  4OO1 G;  1J6Q A;  1SLJ A;  3M4P A;  1X9N A;  3I4M G;  1B70 B;  1L1O C;  2E8G A;  4A3M H;  3BU2 A;  3S1M H;  1YFR A;  4L87 A;  1NNH A;  2CJ9 A;  2DDZ A;  4AQY Q;  1X2G A;  4LWC A;  2KHI A;  1S72 A;  3S2H H;  1C7Y A;  4A3E H;  5K1X A;  1WU7 A;  3I2Z A;  1YEZ A;  3RLF A;  3NEL A;  1PH7 A;  2Q2U A;  1BBW A;  2R93 G;  1IL2 A;  1GM5 A;  1TWF H;  1KMM A;  1SN8 A;  4UP8 A;  1B8A A;  4LFC L;  1SRO A;  2V1C C;  2PQA A;  3I55 A;  2JEA I;  1EIY A;  1GGM A;  3OYY A;  3V8J A;  5LMU L;  3CMA A;  5C52 B;  2RHQ B;  3VQV A;  2A1A A;  4DNI A;  3H3V I;  1HJP A;  4OX9 Q;  1G51 A;  4X64 Q;  2YTY A;  4GLA C;  3T1Y Q;  1XNQ L;  3TRE A;  4HVC A;  1E7Z A;  1HZB A;  4QY7 A;  3VQY A;  2C35 B;  4DR3 Q;  4JBK A;  3A31 A;  4OON A;  2LXK A;  2OCE A;  4BBR H;  5M5Y H;  3HY1 A;  3KJP A;  5LMU Q;  2CWA A;  1C9O A;  1VQO A;  1KC8 C;  2ODR C;  3A5Z B;  1Q1E A;  2CQO A;  1HZ9 A;  2R92 G;  1S3O A;  2QHU A;  4MTN A;  3GO5 A;  2JA7 H;  3A5Z A;  4XIG S;  2ARU A;  4YRJ A;  1VQN A;  4TVA B;  3CPF A;  1BIA A;  4DV3 Q;  3U50 C;  4RDX A;  5JJL A;  1LYL A;  4TQD A;  4KI0 A;  4OO1 I;  2GN5 A;  2ZM6 L;  3L4G B;  4TQF A;  3PIO A;  3LGJ A;  2AMC B;  1JJC B;  3PUY A;  3F1Z A;  3KFU A;  5IYD G;  2JA5 H;  4HIO A;  1E1T A;  1KRT A;  2CJA A;  1B7Y B;  4LUO A;  1K8G A;  2EJG A;  2ZM6 Q;  3CC4 A;  1XNR Q;  1USY C;  4LW1 A;  2JA5 G;  1E22 A;  3CMQ A;  2BH8 A;  4DKA C;  3RUX A;  1EVL A;  1J5E Q;  5IT9 c;  2ZTE A;  1WJJ A;  4DR2 L;  3RKX A;  3HFZ B;  1JE5 A;  5H1S E;  4JI8 L;  3S15 H;  2E10 A;  4IFD J;  2Q2H A;  1VQA A;  4P3N A;  3S17 H;  1KRS A;  5IY0 A;  3P8T A;  1HH2 P;  2UUA L;  2UUA Q;  4YRF A;  5IP9 H;  4DV4 L;  4YRI A;  3STB C;  4X5O A;  2N49 A;  4DUY L;  4NB3 A;  4YYE A;  3QO7 A;  4A3L H;  4A76 A;  2F4V Q;  4HWO A;  4DR7 L;  3Q8D A;  1OXU A;  5E3I A;  1WYD A;  1YJN A;  3HOX G;  3TS0 A;  2ZCE A;  2EL9 A;  3A5U A;  2ZIO A;  2WB1 E;  4HID A;  3M9B A;  2Z6K A;  3UDI A;  3W3S A;  3PUZ A;  5C0X G;  2MFI A;  3UH0 A;  2Y0S E;  2CFM A;  4YRT A;  3RR5 A;  3EBE A;  1EQQ A;  4XU3 A;  1I50 H;  1YHQ A;  1NMG A;  4BXX H;  3DLL A;  2DU7 A;  1KIX A;  1HXD A;  1V9P A;  2I4L A;  4YRL A;  1EWI A;  3TEH B;  1OXV A;  4RQE A;  1Y1W H;  1H4T A;  4H2W A;  4JI2 Q;  1H95 A;  2UUC L;  4K88 A;  3F8T A;  1YJ9 A;  4YRM A;  3ERS X;  4A3K H;  1Q46 A;  4DAM A;  4MZ9 A;  3NEN A;  2E65 A;  1NJ8 A;  3FJP A;  4JI5 Q;  4OWW B;  2ZR2 A;  3K0X A;  3QO8 A;  4H2V A;  3OTO L;  3I4M H;  2ZJR A;  3G6E A;  1PYB A;  3HOZ G;  1X6O A;  5M3M H;  3DSQ A;  1BKB A;  1MIU A;  3GTG H;  3W1G A;  1NJ5 A;  4O2D A;  4DV5 Q;  4BW9 A;  3CCV A;  3HOV G;  1PH3 A;  5C4X G;  4TVA A;  1VQH A;  3S24 A;  4AYB E;  4PZ7 A;  1EFW A;  3L4G A;  1JT8 A;  3V7S A;  3OW2 A;  2FXQ A;  1VQK A;  4J15 A;  2ZNI A;  2EQS A;  4A3G H;  1VQ5 A;  4UPA A;  4P71 A;  3RNU A;  3CQZ H;  2CJB A;  3MXN B;  4BBS H;  1EIY B;  2E64 A;  1OXT A;  1N32 Q;  4R4O A;  3CC2 A;  4CS2 A;  4YCV A;  4IJH A;  1EVK A;  3F2B A;  2NZH A;  1J5W A;  3RF1 A;  4KQE A;  2YTX A;  2E3C A;  3CCM A;  3AQQ A;  4GLV B;  3AEV A;  3S1Q H;  1KQS A;  1UWV A;  2JQO A;  1UE1 A;  2ES2 A;  2DEQ A;  2I5H A;  2JA6 H;  2ZZE A;  1PH8 A;  4XTC S;  1Q81 C;  4JI7 Q;  1LTL A;  1VQC A;  1VCI A;  3M3Y H;  2QHV A;  4H2Y A;  4YRS A;  2UXC L;  1HNW L;  2GVA A;  2KCM A;  2J3L A;  3A7U A;  2VW9 A;  4LFA L;  2L15 A;  5LMN Q;  4FDB A;  4JI6 L;  4KLK A;  1SFO H;  4CH5 A;  3RLO A;  4JI3 L;  4NXM L;  1HZA A;  3KF6 B;  4B3T L;  3A0J A;  2JEB I;  4DV4 Q;  5ELO A;  2UXD Q;  2AHO B;  4DAY B;  2A19 A;  1I94 L;  1O7I A;  5C0X I;  1P8L A;  4JI4 Q;  5GQO A;  4YRQ A;  2ARS A;  5BR8 Q;  4DV1 Q;  3L1A A;  1E1O A;  1HR0 L;  2UXB L;  3RN2 A;  4NXM Q;  2QA4 A;  1U5K A;  2DU5 A;  4P73 A;  5M5X H;  4JBM A;  5IP7 G;  2ZR3 A;  3I4N G;  1WI5 A;  4LF4 Q;  4DUY Q;  4LUV A;  5M3F H;  1VQ9 A;  2G4C A;  3AFP A;  2ASB A;  1Z47 A;  3PIP A;  3HXV A;  4K0K L;  1IXR A;  2IHF A;  5M3F G;  1Y14 B;  1WLE A;  4K87 A;  1X3G A;  4H2X A;  4A3D G;  3AYH B;  4X66 Q;  3I4N H;  1G29 1;  4NXN Q;  4YHH Q;  4IFD G;  3VQX A;  2VQF L;  3A32 A;  1OXX K;  2I4N A;  1ZQ1 C;  4GLX A;  4LF9 Q;  2R6G A;  1VQP A;  3IAL A;  2ZIM A;  1HC7 A;  2ZGW A;  2DZC A;  5C0X J;  1CUK A;  4GOP C;  4A93 G;  3TQY A;  2BA0 A;  3ULL A;  4C2M H;  2KEN A;  3OTO Q;  2ZT7 A;  1K3R A;  5C51 B;  4HJ7 A;  3UGQ A;  1WCM G;  4P73 C;  1K8A C;  3CAM A;  3HTZ A;  1QVF A;  4LF9 L;  4BXX G;  1WNL A;  3ICA A;  1X3E A;  1CKM A;  1YFT A;  4R4T A;  4YP0 A;  4YRO A;  2DTI A;  4A3I H;  4LNS A;  4P74 C;  4DV2 L;  2PQA B;  3HOY G;  3KYH C;  2DTO A;  4HA8 A;  1N36 Q;  1QE0 A;  1D7Q A;  2HHH Q;  2Z0S A;  3HOX H;  1IBM Q;  3BZK A;  1JB7 A;  2FYK A;  2QHS A;  1MKH A;  3CCQ A;  4OWX B;  3KF6 A;  3CW2 C;  4GNX C;  4DPG A;  4A3L G;  2OQK A;  4B3M L;  1CKN B;  3KLW A;  4ZTZ B;  1QVC A;  3JAM i;  1PVO A;  4X65 L;  1K73 C;  1PYS B;  1CKN A;  4YPF A;  3DM3 A;  2PMZ E;  4LUZ A;  4XEO A;  2JK8 A;  4LF6 L;  3HXX A;  4YWL A;  2Q2I A;  4GN3 B;  5GAH C;  4R4Q A;  1Z7N A;  4A3G G;  2DXU A;  1KAW A;  4A3F G;  1JJ2 A;  4B3S Q;  4DQ2 A;  2QGQ A;  4TTV A;  4R4I A;  3PF5 A;  1NBW A;  4CS3 A;  5GAG C;  1AE2 A;  3A7R A;  3HOU G;  2IHE A;  5IYD H;  2Q7G A;  4QL5 A;  4P72 C;  4IOC A;  4L5T A;  4H02 A;  4WJ4 A;  4Q6G A;  2ZIN A;  4PHC A;  3HKS A;  1N33 Q;  1HR0 W;  4JI3 Q;  4BY1 G;  3UGT A;  2NN6 I;  3IRB A;  1NYR A;  3HOZ H;  3J81 i;  11AS A;  4LF4 L;  3U4V A;  3GTL H;  2WFW A;  1W3S A;  3G48 A;  1X65 A;  4Y52 H;  1B70 A;  2K50 A;  4DR4 Q;  4DR2 Q;  2A8V A;  4A75 A;  4GS3 A;  1I3Q H;  3I7F A;  2ODR D;  5K1P A;  3E0E A;  2EJ9 A;  1Y1W G;  5FLM H;  4A3I G;  5C4J H;  3UE1 A;  3CD6 A;  1WFQ A;  1Y1V H;  3NBH B;  3J7A 5;  4ZTU B;  1XMQ Q;  1PV4 A;  1FJG L;  4JCV E;  1PFS A;  1YHA A;  1IBK L;  3HOY H;  3HXW A;  1YIT A;  4KR3 A;  1TXY A;  2LXJ A;  4AYB G;  1SMX A;  3F2D A;  2D62 A;  4A3J H;  3RIR A;  4GKJ L;  5JJI A;  4DV0 L;  2DQ3 A;  5IYC G;  4OLF A;  5IP9 G;  2ATW A;  3CXC A;  2EXD A;  2YU9 H;  3LSQ A;  1UE6 A;  1GKH A;  1P16 A;  1Q8K A;  1NJ2 A;  4TWA A;  4EQ5 A;  1IBL Q;  4JYA L;  4JI4 L;  4X62 L;  3D31 A;  2ZTC A;  3F2C A;  4B3M Q;  2PNH A;  2R7Z G;  4YCU A;  1NJ6 A;  3PUV A;  3S1N H;  2R93 H;  1XNQ Q;  2K52 A;  12AS A;  4QJF A;  4X6A H;  2P0L A;  4BY7 G;  1PH9 A;  4XTV A;  1X2H A;  1W66 A;  4XEM A;  4DV2 Q;  1B76 A;  5HY6 A;  1HNW Q;  2RHS A;  1CSP A;  1YNX A;  4JV5 Q;  2J3M A;  3ERR A;  4P3O A;  2B29 A;  5FLM G;  4YHH L;  1PH4 A;  4TVW A;  1X55 A;  1YIJ A;  4CH6 A;  4BWA A;  4XTZ A;  4PG3 A;  3RZD H;  1KHI A;  5EAY A;  4H2T A;  4DV7 L;  1JJC A;  1X54 A;  3EN2 A;  4IPH A;  2CCZ A;  2MO0 A;  1BIB A;  3TRZ A;  4JBJ A;  5GRO A;  2D0P A;  1PHJ A;  2N3S A;  3K80 C;  1PH6 A;  3V8K A;  4G85 A;  1I5F A;  4QIW E;  1VQL A;  1G5I A;  4P72 A;  3CCL A;  4IPG A;  3ZJY C;  1VS0 A;  4BY1 H;  1A63 A;  4OXP A;  3GDE A;  1KL9 A;  5IE8 A;  5C44 H;  5JEA J;  1N34 L;  4QGU A;  3K7A H;  1IYJ B;  3HOU H;  4LF8 L;  1MJE A;  2ZTG A;  2VUM H;  3KOJ A;  4DV1 L;  1QUQ B;  4LF7 Q;  2B63 G;  4DV0 Q;  2NVY H;  1V1Q A;  1YHB A;  4XU1 A;  4JI1 Q;  1Q82 C;  5IYB G;  3CCJ A;  1L0W A;  4XTU A;  1XPO A;  4RMF A;  1TWG H;  3HRK A;  1IBL L;  4JYA Q;  1C0A A;  1EIF A;  3P8V A;  4DUZ Q;  4HWP A;  4LF8 Q;  1X3F A;  4C3J H;  3PSI A;  3VQW A;  4P75 C;  2K75 A;  4YRC A;  3S16 H;  3GTM H;  1VQF A;  2IX0 A;  2ID0 A;  5IYC H;  4KHP L;  1ASY A;  1VQ7 A;  2Q5H A;  5KNN A;  2C8M A;  2B3G A;  3U4Z A;  2EIF A;  1I94 Q;  3GD7 A;  2JJQ A;  3RGL A;  1VQD A;  1K83 H;  1T9H A;  4DV6 Q;  4H2U A;  3V7C A;  1BVS A;  3HXY A;  1WCM H;  2AWO A;  4DR1 L;  2BH2 A;  1G6P A;  5C53 B;  4K0K Q;  4JI0 L;  4JC0 A;  3S1R H;  2CWP A;  4LFA Q;  4DV3 L;  1A8V A;  4PZ8 A;  1YZ6 A;  3GTO H;  5C3E G;  3W1B A;  5J3B A;  3KDF B;  2F3I A;  1XMQ L;  4EO4 A;  2ZNJ A;  3T1H L;  1H4V B;  4YCW A;  4YY3 Q;  5JEA G;  1VQI A;  1YJW A;  1YVC A;  2DVE A;  3WWV A;  4DR1 Q;  2Q7H A;  1H4Q A;  1KD1 C;  3RZO H;  2ALY A;  4DV6 L;  4CH4 A;  4OWT B;  1SES A;  4TQU S;  3FKI G;  2D0O A;  1VQ8 A;  3M4O H;  4BA2 I;  1VQE A;  1K9M C;  2UUB Q;  3FKI H;  1PH5 A;  3PF4 A;  2QHT A;  3A7A A;  2CKZ B;  4C3I H;  3K8A A;  4GN5 A;  4GOP B;  1YI2 A;  1Z7M A;  3GTK H;  1OTC A;  3GTP H;  4IO9 A;  2NZO A;  3VDY A;  1N32 L;  2RHS B;  2K5H A;  3RKY A;  3PO3 H;  5HGQ A;  3VBB A;  1GD7 A;  2KHJ A;  4KHP Q;  3R07 A;  1OXS C;  2OTJ A;  3L2Z A;  1TWC H;  4P71 C;  2C7I A;  3J81