4AH6A

Human mitochondrial aspartyl-trna synthetase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
589
structure length
589
Chain Sequence
PEFSSFVVRTNTCGELRSSHLGQEVTLCGWIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Thermodynamic Properties Distinguish Human Mitochondrial Aspartyl-tRNA Synthetase from Bacterial Homolog with Same 3D Architecture
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords ASPARTATE--TRNA LIGASE, MITOCHONDRIAL
total genus 117
structure length 589
sequence length 589
chains with identical sequence B, C, D
ec nomenclature ec 6.1.1.12: Aspartate--tRNA ligase.
pdb deposition date 2012-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N)
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
A PF02938 GAD GAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ah6A01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4ah6A02
3.30.1360.30 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 GAD-like domain 4ah6A03
3CW2C 2CQOA 2ZZGA 1XMQQ 3CD6A 4E51A 2AKWB 4JI1L 3EBEA 4UY8C 2F4VQ 2Q2HA 2EXDA 1HNZL 1IBML 2ZT6A 2F52A 1EIYB 2I4NA 4JBMA 1QZGA 3L1AA 4ALPA 3TS2A 4YRPA 1YJNA 1KXLA 1PH3A 3HKSA 3H0GG 1BBUA 2JK8A 4LUVA 1CSPA 1PV4A 3I7FA 2UUCQ 2I5MX 5IT9c 4GKKQ 4BBRH 3MF1A 4OWXB 3LGJA 5FLMG 4KQEA 3JC66 4DR2L 4TWAA 2ZXFA 1VCIA 1YNXA 1Q7YC 2JEAI 3TEHA 3U4VA 3PIPA 2PI2E 4BXXH 1XTDA 5J3BA 4IOAA 4HWRA 2E5LL 1Q86C 1BVSA 2DDZA 3J7ZC 1WPYA 2CIMA 4A93G 1HNZQ 2ZNIA 3NENA 2ES2A 4DR5Q 1YEZA 1TXYA 5IWAL 5C0XI 3CCQA 3OW2A 3K7UC 1YI2A 1B7YB 2UUBQ 3A31A 1HTTA 4LF6L 2VNUD 4A3GG 2B3GA 4IJLA 5GAEC 4AYBG 4LFAL 4A3BG 4YRMA 5ELOA 4YHHQ 5LMUQ 3M9BA 4LF9Q 1Y1VH 3BFMA 3A7AA 2HHHL 4POGA 5HGQA 3I4MH 4XIGS 3CMQA 4OP0A 2K52A 4OWWB 2E2IH 1VQCA 2VY3A 3HOWG 5C3EG 4BBSG 3RR5A 3S1RH 1YHAA 2PI2A 3BZKA 2UUAQ 3KFUA 2YTXA 1N33L 1MKHA 1X55A 3L0OA 5M5XH 1HR0Q 1G51A 4DK3C 4JYAQ 1SLJA 1XNRQ 4XEOA 2EAYA 1NYRA 4B3TQ 3REXA 3HOVH 2K5NA 5C4JH 4DK6C 4DV0Q 1VQ5A 1WCMH 4GNXB 1NJ5A 4DUYL 1USYC 1LM0A 4HWSA 1X56A 3HRKA 1SROA 1MJEA 3L2PA 3VDYA 4LF5L 2MO1A 3RIRA 1N32Q 1VQIA 2E65A 5IP9G 3J80c 3HY1A 4A3LH 1XNQL 1K8GA 5M3MG 4DV5L 4MNOA 2GVBA 1FGUA 2UUCL 1PH8A 4YCVA 4PZ7A 2A8VA 4XTUA 1N8RC 4MZ9A 1G6PA 2DTIA 3NELA 1SMXA 1VQGA 2MNAA 4UPAA 3HOVG 3HOXG 1WI5A 5JEAJ 4GLAC 4P74C 4YRJA 2JA8G 2E3CA 2VL6A 4RQEA 5M3MH 4A3GH 5GAHC 2WFWA 2Q7EA 1TWGH 2R7ZH 2B29A 1H95A 3PO3H 2YYZA 4DR1L 2R7FA 5AJ3L 2RHSB 4JOIC 2CWAA 3HKZG 2ARSA 1U0LA 1KAWA 2Z6KA 1IBMQ 1QUQA 5BR8Q 2K4KA 3M3YH 4A3CG 4X65Q 1WOCA 4XTZA 4LNQA 2CKZB 5IY0A 3OTOQ 5JJLA 3PUVA 1SN8A 1P16A 4QY7A 3V8LA 2LXKA 2JE6I 1Q46A 2NVTH 3RKYA 1HR0L 4XTXA 4YREA 2G4CA 2FYKA 4NB3A 1VQMA 2V1CC 4DV4Q 1VQKA 1BKBA 2F4VL 2JA7G 4OWTB 5IYDH 2IY5B 4RQFA 4H02A 4LNSA 1VQLA 4JI5Q 1YFRA 4L5QA 1J5EL 1BBWA 2JEBI 2ZJQA 4CH6A 4A76A 3RLFA 4A3EG 1UWVA 2OWOA 2DZ9A 3UGTA 4DV7Q 4LF7L 5C44H 4ZTZB 3LSSA 4J15A 3PO2G 3KF6B 5FJ8H 4DV2L 3LSQA 1J5EQ 1W2BA 4PZ8A 1C0AA 4K0KQ 4IPCA 3HXZA 4X6AH 4H2UA 1WYDA 2DKGA 1M1KC 1TWCH 1OXUA 1HR0W 4DR3L 5IYDG 4A75A 1K83H 1JJ2A 1YB3A 3RGLA 2DUDA 3PUZA 2VW9A 5C53B 4A3FG 4GLVB 2K5VA 2J3LA 3AQQA 4LFBQ 4LUZA 3HFZA 2IHEA 3GO5A 1WNLA 1M90C 1E22A 1UE6A 2MFIA 1G5HA 1B70A 4YRCA 2N78A 3S15H 2J3MA 1WQ7A 3S14H 3A5YA 2YU9H 1L1OC 4ME3A 1L0WA 3CMAA 3G6EA 2ZIMA 1ADJA 4TQFA 2UXCQ 5M5YH 1HNWL 2CGHA 1XPOA 3VQYA 4TQUS 1V9PA 3DLLA 3M4PA 5GROA 4KR3A 4JV5Q 1IXRA 5LMNQ 3RUXA 2R92G 3CQZH 1WJJA 2E1HA 1X3EA 4XTYA 3BZCA 1NNHA 3RLOA 4JBWA 2VUMH 1ASYA 2IT1A 4DV1L 4KR2A 1KD1C 4HIMA 5FLXc 3KJOA 1PH4A 3P8VA 3KYHC 4Q15A 2ZTGA 2P5IA 3PUXA 4LUOA 1BIBA 4DR6Q 4RDXA 1NMFA 4LF9L 4AH6A 3A5ZB 1UEBA 4LFCL 4DV2Q 4Y7NH 4PG3A 1XJVA 3CCMA 4YCUA 4A3EH 1L1OA 2ZZFA 3KOJA 4QL5A 3RKWA 4XU3A 1N34Q 2PQAA 3HRIA 4X62Q 4DPGA 1K3RA 1JE5A 1H4SA 3E9HA 1PYSB 2CFMA 2PQAB 1XPUA 1E1OA 3B6YA 1CUKA 3HOZG 3K0XA 5GQOA 3F1ZA 4RMFA 1X65A 5KNNA 1IBLQ 3HXUA 4AQYQ 3I2ZA 2E5LQ 4CH3A 3PO3G 3FKIG 4L5SA 1N33Q 1Y14B 3F2DA 4GN5A 3PV0A 3ERSX 4YRNA 4JG2A 4H2SA 4DR2Q 4P73A 2JA6H 3GTPH 4IJHA 2UXDL 1AE3A 4A3DH 2DTOA 3UFGA 1B76A 3HTZA 1OXSC 5JJIA 5ELNA 2Q2UA 3M85A 4IPHA 4IFDJ 5K1XA 4NCXA 3U58A 2NVYH 2HT1A 1D8LA 3HOXH 1I94Q 1XPRA 2JA7H 3IKMB 1OXVA 2D6FC 1EFWA 4GKJQ 4C3JH 4GN4B 2E8GA 3K81C 3PO2H 1W3SA 4DAMA 4BXXG 2ZIOA 3VQWA 3CMEA 4B3SQ 1JJCA 4X66Q 3BJUA 2QGQA 3HXVA 1UE7A 4B3MQ 4P3NA 3KLWA 4DV6L 2A19A 5IP7H 4WI1A 3PIOA 4K0KL 3CP0A 3IG2A 1IBKQ 4DV5Q 1EQRA 2I0QA 2KENA 1VQHA 3F2BA 2XTIA 3M7NA 3UDGA 3CCLA 4NXNQ 2EJ9A 4DQ2A 1A8VA 4AYBE 5C0XG 2YTVA 4DR4L 4A93H 1EIYA 4FDBA 1Y1VG 4JI5L 1N36Q 2ZCEA 1NTGA 1HJPA 1CKNB 1UE1A 3PF5A 4WJ3M 2R93G 5IYBH 1YHBA 2NVQH 2I5LX 3J80i 4P73C 3HOYG 2JA8H 3S17H 3RKXA 1OTCA 1YFSA 1MIUA 2Z6KC 4A3CH 4G84A 3GTQH 1FJGQ 2HNIA 2PMEA 3GTOH 4DUYQ 4JOIA 3CCSA 2RHQB 1NJ6A 4X65L 3A7UA 3QO7A 3QNEA 1S72A 4A3JH 4C2MH 1N9WA 2F3IA 4DR7L 2OTLA 3T1HL 1JJCB 3EIVA 4EQ5A 4DR5L 1B8AA 3G71A 4YWMA 4TVAB 1GO3E 2WB1E 2ZT5A 3J81c 3CF5A 4KHPQ 2P0LA 1EOVA 1VQBA 1Q1BA 2JJQA 3PCOB 1FVIA 3FHWA 2UU9Q 3KF6A 4WF2A 3OD1A 3P8TA 1FYFA 2DEQA 1HZAA 1YJ9A 2QA4A 4B3RQ 4IO9A 4LF5Q 4B3SL 2DXUA 5IWAQ 3I4MG 2VQFL 2I4OA 1T9HA 4APVA 5HY6A 3VQVA 3E9IA 2R7DA 4Q6GA 4GOPB 5E3IA 3GTKH 3CCEA 3S1NH 4OO1I 4IPDA 2AMCB 4YY3Q 1YFTA 2R7ZG 4JI6Q 4DR7Q 4JI4L 4H2TA 4GLXA 4YROA 4YYEA 1J6QA 4A4IA 4QGUA 1H4TA 3EFSA 4YY3L 4OX9L 3PF4A 2OQ0A 2YV5A 4DV6Q 4AIMA 1K0RA 1PYSA 3I55A 1QVGA 4LFBL 1PVOA 4JBKA 5C4XH 1HC7A 3UH0A 3CPWA 4H2YA 1V43A 4A3DG 3A0JA 3WWVA 4XU2A 1EVKA 3P8YA 4A3LG 3NBHB 4HIOA 4TQDA 1QF6A 4OONA 2CJ9A 2VQEL 3TRZA 3HY0A 3F2CA 2JQOA 1W66A 3OYYA 3M4QA 4X64Q 4TVYA 2Q5IA 1X2GA 4PMWA 2Q7GA 2IX1A 3RZDH 3DSQA 2I4MA 4Y52H 2Q2TA 2N8NA 3K7AH 2ALYB 3W1GA 5IP7G 1LYLA 3MF2A 2IHFA 4NXML 4LWCA 2K14A 3D31A 2BA1A 1KOGA 2I4LA 1PHJA 3GTGH 5E7NA 1IL2A 5K1PA 1PYBA 3S1MH 5IP9H 4A3KG 2E5AA 2KCTA 3PCOA 3S2HH 2E41A 5F5WA 4TTVA 3S16H 2NN6G 4QJFA 4G85A 3QO5A 1E1TA 5IYCH 2ZR3A 3GTJH 4BWAA 4P75A 1NJ1A 4YP0A 2HHHQ 4DNIA 4R1JA 2ZTDA 2ZJRA 4KHZA 4NXMQ 2EQSA 1SERA 1EQQA 2ZT7A 5IYBG 1XMOQ 1PH9A 1VQJA 2Z0SA 1SR3A 5DLQE 2R6GA 4K88A 2NZOA 4CS4A 1B7YA 4R4QA 1HNWQ 2OTJA 1QZHA 2EL9A 1VQ8A 3UDFA 4YWKA 1BIAA 3JAMi 2UXCL 1FJGL 2D62A 1LTLA 1WQWA 3NEMA 2C8MA 3A7RA 1JT8A 4YRSA 2JA6G 3H15A 1NJ8A 4CH5A 3I4OA 4EX5A 4LF7Q 3F8TA 4BY7H 4XU1A 1Q1EA 2E2JH 3RF1A 4HJ7A 1KRSA 4HIKA 3SGIA 1HZBA 3ULPA 2ZTCA 4TVAA 5M5WH 2KBNA 3PSIA 2UU9L 3D0FA 1KRTA 3UGQA 2VQEQ 4DV0L 1I94L 1I50H 4NPSA 2WAQE 4JI0Q 1JJGA 4HA8A 4DV1Q 3FJPA 4KI0A 1YZ6A 4LF8L 4DAYB 1VQZA 1N32L 3CC7A 3HXWA 3CCVA 4DUZQ 1XMOL 3GD7A 4DV7L 3TEGA 1NJ2A 2AKWA 4IFDG 4R4CA 1HZCA 2HIVA 1WLEA 5IE8A 1H4VB 3REUA 4P71C 2ZM6Q 3HOYH 4UP9A 1TWFH 4P3OA 2PNHA 2QHSA 1IBLL 4IPGA 5LMNW 1NE3A 1YVCA 4JI2Q 3K8AA 1QVFA 4P3PA 4DV4L 2PMFA 4JI4Q 1ADYA 3H3VH 4JI6L 3H0GH 4CS3A 1RL2A 1VQ4A 1K73C 2E10A 1ATIA 4C3IH 4YCWA 1E3PA 1EWIA 1PH2A 2ZJPA 3ERRA 2DGYA 2BH2A 4X64L 4LFCQ 5C51B 1WFQA 1NY4A 3CCRA 4HWTA 4LW1A 1GD7A 2UUBL 5FLMH 3ULJA 3CPFA 3E0EA 2NN6I 1Z47A 1KQSA 4RG1A 3PUYA 4BW9A 3V7SA 4H2WA 3AYHB 4JC0A 2FXQA 4JI7Q 1CKMA 2Q5HA 1V1QA 1B70B 2C7IA 4YRKA 1KC8C 3EN2A 3I4NH 2ODRD 4YDQA 2K75A 4JI7L 4OX9Q 4ZIBA 2R92H 2EWNA 3CCUA 1VQNA 4YRTA 1C9OA 3PGZA 2ASBA 1XNQQ 1O7IA 3OTOL 2AWNA 1GGMA 2JA9A 3RN2A 1VS0A 2DTHA 4X66L 2RF4A 4BY7G 5BR8L 3ICEA 4LF4L 4YRGA 1CKOA 4A3MH 2ZNJA 4R4TA 1SFOH 4K86A 4B3TL 3RL6A 4P72C 4JYAL 4DR1Q 3TQYA 1VQ9A 1SRYA 2MQHA 3W1BA 4HWOA 4UP7A 1I3QH 1HNXL 3MEYA 4DKAC 2B63H 1X3GA 2ZM6L 4XTVA 5H1SE 2D0PA 4O0AA 1TWAH 1U5KA 4A3BH 1KMNA 5C4XG 2ZINA 4GNXA 1USYA 3L7ZC 2ZT8A 1Y1WG 2CCZA 3IKLA 2R93H 4DR3Q 2QEXA 1P8LA 4K87A 3G48A 1Q8KA 3AEVA 4GKKL 5IYCG 4X5OA 1NJIC 3WQZA 3A5UA 2ID0A 4B3ML 3S1QH 1N36L 1A63A 4PZ6A 2RHQA 1HH2P 3AFQA 1OXXK 3IALA 4XTCS 3LC0A 4JI2L 2RCNA 1GKHA 3QO8A 2VZAA 1XNRL 2N49A 3Q8DA 1SETA 3MEFA 4GOPA 1QVCA 1YIJA 1Q81C 5M3FH 2A1AA 3T1YQ 1QUQB 2LXJA 1K9MC 1EUJA 1RIPA 5EAYA 4DV3L 3HOUH 4MTNA 1PH6A 2ODRC 3TS0A 2RHSA 4R4OA 3TUPA 1UE5A 3STBC 4PHCA 4DR6L 2ZTEA 4JI8L 1X54A 1Z7NA 1A0IA 2JA5H 1WU7A 1AH9A 2ZZEA 4GNXC 4POFA 2I5HA 2UXDQ 1CSQA 1N34L 4BBSH 2P8TA 3J81j 1OXTA 4L5RC 4YRQA 4A3IG 1YHQA 3CCJA 1HNXQ 1Q82C 4YPFA 4OLFA 4P72A 1IYJB 1H4QA 1A62A 5AJ3Q 1Y1WH 3ICAA 4KLKA 2QHTA 1ASZA 2JA5G 1QE0A 3GDEA 4JBJA 2CWPA 3V8JA 2OCEA 5FJ8G 2L15A 4X62L 1I5FA 2HQLA 2B63G 4A3JG 1YBYA 2Y0SE 4L87A 4GKJL 1X9NA 1X3FA 4AQYL 1HZ9A 1NYQA 3BU2A 2VQFQ 4JV5L 3ULLA 3ZJYC 3ER0A 4JI1Q 3HXXA 1EVLA 5M3FG 1VQDA 4GOPC 4HJ9A 4H2XB 1VQ7A 4GN3B 3S2DH 3L4GA 2DZCA 3CXCA 5GAGC 2GVAA 3PUWA 3TREA 3RLNA 1SE8A 1E7ZA 5GADC 2IY5A 2IX0A 3PZCA 2Y0SG 4XEMA 3RNUA 2KHIA 4BA2I 4BBRG 3KDFA 1PH7A 2DVEA 1X2HA 2UXBQ 1PFSA 1HXDA 1G291 1IBKL 4LF6Q 2KCMA 2MO0A 4O2DA 3KDFB 1XMQL 4JI3L 2WB1G 4L5TA 3I4NG 2N3SA 2WAQG 3HOWH 1SESA 3J7A5 1L1OB 3W5OA 4DR4Q 2DU5A 4DV3Q 5C52B 3GTLH 3AFPA 3EFRA 1KMMA 3HFZB 2LSSA 3T1YL 1E24A 3A32A 2NZHA 5C44G 2QHVA 3QTCA 3FKIH 1JMCA 4IFDI 1VQAA 2HIXA 3TEHB 3STBD 3JAMc 3DM3A 2NVXH 1AE2A 4OO1G 3IRBA 5C3EH 3NETA 1PH5A 2AMCA 4EO4A 4P71A 1VQ6A 4TVWA 4R4IA 2ARUA 2AWOA 3U50C 3RN5A 2H5XA 4YHHL 5LMUL 3L2ZA 1PH1A 4JCVE 3KJPA 1NBWA 2DXTA 5LMNL 1TWHH 2K5HA 4NXNL 4H2XA 4QIWE 4OXPA 2DQ3A 3L4GB 1PA6A 3UE0A 4YRFA 3I56A 4HIDA 1YGBA 1DGSA 3W3SA 1R9TH 1ZQ1C 2ALYA 5K36G 3U4ZA 2GN5A 4JI3Q 3A74A 1I6HH 1RIQA 2YTYA 1S3OA 1JB7A 1LUZA 4A3FH 4HJ5A 1SRUA 2ARTA 3UDXA 4A3MG 1Q12A 1VQOA 2AHOB 2BH8A 1WCMG 3KF8B 4YRIA 4YRRA 2VS1A 1VQPA 5JJKA 1S40A 4JI8Q 1IZ6A 2ATWA 3FP9A 4HJ8A 4KHPL 4LF4Q 2ZR2A 2EJFA 4LFAQ 3CC2A 1CKNA 2WP8J 3MXNB 2K50A 3T1HQ 2OQKA 1VQFA 1D7QA 4HVCA 1G5IA 2ZGWA 2VUMG 4BY1G 2CJBA 3VBBA 3HFVA 4P75C 3HOUG 4CH4A 3J81i 3HXYA 1EYGA 1X01A 4A3IH 2D0OA 1J5WA 3RZOH 2UXBL 2Q2IA 4QQBX 3VQXA 3UDIA 2XGTA 3H3VI 1Z7MA 4DUZL 1GVPA 4CS2A 2QHUA 1MJCA 3RACA 1C7YA 2UUAL 4LF8Q 3S24A 3G4SA 2Q7HA 4JI0L 3R07A 4B3RL 2CJAA 3G1ZA 4YWLA 1YJWA 2KHJA 4H2VA 4IOCA 4ZTUB 3CAMA 2DQ0A 3V7RA 1KL9A 1YITA 3HOZH 3M4OH 4BA1I 5JEAG 1EIFA 1GM5A 4XU0A 1NMGA 1VQEA 11ASA 1K8AC 3CC4A 4BY1H 3V7CA 2BA0A 3K80C 2DU7A 4WJ4A 2C35B 4A3KH 1Z9FA 4HWPA 2DJZA 1KIXA 1X6OA 1FL0A 1KHIA 5C0XJ 2EJGA 3GTMH 4XTWA 4P74A 2PMZE 2E2HH 4C3HH 4GS3A 3A5ZA 4HJAA 1L2FA 4YRLA 2E64A 4UP8A 12ASA 3UE1A 3V8KA 3HKZE 2EIFA
chains in the Genus database with same CATH superfamily
3CW2C 2CQOA 4DNTB 2ZZGA 1XMQQ 3PO3C 3K5NA 1JE4A 3CD6A 4E51A 1WQGA 2AKWB 4JI1L 3SXHA 2GSUA 2E2JC 3EBEA 1SMYC 4UY8C 2F4VQ 2Q2HA 5D65A 4YFXA 2EXDA 3HOXC 1HNZL 1IBML 2ZT6A 2F52A 2FINB 3X3NA 1EIYB 2ENBA 5IYDC 4A3EK 4IUPA 2I4NA 4JBMA 2JN4A 1QZGA 3L1AA 4LVMA 2VUMC 2Q8RE 4ALPA 1TWFK 3SK4A 3TS2A 1SFOC 2OF1A 2BOSA 4YRPA 1JWSD 1YJNA 1KXLA 2F0VA 4KMUC 1LLRD 1PH3A 3HKSA 3H0GG 4Y7NB 4LVLA 1SYFA 1BBUA 4AYBD 2JK8A 4LUVA 1CSPA 1PV4A 3BG3A 2WINB 1TWHB 3I7FA 4C45A 2UUCQ 2I5MX 4QIWD 5IT9c 3TN2A 4GKKQ 3GIRA 1SDFA 4BBRH 3MF1A 4OWXB 3LGJA 4FVMA 5FLMG 3JC66 4KQEA 3DEOA 4DR2L 4C2MK 1GJXA 1JICA 4TWAA 1I50A 2ZXFA 1EK8A 5C6AA 3AMUA 4K5WA 1A6XA 1VCIA 1YNXA 2L12A 2CW0A 1Q7YC 3CQZA 3K7AB 2JEAI 3TEHA 3GTQK 3U4VA 3PIPA 3GTJB 2OEOA 2PI2E 4BXXH 3A8JE 3H09A 4ILDA 2B2YA 1XTDA 5J3BA 4IOAA 4HWRA 3N0BA 2E5LL 1Q86C 1BVSA 2RDGA 4K6DA 2DDZA 1XX8A 3GTPK 2KQ3A 2WV6D 1YCLA 3GTOC 3J7ZC 1WPYA 3T51B 2CIMA 2F1MA 1I4QA 4A93G 5CV7A 4B9WA 2E2IC 4XDXA 1HNZQ 2RVLA 1CA6A 1DCOA 2ZNIA 3NENA 2ES2A 1J6XA 3HOZC 4DR5Q 3SK8A 3AU7A 1YEZA 1TXYA 5IWAL 5C0XI 4RHSA 4LAAA 3CCQA 3OW2A 1KNAA 3K7UC 4KJNA 1YI2A 1PJ6A 4ABNA 1B7YB 4KJOA 4HEDA 4FNFA 2PYKA 4BS9A 2UUBQ 2YU9K 3A31A 2NTSA 1HTTA 3U9OA 4LF6L 2VNUD 4A3GG 4U68A 2B3GA 4IJLA 1JORA 2PHCB 1MBYA 3K5LA 1XZQA 1WORA 5GAEC 4ZAIA 4AYBG 4LFAL 4A3BG 3QG1A 4C3IB 4YRMA 3HGBA 5ELOA 1SJHD 1PDQA 3FVQA 4YHHQ 5LMUQ 4G4KA 3C1FA 3M9BA 5IYCK 1H9JA 3KBXA 4LF9Q 1Y1VH 4DK1A 5I6YA 1ICWA 3T16A 4P9SA 2A6EA 2Z9HA 3BFMA 3H3VC 3EQLA 3I70A 3A7AA 1V1OA 2HHHL 1HUNA 4POGA 5C0XH 2ZUFA 2DNEA 2Z6BA 5HGQA 1DCHA 4OL7A 1WCMC 2PO4A 3I4MH 4XIGS 1TWCA 4P5AA 3J7YW 3KK7A 3CMQA 2PQEA 3V2TA 4BY1B 2K52A 4OP0A 3TDQA 4C3JG 2J4XA 4OWWB 5HGTA 2E2IH 2PA8L 5IOTA 2O2LD 1TWFA 2R92A 1VQCA 2VY3A 3HOWG 5C3EG 4UAIA 4BBSG 3M3YB 3RR5A 1LACA 4KB2A 2JSOA 1YHAA 2PI2A 3BZKA 3S1RH 3VYRA 4KHVA 2UUAQ 3KF8A 3KFUA 2YTXA 1N33L 3GEEA 3C3LA 4N8FA 1MKHA 1BOSA 1X55A 3L0OA 5M5XH 1HR0Q 1B2TA 5EKLA 2PMZB 2I46A 3GTQA 1ENAA 1G51A 3E6ZX 4K5XA 4DK3C 4FM9A 1IHZA 3SE0A 3S1NC 3GTOA 4Y7NK 4Q4ZA 5IP9C 4JYAQ 1SLJA 3T02A 1XNRQ 4XEOA 3QOLA 1LTID 1RJTA 1V5VA 2EAYA 5FJ8K 2EYHA 2ZT9C 1NYRA 4B3TQ 3REXA 3HOVH 2GA4B 2K5NA 5IODA 5C4JH 4DK6C 1G6ZA 1INNA 4DV0Q 1VQ5A 1WCMH 4GNXB 5F2DA 1NJ5A 3V4GA 3N0CA 5IORA 3AH5A 4BY7K 1S4ZA 4DUYL 4RKBA 5CV8A 1USYC 1QB5D 3K7AK 1LM0A 4HWSA 1X56A 3HRKA 1A2UA 1JQWA 1O2FB 3QO2A 1I3QA 1SROA 2HCCA 3BVMA 1MJEA 3L2PA 1AZQA 2E2JK 5CHPA 2PCFB 1BCPB 1CI3M 5K36H 3VDYA 4LF5L 2MO1A 3JAML 4A3JC 4F7XA 3RIRA 5ELBA 1A3TA 1N32Q 1VQIA 2E65A 2Z1CA 2KWAA 2JA6C 5IP9G 1STBA 3J80c 3HY1A 1MGSA 4G7HA 4A3LH 2NVYB 3A54A 5T1GA 5TJ3A 1XNQL 1K8GA 2VUMA 5M3MG 1YNNC 4DV5L 2GAHC 4DAYA 4MNOA 2GVBA 1FGUA 4K14A 2UUCL 1EWHA 1PH8A 3BYYB 2B2UC 4YCVA 4YG2A 4PZ7A 2A8VA 2Q8TA 4XTUA 4FF2A 1NCVA 1N8RC 1EY6A 1BQQT 3RZDK 2PW5A 4HSPA 1TWAA 1NR4A 3D4WA 1K28A 1BBXC 4MZ9A 1G6PA 2DTIA 2F0QA 1SMXA 3NELA 1JC7A 1VQGA 2MNAA 1LTBD 3OREA 4UPAA 3HOVG 4C2MB 4OEMB 4A3FB 3BDLA 3I73A 4EVOA 2M9VA 3HOXG 5ELDA 1WI5A 5JEAJ 1PFMA 4XLNA 4GLAC 2B63C 4P74C 2B8FA 2TMPA 4YRJA 1GXDC 2JA8G 2E3CA 1GOZA 2VL6A 3S2HK 4RQEA 1F9RA 1EWCA 3R8BA 2EPBA 5I4DA 2X69A 1NR2A 3HZXA 5G3LF 5M3MH 5GAHC 2WFWA 4A3GH 2Q7EA 2DY8A 1TWGH 2R7ZH 2B29A 1H95A 4A3DB 3PO3H 2YYZA 4DR1L 1EQTA 2HUGA 2CHBD 1TWCK 3MWYW 2MJ8A 2R7FA 3MFGA 3A8IE 5EGTA 1ENFA 5AJ3L 1S5DD 2RHSB 5JJZA 1DZ1A 3NUCA 5KNBA 3CQZC 4JOIC 2CWAA 4DGZA 3S1NK 1I50C 2R61A 3HKZG 2WKDA 3HOWC 4F87A 1HQRD 2ARSA 3FDTA 2NVXB 1U0LA 1KAWA 2Z6KA 1D5XC 5JPMC 1IBMQ 2R7ZK 1YNJD 1QUQA 5BR8Q 4DN4M 2K4KA 2F0TA 1QE6A 1XWEA 2NZ1D 3P1HA 1E2VA 3QWNA 1MD2D 3EROA 4PABA 3M3YH 4A3CG 1SYCA 4X65Q 4GTDA 2DY7A 1WOCA 4XTZA 3NXWA 3S2DC 3MXGA 2A6HA 1BCPD 4OIJA 4LNQA 1ZEQX 2CKZB 5IY0A 3OTOQ 2VXWA 5JJLA 3PUVA 1SN8A 1P16A 3OPFA 4QY7A 1IYUA 3V8LA 1U9RA 2LXKA 2FQOA 4AYBL 1WTHA 1RD9D 2JE6I 4XYQA 5M5XB 1Q46A 3OOCA 1BF4A 1ISEA 3I4MK 5M5YB 4OIPA 3I4NB 3Q6SA 4JK1A 1YX2A 3S14K 2NVTH 3RKYA 2EY1A 4P2CB 1HR0L 5EGHA 4XTXA 1DYQA 4A3MC 4HR7B 2K04A 4YREA 4F88A 2G4CA 4KMAA 2FYKA 4NB3A 1VQMA 2O5JA 1J9OA 3R2TA 2N88A 2NTTA 3W3AA 2V1CC 2K5WA 4DV4Q 1VQKA 4EGVA 1BKBA 2F4VL 5CV6A 5C44K 3HOVK 3CQZB 3OW7A 3PMFA 4CHTB 4Q5SA 2JA7G 4OWTB 3T56B 3DEPA 5IYDH 1CA5A 1HA5A 4QJVB 3H0GC 2IY5B 4RQFA 1AW7A 3I91A 2BDOA 5IGCA 4A93C 1UAPA 2ZFZA 4H02A 1VMCA 1C4QA 4LNSA 1VQLA 4M1XA 4JI5Q 1YFRA 4L5QA 1J5EL 4NP5A 1D2BA 2R93B 4M1UB 4OO1H 1PZKD 1SYDA 3G7LA 1BBWA 1GUTA 4DDQA 2JEBI 1GUOA 2ZJQA 4CH6A 4A76A 2G9DA 4KV6A 3HP3A 3RLFA 1Y1WA 2EVBA 4A3EG 1UWVA 2OWOA 3T4AC 2DZ9A 3UGTA 4DV7Q 4MIUA 4LF7L 2GAGC 5C44H 4NW2A 1AN8A 2AQ3B 4ZTZB 4KN4C 1K8OA 1BCPF 3AD8C 3S17K 4X3UA 1KLUD 1HQMC 4U673 4CJ1B 5JAVA 5C44C 3LSSA 4J15A 3PO2G 3KF6B 5FJ8H 4DV2L 3FOFA 3LSQA 3I8ZA 1J5EQ 4BBRK 2KECA 1W2BA 4I7AA 4ZUIA 4PZ8A 1C0AA 4N8X1 3A7LA 4ZQ3A 3Q22A 4K0KQ 4IPCA 3HXZA 4X6AH 3A7AB 1VGXA 2OXPA 2DJGC 4H2UA 1WYDA 2DKGA 2MPMA 2Z4HA 1M1KC 1WD0A 3AQOA 4A3FC 3NUHA 1TWCH 1TWCB 1ZBSA 1OXUA 1HR0W 4KTAA 5IYBK 3TFJA 2Y0SL 4YFNA 3NSWA 4DR3L 1Y1WC 1HUMA 1O25A 5IYDG 4A75A 3H6MA 1DJRD 1K83H 1JJ2A 4I7ZC 3GEIA 1YB3A 3RGLA 2CQAA 1XZPB 2DUDA 2A68A 3PUZA 2VW9A 5M3FK 2P5ZX 5CV4A 1J8IA 2RCFA 5C53B 4A3FG 4GLVB 3PIO3 2J0TD 2L0CA 3NBHA 2K5VA 4A3GB 2J3LA 4OELB 3AQQA 4LFBQ 4FP5D 2RGRA 1TU2B 1TWGK 3NPPA 3GTMA 3TFIA 3K5OA 3H0GK 1DM0B 4GTLA 2EYLA 3BDCA 1SBBB 2BCOA 4LUZA 5A2QL 3HFZA 3FMCA 2R3ZA 2IHEA 3G4AA 2R92K 3GO5A 5IIFA 1WNLA 4IURA 1M90C 3S2DB 3ITPA 1E22A 1UE6A 1B3QA 2SNSA 1XXCA 2MFIA 1FGBD 1G5HA 2RA4A 3J80L 1B70A 1F7UA 4BXXC 1H9SB 4YRCA 2N78A 3KUPA 1TT2A 2XVSA 3S15H 2J3MA 1IKLA 1WQ7A 3S14H 5KGUA 3A5YA 2F0WA 3S14B 3NTHA 2A6HC 2YU9H 3T01A 1L1OC 4ME3A 1L0WA 1ML0D 3MFYA 5M5WK 3DXJC 3G6EA 3U9SA 3CMAA 4GZYC 1E2ZA 4KDDA 3PO2K 2CFAB 1UUPA 2ZIMA 1RU0A 1K83A 3Q0AA 4BY1K 3S1NB 1G8ZD 5I9OA 3HS0C 5CORA 4AYBB 3S9WA 2JA8B 1F9QA 1ADJA 4TQFA 4A3KB 2UXCQ 5M5YH 1HNWL 1SNCA 5M9OA 2CGHA 1XPOA 1NAPA 3VQYA 4H0LC 4MEXA 2NVXC 4TQUS 4A3GC 1V9PA 4GTBA 3DLLA 3D4DA 3M4PA 4IUQA 1SE2A 4GT9A 5GROA 2X6LA 2LY7A 2XSCA 1TWGA 1AEXA 5E4XA 4KR3A 4WFN3 4JV5Q 4K5VA 3HKZL 1IXRA 1FR3A 1G2SA 2R7ZB 4IFDH 5LMNQ 3RUXA 2ZUEA 2R92G 3FHZA 4KY6A 5TMCA 3CQZH 1WJJA 2E1HA 4FZBA 1X3EA 2FMCA 1TWAB 1SE4A 4XTYA 3A8IA 4BLBA 3BZCA 3I3CA 4RFBA 3RLOA 4K2LA 1NNHA 2R93A 4JBWA 4R9WA 2VB2X 4WJWA 2JA5B 2VUMH 4XSXA 3TP6A 1ASYA 2IT1A 1STAA 5CBEE 4DV1L 3T00A 1F9PA 5KYLA 4KR2A 1KD1C 4HIMA 5FLXc 3KJOA 2F0OA 3I4MB 1PH4A 4A93B 3P8VA 3KYHC 2K33A 2K5QA 4X3TA 4Q15A 2ZTGA 2ZXOA 4P5BA 2P5IA 3SZZA 4BBRC 1LT6D 5CGKA 3S1MB 3PUXA 4LUOA 5C44B 4GTAA 1BIBA 1SEBD 5KNCA 1BGWA 4DR6Q 4H7BA 1TKWB 4RDXA 3GDZA 1NMFA 4LF9L 4AH6A 3WOFA 4NDXA 4C56C 3A5ZB 1UEBA 4LFCL 1TVXA 4DV2Q 4Y7NH 2CW0D 4PG3A 4TSSA 1EZ6A 1XJVA 3VR2A 4A3EB 4HCEA 3CCMA 4YCUA 4A3EH 3S1RB 4DAPA 4KMHA 1L1OA 4XYOA 2ZZFA 4J3NA 4G0UA 3KOJA 1ZYRA 4QL5A 2XWBB 1JQYD 3MHBA 3RKWA 4XU3A 1J6VA 1N34Q 2PQAA 3HRIA 4LR2A 4X62Q 4DPGA 1K3RA 1JE5A 5D14A 4CDEC 4BLAA 1H4SA 1WTOA 3E9HA 1PYSB 1VLOA 1CT1D 2CFMA 2PQAB 1XPUA 4ZK9B 1Z6HA 1E1OA 4A3KC 3HRZC 3M4OC 2NBFA 2XCRB 1R9TK 3B6YA 1I3QC 1CUKA 3S2DK 1B44D 3HOZG 3K0XA 5GQOA 4LOWA 3F1ZA 5JVH3 4RMFA 5KRUA 1X65A 5KNNA 1IBLQ 5E68A 3HXUA 1KQ4A 2K01A 3K7AC 4AQYQ 3I2ZA 3TP5A 2E5LQ 2JXMB 5CYUA 3PO3G 4CH3A 3FKIG 4L5SA 4A3BC 3TP8A 4G0VA 2EE1A 1N33Q 3HOWB 4KKUA 1Y14B 3X3MA 1WTVA 1G2TA 1WTQA 5IT9E 2JA7K 4ZYSA 3I72A 3F2DA 2WACA 1QNKA 1ET9A 3PV0A 3ERSX 4GN5A 4YRNA 5FLMK 4JG2A 4H2SA 2X6GA 4DR2Q 4P73A 3IAYA 2FMMA 2JA6H 3M7GA 4XXEA 3N3YA 2E76C 4XT3B 4XQQA 3GTPH 4IJHA 2UXDL 1AE3A 4A3DH 2DTOA 3UFGA 4A3DK 1B76A 2B2TA 2K7VA 1OXSC 3HTZA 1Y1VA 3GTQC 5JJIA 2LMCB 2DN8A 5ELNA 2Q2UA 2N55A 3M85A 4IPHA 3OPOA 4IFDJ 4NCXA 5K1XA 3U58A 2NVYH 1O7ZA 2HT1A 4PMCA 1D8LA 3HOXH 5A35A 1I94Q 1XPRA 2PZTA 3HOXB 4HTHA 3DWQA 5C4XB 1EU4A 2JA7H 1Y8PB 3EJIA 2RBMA 3IKMB 1OXVA 2D6FC 3HKZB 2YU9B 1EFWA 4GKJQ 4C3JH 2K5DA 4ZRZA 4GN4B 3VYSA 2E8GA 3CKIB 2NYZD 3SEBA 4DXGA 5IGBA 3K81C 3MXUA 1ZYRD 2QDBA 1WQHA 3PO2H 1W3SA 4B9XA 4DAMA 1HQMA 4BXXG 2ZIOA 3VQWA 4PMBA 3CMEA 4B3SQ 1G91A 1JJCA 4FXKC 1SNDA 4X66Q 3GTKC 3BJUA 1F2ZA 2B2WC 5FLMC 2QGQA 5LL6S 3HXVA 2DJFC 1UE7A 4B3MQ 4P3NA 3KLWA 4DV6L 1RODA 2A19A 2F03A 3GTPC 4C1NI 2RSOA 4KD4A 5IP7H 5J1ZA 3PIOA 4WI1A 4XQNA 4K0KL 2AQ2B 3CP0A 3IG2A 3EQLC 1IBKQ 4DV5Q 4BWGB 3MMLB 2JA6A 1EQRA 3H0GA 2J7ZA 2I0QA 2KENA 2IJ0A 1VQHA 1Z7TA 1JVIA 3F2BA 1CFMA 2XTIA 3M7NA 2HDLA 3UDGA 1NUCA 3D8GA 1SFOK 3CCLA 1B4BA 3FKIB 5IGEA 1AP0A 4RAUC 1QNUA 4I65A 2KJXA 3ZYYX 4NXNQ 2O5JC 2VUMK 2EJ9A 4DQ2A 1A8VA 4AYBE 1I6HK 5C0XG 3GTKK 4DF7A 2YTVA 4L63B 4NKLA 3HOVB 5C4XC 4DR4L 4A93H 3E5SA 1EIYA 2GSOA 4FDBA 4C3JC 1Y1VG 4JK1C 4JI5L 1TWFB 5CV9A 1D1KA 1KDBA 1N36Q 2ZCEA 1HJPA 1NTGA 1CKNB 1H9RA 2KA7A 1UE1A 4JPBW 2WKCA 2KEEA 3PF5A 5E3FA 1PJ7A 4WJ3M 2B2TC 3N52A 3M4OB 1JOEA 2R93G 5IYBH 1YHBA 5C4ZA 2NVQH 1HCZA 1Y8OB 2I5LX 2KCCA 3J80i 1ILQA 1IW7C 1Q8IA 3K6OA 4P73C 1EI6A 2A5HA 4EQNA 1BUVT 1ICFB 4Y7NC 3E3XA 3HOYG 3FPUB 2JA8H 3IPJA 3S17H 4MQ9A 3S17B 2Y0SD 2A68D 3RKXA 1C48A 2KCNA 1IQ0A 3N6RA 1OTCA 1WTXA 1YFSA 1MIUA 5IP9K 2Z6KC 4A3CH 2QILA 4LK1C 2F0FA 3AD9C 4G84A 4LK1A 5EKKA 3GTQH 3TZUA 1FJGQ 2HNIA 2PMEA 4LVJA 3GTOK 2PMZD 3GTOH 4O1NA 4DUYQ 4TKOB 4JOIA 1D5MC 3ONAB 1S5CD 3H3VL 3CCSA 2V4DA 1UEAB 3SR1A 2RHQB 1B53A 4MTKA 2YU9A 1NJ6A 4X65L 3A7UA 3QO7A 3OMCA 3QNEA 4KMUA 1L0YB 4YIJA 1S72A 5KYIA 4QUFA 4A3JH 1UV7A 4C3HC 4C2MH 2ZXPA 1WCMA 1N9WA 1U4PA 2F3IA 4H13C 4DR7L 4FXGC 4R8IA 2OTLA 3T1HL 4CKCA 1JJCB 1X32A 3EIVA 2QEJC 4KK7A 4EQ5A 1I6HC 4DR5L 2F3VA 1B8AA 3G71A 3SK6A 2NB0A 4YWMA 1PZJD 2G5DA 4TVAB 1BJTA 1HRJA 4XLPA 1DOKA 1GO3E 1B9NA 3NWSA 1SYGA 3ND8A 2WB1E 4ZH4A 2ZT5A 3J81c 2BE5D 2R7ZA 1QILA 1CHPD 3CF5A 4KHPQ 1EIHA 2P0LA 3QOJA 2R92B 1EOVA 1VQBA 1Q1BA 2JJQA 3PCOB 5EBCA 1STYA 5I9PA 2B8GA 1FVIA 4E6IA 3FHWA 1JWMD 1M4VA 2JA7B 4A3CC 1EEID 2HDMA 2UU9Q 3KF6A 2E74C 3DUZA 4WF2A 3OD1A 4FXDA 4HCSA 3P8TA 1FYFA 1E0BA 2DEQA 1TS5A 1HZAA 5C3EK 3HOWK 1YJ9A 2QA4A 4B3RQ 4IO9A 1HPCA 4LF5Q 3BVGA 4WRDA 4B3SL 2EBBA 5FO8B 4KKTA 2DXUA 5IT9L 5IWAQ 3I4MG 3GTJK 2VQFL 3PO3K 3QR8A 1SYBA 1T9HA 4APVA 2I4OA 5HY6A 5CMDA 3VQVA 4XCHA 3GTLK 3E9IA 2R7DA 1LTTD 3TP7A 4Q6GA 3GTKA 4BY7C 4GOPB 5E3IA 3TZDA 4XT1B 1EZ8A 4A3MB 1A3VA 3GTKH 3MZ5A 3CCEA 3GTKB 3S1NH 2F0KA 1TWGC 5G3LD 4OO1I 4IPDA 3D6CA 2A73B 2AMCB 2E2DC 2EYOA 2RDFA 4YY3Q 5CC4A 3FOEA 1YFTA 1OO9B 4DU9A 2R7ZG 4JI6Q 1XZPA 3GTMK 2XRSD 3TFHA 5KIXA 4LVKA 4DR7Q 2ICIA 2I07B 4JI4L 2A69C 1C8CA 4H2TA 2E2HK 4GLXA 2AQ1B 1SNQA 3K57A 2NVTB 1J6QA 3OWFA 4YROA 1QOHA 4YYEA 1X31C 4A4IA 3M4OK 5L37A 4QGUA 1H4TA 4YY3L 3EFSA 2G9HD 1I3QB 4ODGA 4GZYA 4CJ2C 3DXJA 4OX9L 3PF4A 2OQ0A 3P20A 1QG7A 2YV5A 2H1EA 1K0RA 1Q90A 4AIMA 4DV6Q 2FQTA 1PYSA 1EYDA 4HMIA 3I55A 3I4NC 1QVGA 1ET6A 4LFBL 1Y1VB 1GHJA 1IBAA 1CQFA 1DD2A 3P75A 2M00A 1PVOA 4JBKA 2EXZA 5C4XH 1HC7A 5CV5A 3UH0A 3CPWA 2A74C 4H2YA 1EEFD 1V43A 4C3JB 2M2LA 4A3DG 3A0JA 3WWVA 4KM8A 1Y1WK 3GV6A 5JVOA 3IFTA 3SDZA 4XU2A 3CAGA 1EVKA 3P8YA 4A3LG 3NBHB 3S17C 4BY7B 4HIOA 4TQDA 1WOOA 1STEA 3E0JA 1RCVD 1QF6A 4OONA 3CHBD 1SFOB 1GUGA 4G7ZC 3J80E 2CJ9A 2NS6A 4X6AC 2D5DA 2HCIA 2VQEL 1EY4A 1LT3D 3TRZA 1HHVA 3HY0A 4KB4A 4JW0A 3F2CA 1EQVA 2JQOA 2L1BA 4KKSA 1W66A 3OYYA 3M4QA 4X64Q 1IYVA 4TVYA 2Q5IA 1X2GA 1K3BC 4PMWA 2R93K 3KBGA 4HN7A 5A2QE 2KOLA 5D3IB 2Q7GA 2IX1A 1ZYRC 3RZDH 2A6EC 3DSQA 1SXTA 4Y52H 2I4MA 4CKEA 2PMZL 2Q2TA 2N8NA 1MHWC 3J81E 1IKMA 3BUEA 3K7AH 1JOOA 2ALYB 3W1GA 1MSHA 5IP7G 3HOUC 5T1IA 2B63K 4RGOS 1PTOB 1LYLA 1ESFA 4UHVA 1B50A 1RKNA 3MF2A 2IHFA 4NXML 4LWCA 4HT4A 2L4NA 2K14A 3QX3A 2EYJA 1O80A 4C3HG 3D31A 2BA1A 1KOGA 1NSNS 2I4LA 3MA2B 1PHJA 3GTGH 5E7NA 5FK9C 1IL2A 1PYBA 5K1PA 1EH1A 3RZOK 3S1MH 5IP9H 2AUKA 1CHQD 4A3KG 2E5AA 1WD1A 1PXUA 4FYDA 2JA5C 2V6UA 2KCTA 4R8NA 3PCOA 2JP1A 1ZVUA 1PRTF 5E4WC 1BDFA 1F7VA 1SNOA 4ZUJA 3S2HH 2NVYC 2E2IA 3S2HB 1WSRA 1JWUD 4ZLTF 2E41A 5F5WA 2RH6A 3S16B 1Q3LA 1BS2A 4TTVA 3S16H 2NN6G 4QJFA 4G85A 3QO5A 4BBSC 1I4XA 4FF4A 3TMEA 1IW7D 5CR3A 1LV9A 1STHA 1E1TA 5IYCH 3Q24A 1LTGD 3OSOA 4KY5A 3GQBA 2VB3X 4LJZA 2ZR3A 1O2BA 1XXBA 1V8QA 3GTJH 4BWAA 1EY5A 4P75A 1NJ1A 3UI2A 2NVXA 4YP0A 2HHHQ 1F77A 3MXNA 4DNIA 5COYA 4R1JA 2SNMA 2E2IK 2ZTDA 2ZJRA 4KHZA 4NXMQ 2EQSA 3NBIA 4M8AA 1XTCD 2KUMA 2XNAC 1SERA 2B39A 1B3AA 1EQQA 1LTAD 2JA8C 1W6KA 1W6JA 2ZT7A 4ULLA 5IYBG 4J1MA 5HL8A 4K8JA 1XMOQ 1PH9A 1GUNA 1Y1VK 1D1IA 1VQJA 1ZKOA 2Z0SA 2EYMA 3I4NK 1SR3A 2Q8IB 1PRTC 5DLQE 2R6GA 5IGGA 4K88A 4KM9A 2NZOA 3NQIA 3GTLB 4CS4A 1B7YA 1WOSA 1F93A 4R4QA 1HNWQ 1Y1WB 5TSSA 2OTJA 4J6HA 1CM9A 4RKLA 3PO3B 2P5MA 3TBIB 4OIKA 1QZHA 2EL9A 1USOA 3D3RA 1GUSA 1VQ8A 1LO5D 4KARA 1WIHA 1EIGA 3UDFA 4YWKA 1BIAA 2F0PA 4FO2A 3JAMi 2L5TA 3VA5A 1FJGL 2UXCL 3H3VD 2D62A 1QCBD 1LTLA 1WQWA 3NEMA 5EBDA 5L46A 2C8MA 1H9MA 4IUNA 3A7RA 1JT8A 4YRSA 1EY9A 5IGDA 2JA6G 3O13A 2VUMB 3H15A 1NJ8A 5IYBC 3HOYC 1STGA 1J98A 2NVXK 4CH5A 4QJVA 3I4OA 4EX5A 4C2MC 3IKJA 4LF7Q 3KLSX 1AB4A 3TTGA 1I3QK 3S1MC 3F8TA 4BY7H 3L9AX 1Q1EA 2E2JH 4XU1A 3RF1A 4BBSB 4HJ7A 1WVLA 1KRSA 3KLRA 4OHJA 4HIKA 2L9HA 2SOBA 1FNVA 3SGIA 1HZBA 3ULPA 2V6SA 2A8EA 2ZTCA 5M5WH 4TVAA 2KBNA 1E2WA 3SZYA 3PSIA 3S1QB 1B9MA 2UU9L 3D0FA 1KRTA 3UGQA 2VQEQ 1TWHK 4DV0L 5C4HA 1I94L 1I50H 2K1BA 4NPSA 2WAQE 3LAJA 4BBRB 4QCLA 1GUWA 4EQOA 2WB1L 4FF1A 4JI0Q 1JJGA 4HA8A 4DV1Q 1DCPA 3FJPA 3P7JA 4CBVA 4KI0A 1YZ6A 4LF8L 3A56A 4DAYB 1VQZA 1CZGA 1N32L 3CC7A 3HXWA 3GTQB 3CCVA 4DUZQ 3C1EA 1XMOL 3GD7A 4DV7L 3H91A 3TEGA 1PZID 1PTOH 3GTOB 1NJ2A 4HSVA 4IFDG 2AKWA 1K83C 4R4CA 1TWAC 3S16K 4CGYB 1HZCA 2HIVA 3L3OC 1DD5A 1PTOF 4LK0A 1WLEA 5IE8A 2B2UA 1H4VB 3REUA 1VJEA 2WAQD 4P71C 2ZM6Q 3HOYH 2EY5A 4UP9A 5EPKA 3HOYB 1TWFH 1SE3A 4P3OA 2PNHA 5M3FB 4A3BB 2QHSA 1IBLL 4IPGA 5LMNW 1VRQC 2EY2A 1BNZA 1NE3A 1YVCA 4JI2Q 5LL6X 3K8AA 1QVFA 4DFAA 2NWGA 4P3PA 4NMZA 4DV4L 2PMFA 4JI4Q 1V1PB 2EYFA 1ADYA 4A3GK 3H3VH 5CBAE 2JA6B 5M3MB 3H0GH 4JI6L 4CS3A 1RL2A 5C5MA 1TR5A 2NN6H 3MXPA 1VQ4A 1K73C 2E10A 3IL8A 2F0SA 1ATIA 1TWHA 5I2YA 4RGTA 4C3IH 4DK0A 1HTLD 5ELEA 4YCWA 3JAME 3BS1A 3BP8C 3PO2C 1E3PA 1EWIA 1K83K 1PH2A 1VF5C 2ZJPA 4LJZC 3ERRA 3R3OA 4IQZA 4QF4A 2DGYA 4IN3A 2BH2A 4X64L 1ZXTA 5I6WA 4LFCQ 2EJMA 3J7AF 3NP8A 5C51B 3QB3A 1WFQA 1Y69U 1SSOA 1NY4A 1EU3A 3CCRA 4HWTA 2RDHA 4LW1A 2K05A 1GD7A 2WIIB 2UUBL 3PO2B 4UDUC 3ULJA 5FLMH 3CPFA 2CFAA 3E0EA 4RWSC 2KVMA 4GFQA 2NN6I 1M8AA 1Z47A 1LT5D 3ND9A 4RG1A 5EQ0A 1KQSA 3HEJA 3PUYA 2PNRC 2O5IC 4BW9A 3V7SA 4H2WA 2EY6A 3AYHB 4JC0A 2FXQA 4JI7Q 3VYTA 5C5LA 4C3IG 1CKMA 1I4HA 3Q23A 1WTPA 2Q5HA 2F0IA 1EYAA 1V1QA 1PFBA 4A3IB 1MI2A 1B70B 1PFNA 2C7IA 1F2LA 4Q5VA 4YRKA 3HOZK 1TWGB 1KC8C 3EN2A 4KN7C 4Q0FA 3I4NH 1XXGA 2ODRD 1H9SA 4YDQA 2R92C 3LX0A 1VMPA 2K75A 1FNWA 3GTGA 3R93A 4JI7L 1EY8A 1QWYA 2JH3A 4OX9Q 1JB3A 4ZIBA 3QIAA 5FOBB 1PTOC 3SVMA 2R92H 2EWNA 4C3IC 3CCUA 1VQNA 4YRTA 1C9OA 4Y52C 1A15A 3PGZA 2ASBA 1XNQQ 1O7IA 3OTOL 4A3IC 1PJ5A 2AWNA 1GGMA 5J22A 2XRQD 4PNYA 4B08A 3EFXD 2JA9A 3RN2A 4IUVA 1VS0A 2AUJD 2DTHA 4X66L 4MN3A 2RF4A 1WCMB 3A8KA 3WDNA 4BY7G 5BR8L 3ICEA 3CU7A 2C9OA 4X3KA 4LF4L 5ELCA 4YRGA 1CKOA 3PQIA 4C3HK 2F0HA 3HOUK 2NVQK 1BCPC 5M5WB 1I6VC 2F0DA 4A3MH 4QUCA 2ZNJA 1ZXOA 5KNDA 4LLGA 4NOIA 4RCOA 4R4TA 3S1RK 1SFOH 4K86A 2JA8K 3M3YK 4YFKA 3A55A 5IOQA 2QDLA 4B3TL 1X3QA 2Z4IA 3RL6A 4P72C 3DMUA 5CJ9A 2C5CA 4JYAL 4DR1Q 4TRDA 3TQYA 1VQ9A 1HFNA 1KDCA 5E1FA 1SRYA 2MQHA 3W1BA 4HWOA 4G7OA 1U4MA 4UP7A 4KAWX 1O26A 1I3QH 1SAPA 1HNXL 4X6AK 3MEYA 4DKAC 2B63H 4Y52K 3T53B 5IGFA 1X3GA 2ZM6L 3NQTA 4XTVA 5C3XA 5H1SE 1XXAA 2D0PA 4O0AA 3LWEA 1S5ED 4G57A 2QW7A 1TWAH 2CVRA 2K32A 2BDNA 1U5KA 4A3BH 1KMNA 3LWUA 4N9PA 5C4XG 1VDZA 4A3FK 2ZINA 3L4JA 3S1QK 1CQVA 4GNXA 2A69A 2XCQA 1EL0A 1USYA 4A3LK 3L7ZC 1U4RA 1QJOA 1Y1WG 2CCZA 2ZT8A 2R93H 2WB1B 3IKLA 1I50K 4A3EC 5IYDK 2QKIC 4DR3Q 2QCPX 3TSSA 2F0GA 2E2JB 2QEXA 1P8LA 1B4AA 4K87A 3S1MK 3G48A 1Q8KA 3LNNA 3AEVA 4GKKL 3GTLA 5IYCG 2F0UA 4X5OA 1NJIC 1IW7A 3WQZA 3A5UA 2ID0A 4OIOA 3M3YC 4XSZA 4IZ8A 4B3ML 3S1QH 1N36L 4A3BK 3A8KE 2Y0SB 1A63A 4PZ6A 5JVG3 1ESRA 4XQJA 2JYOA 2IW3A 5FO9B 5FKAC 5ELFA 1PYWD 2RHQA 1HH2P 4K6LA 1IL8A 2F0JA 3NE5B 5EKIA 1O24A 3AFQA 5JOBA 1T5XD 2NVYK 4A3IK 1R4QB 1OXXK 2H4OA 3IALA 1CTMA 2O4XA 1DCZA 4S3SA 4DNRB 2XCOA 4XTCS 1L0XB 4A3LC 2IL8A 4BXXK 3LC0A 4JI2L 2RCNA 1GKHA 3FKIC 2R7ZC 3QO8A 2VZAA 3D4RA 1XNRL 2JA6K 2N49A 1HI9A 3FKIA 3S2HC 1I6VA 1PMRA 1R4PB 1K83B 3Q8DA 1SETA 3LAPA 3MEFA 4GOPA 1QVCA 3K59A 3S0XA 1TS2A 3CRKC 3VA7A 1YIJA 1Q81C 4C3IK 1TWCC 5M3FH 2A1AA 2MGSA 3GTGB 5D4DA 5M5XK 3T1YQ 1YNNA 1KTKA 1QUQB 2LXJA 1K9MC 3S1QC 1F9SA 4G7HC 3I4MC 2D9UA 3MAQA 3GTPA 1EUJA 2F0MA 2JA7A 1RIPA 3J81L 2RSNA 5EAYA 3NHHA 2PZUA 3Q3QA 3MC0B 1SMYD 3BDOA 4C3HB 4MTNA 4DV3L 3HOUH 1WSVA 1PH6A 2ODRC 4A3MK 5DM73 1V1PA 2YU9C 1HFGA 1SJED 3GTLC 3TS0A 2RHSA 1EOTA 4R4OA 4ZKCB 3TUPA 1UE5A 1PTOD 3R2IA 3STBC 4PHCA 5FLXL 1I6HB 1F2MA 4QIWB 2NVQC 4N9TA 4DR6L 3FKIK 1SNMA 2ZTEA 3S15B 3W2DA 2FJ2A 4JI8L 1X54A 1Z7NA 3L4KA 1A0IA 4J8QA 2JA5H 3SK5A 1WU7A 2KEDA 1AH9A 2ZZEA 5D3DA 4GNXC 4POFA 2I5HA 4L6TB 2WB1D 3HOZB 1AFPA 2UXDQ 1O2AA 5IOCA 2O5IA 4K2KA 1CZWA 3V05A 5C4JC 1CSQA 3GEHA 1N34L 1Y1VC 1S5FD 4BBSH 2P8TA 5DAUA 3J81j 1OXTA 4L5RC 1BO0A 4YRQA 3S14C 1KDAA 2CH4A 1DONA 2B2YC 1FNUA 1PRTD 4A3IG 4G7OC 3NTIA 1YHQA 1SNPA 3CCJA 2CW0C 3IFDA 1HNXQ 1Q82C 4YPFA 2FHTA 3RZDC 1I50B 3DWPA 4P72A 1IYJB 2XWJB 4OLFA 1H4QA 5M5YK 1A62A 5AJ3Q 1Y1WH 3ICAA 4KLKA 2QHTA 1ASZA 1IS1A 2JA5G 1B1ZA 4OINA 2F0EA 2B2VC 1QE0A 3GDEA 4CDDC 4C1NK 3CQZK 4JBJA 1TWFC 2CWPA 3V8JA 2EOTA 3AQPA 4F8MA 2OCEA 1AZPA 5FJ8G 1EFID 2L15A 4X62L 1I5FA 2EJFC 2HQLA 2B63G 1B4OA 4QMGA 4A3JG 1YBYA 4O42A 2Y0SE 4L87A 5IP7C 5C3WA 1SFOA 4GKJL 1X9NA 1YNJA 3HOVC 1X3FA 4RHRA 1S5BD 2ICEC 4AQYL 1HZ9A 1EY7A 1NYQA 5BN3A 3BU2A 3GV3A 2VQFQ 4A3CK 4JV5L 3ULLA 3ZJYC 3ER0A 3PIP3 4JI1Q 3HXXA 4BKWA 1EVLA 1LTSD 2B2WA 5M3FG 1VQDA 1TS4A 1TY2A 4FF3A 4GOPC 1I4GA 2K03A 4HJ9A 1O29A 3URYA 4H2XB 4A3JK 5EPLA 2SDFA 1VQ7A 4GN3B 3S2DH 3L4GA 2DZCA 3CXCA 5EJWA 2GVAA 5GAGC 3PUWA 2BE5A 2K28A 1SYEA 3TREA 3RLNA 1J6WA 1SE8A 1E7ZA 1RDPD 5GADC 2IY5A 2EYPA 2IX0A 3PZCA 5JFEA 2Y0SG 4IUUA 3OHXC 3VR4A 3VR3A 1VF7A 2EJGC 2LFNA 2TSSA 1JOKA 1WTRA 5FO7B 2F3WA 1HTPA 4PQXA 3RNUA 4XEMA 2KHIA 2R93C 4BA2I 3I90A 4BBRG 5LHY1 3KDFA 4K8IA 4CDCC 3K5MA 1PH7A 1RTNA 2DVEA 1X2HA 4LMQD 2UXBQ 4CKBA 1PFSA 1HXDA 1G291 1IBKL 4LF6Q 5JPNC 2KCMA 2MO0A 4O2DA 3KDFB 1PLFA 1XMQL 3GP7A 4JI3L 5IP7K 5C3EC 2WB1G 4L5TA 3I4NG 2L11A 2N3SA 2NUCA 2WAQG 2E2HA 3HOWH 1O7LA 2K6AA 3J7A5 1LABA 1L1OB 3W5OA 4DR4Q 1SESA 2DU5A 3GTMB 4DV3Q 1FYCA 3MEHA 5C52B 2XIWA 3RZOC 3BZDB 2E2HB 3WODA 3GTJC 3GTLH 3AFPA 3EFRA 3H0GB 1KMMA 3HFZB 2LSSA 3T1YL 1TWHC 2FFKB 1E24A 1KNEA 4OIQA 4HAEA 5BN5A 3A32A 4RGMA 3H94A 3C46A 3J7AV 1O7YA 2V6TA 2NZHA 1WTWA 1LT4D 3HG9A 5C44G 2QHVA 1EYCA 3QTCA 3FKIH 1JMCA 4IFDI 2SEBD 1O78A 5I2XA 1VQAA 2HIXA 3T13A 3TEHB 3NK9A 3STBD 1ILPA 3JAMc 3DM3A 2NVXH 5C4JB 4ID6A 1AE2A 2IPKD 4OO1G 4H44C 3C2PA 5C3EB 2A6HD 4WORA 3IRBA 5C3EH 1PH5A 2MHVA 2AMCA 3NETA 4EO4A 4P71A 3WOEA 1VQ6A 4TVWA 4EQPA 5EGEA 4R4IA 2F0NA 2ARUA 3EA6A 4C3JK 2AWOA 1SMYA 3BP3A 1ENCA 1LTRD 3LPXA 3U50C 3RN5A 2H5XA 1WQFA 4YHHL 5LMUL 2HQEA 3L2ZA 4A3KK 4RCNA 1PH1A 2NVQB 2Y3PA 3QJYA 4JCVE 3KJPA 3S16C 1HXYD 5KEEA 3KLSA 1NBWA 3G6JB 2DXTA 5LMNL 5DM63 1YNND 1MSGA 3S15C 1TWHH 2K5HA 4NXNL 1D6EC 1I4PA 4H2XA 3GTMC 4QIWE 1VH2A 3I4LA 2GSNA 3DM1A 5DNFA 4OXPA 2DQ3A 3L4GB 1F9NA 5IYCC 2L55A 1PA6A 2MUYA 3UE0A 4YRFA 5DEHA 2PZWA 2F4IA 4CJ0B 2E2HC 1GE9A 2A68C 3BYTB 3I56A 4HIDA 3HXAA 3A8JA 1YGBA 1R9TA 2NVTK 3RD4A 1DGSA 4RA8A 2PA8D 3S1RC 2A6ED 3W3SA 1KLGD 2ZXRA 1R9TH 1ZQ1C 2ALYA 1R9TB 5K36G 2B63B 3U4ZA 2GN5A 4JI3Q 4L8JA 3A74A 1USMA 2PPBC 1I6HH 1TWAK 5AFWA 3AB9A 2YTYA 1RIQA 1S3OA 1JB7A 1LUZA 3GTGC 4V0BA 2JA5A 5IOSA 4KN7A 5TMFA 4A3FH 1HA6A 3JSTA 4HJ5A 4A93K 2XN9C 3ERQA 1RTOA 1SRUA 3MQZA 2ARTA 2BE5C 3UDXA 2LS01 4A3MG 3HKZD 1Q12A 4RH6A 4GTCA 1JCKB 1NNXA 1VQOA 2AHOB 3AD7C 2BH8A 2PPBA 3GTPB 1WCMG 1XPPA 4IALA 4LQYA 4MEYA 1II3A 4KD3A 2EZVA 3KF8B 3RUZA 4KC6A 4YRIA 3ERED 3HOYK 4IUTA 1D5ZC 5J39A 3NWTA 3EVQA 4YRRA 2VS1A 3CRLC 1VQPA 1H9KA 1RF2D 3OEPA 5JJKA 4QIWL 1S40A 3K58A 1T5EA 4JI8Q 3V96A 2WAQL 1K8MA 1I4RA 5HURA 3M4YA 1R9TC 1IZ6A 2ATWA 1PRTB 4DXFA 1YNJC 3FP9A 4GTEA 4ZKBB 4ILWA 5K5PA 4HJ8A 2EDGA 3OWEB 1O28A 4DA2A 4KHPL 3F2UA 2KHSA 3RZDB 4LF4Q 4PV1C 2ZR2A 2EJFA 4LVIA 4LFAQ 5M3MK 1K0SA 3CC2A 4KY7A 3DWAA 1CKNA 5ISRA 2D2CC 2WP8J 3MXNB 3DHQA 2K50A 3T1HQ 4DAVA 2OQKA 3K0YA 4OGQC 4A3JB 1TY0A 1VQFA 1D7QA 3OIPA 4HVCA 4WILA 1G5IA 2E2IB 4V190 2ZGWA 2VUMG 4BY1G 2WAQB 2CJBA 2B2VA 4KATA 1GHKA 3VBBA 3HFVA 4P75C 4HMJA 2HD3A 3HOUG 4ZCKA 1RHPA 1KABA 4CH4A 3GSIA 4Z9CB 3J81i 3HXYA 1IE0A 1EYGA 4MHEA 1X01A 3RZOB 4A3IH 2D0OA 1J5WA 2IX3A 3RZOH 3GTGK 2E75C 2UXBL 5JEAH 4QB4A 2Q2IA 4QQBX 3FEWX 2CH4W 4ME5A 3VQXA 3UDIA 1TS3A 2XGTA 3RMHA 3H3VI 2A69D 1Z7MA 4DUZL 1GVPA 4CS2A 2QHUA 1MJCA 3RACA 3VYUA 2MP1A 1C7YA 2NVYA 1TQOA 2UUAL 4LF8Q 2NVTC 2QF7A 3S24A 3G4SA 2Q7HA 3NTKA 5BN4A 4JI0L 1BXTA 1BDOA 3R07A 1A2TA 3G4CA 1DOLA 1UNSA 3GTJA 1XZQB 3VR6A 4B3RL 2PW7A 2IWHA 2CJAA 3G1ZA 3HOXK 1FD7D 4YWLA 5C4XK 4OIRA 1YJWA 2KHJA 3FRPB 3OMGA 4H2VA 4IOCA 4PAAA 1JR0D 3S15K 1U4LA 1BR9A 4ZTUB 1STNA 2OT2A 3CAMA 4A3DC 1DXMA 2DQ0A 1F2YA 3MVVA 1KL9A 3V7RA 1YITA 3HOZH 3M4OH 4BA1I 5JEAG 1XYIA 1EIFA 1GM5A 4XU0A 1NMGA 4KN4A 1VQEA 1DOMA 1A3UA 1K8AC 11ASA 2LKVA 5NUCA 3CC4A 2RQXA 4BBSK 4BY1H 2F0LA 1JOQA 3V7CA 5EPJA 2BA0A 3K80C 4CDFC 2DU7A 3ADAC 2RKSA 4G0WA 1EY0A 4RGNA 4JVZA 4WJ4A 1TIID 2C35B 1X3PA 3VR5A 5FLXE 4KASA 4A3KH 2JA7C 4BY1C 3MTSA 2DNCA 1Z9FA 4HWPA 2DJZA 1WCMK 1ONLA 3BVZA 4GTFA 3SHLA 1KIXA 1X6OA 1FL0A 1KHIA 5C0XJ 2EJGA 1Y8NB 3GTMH 4XTWA 3OIQA 3D6WA 5C4JK 2JA5K 3FPPA 4KMDA 4P74A 2PMZE 2E2HH 2B63A 2Z8LA 4C3HH 4GS3A 3HOUB 3A5ZA 1O27A 4HJAA 1L2FA 4YRLA 2E64A 4UP8A 2W7VA 1KAAA 1CK1A 3UE1A 12ASA 3V8KA 4G7ZA 4X3SA 3HKZE 1WOPA 2EIFA
chains in the Genus database with same CATH topology
3CW2C 2CQOA 2ZZGA 1XMQQ 3CD6A 4E51A 2AKWB 4JI1L 3EBEA 4UY8C 2F4VQ 2Q2HA 2EXDA 1HNZL 1IBML 2ZT6A 2F52A 1EIYB 2I4NA 4JBMA 1QZGA 3L1AA 4LVMA 4ALPA 3TS2A 4YRPA 1YJNA 1KXLA 1PH3A 3HKSA 3H0GG 4LVLA 1BBUA 2JK8A 4LUVA 1CSPA 1PV4A 3I7FA 2UUCQ 2I5MX 5IT9c 4GKKQ 4BBRH 3MF1A 4OWXB 3LGJA 5FLMG 4KQEA 3JC66 4DR2L 4TWAA 2ZXFA 1VCIA 1YNXA 1Q7YC 2JEAI 3TEHA 3U4VA 3PIPA 2PI2E 4BXXH 1XTDA 5J3BA 4IOAA 4HWRA 2E5LL 1Q86C 1BVSA 2DDZA 3J7ZC 1WPYA 2CIMA 4A93G 1HNZQ 2ZNIA 3NENA 2ES2A 4DR5Q 1YEZA 1TXYA 5IWAL 5C0XI 3CCQA 3OW2A 3K7UC 1YI2A 1B7YB 2UUBQ 3A31A 1HTTA 4LF6L 2VNUD 4A3GG 2B3GA 4IJLA 5GAEC 4AYBG 4LFAL 4A3BG 4YRMA 5ELOA 4YHHQ 5LMUQ 3M9BA 4LF9Q 1Y1VH 3BFMA 3A7AA 2HHHL 4POGA 5HGQA 3I4MH 4XIGS 3CMQA 4OP0A 2K52A 4OWWB 2E2IH 1VQCA 2VY3A 3HOWG 5C3EG 4BBSG 3RR5A 3S1RH 1YHAA 2PI2A 3BZKA 2UUAQ 3KFUA 2YTXA 1N33L 1MKHA 1X55A 3L0OA 5M5XH 1HR0Q 1G51A 4DK3C 4JYAQ 1SLJA 1XNRQ 4XEOA 2EAYA 1NYRA 4B3TQ 3REXA 3HOVH 2K5NA 5C4JH 4DK6C 4DV0Q 1VQ5A 1WCMH 4GNXB 1NJ5A 4DUYL 1USYC 1LM0A 4HWSA 1X56A 3HRKA 1SROA 1MJEA 3L2PA 3VDYA 4LF5L 2MO1A 3RIRA 1N32Q 1VQIA 2E65A 5IP9G 3J80c 3HY1A 4A3LH 1XNQL 1K8GA 5M3MG 4DV5L 4MNOA 2GVBA 1FGUA 2UUCL 1PH8A 4YCVA 4PZ7A 2A8VA 4XTUA 1N8RC 4MZ9A 1G6PA 2DTIA 3NELA 1SMXA 1VQGA 2MNAA 4UPAA 3HOVG 3HOXG 1WI5A 5JEAJ 4GLAC 4P74C 4YRJA 2JA8G 2E3CA 2VL6A 4RQEA 5M3MH 4A3GH 5GAHC 2WFWA 2Q7EA 1TWGH 2R7ZH 2B29A 1H95A 3PO3H 2YYZA 4DR1L 2R7FA 5AJ3L 2RHSB 4JOIC 2CWAA 3HKZG 2ARSA 1U0LA 1KAWA 2Z6KA 1IBMQ 1QUQA 5BR8Q 2K4KA 3M3YH 4A3CG 4X65Q 1WOCA 4XTZA 4LNQA 2CKZB 5IY0A 3OTOQ 5JJLA 3PUVA 1SN8A 1P16A 4QY7A 3V8LA 2LXKA 2JE6I 1Q46A 2NVTH 3RKYA 1HR0L 4XTXA 4YREA 2G4CA 2FYKA 4NB3A 1VQMA 2V1CC 4DV4Q 1VQKA 1BKBA 2F4VL 2JA7G 4OWTB 5IYDH 2IY5B 4RQFA 4H02A 4LNSA 1VQLA 4JI5Q 1YFRA 4L5QA 1J5EL 1BBWA 2JEBI 2ZJQA 4CH6A 4A76A 3RLFA 4A3EG 1UWVA 2OWOA 2DZ9A 3UGTA 4DV7Q 4LF7L 5C44H 4ZTZB 3LSSA 4J15A 3PO2G 3KF6B 5FJ8H 4DV2L 3LSQA 1J5EQ 1W2BA 4PZ8A 1C0AA 4K0KQ 4IPCA 3HXZA 4X6AH 4H2UA 1WYDA 2DKGA 1M1KC 1TWCH 1OXUA 1HR0W 4DR3L 5IYDG 4A75A 1K83H 1JJ2A 1YB3A 3RGLA 2DUDA 3PUZA 2VW9A 5C53B 4A3FG 4GLVB 2K5VA 2J3LA 3AQQA 4LFBQ 4LUZA 3HFZA 2IHEA 3GO5A 1WNLA 1M90C 1E22A 1UE6A 2MFIA 1G5HA 1B70A 4YRCA 2N78A 3S15H 2J3MA 1WQ7A 3S14H 3A5YA 2YU9H 1L1OC 4ME3A 1L0WA 3CMAA 3G6EA 2ZIMA 1ADJA 4TQFA 2UXCQ 5M5YH 1HNWL 2CGHA 1XPOA 3VQYA 4TQUS 1V9PA 3DLLA 3M4PA 5GROA 4KR3A 4JV5Q 1IXRA 5LMNQ 3RUXA 2R92G 3CQZH 1WJJA 2E1HA 1X3EA 4XTYA 3BZCA 1NNHA 3RLOA 4JBWA 2VUMH 1ASYA 2IT1A 4DV1L 4KR2A 1KD1C 4HIMA 5FLXc 3KJOA 1PH4A 3P8VA 3KYHC 4Q15A 2ZTGA 2P5IA 3PUXA 4LUOA 1BIBA 4DR6Q 4RDXA 1NMFA 4LF9L 4AH6A 3A5ZB 1UEBA 4LFCL 4DV2Q 4Y7NH 4PG3A 1XJVA 3CCMA 4YCUA 4A3EH 1L1OA 2ZZFA 3KOJA 4QL5A 3RKWA 4XU3A 1N34Q 2PQAA 3HRIA 4X62Q 4DPGA 1K3RA 1JE5A 1H4SA 3E9HA 1PYSB 2CFMA 2PQAB 1XPUA 1E1OA 3B6YA 1CUKA 3HOZG 3K0XA 5GQOA 3F1ZA 4RMFA 1X65A 5KNNA 1IBLQ 3HXUA 4AQYQ 3I2ZA 2E5LQ 4CH3A 3PO3G 3FKIG 4L5SA 1N33Q 1Y14B 3F2DA 4GN5A 3PV0A 3ERSX 4YRNA 4JG2A 4H2SA 4DR2Q 4P73A 2JA6H 3GTPH 4IJHA 2UXDL 1AE3A 4A3DH 2DTOA 3UFGA 1B76A 3HTZA 1OXSC 5JJIA 5ELNA 2Q2UA 3M85A 4IPHA 4IFDJ 5K1XA 4NCXA 3U58A 2NVYH 2HT1A 1D8LA 3HOXH 1I94Q 1XPRA 2JA7H 3IKMB 1OXVA 2D6FC 1EFWA 4GKJQ 4C3JH 4GN4B 2E8GA 3K81C 3PO2H 1W3SA 4DAMA 4BXXG 2ZIOA 3VQWA 3CMEA 4B3SQ 1JJCA 4X66Q 3BJUA 2QGQA 3HXVA 1UE7A 4B3MQ 4P3NA 3KLWA 4DV6L 2A19A 5IP7H 4WI1A 3PIOA 4K0KL 3CP0A 3IG2A 1IBKQ 4DV5Q 1EQRA 2I0QA 2KENA 1VQHA 3F2BA 2XTIA 3M7NA 3UDGA 3CCLA 4NXNQ 2EJ9A 4DQ2A 1A8VA 4AYBE 5C0XG 2YTVA 4DR4L 4A93H 1EIYA 4FDBA 1Y1VG 4JI5L 1N36Q 2ZCEA 1NTGA 1HJPA 1CKNB 1UE1A 3PF5A 4WJ3M 2R93G 5IYBH 1YHBA 2NVQH 2I5LX 3J80i 4P73C 3HOYG 2JA8H 3S17H 3RKXA 1OTCA 1YFSA 1MIUA 2Z6KC 4A3CH 4G84A 3GTQH 1FJGQ 2HNIA 2PMEA 4LVJA 3GTOH 4DUYQ 4JOIA 3CCSA 2RHQB 1NJ6A 4X65L 3A7UA 3QO7A 3QNEA 1S72A 4A3JH 4C2MH 1N9WA 2F3IA 4DR7L 2OTLA 3T1HL 1JJCB 3EIVA 4EQ5A 4DR5L 1B8AA 3G71A 4YWMA 4TVAB 1GO3E 2WB1E 2ZT5A 3J81c 3CF5A 4KHPQ 2P0LA 1EOVA 1VQBA 1Q1BA 2JJQA 3PCOB 1FVIA 3FHWA 2UU9Q 3KF6A 4WF2A 3OD1A 3P8TA 1FYFA 2DEQA 1HZAA 1YJ9A 2QA4A 4B3RQ 4IO9A 4LF5Q 4B3SL 2DXUA 5IWAQ 3I4MG 2VQFL 2I4OA 1T9HA 4APVA 5HY6A 3VQVA 3E9IA 2R7DA 4Q6GA 4GOPB 5E3IA 3GTKH 3CCEA 3S1NH 4OO1I 4IPDA 2AMCB 4YY3Q 1YFTA 2R7ZG 4JI6Q 4LVKA 4DR7Q 4JI4L 4H2TA 4GLXA 4YROA 4YYEA 1J6QA 4A4IA 4QGUA 1H4TA 3EFSA 4YY3L 4OX9L 3PF4A 2OQ0A 2YV5A 4DV6Q 4AIMA 1K0RA 1PYSA 3I55A 1QVGA 4LFBL 1PVOA 4JBKA 5C4XH 1HC7A 3UH0A 3CPWA 4H2YA 1V43A 4A3DG 3A0JA 3WWVA 4XU2A 1EVKA 3P8YA 4A3LG 3NBHB 4HIOA 4TQDA 1QF6A 4OONA 2CJ9A 2NS6A 2VQEL 3TRZA 3HY0A 3F2CA 2JQOA 1W66A 3OYYA 3M4QA 4X64Q 4TVYA 2Q5IA 1X2GA 4PMWA 2Q7GA 2IX1A 3RZDH 3DSQA 2I4MA 4Y52H 2Q2TA 2N8NA 3K7AH 2ALYB 3W1GA 5IP7G 1LYLA 3MF2A 2IHFA 4NXML 4LWCA 4HT4A 2K14A 3D31A 2BA1A 1KOGA 2I4LA 1PHJA 3GTGH 5E7NA 1IL2A 5K1PA 1PYBA 3S1MH 5IP9H 4A3KG 2E5AA 2KCTA 3PCOA 3S2HH 2E41A 5F5WA 4TTVA 3S16H 2NN6G 4QJFA 4G85A 3QO5A 1E1TA 5IYCH 2ZR3A 3GTJH 4BWAA 4P75A 1NJ1A 4YP0A 2HHHQ 4DNIA 4R1JA 2ZTDA 2ZJRA 4KHZA 4NXMQ 2EQSA 1SERA 1EQQA 2ZT7A 5IYBG 1XMOQ 1PH9A 1VQJA 2Z0SA 1SR3A 5DLQE 2R6GA 4K88A 2NZOA 4CS4A 1B7YA 4R4QA 1HNWQ 2OTJA 1QZHA 2EL9A 1VQ8A 3UDFA 4YWKA 1BIAA 3JAMi 2UXCL 1FJGL 2D62A 1LTLA 1WQWA 3NEMA 2C8MA 3A7RA 1JT8A 4YRSA 2JA6G 3H15A 1NJ8A 4CH5A 3I4OA 4EX5A 4LF7Q 3F8TA 4BY7H 4XU1A 1Q1EA 2E2JH 3RF1A 4HJ7A 1KRSA 4HIKA 3SGIA 1HZBA 3ULPA 2A8EA 2ZTCA 4TVAA 5M5WH 2KBNA 3PSIA 2UU9L 3D0FA 1KRTA 3UGQA 2VQEQ 4DV0L 1I94L 1I50H 4NPSA 2WAQE 4JI0Q 1JJGA 4HA8A 4DV1Q 3FJPA 4KI0A 1YZ6A 4LF8L 4DAYB 1VQZA 1N32L 3CC7A 3HXWA 3CCVA 4DUZQ 1XMOL 3GD7A 4DV7L 3TEGA 1NJ2A 2AKWA 4IFDG 4R4CA 1HZCA 2HIVA 1WLEA 5IE8A 1H4VB 3REUA 4P71C 2ZM6Q 3HOYH 4UP9A 1TWFH 4P3OA 2PNHA 2QHSA 1IBLL 4IPGA 5LMNW 1NE3A 1YVCA 4JI2Q 3K8AA 1QVFA 4P3PA 4DV4L 2PMFA 4JI4Q 1ADYA 3H3VH 4JI6L 3H0GH 4CS3A 1RL2A 1VQ4A 1K73C 2E10A 1ATIA 4C3IH 4YCWA 1E3PA 1EWIA 1PH2A 2ZJPA 3ERRA 2DGYA 2BH2A 4X64L 4LFCQ 5C51B 1WFQA 1NY4A 3CCRA 4HWTA 4LW1A 1GD7A 2UUBL 5FLMH 3ULJA 3CPFA 3E0EA 2NN6I 1Z47A 1KQSA 4RG1A 3PUYA 4BW9A 3V7SA 4H2WA 3AYHB 4JC0A 2FXQA 4JI7Q 1CKMA 2Q5HA 1V1QA 1B70B 2C7IA 4YRKA 1KC8C 3EN2A 3I4NH 2ODRD 4YDQA 2K75A 4JI7L 4OX9Q 4ZIBA 2R92H 2EWNA 3CCUA 1VQNA 4YRTA 1C9OA 3PGZA 2ASBA 1XNQQ 1O7IA 3OTOL 2AWNA 1GGMA 2JA9A 3RN2A 1VS0A 2DTHA 4X66L 2RF4A 4BY7G 5BR8L 3ICEA 4LF4L 4YRGA 1CKOA 4A3MH 2ZNJA 4R4TA 1SFOH 4K86A 4B3TL 3RL6A 4P72C 4JYAL 4DR1Q 3TQYA 1VQ9A 1SRYA 2MQHA 3W1BA 4HWOA 4UP7A 1I3QH 1HNXL 3MEYA 4DKAC 2B63H 1X3GA 2ZM6L 4XTVA 5H1SE 2D0PA 4O0AA 1TWAH 1U5KA 4A3BH 1KMNA 5C4XG 2ZINA 4GNXA 1USYA 3L7ZC 2ZT8A 1Y1WG 2CCZA 3IKLA 2R93H 4DR3Q 2QEXA 1P8LA 4K87A 3G48A 1Q8KA 3AEVA 4GKKL 5IYCG 4X5OA 1NJIC 3WQZA 3A5UA 2ID0A 4B3ML 3S1QH 1N36L 1A63A 4PZ6A 2RHQA 1HH2P 3AFQA 1OXXK 3IALA 4XTCS 3LC0A 4JI2L 2RCNA 1GKHA 3QO8A 2VZAA 1XNRL 2N49A 3Q8DA 1SETA 3MEFA 4GOPA 1QVCA 1YIJA 1Q81C 5M3FH 2A1AA 3T1YQ 1QUQB 2LXJA 1K9MC 1EUJA 1RIPA 5EAYA 4DV3L 3HOUH 4MTNA 1PH6A 2ODRC 3TS0A 2RHSA 4R4OA 3TUPA 1UE5A 3STBC 4PHCA 4DR6L 2ZTEA 4JI8L 1X54A 1Z7NA 1A0IA 2JA5H 1WU7A 1AH9A 2ZZEA 4GNXC 4POFA 2I5HA 2UXDQ 1CSQA 1N34L 4BBSH 2P8TA 3J81j 1OXTA 4L5RC 4YRQA 4A3IG 1YHQA 3CCJA 1HNXQ 1Q82C 4YPFA 4OLFA 4P72A 1IYJB 1H4QA 1A62A 5AJ3Q 1Y1WH 3ICAA 4KLKA 2QHTA 1ASZA 2JA5G 1QE0A 3GDEA 4JBJA 2CWPA 3V8JA 2OCEA 5FJ8G 2L15A 4X62L 1I5FA 2HQLA 2B63G 4A3JG 1YBYA 2Y0SE 4L87A 4GKJL 1X9NA 1X3FA 4AQYL 1HZ9A 1NYQA 3BU2A 2VQFQ 4JV5L 3ULLA 3ZJYC 3ER0A 4JI1Q 3HXXA 1EVLA 5M3FG 1VQDA 4GOPC 4HJ9A 4H2XB 1VQ7A 4GN3B 3S2DH 3L4GA 2DZCA 3CXCA 5GAGC 2GVAA 3PUWA 3TREA 3RLNA 1SE8A 1E7ZA 5GADC 2IY5A 2IX0A 3PZCA 2Y0SG 4XEMA 3RNUA 2KHIA 4BA2I 4BBRG 3KDFA 1PH7A 2DVEA 1X2HA 2UXBQ 1PFSA 1HXDA 1G291 1IBKL 4LF6Q 2KCMA 2MO0A 4O2DA 3KDFB 1XMQL 4JI3L 2WB1G 4L5TA 3I4NG 2N3SA 2WAQG 3HOWH 1SESA 3J7A5 1L1OB 3W5OA 4DR4Q 2DU5A 4DV3Q 5C52B 3GTLH 3AFPA 3EFRA 1KMMA 3HFZB 2LSSA 3T1YL 1E24A 3A32A 2NZHA 5C44G 2QHVA 3QTCA 3FKIH 1JMCA 4IFDI 1VQAA 2HIXA 3TEHB 3STBD 3JAMc 3DM3A 2NVXH 1AE2A 4OO1G 3IRBA 5C3EH 3NETA 1PH5A 2AMCA 4EO4A 4P71A 1VQ6A 4TVWA 4R4IA 2ARUA 2AWOA 3U50C 3RN5A 2H5XA 4YHHL 5LMUL 3L2ZA 1PH1A 4JCVE 3KJPA 1NBWA 2DXTA 5LMNL 1TWHH 2K5HA 4NXNL 4H2XA 4QIWE 4OXPA 2DQ3A 3L4GB 1PA6A 3UE0A 4YRFA 3I56A 4HIDA 1YGBA 1DGSA 3W3SA 1R9TH 1ZQ1C 2ALYA 5K36G 3U4ZA 2GN5A 4JI3Q 3A74A 1I6HH 1RIQA 2YTYA 1S3OA 1JB7A 1LUZA 4A3FH 4HJ5A 1SRUA 3MQZA 2ARTA 3UDXA 4A3MG 1Q12A 1VQOA 2AHOB 2BH8A 1WCMG 3KF8B 4YRIA 4YRRA 2VS1A 1VQPA 5JJKA 1S40A 4JI8Q 1IZ6A 2ATWA 3FP9A 4HJ8A 4KHPL 4LF4Q 2ZR2A 2EJFA 4LVIA 4LFAQ 3CC2A 1CKNA 2WP8J 3MXNB 2K50A 3T1HQ 2OQKA 1VQFA 1D7QA 4HVCA 1G5IA 2ZGWA 2VUMG 4BY1G 2CJBA 3VBBA 3HFVA 4P75C 3HOUG 4CH4A 3J81i 3HXYA 1EYGA 1X01A 4A3IH 2D0OA 1J5WA 3RZOH 2UXBL 2Q2IA 4QQBX 3VQXA 3UDIA 2XGTA 3H3VI 1Z7MA 4DUZL 1GVPA 4CS2A 2QHUA 1MJCA 3RACA 1C7YA 2UUAL 4LF8Q 3S24A 3G4SA 2Q7HA 4JI0L 3R07A 4B3RL 2CJAA 3G1ZA 4YWLA 1YJWA 2KHJA 4H2VA 4IOCA 4ZTUB 3CAMA 2DQ0A 3V7RA 1KL9A 1YITA 3HOZH 3M4OH 4BA1I 5JEAG 1EIFA 1GM5A 4XU0A 1NMGA 1VQEA 11ASA 1K8AC 3CC4A 4BY1H 3V7CA 2BA0A 3K80C 2DU7A 4WJ4A 2C35B 4A3KH 1Z9FA 4HWPA 2DJZA 1KIXA 1X6OA 1FL0A 1KHIA 5C0XJ 2EJGA 3GTMH 4XTWA 4P74A 2PMZE 2E2HH 4C3HH 4GS3A 3A5ZA 4HJAA 1L2FA 4YRLA 2E64A 4UP8A 12ASA 3UE1A 3V8KA 3HKZE 2EIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CW2 C;  2CQO A;  2ZZG A;  1XMQ Q;  3CD6 A;  4E51 A;  2AKW B;  4JI1 L;  3EBE A;  4UY8 C;  2F4V Q;  2Q2H A;  2EXD A;  1HNZ L;  1IBM L;  2ZT6 A;  2F52 A;  1EIY B;  2I4N A;  4JBM A;  1QZG A;  3L1A A;  4ALP A;  3TS2 A;  4YRP A;  1YJN A;  1KXL A;  1PH3 A;  3HKS A;  3H0G G;  1BBU A;  2JK8 A;  4LUV A;  1CSP A;  1PV4 A;  3I7F A;  2UUC Q;  2I5M X;  5IT9 c;  4GKK Q;  4BBR H;  3MF1 A;  4OWX B;  3LGJ A;  5FLM G;  4KQE A;  3JC6 6;  4DR2 L;  4TWA A;  2ZXF A;  1VCI A;  1YNX A;  1Q7Y C;  2JEA I;  3TEH A;  3U4V A;  3PIP A;  2PI2 E;  4BXX H;  1XTD A;  5J3B A;  4IOA A;  4HWR A;  2E5L L;  1Q86 C;  1BVS A;  2DDZ A;  3J7Z C;  1WPY A;  2CIM A;  4A93 G;  1HNZ Q;  2ZNI A;  3NEN A;  2ES2 A;  4DR5 Q;  1YEZ A;  1TXY A;  5IWA L;  5C0X I;  3CCQ A;  3OW2 A;  3K7U C;  1YI2 A;  1B7Y B;  2UUB Q;  3A31 A;  1HTT A;  4LF6 L;  2VNU D;  4A3G G;  2B3G A;  4IJL A;  5GAE C;  4AYB G;  4LFA L;  4A3B G;  4YRM A;  5ELO A;  4YHH Q;  5LMU Q;  3M9B A;  4LF9 Q;  1Y1V H;  3BFM A;  3A7A A;  2HHH L;  4POG A;  5HGQ A;  3I4M H;  4XIG S;  3CMQ A;  4OP0 A;  2K52 A;  4OWW B;  2E2I H;  1VQC A;  2VY3 A;  3HOW G;  5C3E G;  4BBS G;  3RR5 A;  3S1R H;  1YHA A;  2PI2 A;  3BZK A;  2UUA Q;  3KFU A;  2YTX A;  1N33 L;  1MKH A;  1X55 A;  3L0O A;  5M5X H;  1HR0 Q;  1G51 A;  4DK3 C;  4JYA Q;  1SLJ A;  1XNR Q;  4XEO A;  2EAY A;  1NYR A;  4B3T Q;  3REX A;  3HOV H;  2K5N A;  5C4J H;  4DK6 C;  4DV0 Q;  1VQ5 A;  1WCM H;  4GNX B;  1NJ5 A;  4DUY L;  1USY C;  1LM0 A;  4HWS A;  1X56 A;  3HRK A;  1SRO A;  1MJE A;  3L2P A;  3VDY A;  4LF5 L;  2MO1 A;  3RIR A;  1N32 Q;  1VQI A;  2E65 A;  5IP9 G;  3J80 c;  3HY1 A;  4A3L H;  1XNQ L;  1K8G A;  5M3M G;  4DV5 L;  4MNO A;  2GVB A;  1FGU A;  2UUC L;  1PH8 A;  4YCV A;  4PZ7 A;  2A8V A;  4XTU A;  1N8R C;  4MZ9 A;  1G6P A;  2DTI A;  3NEL A;  1SMX A;  1VQG A;  2MNA A;  4UPA A;  3HOV G;  3HOX G;  1WI5 A;  5JEA J;  4GLA C;  4P74 C;  4YRJ A;  2JA8 G;  2E3C A;  2VL6 A;  4RQE A;  5M3M H;  4A3G H;  5GAH C;  2WFW A;  2Q7E A;  1TWG H;  2R7Z H;  2B29 A;  1H95 A;  3PO3 H;  2YYZ A;  4DR1 L;  2R7F A;  5AJ3 L;  2RHS B;  4JOI C;  2CWA A;  3HKZ G;  2ARS A;  1U0L A;  1KAW A;  2Z6K A;  1IBM Q;  1QUQ A;  5BR8 Q;  2K4K A;  3M3Y H;  4A3C G;  4X65 Q;  1WOC A;  4XTZ A;  4LNQ A;  2CKZ B;  5IY0 A;  3OTO Q;  5JJL A;  3PUV A;  1SN8 A;  1P16 A;  4QY7 A;  3V8L A;  2LXK A;  2JE6 I;  1Q46 A;  2NVT H;  3RKY A;  1HR0 L;  4XTX A;  4YRE A;  2G4C A;  2FYK A;  4NB3 A;  1VQM A;  2V1C C;  4DV4 Q;  1VQK A;  1BKB A;  2F4V L;  2JA7 G;  4OWT B;  5IYD H;  2IY5 B;  4RQF A;  4H02 A;  4LNS A;  1VQL A;  4JI5 Q;  1YFR A;  4L5Q A;  1J5E L;  1BBW A;  2JEB I;  2ZJQ A;  4CH6 A;  4A76 A;  3RLF A;  4A3E G;  1UWV A;  2OWO A;  2DZ9 A;  3UGT A;  4DV7 Q;  4LF7 L;  5C44 H;  4ZTZ B;  3LSS A;  4J15 A;  3PO2 G;  3KF6 B;  5FJ8 H;  4DV2 L;  3LSQ A;  1J5E Q;  1W2B A;  4PZ8 A;  1C0A A;  4K0K Q;  4IPC A;  3HXZ A;  4X6A H;  4H2U A;  1WYD A;  2DKG A;  1M1K C;  1TWC H;  1OXU A;  1HR0 W;  4DR3 L;  5IYD G;  4A75 A;  1K83 H;  1JJ2 A;  1YB3 A;  3RGL A;  2DUD A;  3PUZ A;  2VW9 A;  5C53 B;  4A3F G;  4GLV B;  2K5V A;  2J3L A;  3AQQ A;  4LFB Q;  4LUZ A;  3HFZ A;  2IHE A;  3GO5 A;  1WNL A;  1M90 C;  1E22 A;  1UE6 A;  2MFI A;  1G5H A;  1B70 A;  4YRC A;  2N78 A;  3S15 H;  2J3M A;  1WQ7 A;  3S14 H;  3A5Y A;  2YU9 H;  1L1O C;  4ME3 A;  1L0W A;  3CMA A;  3G6E A;  2ZIM A;  1ADJ A;  4TQF A;  2UXC Q;  5M5Y H;  1HNW L;  2CGH A;  1XPO A;  3VQY A;  4TQU S;  1V9P A;  3DLL A;  3M4P A;  5GRO A;  4KR3 A;  4JV5 Q;  1IXR A;  5LMN Q;  3RUX A;  2R92 G;  3CQZ H;  1WJJ A;  2E1H A;  1X3E A;  4XTY A;  3BZC A;  1NNH A;  3RLO A;  4JBW A;  2VUM H;  1ASY A;  2IT1 A;  4DV1 L;  4KR2 A;  1KD1 C;  4HIM A;  5FLX c;  3KJO A;  1PH4 A;  3P8V A;  3KYH C;  4Q15 A;  2ZTG A;  2P5I A;  3PUX A;  4LUO A;  1BIB A;  4DR6 Q;  4RDX A;  1NMF A;  4LF9 L;  4AH6 A;  3A5Z B;  1UEB A;  4LFC L;  4DV2 Q;  4Y7N H;  4PG3 A;  1XJV A;  3CCM A;  4YCU A;  4A3E H;  1L1O A;  2ZZF A;  3KOJ A;  4QL5 A;  3RKW A;  4XU3 A;  1N34 Q;  2PQA A;  3HRI A;  4X62 Q;  4DPG A;  1K3R A;  1JE5 A;  1H4S A;  3E9H A;  1PYS B;  2CFM A;  2PQA B;  1XPU A;  1E1O A;  3B6Y A;  1CUK A;  3HOZ G;  3K0X A;  5GQO A;  3F1Z A;  4RMF A;  1X65 A;  5KNN A;  1IBL Q;  3HXU A;  4AQY Q;  3I2Z A;  2E5L Q;  4CH3 A;  3PO3 G;  3FKI G;  4L5S A;  1N33 Q;  1Y14 B;  3F2D A;  4GN5 A;  3PV0 A;  3ERS X;  4YRN A;  4JG2 A;  4H2S A;  4DR2 Q;  4P73 A;  2JA6 H;  3GTP H;  4IJH A;  2UXD L;  1AE3 A;  4A3D H;  2DTO A;  3UFG A;  1B76 A;  3HTZ A;  1OXS C;  5JJI A;  5ELN A;  2Q2U A;  3M85 A;  4IPH A;  4IFD J;  5K1X A;  4NCX A;  3U58 A;  2NVY H;  2HT1 A;  1D8L A;  3HOX H;  1I94 Q;  1XPR A;  2JA7 H;  3IKM B;  1OXV A;  2D6F C;  1EFW A;  4GKJ Q;  4C3J H;  4GN4 B;  2E8G A;  3K81 C;  3PO2 H;  1W3S A;  4DAM A;  4BXX G;  2ZIO A;  3VQW A;  3CME A;  4B3S Q;  1JJC A;  4X66 Q;  3BJU A;  2QGQ A;  3HXV A;  1UE7 A;  4B3M Q;  4P3N A;  3KLW A;  4DV6 L;  2A19 A;  5IP7 H;  4WI1 A;  3PIO A;  4K0K L;  3CP0 A;  3IG2 A;  1IBK Q;  4DV5 Q;  1EQR A;  2I0Q A;  2KEN A;  1VQH A;  3F2B A;  2XTI A;  3M7N A;  3UDG A;  3CCL A;  4NXN Q;  2EJ9 A;  4DQ2 A;  1A8V A;  4AYB E;  5C0X G;  2YTV A;  4DR4 L;  4A93 H;  1EIY A;  4FDB A;  1Y1V G;  4JI5 L;  1N36 Q;  2ZCE A;  1NTG A;  1HJP A;  1CKN B;  1UE1 A;  3PF5 A;  4WJ3 M;  2R93 G;  5IYB H;  1YHB A;  2NVQ H;  2I5L X;  3J80 i;  4P73 C;  3HOY G;  2JA8 H;  3S17 H;  3RKX A;  1OTC A;  1YFS A;  1MIU A;  2Z6K C;  4A3C H;  4G84 A;  3GTQ H;  1FJG Q;  2HNI A;  2PME A;  3GTO H;  4DUY Q;  4JOI A;  3CCS A;  2RHQ B;  1NJ6 A;  4X65 L;  3A7U A;  3QO7 A;  3QNE A;  1S72 A;  4A3J H;  4C2M H;  1N9W A;  2F3I A;  4DR7 L;  2OTL A;  3T1H L;  1JJC B;  3EIV A;  4EQ5 A;  4DR5 L;  1B8A A;  3G71 A;  4YWM A;  4TVA B;  1GO3 E;  2WB1 E;  2ZT5 A;  3J81 c;  3CF5 A;  4KHP Q;  2P0L A;  1EOV A;  1VQB A;  1Q1B A;  2JJQ A;  3PCO B;  1FVI A;  3FHW A;  2UU9 Q;  3KF6 A;  4WF2 A;  3OD1 A;  3P8T A;  1FYF A;  2DEQ A;  1HZA A;  1YJ9 A;  2QA4 A;  4B3R Q;  4IO9 A;  4LF5 Q;  4B3S L;  2DXU A;  5IWA Q;  3I4M G;  2VQF L;  2I4O A;  1T9H A;  4APV A;  5HY6 A;  3VQV A;  3E9I A;  2R7D A;  4Q6G A;  4GOP B;  5E3I A;  3GTK H;  3CCE A;  3S1N H;  4OO1 I;  4IPD A;  2AMC B;  4YY3 Q;  1YFT A;  2R7Z G;  4JI6 Q;  4DR7 Q;  4JI4 L;  4H2T A;  4GLX A;  4YRO A;  4YYE A;  1J6Q A;  4A4I A;  4QGU A;  1H4T A;  3EFS A;  4YY3 L;  4OX9 L;  3PF4 A;  2OQ0 A;  2YV5 A;  4DV6 Q;  4AIM A;  1K0R A;  1PYS A;  3I55 A;  1QVG A;  4LFB L;  1PVO A;  4JBK A;  5C4X H;  1HC7 A;  3UH0 A;  3CPW A;  4H2Y A;  1V43 A;  4A3D G;  3A0J A;  3WWV A;  4XU2 A;  1EVK A;  3P8Y A;  4A3L G;  3NBH B;  4HIO A;  4TQD A;  1QF6 A;  4OON A;  2CJ9 A;  2VQE L;  3TRZ A;  3HY0 A;  3F2C A;  2JQO A;  1W66 A;  3OYY A;  3M4Q A;  4X64 Q;  4TVY A;  2Q5I A;  1X2G A;  4PMW A;  2Q7G A;  2IX1 A;  3RZD H;  3DSQ A;  2I4M A;  4Y52 H;  2Q2T A;  2N8N A;  3K7A H;  2ALY B;  3W1G A;  5IP7 G;  1LYL A;  3MF2 A;  2IHF A;  4NXM L;  4LWC A;  2K14 A;  3D31 A;  2BA1 A;  1KOG A;  2I4L A;  1PHJ A;  3GTG H;  5E7N A;  1IL2 A;  5K1P A;  1PYB A;  3S1M H;  5IP9 H;  4A3K G;  2E5A A;  2KCT A;  3PCO A;  3S2H H;  2E41 A;  5F5W A;  4TTV A;  3S16 H;  2NN6 G;  4QJF A;  4G85 A;  3QO5 A;  1E1T A;  5IYC H;  2ZR3 A;  3GTJ H;  4BWA A;  4P75 A;  1NJ1 A;  4YP0 A;  2HHH Q;  4DNI A;  4R1J A;  2ZTD A;  2ZJR A;  4KHZ A;  4NXM Q;  2EQS A;  1SER A;  1EQQ A;  2ZT7 A;  5IYB G;  1XMO Q;  1PH9 A;  1VQJ A;  2Z0S A;  1SR3 A;  5DLQ E;  2R6G A;  4K88 A;  2NZO A;  4CS4 A;  1B7Y A;  4R4Q A;  1HNW Q;  2OTJ A;  1QZH A;  2EL9 A;  1VQ8 A;  3UDF A;  4YWK A;  1BIA A;  3JAM i;  2UXC L;  1FJG L;  2D62 A;  1LTL A;  1WQW A;  3NEM A;  2C8M A;  3A7R A;  1JT8 A;  4YRS A;  2JA6 G;  3H15 A;  1NJ8 A;  4CH5 A;  3I4O A;  4EX5 A;  4LF7 Q;  3F8T A;  4BY7 H;  4XU1 A;  1Q1E A;  2E2J H;  3RF1 A;  4HJ7 A;  1KRS A;  4HIK A;  3SGI A;  1HZB A;  3ULP A;  2ZTC A;  4TVA A;  5M5W H;  2KBN A;  3PSI A;  2UU9 L;  3D0F A;  1KRT A;  3UGQ A;  2VQE Q;  4DV0 L;  1I94 L;  1I50 H;  4NPS A;  2WAQ E;  4JI0 Q;  1JJG A;  4HA8 A;  4DV1 Q;  3FJP A;  4KI0 A;  1YZ6 A;  4LF8 L;  4DAY B;  1VQZ A;  1N32 L;  3CC7 A;  3HXW A;  3CCV A;  4DUZ Q;  1XMO L;  3GD7 A;  4DV7 L;  3TEG A;  1NJ2 A;  2AKW A;  4IFD G;  4R4C A;  1HZC A;  2HIV A;  1WLE A;  5IE8 A;  1H4V B;  3REU A;  4P71 C;  2ZM6 Q;  3HOY H;  4UP9 A;  1TWF H;  4P3O A;  2PNH A;  2QHS A;  1IBL L;  4IPG A;  5LMN W;  1NE3 A;  1YVC A;  4JI2 Q;  3K8A A;  1QVF A;  4P3P A;  4DV4 L;  2PMF A;  4JI4 Q;  1ADY A;  3H3V H;  4JI6 L;  3H0G H;  4CS3 A;  1RL2 A;  1VQ4 A;  1K73 C;  2E10 A;  1ATI A;  4C3I H;  4YCW A;  1E3P A;  1EWI A;  1PH2 A;  2ZJP A;  3ERR A;  2DGY A;  2BH2 A;  4X64 L;  4LFC Q;  5C51 B;  1WFQ A;  1NY4 A;  3CCR A;  4HWT A;  4LW1 A;  1GD7 A;  2UUB L;  5FLM H;  3ULJ A;  3CPF A;  3E0E A;  2NN6 I;  1Z47 A;  1KQS A;  4RG1 A;  3PUY A;  4BW9 A;  3V7S A;  4H2W A;  3AYH B;  4JC0 A;  2FXQ A;  4JI7 Q;  1CKM A;  2Q5H A;  1V1Q A;  1B70 B;  2C7I A;  4YRK A;  1KC8 C;  3EN2 A;  3I4N H;  2ODR D;  4YDQ A;  2K75 A;  4JI7 L;  4OX9 Q;  4ZIB A;  2R92 H;  2EWN A;  3CCU A;  1VQN A;  4YRT A;  1C9O A;  3PGZ A;  2ASB A;  1XNQ Q;  1O7I A;  3OTO L;  2AWN A;  1GGM A;  2JA9 A;  3RN2 A;  1VS0 A;  2DTH A;  4X66 L;  2RF4 A;  4BY7 G;  5BR8 L;  3ICE A;  4LF4 L;  4YRG A;  1CKO A;  4A3M H;  2ZNJ A;  4R4T A;  1SFO H;  4K86 A;  4B3T L;  3RL6 A;  4P72 C;  4JYA L;  4DR1 Q;  3TQY A;  1VQ9 A;  1SRY A;  2MQH A;  3W1B A;  4HWO A;  4UP7 A;  1I3Q H;  1HNX L;  3MEY