4AH6A

Human mitochondrial aspartyl-trna synthetase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
589
structure length
589
Chain Sequence
PEFSSFVVRTNTCGELRSSHLGQEVTLCGWIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Thermodynamic Properties Distinguish Human Mitochondrial Aspartyl-tRNA Synthetase from Bacterial Homolog with Same 3D Architecture
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords ASPARTATE--TRNA LIGASE, MITOCHONDRIAL
total genus 117
structure length 589
sequence length 589
chains with identical sequence B, C, D
ec nomenclature ec 6.1.1.12: Aspartate--tRNA ligase.
pdb deposition date 2012-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N)
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
A PF02938 GAD GAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ah6A01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4ah6A02
3.30.1360.30 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 GAD-like domain 4ah6A03
2P0LA 2AWNA 4X64L 1GGMA 2CJBA 3V8LA 3T1YQ 3PGZA 5HGQA 4LWCA 4KLKA 4IJLA 5C3EH 1BVSA 2ARUA 5C0XG 4PG3A 4P73C 1W3SA 3PCOA 1YHBA 3K81C 4BY7G 4JBWA 3M85A 2N8NA 1IBML 2HNIA 2Q2IA 1X9NA 3UH0A 4C2MH 4GKKL 1YFSA 2EWNA 2DQ0A 2OQKA 1OTCA 1A62A 4LFBQ 2ARTA 4LFCQ 4DV2Q 4DUZL 3A74A 3NELA 4HJ7A 4TQDA 1TWGH 3REUA 3CC7A 2N78A 2QHVA 2YU9H 4ZTZB 1HC7A 2CWAA 2J3MA 3UE0A 3F2BA 3IRBA 3ULLA 2HIVA 3T1HL 1TWCH 2Q2TA 4IOAA 4X64Q 1EVKA 2Y0SE 2DTOA 1TXYA 4LFAQ 4A75A 2P5IA 1P8LA 2OTLA 3UGTA 4A3MG 3RL6A 4H2XB 4B3SQ 3KJPA 3P8TA 1FVIA 1W66A 2JA7G 4NCXA 5GROA 4DR6L 3KJOA 4LFBL 3HOVG 3HOUH 1EFWA 4DAMA 2UUBQ 4EO4A 4TVWA 2E65A 3JC66 2VZAA 4GN3B 11ASA 2K5HA 2E5LL 1EIYB 1EYGA 1HR0W 1S40A 3H3VI 5F5WA 2ID0A 1GO3E 3J80i 4YRGA 2WB1E 4TTVA 1YNXA 2CWPA 1VQNA 4PZ6A 1NJ8A 4YRPA 1E1OA 4LUVA 4KR3A 4DNIA 1PH3A 4JI8L 1JB7A 4B3SL 2GVAA 2CKZB 3CPFA 4Q15A 4CS2A 1XPUA 1SR3A 3A5UA 4RQFA 1JJGA 4A3GG 1HZ9A 1XPOA 2R7DA 4GOPB 2MQHA 4UP7A 4Q6GA 5M5XH 4OWXB 1VQZA 1E3PA 1Q8KA 1VQKA 4A93H 4OONA 1GM5A 2UXDL 1YJWA 2I5LX 1IL2A 4NXNL 2ZTGA 1WCMH 4LF5L 4JI3L 5AJ3Q 5DLQE 4XTZA 1E7ZA 4PZ8A 3PO3H 1Q46A 1XTDA 1SFOH 1PH8A 3V8JA 1AE3A 2KCTA 2R93H 3MEYA 1SLJA 1K8GA 4DR4Q 2MNAA 1LM0A 1FJGQ 4YRCA 3ERRA 4DV4L 1VQBA 2E5LQ 3HXYA 1H95A 5K36G 1AE2A 1B7YA 3RZOH 4XIGS 3ERSX 2CGHA 3IALA 4HIDA 4B3TQ 4JI5Q 3I4MH 3D31A 2WP8J 1NJ5A 3WWVA 5JJLA 2ZTEA 4GNXC 4IFDI 2CFMA 1SETA 2E2JH 1PH7A 2N3SA 1YEZA 3CCVA 4XEOA 1BIAA 3TEHB 1QE0A 3HOYG 2KENA 4OP0A 4X5OA 3HKSA 3UDFA 4DV7L 4P3OA 1QZGA 3GTJH 1Q1BA 2HT1A 3A5ZB 1SN8A 2CJAA 4A3IH 3RF1A 3E9IA 1U5KA 1YI2A 1YGBA 5IY0A 1N34Q 3CCRA 1Y14B 5FLXc 2ZNJA 2LSSA 4XU0A 4JOIC 1B76A 2F4VL 4YHHL 3S17H 2ZT8A 1AH9A 4JI7L 1X55A 2AKWB 5M3MG 1KHIA 4CS3A 3CAMA 2Y0SG 5LMUQ 2EXDA 4DR1Q 4R4OA 2OCEA 2I4NA 4GOPA 1Y1VH 5JEAJ 3KLWA 1K9MC 3HOXG 1ASYA 4YRRA 3I4OA 1JJCA 4A3JG 4X62L 1WI5A 3S1QH 1PH4A 1PH5A 1U0LA 3ICEA 2IY5B 1X54A 4RG1A 2JK8A 2J3LA 4BY1G 4A3BG 1VQPA 1FGUA 1N9WA 1PA6A 3RGLA 4H2UA 1HNZQ 4LFAL 3G48A 3S16H 1BBUA 1J5WA 4LF7L 1VQAA 2ZR2A 1VQDA 2B63G 2BA0A 2ZIMA 1KQSA 2DKGA 3VQWA 4HWPA 4CH5A 1X3EA 4DV0Q 1HR0L 1SRYA 4AYBE 1VQ5A 2DZCA 3CQZH 5ELNA 4PHCA 4A3LH 1YB3A 2AMCA 1PYBA 3EFSA 1NNHA 5M3FH 3QO7A 2ZTDA 2E5AA 2ZT6A 1OXUA 1QUQA 2P8TA 2R7ZG 4A3CG 2DGYA 2NVYH 1PYSA 1X01A 1VS0A 2D0OA 2JJQA 1WLEA 2UU9L 5IP9H 4DR1L 1YITA 1I94Q 4A3DH 4FDBA 2XTIA 4GN4B 4P75A 1KIXA 4X65L 2CQOA 3FKIG 2FXQA 4QY7A 3HFZB 2R92H 4DV3L 4R4IA 2K5VA 2VQEQ 2AKWA 4MZ9A 3PIOA 5EAYA 4IOCA 1QVGA 4DK3C 4YRJA 4PMWA 3U4VA 4R4TA 4G84A 5IYCH 1XNRL 2Z0SA 1R9TH 4H2XA 3A32A 4RMFA 1NJIC 3D0FA 1EOVA 1WQ7A 4DV6Q 4YHHQ 4XEMA 1UE6A 3PV0A 4R1JA 2JA8G 1UEBA 3RNUA 1VQOA 4AQYL 2GN5A 3CCLA 3GTOH 2ARSA 1G5HA 2PI2E 4BBSH 3RZDH 4YRTA 2RCNA 1K3RA 2Q5IA 3CCJA 2UUCL 1WYDA 2OQ0A 4J15A 2Q2UA 3J81i 1I94L 1A8VA 2N49A 4A76A 2Z6KC 1VQ7A 4NXNQ 1VQIA 4JV5Q 3CXCA 3PF5A 1UE7A 4Y7NH 5C44H 4IFDJ 4JI2Q 2JQOA 1EQQA 5IE8A 1USYC 1EUJA 4B3RQ 4OX9L 3F2DA 4CH3A 3K7AH 2VS1A 3L2ZA 3PO2H 1BBWA 4JBKA 4HJ8A 3A0JA 2AMCB 2NN6G 2KCMA 3FHWA 4LNQA 4CH6A 1ZQ1C 4LF8L 4DKAC 3CCSA 4YRKA 4DV1L 4ME3A 3TS2A 1L2FA 4NB3A 3K0XA 2UUAL 5IYBH 3S15H 1HXDA 3HXXA 2R93G 4UPAA 2ZGWA 4HWTA 2RHQB 4JV5L 2QGQA 4LF6Q 1YFRA 2BH2A 5C4JH 3V7RA 1Q81C 4X65Q 4A3EH 2IX1A 3RKXA 1Y1WG 4DR6Q 3AYHB 3I4MG 4YCWA 4YREA 1WOCA 3M4PA 3NENA 4AIMA 4DR5L 3P8VA 2QHUA 3U50C 4JI0Q 2Q5HA 1VQJA 3QO5A 3ICAA 4JBJA 3NBHB 4DV1Q 2EL9A 3G71A 2XGTA 1UE5A 4YWLA 3KF6A 4YWKA 2C7IA 2E64A 1I5FA 3A5ZA 2G4CA 3GTQH 1X6OA 1IBMQ 4HA8A 2JA5H 4LUZA 2ZZGA 3HOZH 3K8AA 3JAMc 1NMFA 3L0OA 3OTOQ 4JYAL 1NBWA 3GTLH 4BA2I 1HNXQ 3RKWA 4DV5Q 5ELOA 2I4OA 4LF8Q 2NVTH 4AH6A 4C3JH 2ODRD 3B6YA 1I3QH 4LF4L 4JI0L 2IY5A 1K73C 3S2DH 4UY8C 4L5QA 1H4QA 5JJIA 2C35B 1HNXL 1E22A 1H4SA 4TQUS 3AFQA 4X62Q 4BXXG 5GAEC 3I55A 2VUMG 4KHZA 3UFGA 2VL6A 3MEFA 2DQ3A 1C7YA 2ES2A 3V8KA 3FJPA 3GDEA 4P74C 4JI6Q 2JA7H 5E7NA 1CKOA 4IFDG 2VNUD 1N36Q 1NE3A 1WNLA 1FL0A 3UDIA 3QNEA 2IHEA 4YRQA 3K7UC 2V1CC 4MTNA 5GAHC 4GLAC 3CD6A 4GN5A 4O0AA 5FJ8G 1YFTA 1M1KC 2HQLA 2LXKA 2IT1A 1TWFH 5FLMH 4H2WA 1VQCA 1WJJA 4DR7L 4JI1Q 3PSIA 4P71A 4YY3Q 1RIQA 4KHPL 2ALYA 1SMXA 2YTVA 1E24A 2K52A 4JI8Q 5M3FG 3UDXA 3CCQA 1Z7NA 4DR7Q 5IYDG 1K83H 4K86A 2CJ9A 4YRNA 4HJAA 1G51A 1KOGA 2K4KA 1SE8A 3CMAA 4NXMQ 5JEAG 4BBRG 2PNHA 4OX9Q 4R4QA 1A0IA 2JA6H 4CS4A 3BZKA 2QEXA 2QA4A 3KF8B 3EFRA 2JA9A 3MF2A 3M3YH 4GKJL 4KQEA 2BH8A 3RUXA 1EWIA 4L5TA 1B70B 3GTGH 1LUZA 2ZINA 1HNZL 5LMNW 1WQWA 1QF6A 1VQHA 4YCUA 3GO5A 4HWRA 3BFMA 4DAYB 3MF1A 4A3FH 2OWOA 1HTTA 1USYA 3H0GG 3A7RA 1SERA 1HH2P 4YY3L 3E0EA 2DU5A 4QQBX 4A93G 3HOVH 3HOUG 2VQFL 3R07A 4P72C 2F3IA 2VY3A 1OXTA 3RLNA 1S72A 4YRSA 1JMCA 2QHSA 1J5EQ 2NZHA 4EX5A 3CC4A 2EQSA 4OWTB 4K0KL 3QTCA 4DPGA 3PUZA 4L87A 1J6QA 2DXUA 3V7SA 1CSQA 1PFSA 4X66Q 2Z6KA 1S3OA 4JCVE 1PYSB 1LTLA 1EIFA 1OXXK 1HJPA 1A63A 4K88A 4WF2A 1Q1EA 4DV2L 4DK6C 3L4GA 1JE5A 1GD7A 2MFIA 2RHQA 3S1RH 3KFUA 1V43A 4P72A 3RLFA 5M3MH 2B29A 3RLOA 4B3RL 4JYAQ 1Q7YC 2I4MA 2CCZA 4DQ2A 3HOYH 2F4VQ 4TVAA 2UU9Q 2F52A 5C0XJ 2K5NA 2ZT5A 1I50H 3BZCA 4UP8A 1H4TA 3HOXH 2DVEA 4Y52H 3VQXA 2DUDA 3KDFA 4X66L 2YV5A 3EIVA 4A3KG 4XU1A 1SRUA 1O7IA 5C3EG 3W5OA 4HJ5A 3TUPA 1Q82C 5C53B 4BY1H 4A3BH 1GVPA 5C52B 2D0PA 4BY7H 1IYJB 4JI4L 1OXVA 3TRZA 3HOWG 1HNWL 4GLVB 2DJZA 4JOIA 1N34L 4YROA 4DR2L 4YRMA 3VQVA 3I2ZA 2PMZE 5IP7G 2DU7A 3I4NG 3REXA 4JI6L 1YBYA 3HFZA 4POFA 4GNXA 4JI2L 1XPRA 1NYQA 3EN2A 4K87A 4LF5Q 2I5MX 1IBKQ 2Q7GA 4RQEA 4DV4Q 4E51A 4DV3Q 3EBEA 3CW2C 1V9PA 4A3JH 5C4XH 2ZCEA 1TWHH 2UUCQ 4P73A 4G85A 4B3TL 1IBKL 1KXLA 1XMOQ 4YPFA 2IX0A 2CIMA 4ALPA 3PUWA 3CMEA 5HY6A 2FYKA 4DUZQ 3G4SA 4H2YA 1MIUA 4C3HH 2EJGA 3T1YL 2D6FC 3HRKA 2JE6I 1G291 3PUVA 5LMNL 1HZBA 4A4IA 4HWOA 4BXXH 1VQ4A 4LF7Q 3F8TA 3PUYA 3BU2A 3TEGA 2R92G 4PZ7A 4DR4L 4DUYQ 3RACA 3A5YA 2OTJA 3VQYA 1JJ2A 2VW9A 1KRTA 4XTYA 3U4ZA 1PV4A 1NJ2A 2ZZEA 3LSSA 1SROA 3IG2A 2I5HA 1D8LA 2R7ZH 2Q2HA 1WU7A 4IPGA 4H2TA 4P74A 3S1NH 1JJCB 2JA8H 1L1OB 1IXRA 3HRIA 4JBMA 12ASA 3SGIA 5LMNQ 1XMQQ 2K50A 1GKHA 3AFPA 2R6GA 1X56A 1FYFA 3NEMA 3G1ZA 2HHHQ 2ASBA 2UXBL 4IPDA 3HXZA 4KR2A 4IJHA 2I0QA 3KF6B 4HWSA 5J3BA 5IYDH 3AEVA 2ZIOA 4O2DA 1N33L 4A3LG 1MJCA 4LW1A 4P3PA 3TS0A 2PMFA 2PQAB 4A3MH 4JI1L 1C9OA 4K0KQ 3PIPA 1KMNA 4A3CH 4XTWA 4XU3A 4BBRH 1VCIA 2A8VA 1EVLA 2A1AA 3IKMB 2GVBA 3HFVA 1KC8C 4TWAA 4A3GH 2ZZFA 2NN6I 3HXWA 3H3VH 2MO0A 2UXCL 1K8AC 2PI2A 1CKNA 3DM3A 3FKIH 3ZJYC 1W2BA 3CCEA 3W1GA 1J5EL 1WCMG 2DZ9A 1QVFA 2D62A 4H02A 1QVCA 3PO3G 1I6HH 4MNOA 1VQEA 4A3EG 1Z9FA 4JI5L 5IT9c 4GKJQ 3HY1A 3PO2G 3OW2A 2ZNIA 3CCMA 5AJ3L 3HKZG 4APVA 4WI1A 4P75C 3OYYA 1IZ6A 1NJ1A 1DGSA 4IPCA 2BA1A 3KDFB 2A19A 2AWOA 2HHHL 1X2GA 2WAQE 1YHAA 2Q7EA 1SESA 1VQ9A 2UUBL 3J81j 1N32L 1NTGA 4DV7Q 1WFQA 3QO8A 2IHFA 4LNSA 4IPHA 4DR5Q 3G6EA 2RHSB 2MO1A 2E1HA 3J80c 3AQQA 1PH6A 1VQGA 4XU2A 3RR5A 3T1HQ 3HOZG 3J81c 4A3IG 4GNXB 3BJUA 3HY0A 4NXML 1RIPA 4TQFA 2K75A 1PH9A 3WQZA 2EIFA 5GAGC 5K1PA 4BWAA 1N33Q 1H4VB 3OD1A 3P8YA 3HXVA 1P16A 3U58A 2B3GA 3HXUA 2YTXA 5M5YH 4GLXA 1YHQA 2UXBQ 4ZTUB 1NMGA 4KI0A 5E3IA 2ZM6Q 4XTXA 1VQLA 3ULPA 2NVQH 4XTCS 2VUMH 3S2HH 3L7ZC 2DTHA 1Y1VG 4YRFA 2JA5G 2EJ9A 5M5WH 1B70A 2NVXH 3STBC 2QHTA 4BW9A 1XMOL 3HOWH 3ER0A 1YVCA 1UE1A 5IWAL 3V7CA 2L15A 1X3GA 1HZAA 4QJFA 4P3NA 1X3FA 2DDZA 1CKMA 1Z7MA 4YYEA 3MXNB 4HIOA 4YRLA 3F1ZA 4JC0A 2EAYA 1C0AA 4JI3Q 2Q7HA 1VQFA 1E1TA 1HZCA 2C8MA 2E2IH 3PUXA 5FJ8H 2R7FA 3RIRA 3CC2A 4KHPQ 3CMQA 2DXTA 3UE1A 5C4XG 3A7AA 3GTMH 3GTPH 4TVYA 3M4OH 1N36L 2UUAQ 2JEAI 3L1AA 1QUQB 3HKZE 2ZJQA 1HNWQ 4AQYQ 5JJKA 4DR3Q 1M90C 3S24A 3KYHC 2NZOA 2ZXFA 5C51B 1X2HA 1YIJA 4YRIA 3DSQA 5KNNA 4GS3A 2WB1G 1N32Q 3L4GB 4OO1I 3A7UA 4HIKA 4QGUA 4LF9L 3RN5A 1B7YB 2ZM6L 5GQOA 1XJVA 4WJ3M 3RN2A 1X65A 4LUOA 4R4CA 3ULJA 2E3CA 4AYBG 2KBNA 1BIBA 5C0XI 2JA6G 1NY4A 5GADC 2PMEA 2B63H 2EJFA 5FLMG 2PQAA 4JG2A 3I56A 4BBSG 2VQEL 1WPYA 4POGA 2AHOB 1NJ6A 3JAMi 1Z47A 4DR2Q 4YWMA 1Q12A 2E10A 4C3IH 1XNRQ 4TVAB 3VDYA 1PH2A 1CKNB 2WFWA 4LF6L 3J7A5 2ZJPA 3S14H 1EQRA 4P71C 4QL5A 3KOJA 1ASZA 5C44G 1OXSC 1FJGL 4LF4Q 4DV0L 1HR0Q 4UP9A 3CCUA 2H5XA 4A3FG 4GOPC 3OTOL 2JEBI 4OWWB 5K1XA 3H0GH 2K14A 1D7QA 3J7ZC 1PH1A 4ZIBA 4XTVA 3PF4A 1MJEA 4X6AH 4HIMA 4DR3L 5IP9G 3I7FA 4YCVA 4JI4Q 4A3DG 2RHSA 2ZT7A 1L1OC 2DTIA 1TWAH 1ATIA 3CF5A 3UDGA 4LF9Q 3PCOB 1ADYA 3Q8DA 3A31A 1JT8A 3TREA 1VQ6A 3M7NA 1V1QA 4XTUA 5IYCG 4WJ4A 3E9HA 4DV5L 1CUKA 2I4LA 1YJNA 3FP9A 1CSPA 3CPWA 1T9HA 1RL2A 4BA1I 4OO1G 2UXCQ 1KD1C 4L5RC 4EQ5A 2YYZA 4YDQA 3GTKH 3W3SA 4DV6L 5H1SE 3IKLA 4B3ML 1KRSA 1KMMA 1N8RC 2VQFQ 1G5IA 1BKBA 3M9BA 1MKHA 5BR8Q 3CP0A 2ZR3A 1VQ8A 5IYBG 3NETA 1VQMA 4GKKQ 2ATWA 3S1MH 3F2CA 4B3MQ 4JI7Q 3L2PA 1L0WA 1KAWA 1L1OA 2E41A 2YTYA 2E8GA 5LMUL 4OLFA 1XNQL 2UXDQ 1B8AA 3GD7A 3TEHA 1PHJA 2KHJA 4DUYL 1YZ6A 1IBLL 4L5SA 2ZTCA 4NPSA 1K0RA 5IP7H 4RDXA 4YP0A 4IO9A 1ADJA 2DEQA 2ALYB 1KL9A 1QZHA 4LFCL 2WAQG 5BR8L 1IBLQ 1PVOA 3H15A 1YJ9A 1G6PA 2RF4A 4A3KH 3K80C 2KHIA 4QIWE 3LC0A 3TQYA 3UGQA 3STBD 3M4QA 3PZCA 1UWVA 3RKYA 3DLLA 2ODRC 3HTZA 1LYLA 4HVCA 4HJ9A 1Y1WH 1Q86C 5IWAQ 3LGJA 1NYRA 3LSQA 1XNQQ 1EIYA 4H2VA 3I4NH 1XMQL 2E2HH 4H2SA 3VBBA 3W1BA 2HIXA 4CH4A 2LXJA 4OXPA 2ZJRA
chains in the Genus database with same CATH superfamily
1EEID 2P0LA 2AWNA 4X64L 1GGMA 1QNUA 5ISRA 2CJBA 3V8LA 4BXXC 3T1YQ 5EPKA 3BVMA 3PGZA 4IUTA 2R7ZB 4YIJA 4LK1A 5HGQA 4LWCA 2F0UA 3AD8C 4KLKA 4IJLA 5C3EH 1IYUA 1BVSA 2ARUA 1F9PA 1JQYD 1I3QB 4KDDA 3FHZA 2YU9C 3BDLA 5C0XG 2GAGC 4PG3A 1BXTA 3J81L 2G5DA 1ISEA 4P73C 2ICEC 1W3SA 1F2LA 2Q8IB 3PCOA 1YHBA 3K81C 4BY7G 4JBWA 3S17K 3BDOA 3M85A 2N8NA 1IBML 1Y8NB 2HNIA 1S5ED 1QCBD 2Y0SD 2Q2IA 2L0CA 1X9NA 2B63A 4CJ1B 3HKZL 3UH0A 4C2MH 4GKKL 1YFSA 2EWNA 3S17C 4KN4C 2XIWA 3PO2B 3GTJA 2DQ0A 2OQKA 2KQ3A 4NOIA 1OTCA 1A62A 1ZYRD 4LFBQ 2ARTA 1VMPA 4LFCQ 2NB0A 1O2AA 4DV2Q 3TP7A 4DUZL 1B3QA 4DN4M 1SNCA 2K32A 5KGUA 3A74A 3NELA 3GTGB 4HJ7A 4MIUA 1TWGH 4TQDA 5C4JC 4OIRA 3REUA 3CC7A 2N78A 1R9TB 2QHVA 1BGWA 2YU9H 4ZTZB 5EBCA 1HC7A 2CWAA 2TMPA 1JWSD 2J3MA 5NUCA 2E2DC 4Q5SA 1PYWD 3IFTA 2H1EA 3FVQA 4XLPA 4B9WA 1G2TA 1SYDA 3G6JB 3X3MA 2ZFZA 1LT5D 3UE0A 2NTSA 3IRBA 3F2BA 4ZQ3A 3PMFA 3ULLA 1J6WA 3C3LA 4LAAA 1EY8A 2HIVA 3T1HL 2K28A 4XLNA 1TWCH 5IP9K 2Q2TA 4IOAA 4X64Q 1EVKA 2NVYK 2Y0SE 3GV6A 2K5QA 2DTOA 2QDBA 1EIHA 1TXYA 3CRKC 3ITPA 4OEMB 4LFAQ 4A75A 2P5IA 1P8LA 1SXTA 2OTLA 4A3MG 3RL6A 1I4QA 4DK1A 4B3SQ 4H2XB 3UGTA 1CT1D 2XRSD 1WTHA 1G8ZD 2FINB 3KJPA 3GTPA 4A3JB 3GTMA 4L63B 3P8TA 1FVIA 2AQ1B 3TZDA 1W66A 2B2TA 2JA7G 4NCXA 1ILPA 4A3EB 3WOFA 5GROA 1JB3A 1F2ZA 3I4MB 1D2BA 1PTOF 1DCOA 2E2IA 4WILA 5FO9B 2NVQC 4P9SA 4ZLTF 5C4ZA 4DR6L 4NW2A 3KJOA 3RD4A 1WVLA 1UAPA 4LFBL 3HOVG 3HOUH 3I4NK 2LKVA 2C9OA 1EFWA 3T51B 4DAMA 5IOSA 1RHPA 2R93K 2UUBQ 4V190 4EO4A 2L1BA 4TVWA 3CRLC 2E65A 3HP3A 2B2VA 1ET6A 1FR3A 3JC66 4YG2A 1V8QA 2VZAA 4GN3B 4J1MA 2K5HA 2E5LL 11ASA 4K8IA 4BLAA 1EIYB 1EYGA 1STYA 1HR0W 1FYCA 1S40A 2XRQD 4LVMA 3H3VI 5CYUA 5F5WA 1TWFA 2ID0A 1GO3E 1IKLA 3PQIA 3J80i 2WB1E 2NS6A 1RJTA 4YRGA 4A3CC 2NWGA 4TTVA 1QOHA 2FMMA 1O25A 3LAPA 4OELB 3RMHA 1O26A 1YNXA 3NTKA 3R93A 2CWPA 1VQNA 4PZ6A 1NJ8A 4YRPA 1E1OA 2A6HC 4I65A 4LUVA 5E3FA 2WAQL 4KR3A 1PTOD 4JW0A 3S2DC 4A3CK 4DNIA 2SNMA 1PH3A 4A3KK 4HMIA 4JI8L 5DM63 1UV7A 4KV6A 4DNRB 3AB9A 1JB7A 4B3SL 2GVAA 2CKZB 1QNKA 3CPFA 4Q15A 2LFNA 1DOLA 1UEAB 4CS2A 1SYFA 1XPUA 2A74C 1SR3A 4MN3A 3A5UA 3DHQA 1JJGA 1BUVT 1FNVA 4RQFA 1SYBA 5M5YK 3HOYB 4A3GG 1HZ9A 4A3KC 4S3SA 1XPOA 4BY7K 1DONA 2R7DA 4GOPB 2MQHA 4UP7A 4Q6GA 3I73A 4OWXB 5M5XH 1VQZA 5IP9C 3QJYA 3T01A 4WFN3 1E3PA 1Q8KA 1VQKA 4A93H 4RKBA 3GTKA 2RSOA 1R4PB 4C2MB 4OONA 1DJRD 1GM5A 2UXDL 3TMEA 2XWJB 4O42A 1O29A 4BY7C 4BLBA 1TWGA 1YJWA 2I5LX 5EKKA 2MHVA 4LVKA 4L6TB 3TZUA 1IL2A 4NXNL 3K58A 3H0GA 3R8BA 2ZTGA 4Y52K 1WCMH 4LF5L 4JI3L 5AJ3Q 4KY7A 4EQOA 5DLQE 2JA7C 4F7XA 4XTZA 1E7ZA 3FRPB 4PZ8A 2F0NA 3MXPA 3PO3H 1Q46A 1HFNA 1XTDA 5C3WA 5HURA 3D4RA 1GUWA 1A2UA 1SNDA 3GEIA 3S1NC 1SFOH 1PH8A 3V8JA 1AE3A 1XZQA 1YNND 2KCTA 2R93H 3W3AA 3MEYA 5J39A 1SLJA 1K8GA 1C8CA 4DR4Q 1EIGA 2EYFA 3VR4A 2MNAA 4CDFC 3M7GA 4F88A 1LM0A 1FJGQ 4YRCA 4DAVA 3ERRA 2K33A 4DV4L 5CR3A 4DDQA 1VQBA 2E5LQ 3HXYA 1H95A 5K36G 3AQOA 1AE2A 1CZGA 1B7YA 3TFIA 5CBEE 3RZOH 4IUVA 4XIGS 3ZYYX 3ERSX 2CGHA 3IALA 4HIDA 1I4GA 4B3TQ 5FLMK 4JI5Q 1O28A 3S16K 3I4MH 3AD7C 3T53B 2F0HA 3D31A 5C5MA 2WP8J 1NJ5A 4QIWD 3WWVA 2K03A 5EQ0A 5JJLA 1B50A 3GTQA 2SNSA 2ZTEA 1B4OA 1MD2D 4GNXC 1D1IA 1PZKD 5E1FA 4IFDI 2CFMA 3C2PA 2PPBC 1SETA 3KBGA 2E2JH 1PH7A 2N3SA 1YEZA 3CCVA 4XEOA 1BIAA 1JR0D 3TEHB 1QE0A 3HOYG 4A3GB 1Q90A 2KENA 4OP0A 2NTTA 4X5OA 2NVXB 4C3JC 3HKSA 3UDFA 4DV7L 4P3OA 2NUCA 1S5DD 1QZGA 3GTJH 1ESFA 1SNMA 1Q1BA 2A8EA 1INNA 3TTGA 5BN5A 1TWGK 1CI3M 1AZPA 2HT1A 3A8IE 3A5ZB 1SN8A 3A54A 5JVG3 2CJAA 5AFWA 4A3IH 3RF1A 3N0BA 2F3WA 3E9IA 3MTSA 1U5KA 1YI2A 1AZQA 3S2HC 3NTIA 1YGBA 4ZUIA 5IY0A 3H3VC 1TWHC 1TWGC 1N34Q 1EU3A 3VR3A 4LJZA 3CCRA 1Y14B 1PJ6A 3D6CA 5FLXc 5EBDA 1T5EA 3NBHA 2EYPA 4DAPA 2ZNJA 2LSSA 4XU0A 1YNNA 4JOIC 1B76A 5T1IA 5C4XK 2F4VL 4TKOB 3HG9A 4CDDC 1B9NA 4G7OA 3SR1A 1SAPA 5I2XA 1RODA 1TWHK 3MXUA 1PRTB 4YHHL 3H94A 3S17H 2ZT8A 4A3JK 4J8QA 1AH9A 2XVSA 4GTLA 3HOWK 4JI7L 1SFOK 1Y1VB 4EVOA 3G4AA 4RGNA 3SVMA 3MAQA 3GTPB 3GTMB 1VMCA 1X55A 2E2HA 2AKWB 5M3MG 3SDZA 2FQTA 1QB5D 1QE6A 1KHIA 3IAYA 4CS3A 2JA7A 2R92B 3CAMA 2DY7A 1SFOC 4BBRK 2Y0SG 5LMUQ 2EXDA 4ULLA 4DR1Q 4ILWA 4R4OA 2OCEA 1TT2A 3H0GC 2I4NA 4GOPA 4FF2A 1IW7C 5CV4A 4I7ZC 1Y1VH 1B4BA 3S14B 1CHQD 5JEAJ 4H0LC 2PA8L 4BKWA 1EL0A 3KLWA 4A3DC 1K9MC 3HOXG 1ASYA 4G4KA 4YRRA 3I4OA 1JJCA 4A3JG 5ELDA 4KHVA 1NCVA 1WI5A 4X62L 3S1QH 1PH4A 1PH5A 1PFNA 1U0LA 2AQ2B 3ICEA 2JA6K 2IY5B 1X54A 3N6RA 4RG1A 2JK8A 4RHRA 2J3LA 1WIHA 4BY1G 4A3BG 2KJXA 1VQPA 2JA5K 4LJZC 1EH1A 1FGUA 1TY0A 1TWFB 5D65A 1N9WA 1PA6A 1I4PA 3RGLA 2HQEA 4H2UA 4DXGA 1HNZQ 5IGDA 3TP5A 1HA6A 1SFOA 4LFAL 5ELFA 3G48A 3S16H 1BBUA 4GTDA 5CJ9A 1J5WA 4A3LK 4LF7L 4JK1A 1VQAA 4OIOA 4CJ2C 1PLFA 3HOVB 1VQDA 2ZR2A 3M4OC 4M8AA 1EQVA 2B63G 1G91A 2BA0A 2R92K 2ZIMA 2B39A 1KQSA 2DKGA 3VQWA 3G4CA 3C46A 4HWPA 2EYHA 5C3XA 4R8IA 1TWAB 1XWEA 4CH5A 2R7ZK 4ZAIA 1X3EA 4DV0Q 1HR0L 4IQZA 1SRYA 1S5BD 3SK6A 1WTOA 1YNNC 1WTXA 4AYBE 2LS01 1PXUA 1XZPA 1EFID 3RZOC 2EVBA 1VQ5A 2DZCA 1WTPA 3CQZH 3HOWC 1VF7A 5ELNA 4PHCA 3K7AB 2RGRA 4A3LH 1YB3A 3SZYA 3P1HA 5EGTA 4B9XA 1PJ7A 4ILDA 3NUCA 4X3TA 1EY5A 2NZ1D 2AMCA 1PYBA 3EFSA 2EYOA 1NNHA 1F77A 2VUMB 3SE0A 5M3FH 4HT4A 3QO7A 2ZTDA 2E5AA 1KLUD 2ZT6A 1OXUA 4C3IB 1QUQA 3Q0AA 2P8TA 2R7ZG 4A3CG 2A6EC 3DEPA 2DGYA 3S0XA 2NVYH 5C5LA 1PYSA 2E2JK 1X01A 2PMZD 1VS0A 2D0OA 1U4PA 1K8MA 5M5XK 5C3EB 2JJQA 3I4LA 2ZT9C 1WLEA 4FNFA 2NVTC 2UU9L 2AUJD 5IYCC 5IP9H 1A3TA 4DR1L 1USMA 1SSOA 2B63K 3HKZD 1YITA 1I94Q 1VRQC 1XPPA 3TFHA 4A3DH 4FDBA 2XTIA 4CGYB 3KF8A 3GTGA 4GN4B 4P2CB 5A2QE 1WQFA 4LR2A 4P75A 1A2TA 1KIXA 3TP8A 3D8GA 1EZ8A 3PO2C 2BOSA 1KTKA 4J6HA 4KC6A 3LX0A 2PO4A 4X65L 2CQOA 3FKIG 1SMYD 1A3UA 3EFXD 2I46A 3VR2A 2V6TA 2FXQA 4QY7A 3SHLA 3HFZB 3S1MK 3I3CA 1J98A 2R92H 4DV3L 4R4IA 2K5VA 2VQEQ 3IKJA 3K7AK 3K59A 3PO2K 2H4OA 1Y8OB 2AKWA 4MZ9A 3PIOA 5IGCA 5EAYA 3KLRA 2NVYC 1R9TC 4IOCA 3HOXB 1QVGA 4DK3C 1Z6HA 4YRJA 4A3FK 1ML0D 2KCCA 3EVQA 4PMWA 2EDGA 3U4VA 2J0TD 4R4TA 4C2MK 4G84A 5IYCH 1XNRL 2Z0SA 1R9TH 1LTID 1CZWA 4QUCA 4H2XA 1ENCA 5JVOA 3A32A 2K7VA 4RMFA 1S5CD 5CORA 1NJIC 3D0FA 1EOVA 3S1QB 1WQ7A 3QR8A 4DV6Q 2EJMA 4YHHQ 5C44K 5E4WC 1ILQA 3S9WA 3D6WA 5C3EK 2NVQK 4DU9A 4XEMA 1UE6A 3PV0A 1SE2A 1TWCB 5FO8B 4R1JA 2KVMA 2JA8G 4KD3A 1UEBA 3RNUA 1VQOA 1PRTD 2WAQB 4AQYL 2GN5A 1VGXA 2QW7A 3CCLA 1LTRD 3GTOH 2ARSA 1G5HA 1H9RA 2PI2E 4BBSH 3RZDH 1ESRA 2CH4A 2RCNA 4YRTA 2P5MA 3S1QK 1XYIA 1K3RA 1XXGA 1E2ZA 2Q5IA 1XXAA 3CCJA 2UUCL 1WYDA 2Z1CA 2F1MA 3VYTA 2OQ0A 4J15A 2Q2UA 3J81i 1I94L 2CVRA 2KOLA 5I6WA 1JC7A 4DAYA 4KMHA 3A7LA 4CHTB 1CFMA 1W6JA 2QCPX 4LK1C 1A8VA 1TY2A 1O78A 4XYQA 2RCFA 2N49A 4A76A 2Z6KC 1VQ7A 4NXNQ 1VQIA 3U9OA 4JV5Q 3CXCA 1D1KA 1PTOB 3L9AX 3PF5A 2O5IA 1BDOA 1GOZA 5HGTA 4CJ0B 1UE7A 4Y7NH 5C44H 4K14A 4C3HC 3U9SA 3FDTA 4IFDJ 5HL8A 4JI2Q 2JQOA 3K5LA 1EQQA 1KDBA 5TMCA 2SOBA 5IE8A 5M5WK 4ZRZA 4Y7NC 1USYC 1EUJA 4B3RQ 4OX9L 5M3MB 5EGEA 3HOYK 2PA8D 3F2DA 4CH3A 3K7AH 2LY7A 3NP8A 2WKCA 1GUTA 3S15C 1H9JA 2WIIB 4KY5A 1I6HC 2F0TA 2VS1A 4HSPA 1W6KA 4XXEA 3NQIA 5FOBB 1EY9A 2KECA 3L2ZA 1EI6A 1DCZA 4G7ZC 3PO2H 4CDCC 1BBWA 4JBKA 4JVZA 4HJ8A 3A0JA 2AMCB 3S1MB 1J8IA 3BYYB 2NN6G 2KCMA 2A68D 5M3MK 1SMYC 2RBMA 3FHWA 2BCOA 1WD1A 4LNQA 2F0QA 4CH6A 2JA5A 1Y1VA 1ZQ1C 4LF8L 4OIKA 1GE9A 1EWHA 2QILA 4DKAC 1CTMA 3CCSA 4YRKA 1U4MA 4DV1L 4ME3A 1EWCA 3TS2A 5CHPA 1L2FA 4NB3A 2ICIA 3V2TA 3K0XA 2UUAL 2M00A 1EYAA 2QDLA 1R9TA 1M4VA 3EQLA 1YNJA 2G9HD 3KLSA 5JAVA 5IYBH 1I50A 3S15H 1HXDA 3HXXA 1I3QC 2R93G 4RFBA 4UPAA 2A68A 3R3OA 2ZGWA 3ERQA 4HAEA 1QG7A 3NK9A 4HWTA 2RHQB 1TWCK 2A6ED 4JV5L 2QGQA 5JPMC 4LF6Q 1YFRA 2BH2A 4MEXA 5C4JH 2L11A 2DY8A 1Y1WB 1DD5A 4LVIA 1OO9B 2JA7K 2XCRB 5IGBA 4Z9CB 1F9NA 2R93C 3BP8C 3V7RA 1Q81C 5I2YA 4X65Q 3CQZK 4A3EH 2IX1A 5C4HA 3OW7A 5I4DA 3I4NB 3A8IA 3FKIA 2NVXA 3RKXA 4GTBA 4ZYSA 1CQVA 1Y1WG 3VYSA 3LAJA 2ZXOA 4DR6Q 3VR5A 3AYHB 3I4MG 4YCWA 1WOOA 4YREA 1WOCA 4K8JA 4QUFA 3M4PA 3S16C 3NENA 3DM1A 3CQZC 4AIMA 1B9MA 4DR5L 3H6MA 3P8VA 1F9RA 1JOKA 2QHUA 3K6OA 3U50C 4JI0Q 2EY1A 5EGHA 2NVXK 2Q5HA 2FJ2A 1VQJA 3QO5A 3ICAA 4JBJA 3NBHB 4DV1Q 2EL9A 2N88A 3G71A 2K1BA 2XGTA 1UE5A 3S2DK 3RZDB 4C3JK 2X6LA 4YWLA 3KF6A 4YWKA 2HCIA 1K83A 3A55A 1PDQA 1HPCA 1YNJC 3OPOA 3HZXA 1EU4A 2C7IA 3MWYW 1J9OA 2E64A 1ZVUA 3GEHA 3GTLB 4XT3B 2A6HD 5D14A 1I5FA 2D5DA 3A5ZA 2E2HB 2G4CA 3GTQH 1X6OA 1IBMQ 4BBSC 1ZXTA 5LHY1 2JA5H 4HA8A 4A3GC 4LUZA 2ZZGA 5M5YB 4C3JB 3RZDK 1Y1WA 3NTHA 3HOZH 3K8AA 5C44B 3JAMc 2HDMA 3Q22A 3I91A 1NMFA 1DCPA 3L0OA 4BBSK 3OTOQ 1Y1VK 2ENBA 5J1ZA 5DM73 3FEWX 1NBWA 3GTLH 4JYAL 1I4RA 2DN8A 4BA2I 1WTVA 2CHBD 2E2HK 1HNXQ 3GTQB 3RKWA 4DV5Q 4XDXA 5ELOA 1LV9A 3S2HB 2I4OA 4LF8Q 2NVTH 1B4AA 1TWGB 4AH6A 4C3JH 1FGBD 2ODRD 3BS1A 1IW7D 5DEHA 2YU9B 3QOJA 3N52A 3Q3QA 3B6YA 2A73B 1I3QH 4DA2A 4LF4L 3OEPA 4JI0L 2IY5A 1K73C 3S2DH 3S1NK 4BBRC 3DWPA 3NPPA 3OMCA 4L5QA 4UY8C 1NNXA 2EJFC 1XXBA 2V6UA 2K01A 2EOTA 1H4QA 4XCHA 2AQ3B 2L12A 2C35B 4MTKA 5JJIA 4P5AA 1HNXL 2CW0A 5IORA 1E22A 1HCZA 1X32A 4TQUS 1H4SA 1MBYA 2FMCA 3AFQA 1ICWA 1ENFA 4G7HA 4C3IG 4X62Q 3S17B 4BXXG 4PAAA 2M9VA 5GAEC 1I50C 3I55A 2VUMG 2ZUEA 1V5VA 4KHZA 3UFGA 2VL6A 2WACA 1IKMA 3MEFA 3NWTA 2JA8B 2JYOA 4A3IK 2DQ3A 5FLMC 3HOUK 1C7YA 3LNNA 2KEEA 3H0GK 4G7HC 3FKIC 2ES2A 5TSSA 2F0JA 3H3VD 3QG1A 4BY1C 4A3BC 3K57A 3V8KA 3H09A 1BO0A 3H91A 4A3KB 3FJPA 3GDEA 4A3DK 3OSOA 5D3IB 5FO7B 4JI6Q 3CU7A 2JA7H 5E7NA 4P74C 4H44C 1CKOA 4IFDG 2VNUD 4KMDA 3H3VL 1VDZA 3E0JA 2EZVA 2WINB 1N36Q 3HS0C 1NE3A 4IZ8A 2F0MA 1WNLA 1FL0A 3UDIA 4OINA 3QNEA 3SK5A 2IHEA 4YRQA 5IP7K 5M3FK 5G3LD 1LO5D 3K7UC 2V1CC 1I3QA 4CKCA 1O7YA 4MTNA 2RDGA 4GLAC 5GAHC 3CD6A 1TWFC 1TWCA 3I8ZA 3I4MK 1LT6D 4GN5A 4O0AA 3BG3A 4A3JC 5FJ8G 1YFTA 1M1KC 2X6GA 2HQLA 2LXKA 2IT1A 1WTWA 1TWFH 3OMGA 5FLMH 4H2WA 1VQCA 4DF7A 1WSVA 2PNRC 4A3EC 1WJJA 4DR7L 4GTCA 4G0UA 4JI1Q 2CQAA 4K5VA 5CV8A 4GTAA 1F7VA 1XZQB 3PSIA 4P71A 3HOZC 4YY3Q 1D6EC 1RIQA 4KHPL 5C4XC 1U9RA 2ALYA 1SMXA 3HXAA 2YTVA 3E5SA 1TWAC 1Q3LA 3HOUB 1E24A 1Z7TA 2K52A 4FP5D 4JI8Q 4PQXA 5M3FG 3UDXA 3CCQA 1Z7NA 3M3YC 1SNOA 4RGMA 4DR7Q 5J22A 5IYDG 3MMLB 1K83H 3GEEA 4K86A 4PV1C 3VYUA 4KN4A 2CJ9A 1LLRD 1TWAK 2VB3X 3HOWB 4YRNA 2BE5A 2KA7A 3T56B 4HJAA 5G3LF 2JA5B 4OIJA 1TR5A 1ONLA 1G51A 1UNSA 1KOGA 1C48A 2KHSA 4GT9A 2K4KA 1A15A 1SE8A 3PIP3 1EQTA 3CMAA 4NXMQ 2K6AA 4HN7A 5JEAG 3GTKK 4OL7A 4BBRG 2PNHA 1BF4A 1EYDA 3V05A 4OX9Q 4R4QA 4A3IC 5DAUA 1O24A 1A0IA 2EBBA 3SK8A 1X3QA 4HTHA 1KNEA 2JA6H 4CS4A 3BZKA 3MXNA 2PCFB 2QEXA 2QA4A 3KF8B 5KNBA 4A3LC 4FXDA 3E6ZX 1BJTA 3EFRA 2JA9A 1EYCA 3MF2A 3M3YH 4NMZA 4ME5A 1SNPA 2JA6C 1VLOA 5KYIA 3A8KE 2Y0SL 1TKWB 1IE0A 4A93K 1SE4A 5FJ8K 3R2TA 2RDHA 4GKJL 4KQEA 2BH8A 3RUXA 5TMFA 5IYBC 1EWIA 4FF3A 2R7ZC 3DWAA 4DXFA 4L5TA 2BDOA 4HMJA 1K8OA 1B70B 1BDFA 5IP7C 3LWUA 3GTGH 1IL8A 3K5NA 5KYLA 1LUZA 4KY6A 2ZINA 2Z9HA 1WCMC 1HNZL 1ZBSA 3K5OA 5LMNW 1MSGA 1WQWA 2ZXRA 1QF6A 1VQHA 4XSZA 3A8JE 4YCUA 2R7ZA 3GO5A 3BFMA 4DAYB 3MF1A 4HWRA 3PO3C 4A3FH 4MQ9A 2OWOA 1VF5C 1HTTA 1USYA 1R9TK 1ET9A 2P5ZX 3H0GG 2LMCB 1PJ5A 5K36H 3A7RA 1SERA 1WOSA 1J6XA 1HH2P 1A3VA 4A3FC 2E76C 3C1FA 2F0GA 4YY3L 3E0EA 2B2VC 5L46A 5ELBA 2DU5A 4QQBX 4A93G 3HOVH 3HOUG 1TWAA 2VQFL 2B2WA 1SFOB 3R07A 4P72C 1VJEA 4N8X1 4A3MK 3D3RA 4BWGB 1USOA 2F3IA 2VY3A 1F93A 1OXTA 4X6AK 4KJNA 2IWHA 3ONAB 3GTGC 4WRDA 2KWAA 3RLNA 2NVTK 1S72A 4YRSA 2MP1A 1AEXA 1JMCA 1BBXC 4OIPA 3Q24A 1X31C 5IGFA 2QHSA 2EE1A 1J5EQ 5CV5A 1TS5A 1A6XA 2NZHA 4EX5A 3NQTA 1VH2A 3CC4A 4LK0A 4AYBB 2EJGC 2EQSA 4OWTB 4K0KL 3QTCA 4DPGA 3PUZA 1SDFA 4L87A 2E2JC 1J6QA 1SYEA 1QWYA 2I07B 4RAUC 2F0LA 2DXUA 1NUCA 1CSQA 3V7SA 1PFSA 1LACA 2B2TC 2PW7A 2Z6KA 4X66Q 2EY5A 1S3OA 4K5WA 4CKEA 1WCMA 2O5JA 2A6EA 2WB1B 1R4QB 4JCVE 2B63C 1PYSB 3QB3A 1LTLA 2RQXA 4RHSA 4RCNA 4G0WA 1GUGA 1EIFA 1Y69U 1OXXK 3MZ5A 3GTJC 4DFAA 1HJPA 1A63A 4K88A 4WF2A 4GTEA 1K83B 4C3HB 1YCLA 2HDLA 1Q1EA 3C1EA 4DV2L 2NVQB 4DK6C 1GJXA 2EPBA 3L4GA 1JE5A 1GD7A 4OO1H 1LTTD 2MFIA 5COYA 3E3XA 2QKIC 2RHQA 3S1RH 2PMZL 3KFUA 2A5HA 1V43A 4P72A 3RLFA 1SEBD 3ND8A 5M3MH 2B29A 2EYMA 3RLOA 4B3RL 1CQFA 4JYAQ 4HEDA 4BS9A 1Q7YC 2Z6BA 3V96A 1XZPB 5FK9C 2I4MA 3S1RK 3QIAA 4RA8A 2CCZA 3MHBA 4DQ2A 3HOYH 1HQRD 2F4VQ 4TVAA 2UU9Q 5IOTA 2F52A 5C0XJ 1U4LA 2K5NA 2ZT5A 2F0WA 5CBAE 2B8GA 1I50H 3BZCA 4UP8A 3N3YA 1H4TA 3HOXH 2DVEA 4Y52H 3VQXA 1WTQA 1BS2A 1EZ6A 1PMRA 2DUDA 3KDFA 3OIQA 4X66L 5C6AA 1DOKA 2YV5A 3EIVA 4A3KG 4X6AC 1SRUA 4XU1A 1RKNA 1O7IA 3GTGK 2Q8TA 5C3EG 3DUZA 3MEHA 1GUNA 1RF2D 3W5OA 4HJ5A 3DXJA 3TUPA 3JAML 2F0DA 4HCEA 1Q82C 2E2IB 4BY1H 5KNDA 4A3BH 5C53B 1LT4D 1U4RA 1GVPA 2XNAC 4C3HK 5C52B 3AQPA 2D0PA 4BY7H 1IYJB 4JI4L 1OXVA 3TRZA 4KARA 3HOWG 2B2WC 4RGOS 3HOYC 4C1NI 1KNAA 2V6SA 4C1NK 1HNWL 3HRZC 4GLVB 2DJZA 4JOIA 1N34L 1I6HK 4YROA 4DR2L 4YRMA 3VQVA 2F0SA 2B2YA 2EYJA 3W2DA 3I2ZA 2PMZE 3MVVA 1IW7A 4AYBD 5IP7G 2M2LA 5ELCA 3I4NG 2DU7A 3REXA 4BY7B 2NVYA 4JI6L 1YBYA 3HFZA 1NSNS 1RD9D 3CQZB 3OPFA 4POFA 4AYBL 4GNXA 3VA7A 4JI2L 1XPRA 3J7AV 4K5XA 1NYQA 3EN2A 4K87A 2I5MX 4LF5Q 4FXKC 1IBKQ 2Q7GA 4RQEA 4DV4Q 4E51A 3I70A 1BCPF 4DV3Q 4G0VA 3EBEA 3CW2C 1V9PA 4N9PA 4A3JH 5C4XH 1EOTA 3HOVC 2ZCEA 1TWHH 4DK0A 2UUCQ 1TS3A 4XT1B 4P73A 4G85A 4B3TL 5F2DA 2PPBA 5K5PA 2R92A 1JCKB 1H9SB 1IBKL 1KXLA 3S1RC 1XMOQ 3S2HK 2K04A 5A35A 4YPFA 2IX0A 4OHJA 2CIMA 2RH6A 4RCOA 1GUSA 1PRTF 2E2HC 4ALPA 3PUWA 2IX3A 3CMEA 5HY6A 3TP6A 2FYKA 4DUZQ 5L37A 3G4SA 4FYDA 3T4AC 4H2YA 1MIUA 3OIPA 4C3HH 1TU2B 2EJGA 3T1YL 2D6FC 3HRKA 2JE6I 4M1UB 1G291 3PUVA 5LMNL 5IYDK 1HZBA 1DZ1A 4A4IA 3KLSX 1RCVD 4HWOA 3VYRA 4KASA 4BXXH 1VQ4A 3LWEA 4LF7Q 1DXMA 3S14K 4WORA 4F87A 5BN4A 1STHA 3F8TA 3PUYA 3BU2A 1MGSA 1I50K 4KAWX 3TEGA 1YNJD 2RA4A 4LVJA 4RGTA 2R92G 1HI9A 4C3IK 5IT9L 4PZ7A 4DR4L 4DUYQ 3MXGA 5KRUA 3RACA 4Y7NB 3A5YA 2OTJA 4LQYA 3VQYA 1JJ2A 3A8JA 2VW9A 1KRTA 4XTYA 4ID6A 3U4ZA 3AU7A 3G7LA 4KKTA 3KUPA 1EY7A 1PV4A 3S1NB 1NJ2A 2ZZEA 3LSSA 1O2BA 3OOCA 1SROA 3IG2A 4FXGC 2I5HA 4IFDH 1D8LA 2R7ZH 2Q2HA 1JOOA 2FFKB 1WU7A 1T5XD 2F0VA 1BCPB 4IPGA 4H2TA 2JA8C 1F9SA 3PIO3 1AP0A 3A7AB 1EEFD 5IGGA 3X3NA 4KMUA 1G2SA 2A69D 3HOVK 4P74A 3D4DA 1JJCB 2R3ZA 2JA8H 1L1OB 1IXRA 3S1NH 3BUEA 1STEA 3HRIA 4JBMA 2BE5C 3GTMC 3GTPC 12ASA 4PNYA 1CA5A 3SGIA 2XCOA 4FM9A 4WJWA 3QOLA 5LMNQ 4HR7B 4PMBA 1XMQQ 1JWMD 2K50A 1GKHA 4Q4ZA 2A69C 3AFPA 2R6GA 1X56A 2SDFA 2R92C 1FYFA 3GTPK 3CHBD 3GTMK 4E6IA 3NEMA 3G1ZA 2WKDA 3GTLA 2HHHQ 2ASBA 2UXBL 3Q23A 3GTOA 2AUKA 2VB2X 4IPDA 4QCLA 3HXZA 2WB1D 4KR2A 4UHVA 4IJHA 2I0QA 4K2KA 3KF6B 3I4MC 4HWSA 5J3BA 5IYDH 3AEVA 1XXCA 2ZIOA 4O2DA 3IL8A 1N33L 4A3LG 2L4NA 3M3YK 4RH6A 1MJCA 4LW1A 4P3PA 5KEEA 5IYDC 4KMUC 2W7VA 1S4ZA 2DNCA 2E74C 3TS0A 3GTQK 3GTKB 2PMFA 2PQAB 5EJWA 4A3MH 4XQNA 4JI1L 1C9OA 1EY0A 5JOBA 3PIPA 4K0KQ 1KMNA 4A3CH 4XTWA 4XU3A 4BBRH 1VCIA 3D4WA 2A8VA 1RDPD 1LTAD 3MC0B 4B08A 2A1AA 3HKZB 4EQNA 1BQQT 1GHKA 1EVLA 4OIQA 2F0PA 2NBFA 1RTNA 1UUPA 1X3PA 4IURA 1LTBD 4V0BA 3IKMB 1Q8IA 4MHEA 4KATA 2GVBA 2K5DA 3HFVA 5IODA 1KC8C 1JQWA 4TWAA 5KNCA 4A3GH 5IYCK 3J80E 3K0YA 5M3FB 2ZZFA 2NN6I 3HXWA 2JA5C 1KDCA 3J7AF 1D5MC 3H3VH 2MO0A 1B53A 3EROA 1V1PA 4KKSA 4G7OC 1G6ZA 3ADAC 3KK7A 2UXCL 4TSSA 3I90A 1K8AC 3T02A 4IUNA 3GIRA 3GSIA 1WTRA 2PI2A 2WAQD 3BZDB 4DNTB 1CKNA 3DM3A 1JOQA 3DXJC 3FKIH 4G7ZA 2RSNA 4A3IB 3ZJYC 4NKLA 1K83K 2VUMK 1W2BA 3BP3A 3NSWA 3CCEA 3W1GA 2O4XA 2QEJC 3F2UA 5CV7A 1GUOA 1J5EL 5CV6A 1WCMG 4P5BA 2DZ9A 2OT2A 3S1MC 4FZBA 1SBBB 5TJ3A 3MFGA 1QVFA 1O2FB 4KB2A 3HOZK 2D62A 4H02A 1QVCA 3PO3G 3EA6A 1I6HH 1HUNA 1B44D 3GTOK 3QO2A 4MNOA 2XWBB 1JVIA 3K5MA 2PYKA 4U68A 3T16A 5LL6S 2EY2A 5IYBK 1VQEA 3L4JA 4LLGA 4A3EG 2JH3A 1Z9FA 4JI5L 1SMYA 4YFXA 4DGZA 5IT9c 4GKJQ 3HY1A 3PO2G 3GTOC 1SE3A 3OW2A 2ZNIA 3CCMA 3V4GA 2K5WA 5AJ3L 3HKZG 4APVA 3CQZA 2NVTB 5C3EC 2NN6H 2GA4B 4WI1A 3OYYA 1IZ6A 1NJ1A 4P75C 1DGSA 4IPCA 2BA1A 3KDFB 4XQQA 2F0KA 2Y0SB 3P20A 2A19A 2YU9K 1O80A 2AWOA 2HHHL 2CFAB 3RZOK 1X2GA 3HOXK 2WAQE 1YHAA 4ZCKA 2R93B 2Q7EA 1CK1A 3SEBA 1SESA 2WB1L 4A3FB 5CGKA 1VQ9A 2UUBL 3M4YA 3EJIA 3DWQA 3NXWA 1HTPA 1F2MA 1MI2A 3J81j 3AMUA 2CH4W 2D9UA 1N32L 1NTGA 1DM0B 4A93B 4DV7Q 2XSCA 3HGBA 1WFQA 3MA2B 4GZYC 3QO8A 3URYA 4A3MC 2DJFC 3A56A 2IHFA 4LNSA 4X3SA 1FNWA 4IPHA 4DR5Q 3RZOB 2OXPA 4K6LA 3G6EA 1Y8PB 2RHSB 1ZEQX 2MO1A 2E1HA 3EQLC 3J80c 3AQQA 1PH6A 3P75A 3J7YW 1VQGA 1L0YB 4XU2A 3N0CA 4KM9A 3RR5A 1LTSD 3T1HQ 2F0FA 1SNQA 1MHWC 3J81c 3HOZG 1DYQA 3GTJK 3WOEA 4Y7NK 4KB4A 4A3IG 4K2LA 4GNXB 1ENAA 3BJUA 5I6YA 3HY0A 3OHXC 4J3NA 2E2JB 2Q8RE 4NXML 2VUMC 1RIPA 4TQFA 2GAHC 3AH5A 3S15K 2BDNA 2K75A 1PH9A 3WQZA 2EIFA 5GAGC 5K1PA 2GSOA 1TQOA 4BWAA 1F7UA 4XYOA 4QMGA 1N33Q 1H4VB 4ZK9B 4C3JG 3OD1A 3P8YA 3HXVA 2B2UA 1P16A 4OGQC 3M4OK 5FKAC 2JA6A 3U58A 2B3GA 2CFAA 3HXUA 4UAIA 2YTXA 2F3VA 3DMUA 5M5YH 1I4XA 5C44C 4GLXA 1YHQA 3HOZB 2UXBQ 4IUQA 4ZTUB 2WV6D 4LVLA 2HD3A 1NMGA 4KI0A 5E3IA 2ZM6Q 4XTXA 1VQLA 3ULPA 1ZYRA 2NVQH 4KD4A 4KN7A 4C2MC 4HSVA 4XTCS 2IJ0A 4I7AA 3GV3A 1HA5A 1LABA 2VUMH 1ICFB 3S2HH 2KCNA 3L7ZC 4M1XA 5JPNC 1HUMA 3QWNA 2DTHA 4QJVA 1Y1VG 4YRFA 2JA5G 2EJ9A 1PFBA 3NUHA 3P7JA 2NVYB 5M5WH 1B70A 3HOXC 2NVXH 3STBC 2QHTA 4IN3A 1XX8A 4BW9A 3CAGA 4EGVA 5IOQA 4GTFA 1XMOL 3HOWH 3ER0A 1YVCA 3S15B 2B2UC 2JP1A 4G57A 1UE1A 1XTCD 1GXDC 4KK7A 4F8MA 5IWAL 2L15A 1I6HB 3V7CA 1X3GA 1HZAA 5C0XH 1TWHA 4QJFA 4P3NA 1I50B 3S1QC 1X3FA 2DDZA 1CKMA 3SK4A 4GZYA 1Z7MA 5BN3A 5JFEA 4YYEA 1GHJA 3MXNB 2A68C 3RUZA 5C4JB 4R9WA 4HIOA 1NR4A 4YRLA 1E2WA 3F1ZA 4JC0A 2EAYA 1C0AA 3NWSA 1STGA 4JI3Q 2Q7HA 1VQFA 1E1TA 4KN7C 4H7BA 2JA6B 4QIWB 4ZH4A 5EKIA 1HZCA 5M5XB 2C8MA 3BYTB 2E2IH 3PUXA 3J81E 5FJ8H 2R7FA 3FPPA 1KLGD 1KAAA 3CC2A 4KHPQ 3CMQA 3RIRA 2DXTA 2RKSA 1LT3D 3UE1A 2KUMA 4HCSA 5C4XG 2D2CC 3A7AA 3GTMH 3GTPH 4TVYA 5C4JK 3M4OH 3VR6A 1N36L 2UUAQ 2JEAI 3L1AA 2L5TA 1QUQB 3HKZE 2ZJQA 1WCMB 1F2YA 1HNWQ 1AN8A 2IL8A 4CDEC 4AQYQ 1F9QA 5JJKA 1TVXA 4DR3Q 1IQ0A 3LPXA 5E4XA 3S24A 1M90C 3KYHC 2F0OA 2NZOA 3BDCA 1E0BA 4FO2A 3PO3B 2ZXFA 5C51B 4KMAA 2VUMA 1JOEA 1Y1WC 3SXHA 1X2HA 5JVH3 1RU0A 1YIJA 3M4OB 4YRIA 5E68A 3DSQA 5KNNA 1WSRA 4GS3A 1STNA 2WB1G 1N32Q 3L4GB 4OO1I 3A7UA 4HIKA 3I4NC 1PZJD 3OWFA 4JPBW 3IFDA 4QGUA 1ZKOA 3RN5A 4LF9L 1B7YB 3TBIB 3J80L 2ZM6L 2J4XA 3NHHA 5IIFA 5C4XB 1C4QA 5GQOA 1XJVA 4WJ3M 1AW7A 3RN2A 1X65A 2PZTA 5FLXE 4LUOA 5EKLA 4R4CA 3ULJA 1B3AA 2E3CA 4AYBG 3IPJA 4CKBA 1CA6A 3M3YB 3FOFA 4RWSC 1L0XB 2KBNA 1EY6A 3MQZA 5CMDA 4FVMA 1BIBA 5C0XI 2JA6G 1NY4A 5GADC 2PMEA 4UDUC 2B63H 2EJFA 5FLMG 2PQAA 4XSXA 4NDXA 1HFGA 4Y52C 4JG2A 3I56A 1WD0A 2VQEL 4BBSG 4QIWL 3BVGA 1WPYA 2OEOA 2AHOB 4POGA 1K0SA 1NJ6A 3TDQA 3JAMi 1Z47A 4PMCA 4DR2Q 4YWMA 1Q12A 2E10A 4C3IH 1K3BC 1SYGA 1B2TA 1XNRQ 1FD7D 4TVAB 3VDYA 1PH2A 1CKNB 2WFWA 4LF6L 3J7A5 3GTLC 3S2DB 2ZJPA 3S14H 1BCPD 1H9SA 4X3UA 2B63B 4N8FA 4N9TA 1EQRA 4P71C 1O7LA 3H0GB 1D5ZC 4QL5A 5LL6X 3KOJA 2TSSA 3GTJB 1ASZA 4Q0FA 3FOEA 4NP5A 5C44G 3S14C 4H13C 1KQ4A 1OXSC 2J7ZA 1ZYRC 2PQEA 3GTLK 1FJGL 4LF4Q 1D5XC 4A3DB 4DV0L 1HR0Q 1EY4A 4UP9A 2CW0C 5CV9A 3CCUA 2H5XA 2R61A 4A3FG 1RTOA 2Z4IA 4GOPC 1S5FD 5M5WB 3OTOL 2JEBI 5JEAH 4OWWB 4QJVB 5K1XA 1EK8A 3H0GH 1HXYD 2K14A 1DD2A 1D7QA 3J7ZC 3CKIB 2PZWA 1PH1A 4ZIBA 4XTVA 3PF4A 1HQMA 1MJEA 2EXZA 4X6AH 4HIMA 4DR3L 4GFQA 5IP9G 2F0EA 4ZKCB 3I7FA 1I6VC 4YCVA 1Y1WK 1BCPC 2GSUA 2JA7B 1JICA 2JN4A 4JI4Q 4A3DG 2RHSA 2ZT7A 3GDZA 1IBAA 1CM9A 1SYCA 1L1OC 2DTIA 3FPUB 2Z4HA 2Z8LA 1TWAH 1ATIA 5I9OA 2PZUA 4A3GK 3CF5A 3UDGA 4LF9Q 3RZDC 3TN2A 4JK1C 1I3QK 3PCOB 1ADYA 3L4KA 3A8KA 3Q8DA 4LMQD 1IHZA 2F4IA 3A31A 3T13A 2L55A 3T00A 1JT8A 5IT9E 3TREA 1V1OA 1TS4A 5ELEA 1VQ6A 4FF1A 2IPKD 2V4DA 1TWCC 3M7NA 2RDFA 3WODA 1V1QA 1V1PB 2MPMA 4FF4A 4MEYA 2EY6A 1NAPA 2R93A 4XTUA 4BBSB 4BY1B 4A3BB 5IYCG 1WQGA 3AD9C 4WJ4A 3E9HA 4DV5L 1CUKA 5CC4A 1IYVA 2I4LA 2SEBD 2HUGA 5T1GA 2O5IC 1AB4A 3TSSA 2FQOA 1YJNA 3FP9A 1CSPA 4K6DA 1O7ZA 4Q5VA 3CPWA 3R2IA 1T9HA 1RL2A 4BA1I 1IS1A 3GQBA 4OO1G 2UXCQ 3GTKC 2JSOA 1BNZA 1KD1C 4L5RC 3GTQC 4C3IC 1SJHD 5DNFA 2MUYA 4EQ5A 4BY1K 4A3BK 4ABNA 2YYZA 4L8JA 4YDQA 1PTOC 1JORA 3GTKH 2A69A 2ZUFA 2NVXC 1DOMA 3BVZA 2C5CA 3W3SA 2OF1A 4ZKBB 2BE5D 4DV6L 2Y3PA 4CBVA 4BBRB 5H1SE 2F03A 3IKLA 3I72A 4B3ML 1K83C 1KRSA 2KEDA 1KMMA 1N8RC 2VQFQ 1G5IA 4X3KA 1BKBA 3M9BA 1BOSA 1JWUD 4IUUA 1MKHA 5BR8Q 3CP0A 1M8AA 5EPLA 5M9OA 2JA8K 3NBIA 1QJOA 5I9PA 2ZR3A 3JSTA 1TWHB 5IGEA 1VQ8A 3SZZA 3KBXA 3QX3A 3S1RB 5IYBG 3NETA 1HQMC 2B8FA 1VQMA 4GKKQ 2ATWA 3S1MH 4KM8A 4EQPA 3F2CA 4B3MQ 4JI7Q 1WORA 4ODGA 3L2PA 1TS2A 2IW3A 1HTLD 2PHCB 2XN9C 2B2YC 1L0WA 5JJZA 2QF7A 1KAWA 1SJED 1PRTC 1PTOH 3FKIB 1BR9A 3JAME 2DNEA 3ERED 1L1OA 3PO3K 1Y1VC 2E41A 2YTYA 1TWFK 1E2VA 2E8GA 1KABA 2N55A 3L3OC 4ZUJA 5LMUL 3UI2A 2DJGC 1XNQL 4OLFA 2UXDQ 1B8AA 1PZID 3GD7A 3OREA 1I6VA 3TEHA 4IALA 1H9MA 3TFJA 2K05A 1WOPA 1PHJA 1J6VA 4QF4A 2KHJA 2CW0D 4DUYL 2EYLA 1YZ6A 1IBLL 4L5SA 4BXXK 2G9DA 1CHPD 1PFMA 4NPSA 2ZTCA 4YFNA 1K0RA 5IP7H 2E75C 3GTOB 4RDXA 5KIXA 4YP0A 2E2IC 2MJ8A 2JXMB 4IO9A 1ADJA 3Q6SA 1KDAA 1QILA 2MGSA 4TRDA 2DEQA 3WDNA 2ALYB 1KL9A 1QZHA 4YFKA 4KJOA 4LFCL 2WAQG 3NE5B 4C56C 2E2IK 2GSNA 4O1NA 5BR8L 5EPJA 1IBLQ 1PVOA 2RVLA 1DCHA 3H15A 1YJ9A 5A2QL 1G6PA 2RF4A 4IUPA 3K80C 4A3KH 5D4DA 2KHIA 4QIWE 4KKUA 1LTGD 3GP7A 1FNUA 3LC0A 3S16B 3TQYA 3HOUC 4A93C 4KTAA 3FKIK 3OWEB 4A3MB 3ND9A 1STAA 3UGQA 2L9HA 1TIID 3STBD 2NYZD 1ZXOA 3M4QA 2X69A 5IOCA 3PZCA 1UWVA 2XCQA 1B1ZA 2O2LD 1YX2A 3RKYA 1I4HA 4C45A 3MFYA 4RKLA 3DLLA 2FHTA 2ODRC 2PMZB 3HTZA 1LYLA 4HVCA 3VA5A 4HJ9A 2PW5A 1WCMK 1Y1WH 1Q86C 1MSHA 3FMCA 5IWAQ 1HHVA 3LGJA 1NYRA 1O27A 2YU9A 2F0IA 3LSQA 1AFPA 1XNQQ 1NR2A 4R8NA 1H9KA 4C3HG 1EIYA 4H2VA 3O13A 1JE4A 3I4NH 5D3DA 1HRJA 1II3A 4LOWA 2A6HA 2O5JC 3HEJA 1XMQL 2E2HH 4H2SA 3VBBA 2ZXPA 3W1BA 2VXWA 2HIXA 4CH4A 3DEOA 4A3EK 4PABA 2HCCA 3K7AC 1STBA 4QB4A 1K28A 2LXJA 4XQJA 1WQHA 4U673 4OXPA 5FLXL 2ZJRA
chains in the Genus database with same CATH topology
2P0LA 2AWNA 4X64L 1GGMA 2CJBA 3V8LA 3T1YQ 3PGZA 5HGQA 4LWCA 4KLKA 4IJLA 5C3EH 1BVSA 2ARUA 5C0XG 4PG3A 4P73C 1W3SA 3PCOA 1YHBA 3K81C 4BY7G 4JBWA 3M85A 2N8NA 1IBML 2HNIA 2Q2IA 1X9NA 3UH0A 4C2MH 4GKKL 1YFSA 2EWNA 2DQ0A 2OQKA 1OTCA 1A62A 4LFBQ 2ARTA 4LFCQ 4DV2Q 4DUZL 3A74A 3NELA 4HJ7A 4TQDA 1TWGH 3REUA 3CC7A 2N78A 2QHVA 2YU9H 4ZTZB 1HC7A 2CWAA 2J3MA 3UE0A 3F2BA 3IRBA 3ULLA 2HIVA 3T1HL 1TWCH 2Q2TA 4IOAA 4X64Q 1EVKA 2Y0SE 2DTOA 1TXYA 4LFAQ 4A75A 2P5IA 1P8LA 2OTLA 3UGTA 4A3MG 3RL6A 4H2XB 4B3SQ 3KJPA 3P8TA 1FVIA 1W66A 2JA7G 4NCXA 5GROA 4DR6L 3KJOA 4LFBL 3HOVG 3HOUH 1EFWA 4DAMA 2UUBQ 4EO4A 4TVWA 2E65A 3JC66 2VZAA 4GN3B 11ASA 2K5HA 2E5LL 1EIYB 1EYGA 1HR0W 1S40A 4LVMA 3H3VI 5F5WA 2ID0A 1GO3E 3J80i 4YRGA 2WB1E 2NS6A 4TTVA 1YNXA 2CWPA 1VQNA 4PZ6A 1NJ8A 4YRPA 1E1OA 4LUVA 4KR3A 4DNIA 1PH3A 4JI8L 1JB7A 4B3SL 2GVAA 2CKZB 3CPFA 4Q15A 4CS2A 1XPUA 1SR3A 3A5UA 4RQFA 1JJGA 4A3GG 1HZ9A 1XPOA 2R7DA 4GOPB 2MQHA 4UP7A 4Q6GA 5M5XH 4OWXB 1VQZA 1E3PA 1Q8KA 1VQKA 4A93H 4OONA 1GM5A 2UXDL 1YJWA 2I5LX 4LVKA 1IL2A 4NXNL 2ZTGA 1WCMH 4LF5L 4JI3L 5AJ3Q 5DLQE 4XTZA 1E7ZA 4PZ8A 3PO3H 1Q46A 1XTDA 1SFOH 1PH8A 3V8JA 1AE3A 2KCTA 2R93H 3MEYA 1SLJA 1K8GA 4DR4Q 2MNAA 1LM0A 1FJGQ 4YRCA 3ERRA 4DV4L 1VQBA 2E5LQ 3HXYA 1H95A 5K36G 1AE2A 1B7YA 3RZOH 4XIGS 3ERSX 2CGHA 3IALA 4HIDA 4B3TQ 4JI5Q 3I4MH 3D31A 2WP8J 1NJ5A 3WWVA 5JJLA 2ZTEA 4GNXC 4IFDI 2CFMA 1SETA 2E2JH 1PH7A 2N3SA 1YEZA 3CCVA 4XEOA 1BIAA 3TEHB 1QE0A 3HOYG 2KENA 4OP0A 4X5OA 3HKSA 3UDFA 4DV7L 4P3OA 1QZGA 3GTJH 1Q1BA 2A8EA 2HT1A 3A5ZB 1SN8A 2CJAA 4A3IH 3RF1A 3E9IA 1U5KA 1YI2A 1YGBA 5IY0A 1N34Q 3CCRA 1Y14B 5FLXc 2ZNJA 2LSSA 4XU0A 4JOIC 1B76A 2F4VL 4YHHL 3S17H 2ZT8A 1AH9A 4JI7L 1X55A 2AKWB 5M3MG 1KHIA 4CS3A 3CAMA 2Y0SG 5LMUQ 2EXDA 4DR1Q 4R4OA 2OCEA 2I4NA 4GOPA 1Y1VH 5JEAJ 3KLWA 1K9MC 3HOXG 1ASYA 4YRRA 3I4OA 1JJCA 4A3JG 4X62L 1WI5A 3S1QH 1PH4A 1PH5A 1U0LA 3ICEA 2IY5B 1X54A 4RG1A 2JK8A 2J3LA 4BY1G 4A3BG 1VQPA 1FGUA 1N9WA 1PA6A 3RGLA 4H2UA 1HNZQ 4LFAL 3G48A 3S16H 1BBUA 1J5WA 4LF7L 1VQAA 2ZR2A 1VQDA 2B63G 2BA0A 2ZIMA 1KQSA 2DKGA 3VQWA 4HWPA 4CH5A 1X3EA 4DV0Q 1HR0L 1SRYA 4AYBE 1VQ5A 2DZCA 3CQZH 5ELNA 4PHCA 4A3LH 1YB3A 2AMCA 1PYBA 3EFSA 1NNHA 5M3FH 4HT4A 3QO7A 2ZTDA 2E5AA 2ZT6A 1OXUA 1QUQA 2P8TA 2R7ZG 4A3CG 2DGYA 2NVYH 1PYSA 1X01A 1VS0A 2D0OA 2JJQA 1WLEA 2UU9L 5IP9H 4DR1L 1YITA 1I94Q 4A3DH 4FDBA 2XTIA 4GN4B 4P75A 1KIXA 4X65L 2CQOA 3FKIG 2FXQA 4QY7A 3HFZB 2R92H 4DV3L 4R4IA 2K5VA 2VQEQ 2AKWA 4MZ9A 3PIOA 5EAYA 4IOCA 1QVGA 4DK3C 4YRJA 4PMWA 3U4VA 4R4TA 4G84A 5IYCH 1XNRL 2Z0SA 1R9TH 4H2XA 3A32A 4RMFA 1NJIC 3D0FA 1EOVA 1WQ7A 4DV6Q 4YHHQ 4XEMA 1UE6A 3PV0A 4R1JA 2JA8G 1UEBA 3RNUA 1VQOA 4AQYL 2GN5A 3CCLA 3GTOH 2ARSA 1G5HA 2PI2E 4BBSH 3RZDH 4YRTA 2RCNA 1K3RA 2Q5IA 3CCJA 2UUCL 1WYDA 2OQ0A 4J15A 2Q2UA 3J81i 1I94L 1A8VA 2N49A 4A76A 2Z6KC 1VQ7A 4NXNQ 1VQIA 4JV5Q 3CXCA 3PF5A 1UE7A 4Y7NH 5C44H 4IFDJ 4JI2Q 2JQOA 1EQQA 5IE8A 1USYC 1EUJA 4B3RQ 4OX9L 3F2DA 4CH3A 3K7AH 2VS1A 3L2ZA 3PO2H 1BBWA 4JBKA 4HJ8A 3A0JA 2AMCB 2NN6G 2KCMA 3FHWA 4LNQA 4CH6A 1ZQ1C 4LF8L 4DKAC 3CCSA 4YRKA 4DV1L 4ME3A 3TS2A 1L2FA 4NB3A 3K0XA 2UUAL 5IYBH 3S15H 1HXDA 3HXXA 2R93G 4UPAA 2ZGWA 4HWTA 2RHQB 4JV5L 2QGQA 4LF6Q 1YFRA 2BH2A 5C4JH 4LVIA 3V7RA 1Q81C 4X65Q 4A3EH 2IX1A 3RKXA 1Y1WG 4DR6Q 3AYHB 3I4MG 4YCWA 4YREA 1WOCA 3M4PA 3NENA 4AIMA 4DR5L 3P8VA 2QHUA 3U50C 4JI0Q 2Q5HA 1VQJA 3QO5A 3ICAA 4JBJA 3NBHB 4DV1Q 2EL9A 3G71A 2XGTA 1UE5A 4YWLA 3KF6A 4YWKA 2C7IA 2E64A 1I5FA 3A5ZA 2G4CA 3GTQH 1X6OA 1IBMQ 4HA8A 2JA5H 4LUZA 2ZZGA 3HOZH 3K8AA 3JAMc 1NMFA 3L0OA 3OTOQ 4JYAL 1NBWA 3GTLH 4BA2I 1HNXQ 3RKWA 4DV5Q 5ELOA 2I4OA 4LF8Q 2NVTH 4AH6A 4C3JH 2ODRD 3B6YA 1I3QH 4LF4L 4JI0L 2IY5A 1K73C 3S2DH 4UY8C 4L5QA 1H4QA 5JJIA 2C35B 1HNXL 1E22A 1H4SA 4TQUS 3AFQA 4X62Q 4BXXG 5GAEC 3I55A 2VUMG 4KHZA 3UFGA 2VL6A 3MEFA 2DQ3A 1C7YA 2ES2A 3V8KA 3FJPA 3GDEA 4P74C 4JI6Q 2JA7H 5E7NA 1CKOA 4IFDG 2VNUD 1N36Q 1NE3A 1WNLA 1FL0A 3UDIA 3QNEA 2IHEA 4YRQA 3K7UC 2V1CC 4MTNA 5GAHC 4GLAC 3CD6A 4GN5A 4O0AA 5FJ8G 1YFTA 1M1KC 2HQLA 2LXKA 2IT1A 1TWFH 5FLMH 4H2WA 1VQCA 1WJJA 4DR7L 4JI1Q 3PSIA 4P71A 4YY3Q 1RIQA 4KHPL 2ALYA 1SMXA 2YTVA 1E24A 2K52A 4JI8Q 5M3FG 3UDXA 3CCQA 1Z7NA 4DR7Q 5IYDG 1K83H 4K86A 2CJ9A 4YRNA 4HJAA 1G51A 1KOGA 2K4KA 1SE8A 3CMAA 4NXMQ 5JEAG 4BBRG 2PNHA 4OX9Q 4R4QA 1A0IA 2JA6H 4CS4A 3BZKA 2QEXA 2QA4A 3KF8B 3EFRA 2JA9A 3MF2A 3M3YH 4GKJL 4KQEA 2BH8A 3RUXA 1EWIA 4L5TA 1B70B 3GTGH 1LUZA 2ZINA 1HNZL 5LMNW 1WQWA 1QF6A 1VQHA 4YCUA 3GO5A 4HWRA 3BFMA 4DAYB 3MF1A 4A3FH 2OWOA 1HTTA 1USYA 3H0GG 3A7RA 1SERA 1HH2P 4YY3L 3E0EA 2DU5A 4QQBX 4A93G 3HOVH 3HOUG 2VQFL 3R07A 4P72C 2F3IA 2VY3A 1OXTA 3RLNA 1S72A 4YRSA 1JMCA 2QHSA 1J5EQ 2NZHA 4EX5A 3CC4A 2EQSA 4OWTB 4K0KL 3QTCA 4DPGA 3PUZA 4L87A 1J6QA 2DXUA 3V7SA 1CSQA 1PFSA 4X66Q 2Z6KA 1S3OA 4JCVE 1PYSB 1LTLA 1EIFA 1OXXK 1HJPA 1A63A 4K88A 4WF2A 1Q1EA 4DV2L 4DK6C 3L4GA 1JE5A 1GD7A 2MFIA 2RHQA 3S1RH 3KFUA 1V43A 4P72A 3RLFA 5M3MH 2B29A 3RLOA 4B3RL 4JYAQ 1Q7YC 2I4MA 2CCZA 4DQ2A 3HOYH 2F4VQ 4TVAA 2UU9Q 2F52A 5C0XJ 2K5NA 2ZT5A 1I50H 3BZCA 4UP8A 1H4TA 3HOXH 2DVEA 4Y52H 3VQXA 2DUDA 3KDFA 4X66L 2YV5A 3EIVA 4A3KG 4XU1A 1SRUA 1O7IA 5C3EG 3W5OA 4HJ5A 3TUPA 1Q82C 5C53B 4BY1H 4A3BH 1GVPA 5C52B 2D0PA 4BY7H 1IYJB 4JI4L 1OXVA 3TRZA 3HOWG 1HNWL 4GLVB 2DJZA 4JOIA 1N34L 4YROA 4DR2L 4YRMA 3VQVA 3I2ZA 2PMZE 5IP7G 2DU7A 3I4NG 3REXA 4JI6L 1YBYA 3HFZA 4POFA 4GNXA 4JI2L 1XPRA 1NYQA 3EN2A 4K87A 4LF5Q 2I5MX 1IBKQ 2Q7GA 4RQEA 4DV4Q 4E51A 4DV3Q 3EBEA 3CW2C 1V9PA 4A3JH 5C4XH 2ZCEA 1TWHH 2UUCQ 4P73A 4G85A 4B3TL 1IBKL 1KXLA 1XMOQ 4YPFA 2IX0A 2CIMA 4ALPA 3PUWA 3CMEA 5HY6A 2FYKA 4DUZQ 3G4SA 4H2YA 1MIUA 4C3HH 2EJGA 3T1YL 2D6FC 3HRKA 2JE6I 1G291 3PUVA 5LMNL 1HZBA 4A4IA 4HWOA 4BXXH 1VQ4A 4LF7Q 3F8TA 3PUYA 3BU2A 3TEGA 4LVJA 2R92G 4PZ7A 4DR4L 4DUYQ 3RACA 3A5YA 2OTJA 3VQYA 1JJ2A 2VW9A 1KRTA 4XTYA 3U4ZA 1PV4A 1NJ2A 2ZZEA 3LSSA 1SROA 3IG2A 2I5HA 1D8LA 2R7ZH 2Q2HA 1WU7A 4IPGA 4H2TA 4P74A 3S1NH 1JJCB 2JA8H 1L1OB 1IXRA 3HRIA 4JBMA 12ASA 3SGIA 5LMNQ 1XMQQ 2K50A 1GKHA 3AFPA 2R6GA 1X56A 1FYFA 3NEMA 3G1ZA 2HHHQ 2ASBA 2UXBL 4IPDA 3HXZA 4KR2A 4IJHA 2I0QA 3KF6B 4HWSA 5J3BA 5IYDH 3AEVA 2ZIOA 4O2DA 1N33L 4A3LG 1MJCA 4LW1A 4P3PA 3TS0A 2PMFA 2PQAB 4A3MH 4JI1L 1C9OA 4K0KQ 3PIPA 1KMNA 4A3CH 4XTWA 4XU3A 4BBRH 1VCIA 2A8VA 1EVLA 2A1AA 3IKMB 2GVBA 3HFVA 1KC8C 4TWAA 4A3GH 2ZZFA 2NN6I 3HXWA 3H3VH 2MO0A 2UXCL 1K8AC 2PI2A 1CKNA 3DM3A 3FKIH 3ZJYC 1W2BA 3CCEA 3W1GA 1J5EL 1WCMG 2DZ9A 1QVFA 2D62A 4H02A 1QVCA 3PO3G 1I6HH 4MNOA 1VQEA 4A3EG 1Z9FA 4JI5L 5IT9c 4GKJQ 3HY1A 3PO2G 3OW2A 2ZNIA 3CCMA 5AJ3L 3HKZG 4APVA 4WI1A 4P75C 3OYYA 1IZ6A 1NJ1A 1DGSA 4IPCA 2BA1A 3KDFB 2A19A 2AWOA 2HHHL 1X2GA 2WAQE 1YHAA 2Q7EA 1SESA 1VQ9A 2UUBL 3J81j 1N32L 1NTGA 4DV7Q 1WFQA 3QO8A 2IHFA 4LNSA 4IPHA 4DR5Q 3G6EA 2RHSB 2MO1A 2E1HA 3J80c 3AQQA 1PH6A 1VQGA 4XU2A 3RR5A 3T1HQ 3HOZG 3J81c 4A3IG 4GNXB 3BJUA 3HY0A 4NXML 1RIPA 4TQFA 2K75A 1PH9A 3WQZA 2EIFA 5GAGC 5K1PA 4BWAA 1N33Q 1H4VB 3OD1A 3P8YA 3HXVA 1P16A 3U58A 2B3GA 3HXUA 2YTXA 5M5YH 4GLXA 1YHQA 2UXBQ 4ZTUB 4LVLA 1NMGA 4KI0A 5E3IA 2ZM6Q 4XTXA 1VQLA 3ULPA 2NVQH 4XTCS 2VUMH 3S2HH 3L7ZC 2DTHA 1Y1VG 4YRFA 2JA5G 2EJ9A 5M5WH 1B70A 2NVXH 3STBC 2QHTA 4BW9A 1XMOL 3HOWH 3ER0A 1YVCA 1UE1A 5IWAL 3V7CA 2L15A 1X3GA 1HZAA 4QJFA 4P3NA 1X3FA 2DDZA 1CKMA 1Z7MA 4YYEA 3MXNB 4HIOA 4YRLA 3F1ZA 4JC0A 2EAYA 1C0AA 4JI3Q 2Q7HA 1VQFA 1E1TA 1HZCA 2C8MA 2E2IH 3PUXA 5FJ8H 2R7FA 3RIRA 3CC2A 4KHPQ 3CMQA 2DXTA 3UE1A 5C4XG 3A7AA 3GTMH 3GTPH 4TVYA 3M4OH 1N36L 2UUAQ 2JEAI 3L1AA 1QUQB 3HKZE 2ZJQA 1HNWQ 4AQYQ 5JJKA 4DR3Q 1M90C 3S24A 3KYHC 2NZOA 2ZXFA 5C51B 1X2HA 1YIJA 4YRIA 3DSQA 5KNNA 4GS3A 2WB1G 1N32Q 3L4GB 4OO1I 3A7UA 4HIKA 4QGUA 4LF9L 3RN5A 1B7YB 2ZM6L 5GQOA 1XJVA 4WJ3M 3RN2A 1X65A 4LUOA 4R4CA 3ULJA 2E3CA 4AYBG 2KBNA 3MQZA 1BIBA 5C0XI 2JA6G 1NY4A 5GADC 2PMEA 2B63H 2EJFA 5FLMG 2PQAA 4JG2A 3I56A 4BBSG 2VQEL 1WPYA 4POGA 2AHOB 1NJ6A 3JAMi 1Z47A 4DR2Q 4YWMA 1Q12A 2E10A 4C3IH 1XNRQ 4TVAB 3VDYA 1PH2A 1CKNB 2WFWA 4LF6L 3J7A5 2ZJPA 3S14H 1EQRA 4P71C 4QL5A 3KOJA 1ASZA 5C44G 1OXSC 1FJGL 4LF4Q 4DV0L 1HR0Q 4UP9A 3CCUA 2H5XA 4A3FG 4GOPC 3OTOL 2JEBI 4OWWB 5K1XA 3H0GH 2K14A 1D7QA 3J7ZC 1PH1A 4ZIBA 4XTVA 3PF4A 1MJEA 4X6AH 4HIMA 4DR3L 5IP9G 3I7FA 4YCVA 4JI4Q 4A3DG 2RHSA 2ZT7A 1L1OC 2DTIA 1TWAH 1ATIA 3CF5A 3UDGA 4LF9Q 3PCOB 1ADYA 3Q8DA 3A31A 1JT8A 3TREA 1VQ6A 3M7NA 1V1QA 4XTUA 5IYCG 4WJ4A 3E9HA 4DV5L 1CUKA 2I4LA 1YJNA 3FP9A 1CSPA 3CPWA 1T9HA 1RL2A 4BA1I 4OO1G 2UXCQ 1KD1C 4L5RC 4EQ5A 2YYZA 4YDQA 3GTKH 3W3SA 4DV6L 5H1SE 3IKLA 4B3ML 1KRSA 1KMMA 1N8RC 2VQFQ 1G5IA 1BKBA 3M9BA 1MKHA 5BR8Q 3CP0A 2ZR3A 1VQ8A 5IYBG 3NETA 1VQMA 4GKKQ 2ATWA 3S1MH 3F2CA 4B3MQ 4JI7Q 3L2PA 1L0WA 1KAWA 1L1OA 2E41A 2YTYA 2E8GA 5LMUL 4OLFA 1XNQL 2UXDQ 1B8AA 3GD7A 3TEHA 1PHJA 2KHJA 4DUYL 1YZ6A 1IBLL 4L5SA 2ZTCA 4NPSA 1K0RA 5IP7H 4RDXA 4YP0A 4IO9A 1ADJA 2DEQA 2ALYB 1KL9A 1QZHA 4LFCL 2WAQG 5BR8L 1IBLQ 1PVOA 3H15A 1YJ9A 1G6PA 2RF4A 4A3KH 3K80C 2KHIA 4QIWE 3LC0A 3TQYA 3UGQA 3STBD 3M4QA 3PZCA 1UWVA 3RKYA 3DLLA 2ODRC 3HTZA 1LYLA 4HVCA 4HJ9A 1Y1WH 1Q86C 5IWAQ 3LGJA 1NYRA 3LSQA 1XNQQ 1EIYA 4H2VA 3I4NH 1XMQL 2E2HH 4H2SA 3VBBA 3W1BA 2HIXA 4CH4A 2LXJA 4OXPA 2ZJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0L A;  2AWN A;  4X64 L;  1GGM A;  2CJB A;  3V8L A;  3T1Y Q;  3PGZ A;  5HGQ A;  4LWC A;  4KLK A;  4IJL A;  5C3E H;  1BVS A;  2ARU A;  5C0X G;  4PG3 A;  4P73 C;  1W3S A;  3PCO A;  1YHB A;  3K81 C;  4BY7 G;  4JBW A;  3M85 A;  2N8N A;  1IBM L;  2HNI A;  2Q2I A;  1X9N A;  3UH0 A;  4C2M H;  4GKK L;  1YFS A;  2EWN A;  2DQ0 A;  2OQK A;  1OTC A;  1A62 A;  4LFB Q;  2ART A;  4LFC Q;  4DV2 Q;  4DUZ L;  3A74 A;  3NEL A;  4HJ7 A;  4TQD A;  1TWG H;  3REU A;  3CC7 A;  2N78 A;  2QHV A;  2YU9 H;  4ZTZ B;  1HC7 A;  2CWA A;  2J3M A;  3UE0 A;  3F2B A;  3IRB A;  3ULL A;  2HIV A;  3T1H L;  1TWC H;  2Q2T A;  4IOA A;  4X64 Q;  1EVK A;  2Y0S E;  2DTO A;  1TXY A;  4LFA Q;  4A75 A;  2P5I A;  1P8L A;  2OTL A;  3UGT A;  4A3M G;  3RL6 A;  4H2X B;  4B3S Q;  3KJP A;  3P8T A;  1FVI A;  1W66 A;  2JA7 G;  4NCX A;  5GRO A;  4DR6 L;  3KJO A;  4LFB L;  3HOV G;  3HOU H;  1EFW A;  4DAM A;  2UUB Q;  4EO4 A;  4TVW A;  2E65 A;  3JC6 6;  2VZA A;  4GN3 B;  11AS A;  2K5H A;  2E5L L;  1EIY B;  1EYG A;  1HR0 W;  1S40 A;  3H3V I;  5F5W A;  2ID0 A;  1GO3 E;  3J80 i;  4YRG A;  2WB1 E;  4TTV A;  1YNX A;  2CWP A;  1VQN A;  4PZ6 A;  1NJ8 A;  4YRP A;  1E1O A;  4LUV A;  4KR3 A;  4DNI A;  1PH3 A;  4JI8 L;  1JB7 A;  4B3S L;  2GVA A;  2CKZ B;  3CPF A;  4Q15 A;  4CS2 A;  1XPU A;  1SR3 A;  3A5U A;  4RQF A;  1JJG A;  4A3G G;  1HZ9 A;  1XPO A;  2R7D A;  4GOP B;  2MQH A;  4UP7 A;  4Q6G A;  5M5X H;  4OWX B;  1VQZ A;  1E3P A;  1Q8K A;  1VQK A;  4A93 H;  4OON A;  1GM5 A;  2UXD L;  1YJW A;  2I5L X;  1IL2 A;  4NXN L;  2ZTG A;  1WCM H;  4LF5 L;  4JI3 L;  5AJ3 Q;  5DLQ E;  4XTZ A;  1E7Z A;  4PZ8 A;  3PO3 H;  1Q46 A;  1XTD A;  1SFO H;  1PH8 A;  3V8J A;  1AE3 A;  2KCT A;  2R93 H;  3MEY A;  1SLJ A;  1K8G A;  4DR4 Q;  2MNA A;  1LM0 A;  1FJG Q;  4YRC A;  3ERR A;  4DV4 L;  1VQB A;  2E5L Q;  3HXY A;  1H95 A;  5K36 G;  1AE2 A;  1B7Y A;  3RZO H;  4XIG S;  3ERS X;  2CGH A;  3IAL A;  4HID A;  4B3T Q;  4JI5 Q;  3I4M H;  3D31 A;  2WP8 J;  1NJ5 A;  3WWV A;  5JJL A;  2ZTE A;  4GNX C;  4IFD I;  2CFM A;  1SET A;  2E2J H;  1PH7 A;  2N3S A;  1YEZ A;  3CCV A;  4XEO A;  1BIA A;  3TEH B;  1QE0 A;  3HOY G;  2KEN A;  4OP0 A;  4X5O A;  3HKS A;  3UDF A;  4DV7 L;  4P3O A;  1QZG A;  3GTJ H;  1Q1B A;  2HT1 A;  3A5Z B;  1SN8 A;  2CJA A;  4A3I H;  3RF1 A;  3E9I A;  1U5K A;  1YI2 A;  1YGB A;  5IY0 A;  1N34 Q;  3CCR A;  1Y14 B;  5FLX c;  2ZNJ A;  2LSS A;  4XU0 A;  4JOI C;  1B76 A;  2F4V L;  4YHH L;  3S17 H;  2ZT8 A;  1AH9 A;  4JI7 L;  1X55 A;  2AKW B;  5M3M G;  1KHI A;  4CS3 A;  3CAM A;  2Y0S G;  5LMU Q;  2EXD A;  4DR1 Q;  4R4O A;  2OCE A;  2I4N A;  4GOP A;  1Y1V H;  5JEA J;  3KLW A;  1K9M C;  3HOX G;  1ASY A;  4YRR A;  3I4O A;  1JJC A;  4A3J G;  4X62 L;  1WI5 A;  3S1Q H;  1PH4 A;  1PH5 A;  1U0L A;  3ICE A;  2IY5 B;  1X54 A;  4RG1 A;  2JK8 A;  2J3L A;  4BY1 G;  4A3B G;  1VQP A;  1FGU A;  1N9W A;  1PA6 A;  3RGL A;  4H2U A;  1HNZ Q;  4LFA L;  3G48 A;  3S16 H;  1BBU A;  1J5W A;  4LF7 L;  1VQA A;  2ZR2 A;  1VQD A;  2B63 G;  2BA0 A;  2ZIM A;  1KQS A;  2DKG A;  3VQW A;  4HWP A;  4CH5 A;  1X3E A;  4DV0 Q;  1HR0 L;  1SRY A;  4AYB E;  1VQ5 A;  2DZC A;  3CQZ H;  5ELN A;  4PHC A;  4A3L H;  1YB3 A;  2AMC A;  1PYB A;  3EFS A;  1NNH A;  5M3F H;  3QO7 A;  2ZTD A;  2E5A A;  2ZT6 A;  1OXU A;  1QUQ A;  2P8T A;  2R7Z G;  4A3C G;  2DGY A;  2NVY H;  1PYS A;  1X01 A;  1VS0 A;  2D0O A;  2JJQ A;  1WLE A;  2UU9 L;  5IP9 H;  4DR1 L;  1YIT A;  1I94 Q;  4A3D H;  4FDB A;  2XTI A;  4GN4 B;  4P75 A;  1KIX A;  4X65 L;  2CQO A;  3FKI G;  2FXQ A;  4QY7 A;  3HFZ B;  2R92 H;  4DV3 L;  4R4I A;  2K5V A;  2VQE Q;  2AKW A;  4MZ9 A;  3PIO A;  5EAY A;  4IOC A;  1QVG A;  4DK3 C;  4YRJ A;  4PMW A;  3U4V A;  4R4T A;  4G84 A;  5IYC H;  1XNR L;  2Z0S A;  1R9T H;  4H2X A;  3A32 A;  4RMF A;  1NJI C;  3D0F A;  1EOV A;  1WQ7 A;  4DV6 Q;  4YHH Q;  4XEM A;  1UE6 A;  3PV0 A;  4R1J A;  2JA8 G;  1UEB A;  3RNU A;  1VQO A;  4AQY L;  2GN5 A;  3CCL A;  3GTO H;  2ARS A;  1G5H A;  2PI2 E;  4BBS H;  3RZD H;  4YRT A;  2RCN A;  1K3R A;  2Q5I A;  3CCJ A;  2UUC L;  1WYD A;  2OQ0 A;  4J15 A;  2Q2U A;  3J81 i;  1I94 L;  1A8V A;  2N49 A;  4A76 A;  2Z6K C;  1VQ7 A;  4NXN Q;  1VQI A;  4JV5 Q;  3CXC A;  3PF5 A;  1UE7 A;  4Y7N H;  5C44 H;  4IFD J;  4JI2 Q;  2JQO A;  1EQQ A;  5IE8 A;  1USY C;  1EUJ A;  4B3R Q;  4OX9 L;  3F2D A;  4CH3 A;  3K7A H;  2VS1 A;  3L2Z A;  3PO2 H;  1BBW A;  4JBK A;  4HJ8 A;  3A0J A;  2AMC B;  2NN6 G;  2KCM A;  3FHW A;  4LNQ A;  4CH6 A;  1ZQ1 C;  4LF8 L;  4DKA C;  3CCS A;  4YRK A;  4DV1 L;  4ME3 A;  3TS2 A;  1L2F A;  4NB3 A;  3K0X A;  2UUA L;  5IYB H;  3S15 H;  1HXD A;  3HXX A;  2R93 G;  4UPA A;  2ZGW A;  4HWT A;  2RHQ B;  4JV5 L;  2QGQ A;  4LF6 Q;  1YFR A;  2BH2 A;  5C4J H;  3V7R A;  1Q81 C;  4X65 Q;  4A3E H;  2IX1 A;  3RKX A;  1Y1W G;  4DR6 Q;  3AYH B;  3I4M G;  4YCW A;  4YRE A;  1WOC A;  3M4P A;  3NEN A;  4AIM A;  4DR5 L;  3P8V A;  2QHU A;  3U50 C;  4JI0 Q;  2Q5H A;  1VQJ A;  3QO5 A;  3ICA A;  4JBJ A;  3NBH B;  4DV1 Q;  2EL9 A;  3G71 A;  2XGT A;  1UE5 A;  4YWL A;  3KF6 A;  4YWK A;  2C7I A;  2E64 A;  1I5F A;  3A5Z A;  2G4C A;  3GTQ H;  1X6O A;  1IBM Q;  4HA8 A;  2JA5 H;  4LUZ A;  2ZZG A;  3HOZ H;  3K8A A;  3JAM c;  1NMF A;  3L0O A;  3OTO Q;  4JYA L;  1NBW A;  3GTL H;  4BA2 I;  1HNX Q;  3RKW A;  4DV5 Q;  5ELO A;  2I4O A;  4LF8 Q;  2NVT H;  4AH6 A;  4C3J H;  2ODR D;  3B6Y A;  1I3Q H;  4LF4 L;  4JI0 L;  2IY5 A;  1K73 C;  3S2D H;  4UY8 C;  4L5Q A;  1H4Q A;  5JJI A;  2C35 B;  1HNX L;  1E22 A;  1H4S A;  4TQU S;  3AFQ A;  4X62 Q;  4BXX G;  5GAE C;  3I55 A;  2VUM G;  4KHZ A;  3UFG A;  2VL6 A;  3MEF A;  2DQ3 A;  1C7Y A;  2ES2 A;  3V8K A;  3FJP A;  3GDE A;  4P74 C;  4JI6 Q;  2JA7 H;  5E7N A;  1CKO A;  4IFD G;  2VNU D;  1N36 Q;  1NE3 A;  1WNL A;  1FL0 A;  3UDI A;  3QNE A;  2IHE A;  4YRQ A;  3K7U C;  2V1C C;  4MTN A;  5GAH C;  4GLA C;  3CD6 A;  4GN5 A;  4O0A A;  5FJ8 G;  1YFT A;  1M1K C;  2HQL A;  2LXK A;  2IT1 A;  1TWF H;  5FLM H;  4H2W A;  1VQC A;  1WJJ A;  4DR7 L;  4JI1 Q;  3PSI A;  4P71 A;  4YY3 Q;  1RIQ A;  4KHP L;  2ALY A;  1SMX A;  2YTV A;  1E24 A;  2K52 A;  4JI8 Q;  5M3F G;  3UDX A;  3CCQ A;  1Z7N A;  4DR7 Q;  5IYD G;  1K83 H;  4K86 A;  2CJ9 A;  4YRN A;  4HJA A;  1G51 A;  1KOG A;  2K4K A;  1SE8 A;  3CMA A;  4NXM Q;  5JEA G;  4BBR G;  2PNH A;  4OX9 Q;  4R4Q A;  1A0I A;  2JA6 H;  4CS4 A;  3BZK A;  2QEX A;  2QA4 A;  3KF8 B;  3EFR A;  2JA9 A;  3MF2 A;  3M3Y H;  4GKJ L;  4KQE A;  2BH8 A;  3RUX A;  1EWI A;  4L5T A;  1B70 B;  3GTG H;  1LUZ A;  2ZIN A;  1HNZ L;  5LMN W;  1WQW A;  1QF6 A;  1VQH A;  4YCU A;  3GO5 A;  4HWR A;  3BFM A;  4DAY B;  3MF1 A;  4A3F H;  2OWO A;  1HTT A;  1USY A;  3H0G G;  3A7R A;  1SER A;  1HH2 P;  4YY3 L;  3E0E A;  2DU5 A;  4QQB X;  4A93 G;  3HOV H;  3HOU G;  2VQF L;  3R07 A;  4P72 C;  2F3I A;  2VY3 A;  1OXT A;  3RLN A;  1S72 A;  4YRS A;  1JMC A;  2QHS A;  1J5E Q;  2NZH A;  4EX5 A;  3CC4 A;  2EQS A;  4OWT B;  4K0K L;  3QTC A;  4DPG A;  3PUZ A;  4L87 A;  1J6Q A;  2DXU A;  3V7S A;  1CSQ A;  1PFS A;  4X66 Q;  2Z6K A;  1S3O A;  4JCV E;  1PYS B;  1LTL A;  1EIF A;  1OXX K;  1HJP A;  1A63 A;  4K88 A;  4WF2 A;  1Q1E A;  4DV2 L;  4DK6 C;  3L4G A;  1JE5 A;  1GD7 A;  2MFI A;  2RHQ A;  3S1R H;  3KFU A;  1V43 A;  4P72 A;  3RLF A;  5M3M H;  2B29 A;  3RLO A;  4B3R L;  4JYA Q;  1Q7Y C;  2I4M A;  2CCZ A;  4DQ2 A;  3HOY H;  2F4V Q;  4TVA A;  2UU9 Q;  2F52 A;  5C0X J;  2K5N A;  2ZT5 A;  1I50 H;  3BZC A;  4UP8 A;  1H4T A;  3HOX H;  2DVE A;  4Y52 H;  3VQX A;  2DUD A;  3KDF A;  4X66 L;  2YV5 A;  3EIV A;  4A3K G;  4XU1 A;  1SRU A;  1O7I A;  5C3E G;  3W5O A;  4HJ5 A;  3TUP A;  1Q82 C;  5C53 B;  4BY1 H;  4A3B H;  1GVP A;  5C52 B;  2D0P A;  4BY7 H;  1IYJ B;  4JI4 L;  1OXV A;  3TRZ A;  3HOW G;  1HNW L;  4GLV B;  2DJZ A;  4JOI A;  1N34 L;  4YRO A;  4DR2 L;  4YRM A;  3VQV A;  3I2Z A;  2PMZ E;  5IP7 G;  2DU7 A;  3I4N G;  3REX A;  4JI6 L;  1YBY A;  3HFZ A;  4POF A;  4GNX A;  4JI2 L;  1XPR A;  1NYQ A;  3EN2 A;  4K87 A;  4LF5 Q;  2I5M X;  1IBK Q;  2Q7G A;  4RQE A;  4DV4 Q;  4E51 A;  4DV3 Q;  3EBE A;  3CW2 C;  1V9P A;  4A3J H;  5C4X H;  2ZCE A;  1TWH H;  2UUC Q;  4P73 A;  4G85 A;  4B3T L;  1IBK L;  1KXL A;  1XMO Q;  4YPF A;  2IX0 A;  2CIM A;  4ALP A;  3PUW A;  3CME A;  5HY6 A;  2FYK A;  4DUZ Q;  3G4S A;  4H2Y A;  1MIU A;  4C3H H;  2EJG A;  3T1Y L;  2D6F C;  3HRK A;  2JE6 I;  1G29 1;  3PUV A;  5LMN L;  1HZB A;  4A4I A;  4HWO A;  4BXX H;  1VQ4 A;  4LF7 Q;  3F8T A;  3PUY A;  3BU2 A;  3TEG A;  2R92 G;  4PZ7 A;  4DR4 L;  4DUY Q;  3RAC A;  3A5Y A;  2OTJ A;  3VQY A;  1JJ2 A;  2VW9 A;  1KRT A;  4XTY A;  3U4Z A;  1PV4 A;  1NJ2 A;  2ZZE A;  3LSS A;  1SRO A;  3IG2 A;  2I5H A;  1D8L A;  2R7Z H;  2Q2H A;  1WU7 A;  4IPG A;  4H2T A;  4P74 A;  3S1N H;  1JJC B;  2JA8 H;  1L1O B;  1IXR A;  3HRI A;  4JBM A;  12AS A;  3SGI A;  5LMN Q;  1XMQ Q;  2K50 A;  1GKH A;  3AFP A;  2R6G A;  1X56 A;  1FYF A;  3NEM A;  3G1Z A;  2HHH Q;  2ASB A;  2UXB L;  4IPD A;  3HXZ A;  4KR2 A;  4IJH A;  2I0Q A;  3KF6 B;  4HWS A;  5J3B A;  5IYD H;  3AEV A;  2ZIO A;  4O2D A;  1N33 L;  4A3L G;  1MJC A;  4LW1 A;  4P3P A;  3TS0 A;  2PMF A;  2PQA B;  4A3M H;  4JI1 L;  1C9O A;  4K0K Q;  3PIP A;  1KMN A;  4A3C H;  4XTW A;  4XU3 A;  4BBR H;  1VCI A;  2A8V A;  1EVL A;  2A1A A;  3IKM B;  2GVB A;  3HFV A;  1KC8 C;  4TWA A;  4A3G H;  2ZZF A;  2NN6 I;  3HXW A;  3H3V H;  2MO0 A;  2UXC L;  1K8A C;  2PI2 A;  1CKN A;  3DM3 A;  3FKI