4AH6A

Human mitochondrial aspartyl-trna synthetase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
589
structure length
589
Chain Sequence
PEFSSFVVRTNTCGELRSSHLGQEVTLCGWIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ASPARTATE--TRNA LIGASE, MITOCHONDRIAL
publication title Thermodynamic Properties Distinguish Human Mitochondrial Aspartyl-tRNA Synthetase from Bacterial Homolog with Same 3D Architecture
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 117
structure length 589
sequence length 589
chains with identical sequence B, C, D
ec nomenclature ec 6.1.1.12: Aspartate--tRNA ligase.
pdb deposition date 2012-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N)
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
A PF02938 GAD GAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ah6A01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4ah6A02
3.30.1360.30 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 GAD-like domain 4ah6A03
4GN4B 1IBKQ 2RHQA 3MF2A 2NVYH 1NMGA 2DZCA 4YRMA 4JG2A 1KRSA 4LF5Q 1X6OA 3AEVA 2ZINA 3TRZA 1VQBA 2UXDL 4XU0A 1VQGA 4ALPA 1VQLA 4GLVB 2ZIOA 1OXUA 1VQDA 2B29A 4X64L 2R92H 2Q5HA 4DUZQ 1B76A 4TQFA 1N36L 3RZDH 4A3EG 3HFZB 3QO5A 5K1XA 1CKNA 3BU2A 3E9HA 5C3EG 4A4IA 1LUZA 4A3CH 3I7FA 3OTOL 1VQ5A 4A75A 4A3MH 3A0JA 3RN5A 1SLJA 3S17H 2L15A 1JB7A 1NMFA 1XNRL 4JI7L 1Z47A 1B70A 4UP9A 1NYRA 4IPGA 4A3FG 4KLKA 3M4PA 4LF6Q 2JA8H 2J3LA 2JA5G 2LXJA 4LF7Q 3MXNB 2WB1E 2Z6KA 5IY0A 4G84A 2ODRC 4GOPB 4XTUA 1QVCA 4QQBX 1B8AA 2I5MX 1N32Q 4IPHA 3HOUG 2CQOA 4LUZA 1WPYA 4X5OA 1BKBA 4TVYA 3AFQA 1UE7A 2IX1A 3PF4A 4E51A 1P16A 1AE3A 3EFRA 1PYSA 1HNWQ 4Y7NH 3CQZH 2Q2IA 1YI2A 3RL6A 4QGUA 4DR2L 4DR4L 4P3OA 2ZT7A 2ZJPA 1HZAA 5LMNQ 2AWNA 3DSQA 4L5TA 3CMQA 2D62A 2I0QA 3CCEA 4RMFA 3HKZE 1SR3A 3KFUA 1JJGA 1HH2P 3SGIA 3RNUA 1VQJA 4YHHL 4ME3A 4JV5Q 3S24A 5FLMG 4HJ5A 1XMQL 1CSQA 1IBML 1HR0Q 4Q15A 3L0OA 1TWFH 5DLQE 3LSSA 1KL9A 4JOIA 1I94Q 3LC0A 5IYBG 1P8LA 4JI4Q 4A3IG 1VQAA 3I4NG 2AMCA 4X65L 3CC7A 1U0LA 1FYFA 2E64A 3M3YH 1YHBA 5FLXc 3I4MG 2FYKA 3NEMA 3S2DH 1X9NA 2F52A 3TQYA 1VQ4A 4DR5Q 4QL5A 1YNXA 4UP7A 4A3KH 2VQFQ 4GOPC 4HIOA 1Y1WH 3GTGH 4JI1L 3T1YL 1HC7A 4HIMA 2JA6H 3CXCA 5IYCG 3FKIG 3TEHA 1V1QA 5JEAG 3UGTA 2ZT5A 4A3LH 4IFDI 2ZXFA 4H2XA 1W2BA 4DR1L 3HXVA 3CMEA 3GTKH 1UEBA 4PMWA 2HNIA 1EWIA 3CCLA 5C44G 3U4VA 3S1MH 3UE1A 4LNSA 3REUA 4GN5A 4JI0Q 4JI8L 1HNZL 2K4KA 1Q81C 4LW1A 2ZM6L 3A5YA 2CCZA 2E65A 1PHJA 4YRNA 2HHHL 4B3SL 1AE2A 4LF9L 3J80c 1XTDA 4Q6GA 4L5SA 4DV6L 1O7IA 2E2JH 1EIYB 3E0EA 5JEAJ 2E41A 1HNXQ 1USYC 2MO1A 2Y0SG 2JJQA 2PNHA 2Z0SA 4CS4A 2OTJA 3CMAA 1FJGQ 4NXML 1NJ5A 4BBSH 2I4LA 3QNEA 5C0XG 2UU9Q 1GO3E 2A1AA 4OXPA 2EJ9A 1NY4A 1CKOA 4A3DH 4TQDA 2D6FC 1EQRA 2E8GA 3PO3H 2IHEA 3A5ZA 4NXNQ 2ES2A 4BBRH 4R4TA 2OQKA 3W5OA 4GN3B 3FP9A 5EAYA 1PH7A 3ULPA 2K52A 5C4JH 1BBUA 1E1OA 2ASBA 2ZTDA 1CSPA 3AYHB 3UFGA 4UP8A 3KF6A 3S2HH 5M3MH 4YP0A 1CKNB 4DQ2A 4JBMA 2GN5A 4TVWA 1H4TA 2ZNIA 4P72A 4BY7G 1Q8KA 3J7A5 2ZCEA 4QJFA 4YROA 4YRFA 3IKLA 1GKHA 5GROA 3HY1A 1B70B 1MJEA 1PV4A 3MEFA 1EVKA 3AFPA 5FJ8H 3V7SA 4IOAA 3UH0A 4P74C 4OP0A 3L2ZA 1BIBA 2R6GA 2E5LL 5K1PA 1VQPA 1K73C 2IY5B 2UUBQ 3H0GG 4GKKL 2QGQA 2DXUA 1WNLA 3IALA 4BW9A 1I6HH 2Q7EA 2N3SA 4L87A 3PUXA 3L4GA 1KXLA 3MEYA 1X3GA 2XTIA 1PYSB 1A8VA 2JEAI 1PH4A 3G71A 4APVA 4JI5L 4BXXH 5GAEC 4LFCQ 1X3EA 2IX0A 4HIKA 2DZ9A 5LMNW 5F5WA 3CCJA 3L2PA 1VQ8A 4CS2A 1TWGH 5IWAL 1MKHA 1YFSA 1WLEA 3HOYH 3HOXH 1CUKA 4X64Q 4A3JG 1KD1C 1ADYA 2F4VQ 1D7QA 4OX9L 4R4OA 1Q7YC 1SN8A 4OWWB 2GVAA 3VDYA 4DR7L 4JI2Q 1HR0W 2E1HA 4C2MH 2PMZE 2WB1G 4LUOA 2RHSA 4AYBE 2AMCB 2EJGA 2PI2A 2QHUA 1EQQA 4YWLA 1X65A 2PQAA 1JMCA 1EUJA 2I4MA 2AWOA 4KR2A 2R92G 1BBWA 2AKWB 4L5RC 1UWVA 1XNRQ 4JI7Q 2UUCQ 3ZJYC 4MNOA 3S1NH 4DV1Q 4HA8A 4XEMA 3TEHB 1KMNA 2JEBI 3UDFA 3V7RA 2CGHA 1YGBA 4P71A 4A3CG 1QUQA 4P73A 3F2BA 1VQFA 4A3MG 3L1AA 1EIFA 4H2XB 4PZ6A 3F8TA 2I5LX 4POGA 3BFMA 1SRYA 5IP7H 2JE6I 4XIGS 1C0AA 2ZTEA 4LF8L 4JBKA 4HJAA 2DTOA 4LFBQ 1N33L 5E7NA 4B3TQ 3HKZG 4YYEA 3FHWA 1EFWA 3HKSA 2JA8G 2DJZA 1Z9FA 4DV7Q 2ZZFA 4POFA 1SMXA 1A0IA 2ATWA 4IFDG 5C4XH 3P8YA 3GO5A 1N34L 4YCUA 4DR2Q 3T1HL 2AHOB 2DGYA 4DR4Q 3GTPH 2P5IA 1ASZA 1A63A 4WJ3M 2D0PA 1PH9A 4H2WA 2ZIMA 1QF6A 3OW2A 1Q12A 4WF2A 4JOIC 1VQNA 2R7DA 1E7ZA 3A5UA 1B7YA 1K0RA 4ZTUB 4IOCA 3TUPA 1NTGA 3HRKA 3K8AA 1XMQQ 1VQKA 3HOWH 1OXXK 1IBMQ 4ZTZB 4IFDJ 1XNQL 3PF5A 3A5ZB 3PUVA 4EX5A 5GAHC 2J3MA 2EAYA 1J5EL 5LMUL 4TVAB 3UDXA 3S14H 2LSSA 4DUYL 5K36G 1H4SA 4KHZA 5IT9c 1YFRA 2ALYA 4CH6A 4DV0L 3V8JA 1K3RA 1Q1BA 1K83H 1TXYA 1G5HA 3KDFA 1UE1A 3BZCA 5J3BA 4JI1Q 3T1YQ 1K8AC 4MTNA 2VQEL 4K86A 4P75A 2VNUD 3EN2A 2DEQA 3I2ZA 4GNXB 4O2DA 2K50A 2OCEA 3KF8B 3ERSX 5M5XH 1K8GA 4DV3L 2JQOA 1L1OA 1IBKL 4IO9A 4A3KG 1Y1WG 4LF5L 5HY6A 3I56A 4UPAA 4JI8Q 1HNZQ 4GKJL 2CJAA 4CS3A 2NVTH 3QTCA 3K7AH 2ZM6Q 4R4IA 1OTCA 1SFOH 3ULLA 2DVEA 1XMOQ 4H2SA 4A3LG 4DR6L 5AJ3L 1RIPA 4LF9Q 1VQ6A 1NJ8A 3LSQA 3VQVA 3VQXA 3PO2G 3PUZA 1KQSA 2UXBL 2DXTA 3KJOA 1MIUA 1AH9A 1G6PA 1SERA 4YRRA 4RQEA 4B3RQ 1VQCA 2QHTA 4WI1A 5ELOA 4HIDA 3M9BA 4JI6Q 4A3BH 3TREA 4AIMA 4DV5Q 1OXSC 2E5AA 2QA4A 4J15A 3E9IA 4CH4A 3GTMH 5JJKA 3IKMB 1YB3A 1PH3A 4LF6L 4P72C 1CKMA 4BBSG 3W1BA 2QHSA 4IJHA 3FJPA 4LF7L 3QO7A 3PCOA 3NBHB 1HXDA 3HXYA 3HXWA 4GNXC 4A3DG 2D0OA 2RHSB 4AQYL 2DQ3A 3CAMA 2R7ZH 1D8LA 1Y1VH 1FGUA 4PZ8A 3W1GA 4HWSA 1YJ9A 1WFQA 2PQAB 3GTQH 4BBRG 4DR3Q 1VQEA 1VS0A 4OLFA 2C8MA 3PUYA 4DPGA 2P0LA 2NN6I 5IE8A 1I50H 3CP0A 1I5FA 4XTXA 1GGMA 5ELNA 3UGQA 2P8TA 4HJ8A 2K5HA 3A74A 1KHIA 5M3FH 3ICAA 1NNHA 4YRKA 4K0KL 3OYYA 2RHQB 1X3FA 1X01A 1E1TA 1Q46A 3I4OA 1C9OA 4JV5L 5FJ8G 1PH1A 1HTTA 4C3IH 3ICEA 3KJPA 4RDXA 3STBD 4A76A 5IYDH 1IBLQ 4G85A 4HJ9A 3HTZA 3CF5A 2K5NA 3KYHC 5IP9H 2QEXA 3J80i 4X66L 4MZ9A 4KQEA 2KBNA 4AYBG 4YRCA 1WU7A 3CC4A 2YTVA 4XU3A 3TS2A 4OO1I 4ZIBA 2VQFL 4NCXA 4DV4L 2DTIA 2Q7GA 4BXXG 1VQIA 1B7YB 4OX9Q 2EL9A 1S72A 1QVGA 4IJLA 2PMFA 1SETA 3PIPA 2Q7HA 4GS3A 1M1KC 3TEGA 1VQ7A 2VUMH 1I3QH 3HOZH 4YRPA 4RQFA 4B3ML 3REXA 3HOYG 4JI0L 3BJUA 3HOXG 4P71C 1C7YA 4QY7A 4YREA 1X56A 2EXDA 1ZQ1C 2R7FA 4YY3Q 3D31A 4K88A 3KDFB 1Z7NA 3TS0A 2JA9A 3H3VH 3RKYA 1PVOA 2UXCQ 2RCNA 4R1JA 1EOVA 4H2VA 3GTJH 2Q2TA 3B6YA 1Y14B 3ULJA 2KHIA 3F2DA 4LF8Q 1L1OB 1ASYA 2YU9H 1NJ6A 1N33Q 3J7ZC 1XPUA 1NJ2A 4X62L 4R4CA 2JA7H 1E3PA 1MJCA 2VS1A 1NYQA 3RZOH 2V1CC 1QZHA 2UXDQ 4LFAL 3D0FA 3L7ZC 2R93H 1S3OA 1N34Q 1IXRA 3T1HQ 1LTLA 5JJIA 2E3CA 2OWOA 2EJFA 3K80C 2H5XA 4YRGA 1VQZA 4JYAL 1YEZA 1IYJB 1PFSA 3K7UC 5GAGC 1WI5A 4TTVA 3EIVA 2YYZA 4P3PA 5HGQA 2CKZB 1N36Q 5KNNA 2VW9A 4YWMA 1S40A 3RKWA 5C4XG 2KCTA 2DU7A 3GD7A 3OTOQ 1V43A 2BH2A 3W3SA 1G291 4HVCA 1NJIC 1J5WA 1XNQQ 2Z6KC 4JI3L 4X6AH 4L5QA 4CH3A 4LF4L 4CH5A 4DV2L 1J5EQ 5LMUQ 3STBC 4YDQA 4DAYB 2VL6A 1HJPA 3Q8DA 1VQOA 2UUAL 3F2CA 4A3GH 3PCOB 4P75C 2C35B 1PH8A 1JJCA 1UE5A 4DV0Q 2MO0A 3HOWG 1N8RC 2YTYA 1OXVA 4XTYA 4A93H 4HWTA 3IG2A 1L1OC 4DNIA 4IPCA 4XTVA 3PZCA 2JK8A 3A32A 3H3VI 2VQEQ 2LXKA 4C3JH 1YFTA 4DKAC 2FXQA 4PZ7A 4KHPL 3HOVH 3CCSA 3CCVA 2DTHA 1W3SA 1QZGA 4LFCL 1H95A 2CWAA 4YRIA 4GKJQ 3CCUA 3CCQA 3V8KA 3A7UA 2NN6G 4DR6Q 1G5IA 1UE6A 5AJ3Q 4BY1H 1LYLA 2YTXA 4YHHQ 4YPFA 2F4VL 2DDZA 3PV0A 2UXBQ 3RLFA 1YITA 3OD1A 2B63H 1BIAA 3MF1A 4JI2L 2ZZGA 3K0XA 5H1SE 3QO8A 4LUVA 4H2TA 4NPSA 4XU2A 4FDBA 2ID0A 4YWKA 1Z7MA 2WAQE 1WCMH 3RF1A 4EO4A 4X65Q 1SESA 1WJJA 4IPDA 3R07A 5E3IA 2HT1A 1VQ9A 3KF6B 2UUCL 1X54A 1SROA 3NELA 2N49A 1G51A 2ZJQA 1TWCH 2CJ9A 2EQSA 2DU5A 4R4QA 4DV1L 12ASA 3CC2A 5BR8L 2IHFA 2B3GA 1A62A 4A3BG 4GLAC 3G4SA 2MFIA 2G4CA 3U50C 3RN2A 4DR1Q 2KENA 2I4OA 4AQYQ 3VQYA 4BWAA 2IY5A 3RKXA 11ASA 4OO1G 4LFBL 4BA2I 3I55A 4B3TL 3S15H 2GVBA 5M5WH 3RUXA 1VQMA 3ER0A 4YRSA 4HWPA 2JA6G 3U4ZA 3K81C 4A3EH 2N8NA 4DV7L 2N78A 1J6QA 4DK6C 2BA0A 2NZHA 5C3EH 3HXUA 1YHAA 3M4QA 4RG1A 2ARTA 3J81j 2HHHQ 1YBYA 4B3SQ 2VY3A 2R7ZG 1Y1VG 2ZGWA 3L4GB 2CFMA 4DV6Q 2OQ0A 4DUZL 2I5HA 3HY0A 3S1RH 1SE8A 4A3FH 1TWHH 3AQQA 3S16H 3P8VA 2HIXA 4K0KQ 3CCMA 2ZR2A 4NXMQ 1NBWA 1E22A 4TQUS 1HZ9A 2JA5H 1JJ2A 1IL2A 1ATIA 1L0WA 1XJVA 4YCVA 1Q82C 1ADJA 3M4OH 3HOUH 1T9HA 4HWOA 1Q1EA 4H02A 1EYGA 5M3FG 4HJ7A 5C53B 4X66Q 1YHQA 4QIWE 2VZAA 2F3IA 3KLWA 3KOJA 1NE3A 2DKGA 1GM5A 3P8TA 5GADC 4TWAA 2AKWA 2ARUA 4DV4Q 5IYDG 1N32L 4XTZA 3M85A 1WQ7A 3PO3G 1U5KA 5IP9G 2MQHA 3UDGA 4GLXA 1V9PA 4KR3A 2XGTA 3V7CA 4UY8C 3VBBA 1YVCA 1HNWL 2HQLA 1QE0A 3RIRA 3PO2H 2PMEA 1BVSA 2ZZEA 5M5YH 5M3MG 4OWXB 4K87A 2PI2E 4B3MQ 4KI0A 5FLMH 3HFVA 4OONA 1QUQB 3RACA 5LMNL 1JJCB 2CIMA 1N9WA 4JC0A 4WJ4A 2C7IA 2E5LQ 3HXXA 3EFSA 1VQHA 1NJ1A 1DGSA 1RIQA 2IT1A 5IYBH 1R9TH 1XMOL 3RR5A 4A3IH 3I4NH 1X2GA 2NVXH 4GKKQ 3G48A 2VUMG 3ERRA 3RGLA 1WQWA 3UDIA 3CW2C 4DAMA 2K14A 1L2FA 3DLLA 3I4MH 3HOZG 1H4VB 1X55A 4YRJA 1KIXA 2I4NA 4JI5Q 1KRTA 1HR0L 2K5VA 4B3RL 2CWPA 2BA1A 5GQOA 3PUWA 3HFZA 4AH6A 1I94L 2WP8J 5IYCH 3FKIH 4JI4L 4JI6L 3IRBA 4X62Q 2ZJRA 2EIFA 1JE5A 1H4QA 4JBWA 1M90C 1KC8C 4DV5L 1FL0A 4LFAQ 5C51B 2ZNJA 2YV5A 5C44H 3HRIA 1KOGA 4DR5L 2MNAA 5IWAQ 1K9MC 3GTLH 1XPRA 2OTLA 1KAWA 2ZTCA 4TVAA 4JYAQ 1PH6A 4Y52H 2EWNA 1GVPA 3WQZA 3NETA 3JAMc 2JA7G 4DR7Q 2ZR3A 2A8VA 4XTWA 1WOCA 3VQWA 3V8LA 3F1ZA 3M7NA 3CPFA 1TWAH 4GOPA 2ZT8A 2DUDA 2R93G 3RLNA 5C0XJ 2ARSA 3UE0A 2E10A 1RL2A 4PHCA 3CPWA 4DR3L 1X2HA 2ALYB 3WWVA 4NB3A 4P73C 4GNXA 1PH2A 4JI3Q 2E2IH 3H15A 5C52B 3G6EA 4LF4Q 4DV2Q 1PA6A 3DM3A 3CCRA 3A7RA 3RLOA 2UUAQ 4LWCA 3LGJA 1HZBA 4JBJA 3G1ZA 3JAMi 1E24A 2NZOA 3GTOH 1HNXL 3A31A 1FJGL 3NENA 3JC66 3J81c 3PSIA 3BZKA 1XPOA 1QVFA 4XU1A 2BH8A 2UU9L 1YZ6A 3HXZA 1YIJA 1USYA 4DK3C 4A3GG 4H2UA 4KHPQ 4JCVE 4PG3A 2WFWA 1IBLL 2HIVA 3S1QH 4BY7H 4NXNL 5IP7G 5JJLA 4YCWA 2QHVA 2Y0SE 4A93G 1Q86C 2ODRD 1GD7A 3EBEA 4C3HH 4BA1I 2WAQG 2K75A 1W66A 1WYDA 1OXTA 2E2HH 1PH5A 3J81i 1YJWA 1HZCA 4H2YA 3HOVG 3GDEA 4XEOA 4XTCS 1JT8A 4P3NA 3H0GH 2NVQH 3A7AA 1FVIA 4HWRA 3PIOA 4DUYQ 4EQ5A 2A19A 2DQ0A 4BY1G 4YRTA 3U58A 1PYBA 4YRLA 1VCIA 2Q2HA 1YJNA 4YY3L 2KCMA 2RF4A 2ZT6A 1IZ6A 2B63G 2UUBL 3PGZA 1SRUA 5C0XI 1EVLA 2KHJA 2UXCL 5BR8Q 2ZTGA 4OWTB 4LNQA 4P74A 3CD6A 1WCMG 1EIYA 1LM0A 4YRQA 2Q5IA 1KMMA 2CJBA 4DV3Q 2Q2UA 4A3JH 4O0AA
chains in the Genus database with same CATH superfamily
4GN4B 4Q0FA 1IBKQ 2RHQA 3MF2A 4XXEA 2NVYH 1NMGA 3W3AA 3GTQA 2DZCA 4ZK9B 4PQXA 4A3CK 2M00A 4YRMA 4JG2A 3VR3A 1KRSA 4LF5Q 1WCMK 3AH5A 1GUSA 1X6OA 1VMCA 5IT9L 5BN3A 3AEVA 2ZINA 4F87A 3TRZA 1VQBA 1RD9D 3S17K 4KD3A 5IODA 2UXDL 2RCFA 1O25A 4XU0A 1KNEA 2K5WA 1O29A 1SYFA 5EBDA 1I50A 1VQGA 4ALPA 2CH4W 1BXTA 5KNBA 4RGMA 2K6AA 1O26A 2P5ZX 1VQLA 4GLVB 2ZIOA 1I6HC 1OXUA 5ELEA 1VQDA 5IOCA 5LHY1 2B29A 2GSNA 4LVJA 4X64L 1EEFD 3IL8A 2R92H 1H9MA 1I4HA 2Q5HA 3FRPB 3HKZD 4DUZQ 4Q5VA 5CV8A 1H9SB 1B76A 2X6LA 1ET6A 4TQFA 4LK1A 1N36L 1MHWC 3RZDH 1BDOA 5DAUA 4TKOB 4A3EG 3HFZB 3OWEB 1QNUA 1U4PA 3QO5A 1BJTA 5K1XA 2FJ2A 2PYKA 1USMA 1CKNA 2QCPX 3BU2A 2MP1A 3E9HA 4A4IA 1LUZA 5C3EG 2BE5C 4A3CH 3MTSA 3I7FA 3OTOL 1VQ5A 4A75A 3VA7A 4A3MH 3BG3A 2F3WA 2V4DA 4B08A 3A0JA 4G7ZC 1UEAB 3RN5A 1EEID 4C3HC 1SLJA 3BUEA 3LPXA 1B3AA 5C4XB 2WB1B 3S17H 1STEA 2E2DC 4QCLA 1X3PA 1JVIA 1FGBD 2L15A 3HEJA 1JB7A 1NMFA 1Y8PB 4UAIA 1XNRL 1HQMA 1I4RA 1TR5A 1Z47A 4JI7L 3GTPB 3GEEA 4Y7NK 4G0UA 1ZYRD 3SEBA 2O5IC 2VB3X 3K6OA 4UP9A 1B70A 1NYRA 2E2HC 5C3EK 1TU2B 3HOYC 2QKIC 4IPGA 3OPOA 4A3FG 4KLKA 3SHLA 1FNVA 2HDMA 2R92B 3M4PA 4LF6Q 4XLPA 1IW7A 1B4OA 1TT2A 1SYGA 2HCIA 5JPMC 3MXUA 2JA8H 1XZPB 1MBYA 3IFTA 1II3A 4ZLTF 2J3LA 4IFDH 2JA5G 2LXJA 4LF7Q 1O80A 2RBMA 3MXNB 2WB1E 3RZDB 2Z6KA 5IY0A 4G84A 3DM1A 2NVQC 5EKKA 4FF2A 2ODRC 1SSOA 1EFID 3K59A 1PTOC 4C2MC 4GOPB 2JXMB 4XTUA 1J98A 1QVCA 4QQBX 4FXGC 1B8AA 2I5MX 3KLRA 4IPHA 4CGYB 1N32Q 1TWHK 4A3MB 3HOUG 4K5VA 2CQOA 5J39A 1E0BA 2A5HA 4LUZA 1WPYA 4X5OA 1BKBA 4TVYA 2F4IA 3AFQA 5I6WA 1UE7A 2IX3A 3S17B 4KARA 2IX1A 3PF4A 2XCOA 4E51A 1P16A 3W2DA 1F7UA 3TTGA 1AE3A 3EFRA 3MXPA 2CQAA 4C1NI 1DCHA 1PYSA 2KCNA 1TY0A 4Y7NH 1HNWQ 1SBBB 3HKZB 5D14A 3CQZH 1HFNA 2Q2IA 3LX0A 1WTQA 3S14B 1YI2A 3RL6A 1LT6D 5G3LF 1I3QA 4JVZA 4QGUA 4DR2L 4DR4L 1SEBD 1ZKOA 2JA8B 3M4YA 1JWSD 5FOBB 3DEPA 1XXBA 1B2TA 4P3OA 3IPJA 2ZT7A 2ZJPA 1HZAA 4QUCA 5LMNQ 3TP5A 1ENAA 2AWNA 4QJVB 3M3YK 4JK1A 3DSQA 1HFGA 4K8JA 1WOPA 4L5TA 3CMQA 5C5MA 1STYA 1PMRA 2D62A 2VXWA 2I0QA 3CCEA 4RMFA 3TBIB 3S2DK 3OPFA 3HKZE 2L12A 3R2TA 4P5BA 1SR3A 4FZBA 2HD3A 3KFUA 1LTBD 3QJYA 1JJGA 5K36H 2E74C 4DDQA 3V4GA 3P1HA 1NAPA 1HH2P 3SGIA 1Y1WK 5C4HA 3RNUA 2A69A 1VQJA 4YHHL 4ME3A 2F0IA 3GTJA 4JV5Q 5J22A 3I8ZA 3S24A 5FLMG 4HJ5A 3A8JA 5F2DA 1XMQL 3CQZB 2LFNA 3R93A 4A3LK 1CSQA 5C4XC 1IBML 1HR0Q 4Q15A 3L0OA 3NK9A 2B2TA 1TWFH 2A6HC 1CT1D 4XT3B 5DLQE 3LSSA 4KM8A 3SZZA 1CA6A 1VH2A 1KL9A 4JOIA 1I94Q 3LC0A 3GTPC 3GTKK 1SE2A 1F9SA 5IYBG 1P8LA 4Q4ZA 3PO2K 4JI4Q 4A3IG 3D3RA 1RTNA 1VQAA 3I4NG 4QF4A 2AMCA 4KN7A 4X65L 2JA7A 5JJZA 3S1MK 3CC7A 1UAPA 2F0UA 1U0LA 1FYFA 2E64A 3M3YH 2RKSA 3A7LA 3PIP3 1YHBA 3VYTA 1O7YA 5FLXc 1GXDC 1AW7A 3I4MG 2FYKA 1QCBD 4LJZA 2RGRA 3NEMA 1EOTA 3S2DH 1X9NA 2F52A 3TQYA 3RZDC 1TWGA 1VQ4A 4DR5Q 4QL5A 1YNXA 3N52A 4UP7A 2CFAB 4A3KH 2VQFQ 4A3IK 4GOPC 4HIOA 1Y1WH 3GTGH 2NVXK 4BWGB 4JI1L 3T1YL 1HC7A 3HP3A 4HIMA 4MQ9A 4DAYA 2JA6H 3CXCA 4A3MC 5IYCG 3FKIG 3S9WA 3TEHA 1V1QA 3SK5A 1B9MA 3S17C 5JEAG 1CFMA 3UGTA 2ZT5A 1TWFB 1IBAA 4A3LH 4IFDI 2ZXFA 3A7AB 4H2XA 1W2BA 3L9AX 1S5ED 4DR1L 3HXVA 4CDFC 1O24A 3OIQA 1SNPA 3CMEA 1Y69U 3GTKH 1UEBA 3NP8A 4PMWA 1YX2A 2HNIA 1EWIA 3CCLA 3S14C 4BBSK 4RGTA 5C44G 2XN9C 3U4VA 1U4RA 4V0BA 3NPPA 3M3YB 3FKIK 2G9DA 3S1MH 1B53A 3UE1A 1DONA 2JA8C 4LNSA 2WV6D 3REUA 3GV6A 4GN5A 4JI0Q 4JI8L 4Q5SA 1HNZL 4RAUC 2QEJC 2K4KA 1HUNA 1Q81C 4LW1A 1BNZA 4A3DK 5IGEA 1I6VA 4J3NA 1ISEA 2ZM6L 3FMCA 3A5YA 5CBEE 4A3KB 4Z9CB 1BCPF 5ELBA 1Y1WB 3GTGB 1FR3A 2CCZA 2E65A 1PHJA 4L63B 2JA6B 4ZCKA 4YRNA 2Y0SL 3ZYYX 2HHHL 4B3SL 1AE2A 4LF9L 4I65A 2FMCA 3OMGA 4BBRK 1WTHA 3SK4A 1XTDA 3J80c 3MAQA 4B9WA 1KABA 1ZYRC 3OW7A 4Q6GA 4L5SA 2LMCB 4DV6L 1O7IA 3JAML 1LTGD 2E2JH 1EIYB 3E0EA 5KYLA 1SDFA 5JEAJ 1PZID 1QWYA 2QF7A 2E41A 1JORA 1D5ZC 3EA6A 1SNDA 1HNXQ 1USYC 4KHVA 2MO1A 2SEBD 2Y0SG 1B4AA 2JJQA 4XCHA 2PNHA 2Z0SA 4CS4A 2OTJA 3CMAA 1FJGQ 3CQZC 1Y1VB 1PYWD 3S2HK 3OEPA 1IW7D 4KMDA 2AQ3B 4NXML 3TZDA 3R2IA 1NJ5A 3AQPA 4BBSH 1DD5A 3S1MB 2I4LA 3QNEA 1HUMA 2ZT9C 3E3XA 3EQLC 5C0XG 2UU9Q 1CQFA 1GO3E 4JPBW 2BDNA 4HN7A 2NVTC 2A1AA 4JW0A 4TRDA 4OXPA 1AB4A 2EJ9A 1NY4A 1CKOA 4A3DH 2EPBA 4HAEA 4TQDA 2D6FC 1EQRA 1HTPA 4GTBA 3RUZA 2E8GA 4BKWA 4AYBL 3CAGA 1S5DD 4KMUA 3PO3H 1LT3D 5I4DA 2IHEA 3A5ZA 1R4QB 5G3LD 4CKCA 4NXNQ 2ES2A 4CKBA 1PDQA 4WJWA 3ERQA 2CW0A 4OIRA 3ND9A 4BBRH 4R4TA 2OQKA 3W5OA 2E2JB 4GN3B 3FP9A 5EAYA 1PH7A 1GUOA 3ULPA 4CDCC 2K52A 2Z6BA 5EKLA 1GOZA 2WIIB 1F2ZA 1BBUA 1E1OA 5C4JH 1SMYC 2KQ3A 2ASBA 3VR5A 2ZTDA 3EROA 5M3FB 2OF1A 1NNXA 1CSPA 1F2YA 1W6KA 1DOMA 2RA4A 3AYHB 3UFGA 4UP8A 2L9HA 1TWFC 3KF6A 3S2HH 3KLSA 1J6VA 3BDCA 5M3MH 3N6RA 4XYQA 3PIO3 4YP0A 1CKNB 3J81L 2F0JA 3DWAA 4DQ2A 1HXYD 1VMPA 4JBMA 1SNQA 4RHRA 3UI2A 2GN5A 5A2QL 4TVWA 1H4TA 2ZNIA 4P72A 4BY7G 1Q8KA 3TFIA 1I6HK 1ZBSA 2F0LA 3J7A5 2ZCEA 3M3YC 2B63A 4KTAA 1STGA 1AP0A 3GDZA 1BQQT 2PMZD 4QJFA 4CDEC 4YROA 2I07B 3IKLA 4YRFA 1GKHA 3PO3B 5GROA 4C3HG 4AYBD 3HY1A 1B70B 1G2SA 2A69D 3G6JB 1RCVD 2C5CA 1MJEA 4J8QA 1PV4A 1TQOA 3KF8A 4K14A 4BXXK 3MEFA 4BBRB 4A3KC 1S4ZA 3CKIB 1Y1WC 1EVKA 3GTGC 1V1OA 3AFPA 5FJ8H 4LVMA 1EK8A 2JA6C 1HA6A 4E6IA 3V7SA 5C4JB 4IOAA 5I9PA 1IKLA 3UH0A 3AD9C 1LLRD 1UNSA 4RKLA 4P74C 3OIPA 4ILDA 1ZXTA 5JVH3 2L4NA 4OP0A 3L2ZA 1PLFA 1BIBA 3S2HB 2R6GA 2KWAA 1AEXA 2E5LL 1RODA 5K1PA 5M3MB 2EDGA 3L3OC 4RHSA 1JOEA 1IYVA 4RKBA 2EY2A 2CVRA 3GQBA 4R9WA 3MFGA 1VQPA 1ESFA 1K73C 1SNCA 2IY5B 2UUBQ 3H0GG 2R7ZC 1TWCA 1Y1VC 3BYYB 4GKKL 2E2HK 2LS01 2QGQA 3AMUA 2DXUA 1WNLA 3FPPA 3IALA 4BW9A 3M7GA 1I6HH 3HOYK 3HOXK 1STHA 2Q7EA 3GTQC 3S1MC 2N3SA 3KLSX 1EIGA 1TS4A 1CZGA 4L87A 3PUXA 3L4GA 1KXLA 5E4XA 3MEYA 2RSNA 1X3GA 2XTIA 1PYSB 1A8VA 2JEAI 4GZYA 1PH4A 3G71A 1ZXOA 2O5JA 1I4XA 4APVA 4JI5L 1QOHA 4BXXH 1EWCA 5GAEC 1I50C 4C2MK 2M9VA 2XRQD 4OIQA 4LFCQ 5FO9B 1X3EA 3LAPA 2IX0A 5C6AA 4HIKA 5LMNW 2DZ9A 1F7VA 1WORA 3NE5B 3MWYW 2E2JC 3Q22A 5F5WA 3DHQA 1RF2D 2KEDA 3CCJA 2F0QA 1JOOA 3L2PA 3TP6A 3CU7A 3JAME 1X31C 1XPPA 1SFOA 1VQ8A 4CS2A 3MMLB 2PMZB 4QMGA 4LK1C 5KRUA 2XCQA 1TWGH 3P20A 4ZYSA 3V05A 5IWAL 1MKHA 1YFSA 1GUGA 1WLEA 1IQ0A 1O2BA 3HOYH 3HOXH 3GTJB 1CUKA 4X64Q 4A3JG 2F0WA 1KD1C 1ADYA 4OHJA 2F4VQ 1K28A 5J1ZA 1LO5D 1D7QA 4OX9L 3A56A 2TMPA 4R4OA 1Q7YC 4FO2A 4G7OA 1SN8A 5FKAC 4OWWB 2GVAA 3VDYA 4DR7L 4JI2Q 2QILA 1HR0W 1BBXC 2E1HA 1HQMC 1KLUD 4C2MH 3PO3C 2PMZE 2WB1G 1H9RA 4PABA 4LUOA 3TP7A 4OINA 2RHSA 4AYBE 2AMCB 2JA7B 4BBRC 2JA5A 1JQWA 1STBA 2EJGA 2PI2A 1IW7C 3NWTA 1F77A 5EKIA 2QHUA 5DM73 1EQQA 5C4JC 3A8JE 1KDAA 4YWLA 1X65A 2PQAA 4DFAA 1JMCA 1EUJA 2I4MA 2B2VC 2AWOA 4KR2A 2O2LD 2R92G 4DXGA 1BBWA 2AKWB 4L5RC 1TWGB 1UWVA 1XNRQ 4JI7Q 3S2HC 2PPBC 3GTMA 2UUCQ 2RQXA 2WAQD 5C4XK 3ZJYC 3HOYB 4KDDA 3HOXB 3FHZA 5I2XA 3QX3A 4MNOA 3GTPK 2XNAC 3S1NH 3J81E 4DV1Q 4HA8A 4XEMA 3TEHB 1KMNA 2JEBI 3J7AV 3IKJA 3UDFA 3SVMA 3V7RA 1U4LA 5A2QE 4ZRZA 2CGHA 1B4BA 5IGBA 1YGBA 4P71A 4A3CG 1QUQA 1PJ7A 3WODA 4P73A 3FOEA 3F2BA 1IKMA 1VQFA 4A3MG 3L1AA 1EIFA 4H2XB 4PZ6A 3F8TA 2I5LX 3HKZL 4NDXA 4POGA 3BFMA 3PMFA 4KY7A 1SRYA 5IP7H 2JE6I 1KQ4A 4XIGS 1C0AA 2ZTEA 4LF8L 4JBKA 4HJAA 2DTOA 3RZDK 1DYQA 1K0SA 4IZ8A 1XZQA 2FFKB 1BCPB 4LFBQ 1N33L 5E7NA 2A68A 5DM63 1LTID 4B3TQ 3N3YA 3HKZG 4YYEA 4ABNA 1VRQC 4U68A 4A3MK 2PW5A 3FHWA 4C45A 1SYDA 1Z7TA 1EFWA 4OGQC 3HKSA 3I73A 4JK1C 2JA8G 2DJZA 5ELDA 1TS2A 1Z9FA 3BVGA 4DV7Q 3I70A 4POFA 2ZZFA 2NS6A 1SMXA 2Z9HA 1A0IA 2ATWA 4IFDG 1A3UA 3QIAA 5C4XH 2XCRB 3P8YA 3GO5A 4RCOA 1N34L 3E5SA 1O2AA 3S1NB 1DCPA 1Z6HA 1TS5A 1WD0A 4YCUA 4DR2Q 3T1HL 2AHOB 2DGYA 4DR4Q 3GTPH 4A3GB 3URYA 2P5IA 1ASZA 5T1IA 1A63A 2A69C 3S14K 4WJ3M 5TMFA 2D0PA 5IGFA 2F0HA 3GTJC 1PH9A 2JA8K 4L6TB 4H2WA 3ADAC 1HRJA 1R9TA 2ZIMA 4KB2A 3L4JA 1QF6A 2EYLA 4A93B 5CC4A 3OW2A 5CYUA 4BXXC 1SE3A 1Q12A 2B2TC 1K83K 4WF2A 3SK8A 4KAWX 2TSSA 4JOIC 2MJ8A 1VQNA 2KOLA 2WAQB 2HCCA 2R7DA 3TN2A 2NZ1D 1E7ZA 4TSSA 1PJ5A 3WOFA 4P2CB 3A5UA 1L0XB 4C3JB 1B7YA 3OMCA 4KN7C 1K0RA 2JA7C 4ZTUB 1SAPA 2XIWA 1EY7A 4IOCA 3TUPA 4GTFA 4LLGA 1NTGA 2E75C 1WTOA 3HRKA 3K8AA 3BP8C 1XMQQ 1VQKA 3HOWH 1OXXK 3HOVB 4P5AA 1IBMQ 4ZTZB 4IFDJ 1XNQL 4LJZC 4NW2A 5ELFA 3A5ZB 3PUVA 4EX5A 3PF5A 2F0GA 2SNMA 1TWGC 5GAHC 2J3MA 3CQZK 3CHBD 1EY8A 1MSHA 2EAYA 2ZFZA 5EJWA 3U9SA 2B39A 1J5EL 5LMUL 4TVAB 3HOXC 3UDXA 3S14H 1ICWA 2LSSA 4DUYL 5K36G 1H4SA 4BS9A 2AUJD 2NTSA 3A8IE 4KHZA 3E6ZX 4G0WA 2B2WA 4ULLA 5IT9c 2NVTK 2F0OA 1YFRA 1A2TA 2ALYA 4CH6A 4XSZA 3NBIA 4DV0L 1WQGA 2K05A 1K3RA 3V8JA 1PRTD 1Q1BA 3K7AK 1B3QA 1GUWA 1K83H 1M8AA 1EWHA 2NBFA 3T53B 3GTLA 1TXYA 1G5HA 3KDFA 1UE1A 3BZCA 1E2ZA 5J3BA 1BUVT 4JI1Q 3T1YQ 1TVXA 4KKTA 1K8AC 1B1ZA 4MTNA 1BCPC 5DEHA 3ITPA 3HOWB 2VQEL 4K86A 1O7ZA 4P75A 5CGKA 3FOFA 4GFQA 2VNUD 3WOEA 3EN2A 2DEQA 3I2ZA 3GEHA 4GNXB 2NN6H 4N9PA 1XXCA 1SXTA 4O2DA 1I6VC 2K50A 1O28A 2OCEA 1TWAA 1LTAD 3KF8B 3NSWA 3P7JA 3ERSX 4X6AC 5M5XH 1ML0D 1K8GA 4DV3L 2VUMA 1TWFK 2JQOA 4N9TA 2EBBA 1L1OA 1IBKL 4L8JA 3H09A 1SMYD 2M2LA 3S1NC 4IQZA 4IO9A 4QUFA 4A3KG 4A3GC 1Y1WG 5LL6S 5IORA 4LF5L 5HY6A 3I56A 4A3BK 4UPAA 4JI8Q 1HNZQ 4GKJL 2KECA 2CJAA 2QDLA 2P5MA 4CS3A 5FLXL 2NVTH 3QWNA 3QTCA 2F03A 1PZKD 2E2IA 1K83B 3K7AH 2ZM6Q 4R4IA 1ZVUA 1J6XA 1OTCA 1SFOH 3ULLA 4BLBA 5IP7C 2DVEA 1XMOQ 1TWCB 1S5CD 4HCSA 4H2SA 4A3LG 5KEEA 4DR6L 4A93C 5AJ3L 1RIPA 4LF9Q 1INNA 4A3KK 1VQ6A 3WDNA 1NJ8A 5LL6X 3LSQA 3VQVA 4YIJA 3X3MA 2WINB 3VQXA 3PO2G 3GTGK 3K5MA 1F9QA 3PUZA 2JA6K 3A8KA 1WOOA 1WTRA 2EY6A 1BGWA 1KQSA 1G2TA 2UXBL 2DXTA 3KJOA 4C3JC 1F9NA 3GTOA 1CM9A 1MIUA 1AH9A 1JOKA 5M5XB 4KN4A 1G6PA 4DAPA 2SDFA 1QG7A 1SERA 4YRRA 4RQEA 3SR1A 3HOVC 2OT2A 4B3RQ 2YU9A 1BDFA 3EJIA 1EI6A 4KMUC 1PRTB 4ILWA 1TIID 2EYHA 1VQCA 2QHTA 4WI1A 5ELOA 4HMIA 3C2PA 3QR8A 3HXAA 4LMQD 4PAAA 1Y1VK 4QIWB 4HIDA 3M9BA 4JI6Q 2NVTB 2PZTA 4A3BH 3TREA 3GTQK 4AIMA 3K7AB 1WSRA 1EQVA 1SFOB 4DV5Q 3J7AF 2JSOA 1OXSC 4J1MA 2NYZD 2EYFA 4MTKA 1PFBA 2A68D 2AQ1B 2ZXOA 2E5AA 4OO1H 2R93A 2QA4A 4J15A 5IGGA 1LTTD 3E9IA 4CH4A 3GTMH 3J7YW 3CRLC 1CHQD 5JJKA 3IKMB 4RH6A 1I50K 2QW7A 1NSNS 1YB3A 5I9OA 1PH3A 1EH1A 4IUNA 4RA8A 4LF6L 4P72C 1CKMA 4BBSG 2B2YA 3W1BA 3T01A 2QHSA 4IJHA 1JCKB 3FJPA 2IWHA 2B63C 1QJOA 3HOWC 4LF7L 3QO7A 2E2JK 3PCOA 4A3FB 3NBHB 1HXDA 3HXYA 3HXWA 1EY9A 1E2WA 2IPKD 3TFHA 4DK1A 4GNXC 1XXGA 1S5FD 4A3DG 1KTKA 4KKSA 4RGOS 4NKLA 5D3IB 1UUPA 2D0OA 2RHSB 5M3FK 4AQYL 2DQ3A 3CAMA 5KNCA 2R7ZH 1D8LA 1RTOA 3K0YA 1Y1VH 4XQJA 1FGUA 3VYRA 4A3BB 1D1KA 2ENBA 4PZ8A 3W1GA 4HWSA 4IUQA 1J8IA 1YJ9A 4HSPA 1WFQA 2PQAB 3GTQH 2BOSA 4BBRG 4DR3Q 1VQEA 3H0GA 1VS0A 4YFKA 4OLFA 2C8MA 3NHHA 3PUYA 4DPGA 3GTMB 2P0LA 2K1BA 3E0JA 2NN6I 3D4WA 1K83C 2G5DA 5IE8A 2WACA 1I50H 1TWCC 3PO3K 4HMJA 2KUMA 3CP0A 2H1EA 1I5FA 1CA5A 4H13C 4XTXA 1YNNA 1GGMA 5ELNA 4KASA 3IFDA 1D5MC 5KIXA 1MI2A 3UGQA 2P8TA 5C4JK 1WQHA 1BOSA 4LVKA 4HJ8A 3AU7A 2K5HA 3A74A 2O5JC 4ZUIA 1CHPD 2R7ZB 1KHIA 5EBCA 5M3FH 5CHPA 1C4QA 4CHTB 4KC6A 5IOQA 5A35A 3ICAA 3FPUB 5FO7B 1NNHA 2C9OA 5M3MK 2JP1A 4YRKA 1BO0A 3OYYA 4K0KL 2RHQB 4DAVA 3S15C 1O2FB 1X3FA 1PRTC 5IIFA 3GTQB 1X01A 2R61A 1E1TA 1Q46A 2NTTA 1V1PA 5BN4A 1RKNA 3I4OA 1C9OA 3S0XA 4JV5L 1JOQA 2PZUA 5FJ8G 1PH1A 1HTTA 4XSXA 4C3IH 3SK6A 4BLAA 3ICEA 2PA8D 3KJPA 3SZYA 3V96A 3RD4A 4RDXA 4FYDA 3K7AC 3STBD 4A76A 1A6XA 1I4GA 3GV3A 2PMZL 4KY5A 1SFOC 5FLXE 5IYDH 1I50B 1IBLQ 5M5YB 4G85A 4HJ9A 3HTZA 4DA2A 3CF5A 2K5NA 2NVYA 3AQOA 3DWQA 2HQEA 3KYHC 5IP9H 3QB3A 4NOIA 5KYIA 2QEXA 1I3QK 5FJ8K 1G6ZA 1G91A 3J80i 1VJEA 4X66L 4MZ9A 4KQEA 1PFNA 3AB9A 1QNKA 2KBNA 4AYBG 1WQFA 4FM9A 4YRCA 2RDGA 4K2LA 1WU7A 4G7OC 4ZAIA 1GUTA 3MA2B 5HURA 3CC4A 4RGNA 2A6HA 2YTVA 4XU3A 3TS2A 4A3FC 1D1IA 2F3VA 4OO1I 2FMMA 2KVMA 4CJ1B 2VQFL 4NCXA 4ZIBA 2F0FA 4DV4L 4YG2A 2DTIA 4XDXA 2Q7GA 4XLNA 3TMEA 3HZXA 1VQIA 4BXXG 1B7YB 4C3IB 3CRKC 2JA5C 2R92A 1T5EA 4A3BC 4OX9Q 2EL9A 1S72A 1QVGA 2Q8IB 4IJLA 1WTXA 1DZ1A 1EY6A 2PMFA 3GTJK 3MXNA 3SDZA 1SETA 3TSSA 3H3VD 1K3BC 3PIPA 2Q7HA 4GS3A 4MHEA 1M1KC 3M4OC 1XTCD 3SE0A 3TEGA 3GTMC 2XWJB 1SJHD 1VQ7A 2PZWA 2VUMH 1JWMD 1WCMA 3MEHA 1I3QH 4F8MA 3HOZH 4YRPA 4RQFA 4DF7A 4B3ML 2EYMA 2EXZA 1KLGD 3J80E 3REXA 3HOYG 4JI0L 2MHVA 3BJUA 3HOXG 2JA7K 4P71C 1C7YA 5E68A 4QY7A 2XRSD 4YREA 2JH3A 5JFEA 5C44B 3G4CA 1FNWA 1X56A 2EXDA 1ZQ1C 2R7FA 3GTLB 4YY3Q 3D31A 4K88A 3VR4A 3GIRA 1SYEA 3MZ5A 1VDZA 3KDFB 4H7BA 3I72A 1Z7NA 4I7ZC 3K5NA 1TWGK 2Y3PA 4KD4A 3TS0A 4LOWA 2JA9A 3H3VH 2A68C 4ID6A 1I4PA 3RKYA 1PVOA 2UXCQ 1IS1A 2CHBD 2A6EA 2RCNA 4R1JA 1EOVA 4RCNA 4H2VA 3T13A 2AQ2B 3NUCA 1EYCA 3GTJH 1AFPA 2Q2TA 3B6YA 4FXDA 1FNUA 1Y14B 2H4OA 1TWAB 3ULJA 2KHIA 1RDPD 3GEIA 1E2VA 2LY7A 3F2DA 2VUMB 4LF8Q 4PNYA 1L1OB 1ASYA 1JICA 1I3QB 4DXFA 2YU9H 1C48A 2RDHA 1NJ6A 2DY8A 1N33Q 3HOZB 3J7ZC 1XPUA 5FLMC 5JPNC 1D2BA 2DN8A 2BCOA 1PZJD 1NJ2A 5EPLA 4X62L 4R4CA 2JA7H 2A8EA 1YNJA 1E3PA 1MJCA 2VS1A 1NYQA 5C5LA 2E2IB 3RZOH 4IUVA 1Y8OB 2GAGC 2V1CC 2FHTA 2N88A 2XSCA 1QZHA 4DNRB 2UXDQ 4OELB 5D3DA 4LFAL 5IYBC 1R9TC 5JVG3 4LVLA 5CV4A 2EOTA 3D0FA 3L7ZC 5EGEA 2R93H 1S3OA 1WOSA 1N34Q 1BCPD 5HGTA 1IXRA 4X6AK 1J6WA 3NQIA 2WAQL 1TY2A 1HA5A 5KGUA 3T1HQ 3H91A 1LTLA 5JVOA 4ZUJA 1EU3A 5JJIA 2E3CA 3OREA 2OWOA 2EJFA 2K33A 3K80C 2H5XA 3TP8A 4YRGA 1DD2A 1ILPA 1VQZA 3Q3QA 2A6EC 3S1NK 2EYJA 1H9KA 3LWEA 2DJGC 4JYAL 4C3IC 1YEZA 1IYJB 4A3GK 1PFSA 3K7UC 3QOLA 1AZQA 5GAGC 1WI5A 4TTVA 2F0PA 3EIVA 1ENFA 2YYZA 4P3PA 4XQNA 3KBGA 5IYDC 5HGQA 2CKZB 2F0DA 2YU9B 4ZKCB 2EYOA 5IOSA 2KEEA 1N36Q 1DCOA 1TWHA 1O27A 5KNNA 1ESRA 4CJ0B 2VW9A 1YNND 5IP7K 4YWMA 1PFMA 1MD2D 3H94A 1S40A 3RKWA 5IYCC 3D4RA 5C4XG 4PMCA 3LWUA 2KCTA 2DU7A 3ONAB 4A93K 5IP9C 1VF5C 3GD7A 3OTOQ 5CORA 1V43A 4C56C 1NR2A 2NB0A 2BH2A 3RZOB 3OOCA 1AN8A 1AZPA 1HHVA 3PQIA 3HRZC 1G291 3W3SA 5CMDA 4EQNA 4HVCA 4F7XA 1NJIC 1J5WA 4EVOA 1DCZA 4HT4A 3N0BA 2B2WC 4C3JK 2ICIA 4MEXA 2R93B 4WRDA 4DGZA 3S1QB 3TZUA 1XNQQ 1BR9A 3BZDB 3O13A 2Z6KC 2GAHC 5C44C 4JI3L 2WKCA 3MC0B 4L5QA 4IUUA 2PW7A 4X6AH 4CH3A 3GTLC 1BS2A 4LF4L 3HOVK 4CH5A 4MEYA 4DV2L 1J5EQ 5LMUQ 4FP5D 3STBC 3QG1A 1Q8IA 2FINB 4YDQA 1O7LA 4DAYB 2VL6A 1HJPA 3Q8DA 2X69A 1VQOA 1F93A 4Y52C 2UUAL 3F2CA 2ZXRA 1NUCA 4A3GH 4FNFA 4KJOA 4MIUA 3PCOB 3K5OA 4P75C 2C35B 1PH8A 1JJCA 1UE5A 5EPKA 3T16A 4DV0Q 3AD7C 4IN3A 1CI3M 1HQRD 2MO0A 1WTPA 3HOWG 2CW0D 1N8RC 1TWAC 3DXJA 4N8FA 5T1GA 3Q24A 1Y1WA 2YTYA 1OXVA 4X3TA 1EYAA 1TS3A 4XTYA 3BDOA 2VUMC 1EZ6A 1L0YB 4A93H 4HWTA 3IG2A 1L1OC 1I3QC 4FF3A 4DNIA 2EZVA 4IPCA 4XTVA 3PZCA 2JK8A 3HOZC 3A32A 3H3VI 2X6GA 3A55A 5JAVA 1F2LA 2VQEQ 3T02A 2LXKA 3H0GB 4K6LA 1O78A 3D6CA 3KUPA 4WORA 2R7ZK 4C3JH 1YFTA 1U9RA 2B63K 3JSTA 4DN4M 4DKAC 5C3XA 2E2IC 2NWGA 3HOWK 2FXQA 4PZ7A 4KHPL 3GTKA 1IE0A 4LQYA 5CV7A 3HOVH 3CCSA 3CCVA 1WIHA 2DTHA 1W3SA 1QZGA 4HR7B 4LFCL 3H3VC 4G7HA 5L37A 5C3WA 5TMCA 4UDUC 1H95A 2CWAA 4YRIA 2G9HD 4GKJQ 3CCUA 3CCQA 3GTOC 4IUPA 1CK1A 3V8KA 3A7UA 2QDBA 4KN4C 1LABA 3EFXD 4GTCA 2NN6G 2SNSA 4NMZA 5JOBA 4DR6Q 5D4DA 2EE1A 2NVXA 1G5IA 2YU9C 1UE6A 5D65A 1ZEQX 5AJ3Q 4QIWL 4LAAA 1V1PB 4BY1H 3DUZA 1TWCK 4P9SA 4KMHA 1LYLA 2YTXA 4IALA 4YHHQ 4YPFA 4CDDC 2F4VL 2DDZA 3PV0A 2UXBQ 5CBAE 3RLFA 1YITA 2FQTA 1GJXA 3OD1A 4YFXA 3RZOC 4IURA 2K5DA 2B63H 1BIAA 3MF1A 4JI2L 2ZZGA 1JR0D 1FYCA 3NTHA 1CTMA 4A3JB 2R93C 4KJNA 5COYA 1STAA 3K0XA 2NVYB 5H1SE 3S1QC 4BY7C 3QO8A 2DJFC 5ISRA 5M5XK 4LUVA 4H2TA 3C3LA 4NPSA 4XU2A 4F88A 3TDQA 3FKIA 4FDBA 3AD8C 2ID0A 4FXKC 4YWKA 1Z7MA 1OO9B 1WCMH 2WAQE 3RF1A 4X65Q 1A15A 4EO4A 3S15K 5M5WK 1SESA 1WJJA 1QB5D 2B2YC 4IPDA 3IAYA 3DEOA 1VF7A 2O4XA 3R07A 4KK7A 3Q0AA 5E3IA 2HT1A 3HG9A 1V8QA 4UHVA 4A3EK 1VQ9A 1X3QA 3KF6B 3VR2A 2UUCL 3BS1A 4G57A 1SFOK 4BY1B 1X54A 1SROA 4QIWD 3NELA 2N49A 3DWPA 1G51A 1YNJD 3DMUA 2ZJQA 1TWCH 4V190 2CJ9A 2EQSA 1NR4A 2DU5A 4R4QA 4DV1L 4DNTB 1ICFB 4OEMB 12ASA 4KATA 4X3SA 3L4KA 3CC2A 5BR8L 2B63B 2B2VA 2IHFA 2PQEA 2IL8A 2F1MA 3BDLA 2B3GA 4B9XA 1A62A 4A3BG 3H0GC 4GLAC 1USOA 3G4SA 2PPBA 2MFIA 2G4CA 4XT1B 3U50C 3S1RK 3MFYA 3RN2A 4DR1Q 2KENA 2I4OA 4AQYQ 3VQYA 4A3FK 4BWAA 2IY5A 3RKXA 2K32A 11ASA 3S16K 1WCMB 3EVQA 4OO1G 4LFBL 1M4VA 4BA2I 3I55A 2FQOA 4B3TL 3S15H 2GVBA 5M5WH 4GTEA 3QOJA 3LNNA 3RUXA 1YNNC 4K5XA 5CR3A 1VQMA 3MQZA 2JA5K 2DNEA 3ER0A 4YRSA 2E76C 4HWPA 2JA6G 3I3CA 3U4ZA 3K81C 4A3EH 4G0VA 2N8NA 2B2UA 4DV7L 2N78A 2F0TA 1RU0A 1J6QA 4DK6C 4IUTA 4KKUA 1ET9A 2BA0A 2NZHA 5C3EH 3M4OK 3HOUK 3HXUA 5BN5A 1QILA 1YHAA 3GTMK 3M4QA 4RG1A 1GHJA 5TSSA 2EY5A 1LT5D 4M8AA 4X3UA 5E4WC 3J81j 2ARTA 2HHHQ 1YBYA 1SNMA 4B3SQ 2VY3A 4J6HA 2R7ZG 1YCLA 4HSVA 1Y1VG 2ZGWA 3L4GB 2CFMA 4DV6Q 2OQ0A 3R3OA 5EGHA 4DUZL 2I5HA 3HY0A 3S1RH 4O42A 1SE8A 2A74C 4DU9A 2IW3A 4A3FH 1FD7D 1TWHH 3AQQA 3OHXC 3S16H 3P8VA 3LAJA 2HIXA 4K0KQ 3CCMA 3S15B 2B8FA 2ZR2A 5M5WB 4NXMQ 4M1UB 4U673 2NVYC 1KAAA 1NBWA 1E22A 4KMAA 2KJXA 2CW0C 4TQUS 1XWEA 1HZ9A 5E1FA 4CBVA 2JA5H 1IHZA 4ME5A 4A3EB 1JJ2A 1IL2A 4Y7NB 1ATIA 2Z4IA 2LKVA 4ZQ3A 1L0WA 1DOLA 4H0LC 3G7LA 1DXMA 1XJVA 4HEDA 2RH6A 3NUHA 4G4KA 5IT9E 3T51B 5C3EB 4YCVA 2K28A 1Q82C 2V6TA 1ADJA 1MGSA 3M4OH 3HOUH 1T9HA 4HWOA 1Q1EA 1EU4A 2J0TD 1WTWA 4H02A 1EYGA 1WD1A 5M3FG 4HJ7A 4BY1C 2BE5A 3J80L 5M5YK 5C53B 4X66Q 1YHQA 3FDTA 2L5TA 4QIWE 2VZAA 1STNA 2R92C 5FLMK 4G7ZA 3R8BA 2F3IA 3KLWA 3KOJA 4NP5A 1NE3A 1ENCA 4OIPA 2DKGA 1GM5A 3P8TA 3S1RB 5GADC 2F0VA 4OIOA 2F0KA 1GUNA 4C3IG 1B9NA 4TWAA 1TWHB 3S16B 2D2CC 2AKWA 2ARUA 5AFWA 2PNRC 2O5IA 2E2HA 5IYBK 1R9TK 1J9OA 4A3JC 4DV4Q 2ZUEA 3I4NK 5IYDG 2JN4A 1N32L 1EY5A 1JC7A 2JA5B 4XTZA 4A3CC 3M85A 2KCCA 1WQ7A 2F0MA 3PO3G 1WCMC 1SJED 4KM9A 1U5KA 3ERED 3K57A 3TFJA 3U9OA 1LV9A 5IP9G 3X3NA 3VYSA 2MQHA 2R3ZA 3UDGA 4C3IK 3I4MK 2PA8L 5IGCA 4GLXA 1V9PA 3M4OB 2XGTA 3HOUB 3V7CA 4KR3A 4UY8C 3VBBA 1YVCA 5EGTA 1HNWL 2HQLA 1QE0A 5IYDK 3RIRA 2A6ED 3PO2H 2PMEA 1BVSA 2OXPA 4XQQA 2ZZEA 2MUYA 5M5YH 5M3MG 4OWXB 4K87A 5IYCK 2PI2E 3P75A 2CH4A 3HGBA 4B3MQ 1KDBA 4KI0A 5FLMH 2KA7A 3HFVA 5IP9K 5C4ZA 2ICEC 1PTOF 2EJMA 4OONA 2K04A 1QUQB 1HCZA 3RACA 2GSOA 5LMNL 1JJCB 2CIMA 3S2DB 3H6MA 1N9WA 4XYOA 4GTDA 4JC0A 2RSOA 4WJ4A 2C7IA 2E5LQ 3HXXA 3EFSA 1VQHA 2ZXPA 4GZYC 5E3FA 1NJ1A 1DGSA 1RIQA 2IT1A 5IYBH 1R9TH 1XMOL 4K5WA 3RR5A 4A3IH 5EQ0A 3I4NH 1XZQB 4R8IA 1X2GA 5C44K 2N55A 2NVXH 5FO8B 1DM0B 1XYIA 4GKKQ 5HL8A 1LT4D 4RWSC 3GTLK 3F2UA 2I46A 3G48A 2OEOA 2VUMG 3ERRA 3RGLA 1CZWA 2KHSA 2K5QA 5KNDA 2Q8TA 1WQWA 3UDIA 3CW2C 4DAMA 4Y52K 2K14A 1L2FA 1YNJC 3V2TA 3VR6A 3DLLA 4FF4A 3HOZG 3I4MH 1CQVA 1H4VB 1X55A 4A3EC 1T5XD 1HI9A 3MHBA 4YRJA 3GTKB 4Y7NC 1BF4A 2Z8LA 1KIXA 2I4NA 3C1FA 3PO2B 4JI5Q 1KRTA 1H9SA 1HR0L 3H3VL 5C3EC 2K5VA 4B3RL 5L46A 2CWPA 4HCEA 2EVBA 2BA1A 5GQOA 1TWAK 3PUWA 3HFZA 4AH6A 1I94L 2WP8J 5IYCH 3FKIH 1EY0A 4JI4L 2VUMK 1GE9A 4K2KA 3K58A 1WSVA 2EJFC 4JI6L 2RVLA 1HTLD 1Q3LA 2D9UA 4GTLA 1XX8A 3D6WA 3IRBA 5JEAH 4X62Q 2ZJRA 2EIFA 5TJ3A 1JE5A 3HOZK 1NCVA 2V6UA 1H4QA 1B50A 3A8IA 4KB4A 1D6EC 2VB2X 2BDOA 4JBWA 1M90C 1ILQA 1KC8C 4S3SA 2DNCA 4DV5L 2Z4HA 1FL0A 1R9TB 4LFAQ 4I7AA 4A3IB 1V5VA 3S1RC 3I4NB 5C51B 3VA5A 4LVIA 2NVXB 1S5BD 2ZNJA 2RDFA 2E2IK 1EL0A 2YV5A 3BYTB 1K8MA 5C44H 3HRIA 4DR5L 1KOGA 1TWHC 3S16C 3GTPA 1JQYD 5IWAQ 2MNAA 2Y0SD 1H9JA 2XVSA 1K9MC 3GTLH 1XPRA 2OTLA 4EQPA 1KAWA 2ZTCA 4TVAA 3I4MB 3T4AC 2L1BA 4JYAQ 1PH6A 2EJGC 4Y52H 2EWNA 3T00A 2PCFB 1GVPA 5CJ9A 5K5PA 3WQZA 1KDCA 1GHKA 3NETA 1XZPA 5CV5A 4R8NA 3JAMc 4EQOA 1D5XC 2JA7G 4DR7Q 2ZR3A 3GTOK 3BVMA 3NTIA 2A8VA 1ONLA 4XTWA 1WOCA 2PO4A 4BBSB 3VQWA 3V8LA 3F1ZA 3M7NA 3HOUC 2Q8RE 2J7ZA 3CPFA 3FKIB 1TWAH 1PJ6A 3QO2A 4GOPA 2ZT8A 2DUDA 3Q6SA 2R93G 3RLNA 2YU9K 5C0XJ 1Y8NB 3Q23A 4A3DB 2ARSA 1WTVA 3UE0A 3NXWA 2E10A 1RL2A 4PHCA 3CPWA 3G4AA 4DR3L 1X2HA 2ALYB 3WWVA 4NB3A 4WILA 4P73C 3RZOK 2WKDA 4GNXA 3S2DC 4MN3A 1F9RA 1PH2A 3N0CA 3K5LA 4JI3Q 2E2IH 4ODGA 3H15A 5EPJA 5C52B 3G6EA 4LF4Q 3BP3A 4GTAA 3FEWX 3DXJC 4DV2Q 2R93K 5C0XH 1PA6A 3S1QK 3DM3A 4BY7K 3CCRA 1MSGA 3A7RA 3RLOA 3NWSA 2UUAQ 3ND8A 4LWCA 4PMBA 5ELCA 3LGJA 3RMHA 1HZBA 4JBJA 3NTKA 5CV9A 1EQTA 3G1ZA 1SYBA 1IYUA 3BVZA 1E24A 4K6DA 3JAMi 4A3LC 1RHPA 4C3HK 2NZOA 4QJVA 4X3KA 3GTOH 2V6SA 2F0SA 4LR2A 1HNXL 4GT9A 2HDLA 1K83A 3A31A 2BE5D 3MVVA 1FJGL 1VGXA 3GTKC 3NENA 3GP7A 3PO2C 1UV7A 1EY4A 3JC66 2XWBB 3J81c 3PSIA 2NUCA 3BZKA 1XPOA 1QVFA 1RJTA 4XU1A 4LK0A 4G7HC 2ZUFA 2HUGA 1DOKA 2Y0SB 2BH8A 2Z1CA 1ZYRA 2UU9L 1XXAA 4WFN3 1YZ6A 3HXZA 1YIJA 2L11A 1USYA 2EYPA 4DK3C 4A3GG 4H2UA 2SOBA 3D8GA 4KHPQ 3CQZA 1C8CA 3H0GK 2NVQK 4JCVE 4PG3A 2WFWA 2MGSA 1IBLL 4A3IC 1SNOA 2HIVA 5IGDA 3I4NC 4KY6A 5IOTA 2EY1A 1X32A 3S1QH 2NVXC 4BY7H 3KK7A 4NXNL 1JWUD 5IP7G 1WVLA 5JJLA 3EQLA 4YCWA 2QHVA 3SXHA 4OIJA 2Y0SE 1LTSD 4A93G 1Q86C 2ODRD 2MPMA 1GD7A 4QB4A 1PTOD 3GTOB 2F0NA 3EBEA 3I4MC 3D4DA 4PV1C 4C3HH 1R4PB 4BA1I 2WAQG 2K75A 1PRTF 1A2UA 4C3JG 1W66A 4O1NA 1WYDA 2AUKA 1OXTA 2E2HH 4AYBB 1I6HB 4ZKBB 4BBSC 5I6YA 3NQTA 1PH5A 3J81i 1YJWA 1HZCA 4OIKA 4H2YA 1VLOA 2CFAA 3FKIC 2JYOA 3I90A 1EZ8A 3HOVG 4ZH4A 2IJ0A 1SE4A 4M1XA 2K7VA 2J4XA 4H44C 3GDEA 5M9OA 3A8KE 2WB1L 5FK9C 1EIHA 1SMYA 4A3DC 5CV6A 4C1NK 1A3TA 4XEOA 4XTCS 4N8X1 1JT8A 4P3NA 3H0GH 3NBHA 2NVQH 1TWFA 2D5DA 1LACA 3FVQA 4BY7B 4CKEA 1PTOH 1B44D 4HTHA 3A7AA 1FVIA 3C1EA 1EYDA 4HWRA 1PXUA 3I91A 3KBXA 4A3JK 3PIOA 2NVYK 4DUYQ 4EQ5A 4C3HB 1LTRD 2A19A 4K8IA 2DQ0A 4BY1G 4YRTA 2K01A 4FVMA 3U58A 1PYBA 1G8ZD 4YRLA 1VCIA 2K03A 4OL7A 1Q90A 2Q2HA 1F2MA 3C46A 1YJNA 3I4LA 1W6JA 2E2HB 4YY3L 3T56B 3MXGA 2KCMA 2RF4A 1IZ6A 2B63G 4CJ2C 2ZT6A 3A54A 1KNAA 1U4MA 3HS0C 2GSUA 1JE4A 2UUBL 3PGZA 1SRUA 1TKWB 3GTGA 2GA4B 1K8OA 5C0XI 2PHCB 2JA6A 1SYCA 2F0EA 1F9PA 1EVLA 2L55A 4BY1K 2KHJA 1IL8A 5DNFA 5BR8Q 2UXCL 2W7VA 2WB1D 3GSIA 2ZTGA 4OWTB 5NUCA 2A6HD 4LNQA 4P74A 3CD6A 1WCMG 2R92K 2NVQB 5I2YA 1QE6A 2A73B 4DK0A 2B8GA 4C2MB 1EIYA 1PTOB 1I4QA 4FF1A 1LM0A 4EGVA 2B2UC 1A3VA 4YRQA 4KV6A 1DJRD 1KMMA 2Q5IA 1JB3A 2L0CA 2CJBA 3VYUA 2R7ZA 3OSOA 4YFNA 3OWFA 1Y1VA 4DV3Q 2Q2UA 4A3JH 1HPCA 2DY7A 4O0AA 4RFBA
chains in the Genus database with same CATH topology
4GN4B 1IBKQ 2RHQA 3MF2A 2NVYH 1NMGA 2DZCA 4YRMA 4JG2A 1KRSA 4LF5Q 1X6OA 3AEVA 2ZINA 3TRZA 1VQBA 2UXDL 4XU0A 1VQGA 4ALPA 1VQLA 4GLVB 2ZIOA 1OXUA 1VQDA 2B29A 4LVJA 4X64L 2R92H 2Q5HA 4DUZQ 1B76A 4TQFA 1N36L 3RZDH 4A3EG 3HFZB 3QO5A 5K1XA 1CKNA 3BU2A 3E9HA 5C3EG 4A4IA 1LUZA 4A3CH 3I7FA 3OTOL 1VQ5A 4A75A 4A3MH 3A0JA 3RN5A 1SLJA 3S17H 2L15A 1JB7A 1NMFA 1XNRL 4JI7L 1Z47A 1B70A 4UP9A 1NYRA 4IPGA 4A3FG 4KLKA 3M4PA 4LF6Q 2JA8H 2J3LA 2JA5G 2LXJA 4LF7Q 3MXNB 2WB1E 2Z6KA 5IY0A 4G84A 2ODRC 4GOPB 4XTUA 1QVCA 4QQBX 1B8AA 2I5MX 1N32Q 4IPHA 3HOUG 2CQOA 4LUZA 1WPYA 4X5OA 1BKBA 4TVYA 3AFQA 1UE7A 2IX1A 3PF4A 4E51A 1P16A 1AE3A 3EFRA 1PYSA 1HNWQ 4Y7NH 3CQZH 2Q2IA 1YI2A 3RL6A 4QGUA 4DR2L 4DR4L 4P3OA 2ZT7A 2ZJPA 1HZAA 5LMNQ 2AWNA 3DSQA 4L5TA 3CMQA 2D62A 2I0QA 3CCEA 4RMFA 3HKZE 1SR3A 3KFUA 1JJGA 1HH2P 3SGIA 3RNUA 1VQJA 4YHHL 4ME3A 4JV5Q 3S24A 5FLMG 4HJ5A 1XMQL 1CSQA 1IBML 1HR0Q 4Q15A 3L0OA 1TWFH 5DLQE 3LSSA 1KL9A 4JOIA 1I94Q 3LC0A 5IYBG 1P8LA 4JI4Q 4A3IG 1VQAA 3I4NG 2AMCA 4X65L 3CC7A 1U0LA 1FYFA 2E64A 3M3YH 1YHBA 5FLXc 3I4MG 2FYKA 3NEMA 3S2DH 1X9NA 2F52A 3TQYA 1VQ4A 4DR5Q 4QL5A 1YNXA 4UP7A 4A3KH 2VQFQ 4GOPC 4HIOA 1Y1WH 3GTGH 4JI1L 3T1YL 1HC7A 4HIMA 2JA6H 3CXCA 5IYCG 3FKIG 3TEHA 1V1QA 5JEAG 3UGTA 2ZT5A 4A3LH 4IFDI 2ZXFA 4H2XA 1W2BA 4DR1L 3HXVA 3CMEA 3GTKH 1UEBA 4PMWA 2HNIA 1EWIA 3CCLA 5C44G 3U4VA 3S1MH 3UE1A 4LNSA 3REUA 4GN5A 4JI0Q 4JI8L 1HNZL 2K4KA 1Q81C 4LW1A 2ZM6L 3A5YA 2CCZA 2E65A 1PHJA 4YRNA 2HHHL 4B3SL 1AE2A 4LF9L 3J80c 1XTDA 4Q6GA 4L5SA 4DV6L 1O7IA 2E2JH 1EIYB 3E0EA 5JEAJ 2E41A 1HNXQ 1USYC 2MO1A 2Y0SG 2JJQA 2PNHA 2Z0SA 4CS4A 2OTJA 3CMAA 1FJGQ 4NXML 1NJ5A 4BBSH 2I4LA 3QNEA 5C0XG 2UU9Q 1GO3E 2A1AA 4OXPA 2EJ9A 1NY4A 1CKOA 4A3DH 4TQDA 2D6FC 1EQRA 2E8GA 3PO3H 2IHEA 3A5ZA 4NXNQ 2ES2A 4BBRH 4R4TA 2OQKA 3W5OA 4GN3B 3FP9A 5EAYA 1PH7A 3ULPA 2K52A 5C4JH 1BBUA 1E1OA 2ASBA 2ZTDA 1CSPA 3AYHB 3UFGA 4UP8A 3KF6A 3S2HH 5M3MH 4YP0A 1CKNB 4DQ2A 4JBMA 2GN5A 4TVWA 1H4TA 2ZNIA 4P72A 4BY7G 1Q8KA 3J7A5 2ZCEA 4QJFA 4YROA 4YRFA 3IKLA 1GKHA 5GROA 3HY1A 1B70B 1MJEA 1PV4A 3MEFA 1EVKA 3AFPA 5FJ8H 4LVMA 3V7SA 4IOAA 3UH0A 4P74C 4OP0A 3L2ZA 1BIBA 2R6GA 2E5LL 5K1PA 1VQPA 1K73C 2IY5B 2UUBQ 3H0GG 4GKKL 2QGQA 2DXUA 1WNLA 3IALA 4BW9A 1I6HH 2Q7EA 2N3SA 4L87A 3PUXA 3L4GA 1KXLA 3MEYA 1X3GA 2XTIA 1PYSB 1A8VA 2JEAI 1PH4A 3G71A 4APVA 4JI5L 4BXXH 5GAEC 4LFCQ 1X3EA 2IX0A 4HIKA 2DZ9A 5LMNW 5F5WA 3CCJA 3L2PA 1VQ8A 4CS2A 1TWGH 5IWAL 1MKHA 1YFSA 1WLEA 3HOYH 3HOXH 1CUKA 4X64Q 4A3JG 1KD1C 1ADYA 2F4VQ 1D7QA 4OX9L 4R4OA 1Q7YC 1SN8A 4OWWB 2GVAA 3VDYA 4DR7L 4JI2Q 1HR0W 2E1HA 4C2MH 2PMZE 2WB1G 4LUOA 2RHSA 4AYBE 2AMCB 2EJGA 2PI2A 2QHUA 1EQQA 4YWLA 1X65A 2PQAA 1JMCA 1EUJA 2I4MA 2AWOA 4KR2A 2R92G 1BBWA 2AKWB 4L5RC 1UWVA 1XNRQ 4JI7Q 2UUCQ 3ZJYC 4MNOA 3S1NH 4DV1Q 4HA8A 4XEMA 3TEHB 1KMNA 2JEBI 3UDFA 3V7RA 2CGHA 1YGBA 4P71A 4A3CG 1QUQA 4P73A 3F2BA 1VQFA 4A3MG 3L1AA 1EIFA 4H2XB 4PZ6A 3F8TA 2I5LX 4POGA 3BFMA 1SRYA 5IP7H 2JE6I 4XIGS 1C0AA 2ZTEA 4LF8L 4JBKA 4HJAA 2DTOA 4LFBQ 1N33L 5E7NA 4B3TQ 3HKZG 4YYEA 3FHWA 1EFWA 3HKSA 2JA8G 2DJZA 1Z9FA 4DV7Q 2ZZFA 4POFA 2NS6A 1SMXA 1A0IA 2ATWA 4IFDG 5C4XH 3P8YA 3GO5A 1N34L 4YCUA 4DR2Q 3T1HL 2AHOB 2DGYA 4DR4Q 3GTPH 2P5IA 1ASZA 1A63A 4WJ3M 2D0PA 1PH9A 4H2WA 2ZIMA 1QF6A 3OW2A 1Q12A 4WF2A 4JOIC 1VQNA 2R7DA 1E7ZA 3A5UA 1B7YA 1K0RA 4ZTUB 4IOCA 3TUPA 1NTGA 3HRKA 3K8AA 1XMQQ 1VQKA 3HOWH 1OXXK 1IBMQ 4ZTZB 4IFDJ 1XNQL 3PF5A 3A5ZB 3PUVA 4EX5A 5GAHC 2J3MA 2EAYA 1J5EL 5LMUL 4TVAB 3UDXA 3S14H 2LSSA 4DUYL 5K36G 1H4SA 4KHZA 5IT9c 1YFRA 2ALYA 4CH6A 4DV0L 3V8JA 1K3RA 1Q1BA 1K83H 1TXYA 1G5HA 3KDFA 1UE1A 3BZCA 5J3BA 4JI1Q 3T1YQ 1K8AC 4MTNA 2VQEL 4K86A 4P75A 2VNUD 3EN2A 2DEQA 3I2ZA 4GNXB 4O2DA 2K50A 2OCEA 3KF8B 3ERSX 5M5XH 1K8GA 4DV3L 2JQOA 1L1OA 1IBKL 4IO9A 4A3KG 1Y1WG 4LF5L 5HY6A 3I56A 4UPAA 4JI8Q 1HNZQ 4GKJL 2CJAA 4CS3A 2NVTH 3QTCA 3K7AH 2ZM6Q 4R4IA 1OTCA 1SFOH 3ULLA 2DVEA 1XMOQ 4H2SA 4A3LG 4DR6L 5AJ3L 1RIPA 4LF9Q 1VQ6A 1NJ8A 3LSQA 3VQVA 3VQXA 3PO2G 3PUZA 1KQSA 2UXBL 2DXTA 3KJOA 1MIUA 1AH9A 1G6PA 1SERA 4YRRA 4RQEA 4B3RQ 1VQCA 2QHTA 4WI1A 5ELOA 4HIDA 3M9BA 4JI6Q 4A3BH 3TREA 4AIMA 4DV5Q 1OXSC 2E5AA 2QA4A 4J15A 3E9IA 4CH4A 3GTMH 5JJKA 3IKMB 1YB3A 1PH3A 4LF6L 4P72C 1CKMA 4BBSG 3W1BA 2QHSA 4IJHA 3FJPA 4LF7L 3QO7A 3PCOA 3NBHB 1HXDA 3HXYA 3HXWA 4GNXC 4A3DG 2D0OA 2RHSB 4AQYL 2DQ3A 3CAMA 2R7ZH 1D8LA 1Y1VH 1FGUA 4PZ8A 3W1GA 4HWSA 1YJ9A 1WFQA 2PQAB 3GTQH 4BBRG 4DR3Q 1VQEA 1VS0A 4OLFA 2C8MA 3PUYA 4DPGA 2P0LA 2NN6I 5IE8A 1I50H 3CP0A 1I5FA 4XTXA 1GGMA 5ELNA 3UGQA 2P8TA 4LVKA 4HJ8A 2K5HA 3A74A 1KHIA 5M3FH 3ICAA 1NNHA 4YRKA 4K0KL 3OYYA 2RHQB 1X3FA 1X01A 1E1TA 1Q46A 3I4OA 1C9OA 4JV5L 5FJ8G 1PH1A 1HTTA 4C3IH 3ICEA 3KJPA 4RDXA 3STBD 4A76A 5IYDH 1IBLQ 4G85A 4HJ9A 3HTZA 3CF5A 2K5NA 3KYHC 5IP9H 2QEXA 3J80i 4X66L 4MZ9A 4KQEA 2KBNA 4AYBG 4YRCA 1WU7A 3CC4A 2YTVA 4XU3A 3TS2A 4OO1I 4ZIBA 2VQFL 4NCXA 4DV4L 2DTIA 2Q7GA 4BXXG 1VQIA 1B7YB 4OX9Q 2EL9A 1S72A 1QVGA 4IJLA 2PMFA 1SETA 3PIPA 2Q7HA 4GS3A 1M1KC 3TEGA 1VQ7A 2VUMH 1I3QH 3HOZH 4YRPA 4RQFA 4B3ML 3REXA 3HOYG 4JI0L 3BJUA 3HOXG 4P71C 1C7YA 4QY7A 4YREA 1X56A 2EXDA 1ZQ1C 2R7FA 4YY3Q 3D31A 4K88A 3KDFB 1Z7NA 3TS0A 2JA9A 3H3VH 3RKYA 1PVOA 2UXCQ 2RCNA 4R1JA 1EOVA 4H2VA 3GTJH 2Q2TA 3B6YA 1Y14B 3ULJA 2KHIA 3F2DA 4LF8Q 1L1OB 1ASYA 2YU9H 1NJ6A 1N33Q 3J7ZC 1XPUA 1NJ2A 4X62L 4R4CA 2JA7H 2A8EA 1E3PA 1MJCA 2VS1A 1NYQA 3RZOH 2V1CC 1QZHA 2UXDQ 4LFAL 4LVLA 3D0FA 3L7ZC 2R93H 1S3OA 1N34Q 1IXRA 3T1HQ 1LTLA 5JJIA 2E3CA 2OWOA 2EJFA 3K80C 2H5XA 4YRGA 1VQZA 4JYAL 1YEZA 1IYJB 1PFSA 3K7UC 5GAGC 1WI5A 4TTVA 3EIVA 2YYZA 4P3PA 5HGQA 2CKZB 1N36Q 5KNNA 2VW9A 4YWMA 1S40A 3RKWA 5C4XG 2KCTA 2DU7A 3GD7A 3OTOQ 1V43A 2BH2A 3W3SA 1G291 4HVCA 1NJIC 1J5WA 4HT4A 1XNQQ 2Z6KC 4JI3L 4X6AH 4L5QA 4CH3A 4LF4L 4CH5A 4DV2L 1J5EQ 5LMUQ 3STBC 4YDQA 4DAYB 2VL6A 1HJPA 3Q8DA 1VQOA 2UUAL 3F2CA 4A3GH 3PCOB 4P75C 2C35B 1PH8A 1JJCA 1UE5A 4DV0Q 2MO0A 3HOWG 1N8RC 2YTYA 1OXVA 4XTYA 4A93H 4HWTA 3IG2A 1L1OC 4DNIA 4IPCA 4XTVA 3PZCA 2JK8A 3A32A 3H3VI 2VQEQ 2LXKA 4C3JH 1YFTA 4DKAC 2FXQA 4PZ7A 4KHPL 3HOVH 3CCSA 3CCVA 2DTHA 1W3SA 1QZGA 4LFCL 1H95A 2CWAA 4YRIA 4GKJQ 3CCUA 3CCQA 3V8KA 3A7UA 2NN6G 4DR6Q 1G5IA 1UE6A 5AJ3Q 4BY1H 1LYLA 2YTXA 4YHHQ 4YPFA 2F4VL 2DDZA 3PV0A 2UXBQ 3RLFA 1YITA 3OD1A 2B63H 1BIAA 3MF1A 4JI2L 2ZZGA 3K0XA 5H1SE 3QO8A 4LUVA 4H2TA 4NPSA 4XU2A 4FDBA 2ID0A 4YWKA 1Z7MA 2WAQE 1WCMH 3RF1A 4EO4A 4X65Q 1SESA 1WJJA 4IPDA 3R07A 5E3IA 2HT1A 1VQ9A 3KF6B 2UUCL 1X54A 1SROA 3NELA 2N49A 1G51A 2ZJQA 1TWCH 2CJ9A 2EQSA 2DU5A 4R4QA 4DV1L 12ASA 3CC2A 5BR8L 2IHFA 2B3GA 1A62A 4A3BG 4GLAC 3G4SA 2MFIA 2G4CA 3U50C 3RN2A 4DR1Q 2KENA 2I4OA 4AQYQ 3VQYA 4BWAA 2IY5A 3RKXA 11ASA 4OO1G 4LFBL 4BA2I 3I55A 4B3TL 3S15H 2GVBA 5M5WH 3RUXA 1VQMA 3MQZA 3ER0A 4YRSA 4HWPA 2JA6G 3U4ZA 3K81C 4A3EH 2N8NA 4DV7L 2N78A 1J6QA 4DK6C 2BA0A 2NZHA 5C3EH 3HXUA 1YHAA 3M4QA 4RG1A 2ARTA 3J81j 2HHHQ 1YBYA 4B3SQ 2VY3A 2R7ZG 1Y1VG 2ZGWA 3L4GB 2CFMA 4DV6Q 2OQ0A 4DUZL 2I5HA 3HY0A 3S1RH 1SE8A 4A3FH 1TWHH 3AQQA 3S16H 3P8VA 2HIXA 4K0KQ 3CCMA 2ZR2A 4NXMQ 1NBWA 1E22A 4TQUS 1HZ9A 2JA5H 1JJ2A 1IL2A 1ATIA 1L0WA 1XJVA 4YCVA 1Q82C 1ADJA 3M4OH 3HOUH 1T9HA 4HWOA 1Q1EA 4H02A 1EYGA 5M3FG 4HJ7A 5C53B 4X66Q 1YHQA 4QIWE 2VZAA 2F3IA 3KLWA 3KOJA 1NE3A 2DKGA 1GM5A 3P8TA 5GADC 4TWAA 2AKWA 2ARUA 4DV4Q 5IYDG 1N32L 4XTZA 3M85A 1WQ7A 3PO3G 1U5KA 5IP9G 2MQHA 3UDGA 4GLXA 1V9PA 4KR3A 2XGTA 3V7CA 4UY8C 3VBBA 1YVCA 1HNWL 2HQLA 1QE0A 3RIRA 3PO2H 2PMEA 1BVSA 2ZZEA 5M5YH 5M3MG 4OWXB 4K87A 2PI2E 4B3MQ 4KI0A 5FLMH 3HFVA 4OONA 1QUQB 3RACA 5LMNL 1JJCB 2CIMA 1N9WA 4JC0A 4WJ4A 2C7IA 2E5LQ 3HXXA 3EFSA 1VQHA 1NJ1A 1DGSA 1RIQA 2IT1A 5IYBH 1R9TH 1XMOL 3RR5A 4A3IH 3I4NH 1X2GA 2NVXH 4GKKQ 3G48A 2VUMG 3ERRA 3RGLA 1WQWA 3UDIA 3CW2C 4DAMA 2K14A 1L2FA 3DLLA 3I4MH 3HOZG 1H4VB 1X55A 4YRJA 1KIXA 2I4NA 4JI5Q 1KRTA 1HR0L 2K5VA 4B3RL 2CWPA 2BA1A 5GQOA 3PUWA 3HFZA 4AH6A 1I94L 2WP8J 5IYCH 3FKIH 4JI4L 4JI6L 3IRBA 4X62Q 2ZJRA 2EIFA 1JE5A 1H4QA 4JBWA 1M90C 1KC8C 4DV5L 1FL0A 4LFAQ 5C51B 4LVIA 2ZNJA 2YV5A 5C44H 3HRIA 1KOGA 4DR5L 2MNAA 5IWAQ 1K9MC 3GTLH 1XPRA 2OTLA 1KAWA 2ZTCA 4TVAA 4JYAQ 1PH6A 4Y52H 2EWNA 1GVPA 3WQZA 3NETA 3JAMc 2JA7G 4DR7Q 2ZR3A 2A8VA 4XTWA 1WOCA 3VQWA 3V8LA 3F1ZA 3M7NA 3CPFA 1TWAH 4GOPA 2ZT8A 2DUDA 2R93G 3RLNA 5C0XJ 2ARSA 3UE0A 2E10A 1RL2A 4PHCA 3CPWA 4DR3L 1X2HA 2ALYB 3WWVA 4NB3A 4P73C 4GNXA 1PH2A 4JI3Q 2E2IH 3H15A 5C52B 3G6EA 4LF4Q 4DV2Q 1PA6A 3DM3A 3CCRA 3A7RA 3RLOA 2UUAQ 4LWCA 3LGJA 1HZBA 4JBJA 3G1ZA 3JAMi 1E24A 2NZOA 3GTOH 1HNXL 3A31A 1FJGL 3NENA 3JC66 3J81c 3PSIA 3BZKA 1XPOA 1QVFA 4XU1A 2BH8A 2UU9L 1YZ6A 3HXZA 1YIJA 1USYA 4DK3C 4A3GG 4H2UA 4KHPQ 4JCVE 4PG3A 2WFWA 1IBLL 2HIVA 3S1QH 4BY7H 4NXNL 5IP7G 5JJLA 4YCWA 2QHVA 2Y0SE 4A93G 1Q86C 2ODRD 1GD7A 3EBEA 4C3HH 4BA1I 2WAQG 2K75A 1W66A 1WYDA 1OXTA 2E2HH 1PH5A 3J81i 1YJWA 1HZCA 4H2YA 3HOVG 3GDEA 4XEOA 4XTCS 1JT8A 4P3NA 3H0GH 2NVQH 3A7AA 1FVIA 4HWRA 3PIOA 4DUYQ 4EQ5A 2A19A 2DQ0A 4BY1G 4YRTA 3U58A 1PYBA 4YRLA 1VCIA 2Q2HA 1YJNA 4YY3L 2KCMA 2RF4A 2ZT6A 1IZ6A 2B63G 2UUBL 3PGZA 1SRUA 5C0XI 1EVLA 2KHJA 2UXCL 5BR8Q 2ZTGA 4OWTB 4LNQA 4P74A 3CD6A 1WCMG 1EIYA 1LM0A 4YRQA 2Q5IA 1KMMA 2CJBA 4DV3Q 2Q2UA 4A3JH 4O0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GN4 B;  1IBK Q;  2RHQ A;  3MF2 A;  2NVY H;  1NMG A;  2DZC A;  4YRM A;  4JG2 A;  1KRS A;  4LF5 Q;  1X6O A;  3AEV A;  2ZIN A;  3TRZ A;  1VQB A;  2UXD L;  4XU0 A;  1VQG A;  4ALP A;  1VQL A;  4GLV B;  2ZIO A;  1OXU A;  1VQD A;  2B29 A;  4X64 L;  2R92 H;  2Q5H A;  4DUZ Q;  1B76 A;  4TQF A;  1N36 L;  3RZD H;  4A3E G;  3HFZ B;  3QO5 A;  5K1X A;  1CKN A;  3BU2 A;  3E9H A;  5C3E G;  4A4I A;  1LUZ A;  4A3C H;  3I7F A;  3OTO L;  1VQ5 A;  4A75 A;  4A3M H;  3A0J A;  3RN5 A;  1SLJ A;  3S17 H;  2L15 A;  1JB7 A;  1NMF A;  1XNR L;  4JI7 L;  1Z47 A;  1B70 A;  4UP9 A;  1NYR A;  4IPG A;  4A3F G;  4KLK A;  3M4P A;  4LF6 Q;  2JA8 H;  2J3L A;  2JA5 G;  2LXJ A;  4LF7 Q;  3MXN B;  2WB1 E;  2Z6K A;  5IY0 A;  4G84 A;  2ODR C;  4GOP B;  4XTU A;  1QVC A;  4QQB X;  1B8A A;  2I5M X;  1N32 Q;  4IPH A;  3HOU G;  2CQO A;  4LUZ A;  1WPY A;  4X5O A;  1BKB A;  4TVY A;  3AFQ A;  1UE7 A;  2IX1 A;  3PF4 A;  4E51 A;  1P16 A;  1AE3 A;  3EFR A;  1PYS A;  1HNW Q;  4Y7N H;  3CQZ H;  2Q2I A;  1YI2 A;  3RL6 A;  4QGU A;  4DR2 L;  4DR4 L;  4P3O A;  2ZT7 A;  2ZJP A;  1HZA A;  5LMN Q;  2AWN A;  3DSQ A;  4L5T A;  3CMQ A;  2D62 A;  2I0Q A;  3CCE A;  4RMF A;  3HKZ E;  1SR3 A;  3KFU A;  1JJG A;  1HH2 P;  3SGI A;  3RNU A;  1VQJ A;  4YHH L;  4ME3 A;  4JV5 Q;  3S24 A;  5FLM G;  4HJ5 A;  1XMQ L;  1CSQ A;  1IBM L;  1HR0 Q;  4Q15 A;  3L0O A;  1TWF H;  5DLQ E;  3LSS A;  1KL9 A;  4JOI A;  1I94 Q;  3LC0 A;  5IYB G;  1P8L A;  4JI4 Q;  4A3I G;  1VQA A;  3I4N G;  2AMC A;  4X65 L;  3CC7 A;  1U0L A;  1FYF A;  2E64 A;  3M3Y H;  1YHB A;  5FLX c;  3I4M G;  2FYK A;  3NEM A;  3S2D H;  1X9N A;  2F52 A;  3TQY A;  1VQ4 A;  4DR5 Q;  4QL5 A;  1YNX A;  4UP7 A;  4A3K H;  2VQF Q;  4GOP C;  4HIO A;  1Y1W H;  3GTG H;  4JI1 L;  3T1Y L;  1HC7 A;  4HIM A;  2JA6 H;  3CXC A;  5IYC G;  3FKI G;  3TEH A;  1V1Q A;  5JEA G;  3UGT A;  2ZT5 A;  4A3L H;  4IFD I;  2ZXF A;  4H2X A;  1W2B A;  4DR1 L;  3HXV A;  3CME A;  3GTK H;  1UEB A;  4PMW A;  2HNI A;  1EWI A;  3CCL A;  5C44 G;  3U4V A;  3S1M H;  3UE1 A;  4LNS A;  3REU A;  4GN5 A;  4JI0 Q;  4JI8 L;  1HNZ L;  2K4K A;  1Q81 C;  4LW1 A;  2ZM6 L;  3A5Y A;  2CCZ A;  2E65 A;  1PHJ A;  4YRN A;  2HHH L;  4B3S L;  1AE2 A;  4LF9 L;  3J80 c;  1XTD A;  4Q6G A;  4L5S A;  4DV6 L;  1O7I A;  2E2J H;  1EIY B;  3E0E A;  5JEA J;  2E41 A;  1HNX Q;  1USY C;  2MO1 A;  2Y0S G;  2JJQ A;  2PNH A;  2Z0S A;  4CS4 A;  2OTJ A;  3CMA A;  1FJG Q;  4NXM L;  1NJ5 A;  4BBS H;  2I4L A;  3QNE A;  5C0X G;  2UU9 Q;  1GO3 E;  2A1A A;  4OXP A;  2EJ9 A;  1NY4 A;  1CKO A;  4A3D H;  4TQD A;  2D6F C;  1EQR A;  2E8G A;  3PO3 H;  2IHE A;  3A5Z A;  4NXN Q;  2ES2 A;  4BBR H;  4R4T A;  2OQK A;  3W5O A;  4GN3 B;  3FP9 A;  5EAY A;  1PH7 A;  3ULP A;  2K52 A;  5C4J H;  1BBU A;  1E1O A;  2ASB A;  2ZTD A;  1CSP A;  3AYH B;  3UFG A;  4UP8 A;  3KF6 A;  3S2H H;  5M3M H;  4YP0 A;  1CKN B;  4DQ2 A;  4JBM A;  2GN5 A;  4TVW A;  1H4T A;  2ZNI A;  4P72 A;  4BY7 G;  1Q8K A;  3J7A 5;  2ZCE A;  4QJF A;  4YRO A;  4YRF A;  3IKL A;  1GKH A;  5GRO A;  3HY1 A;  1B70 B;  1MJE A;  1PV4 A;  3MEF A;  1EVK A;  3AFP A;  5FJ8 H;  3V7S A;  4IOA A;  3UH0 A;  4P74 C;  4OP0 A;  3L2Z A;  1BIB A;  2R6G A;  2E5L L;  5K1P A;  1VQP A;  1K73 C;  2IY5 B;  2UUB Q;  3H0G G;  4GKK L;  2QGQ A;  2DXU A;  1WNL A;  3IAL A;  4BW9 A;  1I6H H;  2Q7E A;  2N3S A;  4L87 A;  3PUX A;  3L4G A;  1KXL A;  3MEY A;  1X3G A;  2XTI A;  1PYS B;  1A8V A;  2JEA I;  1PH4 A;  3G71 A;  4APV A;  4JI5 L;  4BXX H;  5GAE C;  4LFC Q;  1X3E A;  2IX0 A;  4HIK A;  2DZ9 A;  5LMN W;  5F5W A;  3CCJ A;  3L2P A;  1VQ8 A;  4CS2 A;  1TWG H;  5IWA L;  1MKH A;  1YFS A;  1WLE A;  3HOY H;  3HOX H;  1CUK A;  4X64 Q;  4A3J G;  1KD1 C;  1ADY A;  2F4V Q;  1D7Q A;  4OX9 L;  4R4O A;  1Q7Y C;  1SN8 A;  4OWW B;  2GVA A;  3VDY A;  4DR7 L;  4JI2 Q;  1HR0 W;  2E1H A;  4C2M H;  2PMZ E;  2WB1 G;  4LUO A;  2RHS A;  4AYB E;  2AMC B;  2EJG A;  2PI2 A;  2QHU A;  1EQQ A;  4YWL A;  1X65 A;  2PQA A;  1JMC A;  1EUJ A;  2I4M A;  2AWO A;  4KR2 A;  2R92 G;  1BBW A;  2AKW B;  4L5R C;  1UWV A;  1XNR Q;  4JI7 Q;  2UUC Q;  3ZJY C;  4MNO A;  3S1N H;  4DV1 Q;  4HA8 A;  4XEM A;  3TEH B;  1KMN A;  2JEB I;  3UDF A;  3V7R A;  2CGH A;  1YGB A;  4P71 A;  4A3C G;  1QUQ A;  4P73 A;  3F2B A;  1VQF A;  4A3M G;  3L1A A;  1EIF A;  4H2X B;  4PZ6 A;  3F8T A;  2I5L X;  4POG A;  3BFM A;  1SRY A;  5IP7 H;  2JE6 I;  4XIG S;  1C0A A;  2ZTE A;  4LF8 L;  4JBK A;  4HJA A;  2DTO A;  4LFB Q;  1N33 L;  5E7N A;  4B3T Q;  3HKZ G;  4YYE A;  3FHW A;  1EFW A;  3HKS A;  2JA8 G;  2DJZ A;  1Z9F A;  4DV7 Q;  2ZZF A;  4POF A;  1SMX A;  1A0I A;  2ATW A;  4IFD G;  5C4X H;  3P8Y A;  3GO5 A;  1N34 L;  4YCU A;  4DR2 Q;  3T1H L;  2AHO B;  2DGY A;  4DR4 Q;  3GTP H;  2P5I A;  1ASZ A;  1A63 A;  4WJ3 M;  2D0P A;  1PH9 A;  4H2W A;  2ZIM A;  1QF6 A;  3OW2 A;  1Q12 A;  4WF2 A;  4JOI C;  1VQN A;  2R7D A;  1E7Z A;  3A5U A;  1B7Y A;  1K0R A;  4ZTU B;  4IOC A;  3TUP A;  1NTG A;  3HRK A;  3K8A A;  1XMQ Q;  1VQK A;  3HOW H;  1OXX K;  1IBM Q;  4ZTZ B;  4IFD J;  1XNQ L;  3PF5 A;  3A5Z B;  3PUV A;  4EX5 A;  5GAH C;  2J3M A;  2EAY A;  1J5E L;  5LMU L;  4TVA B;  3UDX A;  3S14 H;  2LSS A;  4DUY L;  5K36 G;  1H4S A;  4KHZ A;  5IT9 c;  1YFR A;  2ALY A;  4CH6 A;  4DV0 L;  3V8J A;  1K3R A;  1Q1B A;  1K83 H;  1TXY A;  1G5H A;  3KDF A;  1UE1 A;  3BZC A;  5J3B A;  4JI1 Q;  3T1Y Q;  1K8A C;  4MTN A;  2VQE L;  4K86 A;  4P75 A;  2VNU D;  3EN2 A;  2DEQ A;  3I2Z A;  4GNX B;  4O2D A;  2K50 A;  2OCE A;  3KF8 B;  3ERS X;  5M5X H;  1K8G A;  4DV3 L;  2JQO A;  1L1O A;  1IBK L;  4IO9 A;  4A3K G;  1Y1W G;  4LF5 L;  5HY6 A;  3I56 A;  4UPA A;  4JI8 Q;  1HNZ Q;  4GKJ L;  2CJA A;  4CS3 A;  2NVT H;  3QTC A;  3K7A H;  2ZM6 Q;  4R4I A;  1OTC A;  1SFO H;  3ULL A;  2DVE A;  1XMO Q;  4H2S A;  4A3L G;  4DR6 L;  5AJ3 L;  1RIP A;  4LF9 Q;  1VQ6 A;  1NJ8 A;  3LSQ A;  3VQV A;  3VQX A;  3PO2 G;  3PUZ A;  1KQS A;  2UXB L;  2DXT A;  3KJO A;  1MIU A;  1AH9 A;  1G6P A;  1SER A;  4YRR A;  4RQE A;  4B3R Q;  1VQC A;  2QHT A;  4WI1 A;  5ELO A;  4HID A;  3M9B A;  4JI6 Q;  4A3B H;  3TRE A;  4AIM A;  4DV5 Q;  1OXS C;  2E5A A;  2QA4 A;  4J15 A;  3E9I A;  4CH4 A;  3GTM H;  5JJK A;  3IKM B;  1YB3 A;  1PH3 A;  4LF6 L;  4P72 C;  1CKM A;  4BBS G;  3W1B A;  2QHS A;  4IJH A;  3FJP A;  4LF7 L;  3QO7 A;  3PCO A;  3NBH B;  1HXD A;  3HXY A;  3HXW A;  4GNX C;  4A3D G;  2D0O A;  2RHS B;  4AQY L;  2DQ3 A;  3CAM A;  2R7Z H;  1D8L A;  1Y1V H;  1FGU A;  4PZ8 A;  3W1G A;  4HWS A;  1YJ9 A;  1WFQ A;  2PQA B;  3GTQ H;  4BBR G;  4DR3 Q;  1VQE A;  1VS0 A;  4OLF A;  2C8M A;  3PUY A;  4DPG A;  2P0L A;  2NN6 I;  5IE8 A;  1I50 H;  3CP0 A;  1I5F A;  4XTX A;  1GGM A;  5ELN A;  3UGQ A;  2P8T A;  4HJ8 A;  2K5H A;  3A74 A;  1KHI A;  5M3F H;  3ICA A;  1NNH A;  4YRK A;  4K0K L;  3OYY A;  2RHQ B;  1X3F A;  1X01 A;  1E1T A;  1Q46 A;  3I4O A;  1C9O A;  4JV5 L;  5FJ8 G;  1PH1 A;  1HTT A;  4C3I H;  3ICE A;  3KJP A;  4RDX A;  3STB D;  4A76 A;  5IYD H;  1IBL Q;  4G85 A;  4HJ9 A;  3HTZ A;  3CF5 A;  2K5N A;  3KYH C;  5IP9 H;  2QEX A;  3J80 i;  4X66 L;  4MZ9 A;  4KQE A;  2KBN A;  4AYB G;  4YRC A;  1WU7 A;  3CC4 A;  2YTV A;  4XU3 A;  3TS2 A;  4OO1 I;  4ZIB A;  2VQF L;  4NCX A;  4DV4 L;  2DTI A;  2Q7G A;  4BXX G;  1VQI A;  1B7Y B;  4OX9 Q;  2EL9 A;  1S72 A;  1QVG A;  4IJL A;  2PMF A;  1SET A;  3PIP A;  2Q7H A;  4GS3 A;  1M1K C;  3TEG A;  1VQ7 A;  2VUM H;  1I3Q H;  3HOZ H;  4YRP A;  4RQF A;  4B3M L;  3REX A;  3HOY G;  4JI0 L;  3BJU A;  3HOX G;  4P71 C;  1C7Y A;  4QY7 A;  4YRE A;  1X56 A;  2EXD A;  1ZQ1 C;  2R7F A;  4YY3 Q;  3D31 A;  4K88 A;  3KDF B;  1Z7N A;  3TS0 A;  2JA9 A;  3H3V H;  3RKY A;  1PVO A;  2UXC Q;  2RCN A;  4R1J A;  1EOV A;  4H2V A;  3GTJ H;  2Q2T A;  3B6Y A;  1Y14 B;  3ULJ A;  2KHI A;  3F2D A;  4LF8 Q;  1L1O B;  1ASY A;  2YU9 H;  1NJ6 A;  1N33 Q;  3J7Z C;  1XPU A;  1NJ2 A;  4X62 L;  4R4C A;  2JA7 H;  1E3P A;  1MJC A;  2VS1 A;  1NYQ A;  3RZO H;  2V1C C;  1QZH A;  2UXD Q;  4LFA L;  3D0F A;  3L7Z C;  2R93 H;  1S3O A;  1N34 Q;  1IXR A;  3T1H Q;  1LTL A;  5JJI A;  2E3C A;  2OWO A;  2EJF A;  3K80 C;  2H5X A;  4YRG A;  1VQZ A;  4JYA L;  1YEZ A;  1IYJ B;  1PFS A;  3K7U C;  5GAG C;  1WI5 A;  4TTV A;  3EIV A;  2YYZ A;  4P3P A;  5HGQ A;  2CKZ B;  1N36 Q;  5KNN A;  2VW9 A;  4YWM A;  1S40 A;  3RKW A;  5C4X G;  2KCT A;  2DU7 A;  3GD7 A;  3OTO Q;  1V43 A;  2BH2 A;  3W3S A;  1G29 1;  4HVC A;  1NJI C;  1J5W A;  1XNQ Q;  2Z6K C;  4JI3 L;  4X6A H;  4L5Q A;  4CH3 A;  4LF4 L;  4CH5 A;  4DV2 L;  1J5E Q;  5LMU Q;  3STB C;  4YDQ A;  4DAY B;  2VL6 A;  1HJP A;  3Q8D A;  1VQO A;  2UUA L;  3F2C A;  4A3G H;  3PCO B;  4P75 C;  2C35 B;  1PH8 A;  1JJC A;  1UE5 A;  4DV0 Q;  2MO0 A;  3HOW G;  1N8R C;  2YTY A;  1OXV A;  4XTY A;  4A93 H;  4HWT A;  3IG2 A;  1L1O C;  4DNI A;  4IPC A;  4XTV A;  3PZC A;  2JK8 A;  3A32 A;  3H3V I;  2VQE Q;  2LXK A;  4C3J H;  1YFT A;  4DKA C;  2FXQ A;  4PZ7 A;  4KHP L;  3HOV H;  3CCS A;  3CCV A;  2DTH A;  1W3S A;  1QZG A;  4LFC L;  1H95 A;  2CWA A;  4YRI A;  4GKJ Q;  3CCU A;  3CCQ A;  3V8K A;  3A7U A;  2NN6 G;  4DR6 Q;  1G5I A;  1UE6 A;  5AJ3 Q;  4BY1 H;  1LYL A;  2YTX A;  4YHH Q;  4YPF A;  2F4V L;  2DDZ A;  3PV0 A;  2UXB Q;  3RLF A;  1YIT A;  3OD1 A;  2B63 H;  1BIA A;  3MF1 A;  4JI2 L;  2ZZG A;  3K0X A;  5H1S E;  3QO8 A;  4LUV A;  4H2T A;  4NPS A;  4XU2 A;  4FDB A;  2ID0 A;  4YWK A;  1Z7M A;  2WAQ E;  1WCM H;  3RF1 A;  4E