4AHSA

Parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
154
structure length
150
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Parallel Screening of Low Molecular Weight Fragment Libraries: Do Differences in Methodology Affect Hit Identification?
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
molecule keywords INTEGRASE
total genus 60
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ahsA00
3B6OA 2E4LA 1HNVA 3OVNA 5C42A 4HUGA 4DTOA 1L3SA 4CGJA 2D5RA 4CHZA 2WONA 4FJ8A 4O5BA 1TAUA 5FDLA 4W5NA 4CGDA 5FROA 2Z1GA 3AA2A 3CFRA 4FJMA 3ZSXA 2ZE2A 3NCIA 4FZYA 2YNFA 2RN2A 3LP2A 4CEOA 5CYMA 1NK6A 3C6TA 2PYLA 1D9FA 4FK4A 3DLEA 3VQBA 3TAPA 1KLNA 1JLCA 4CCHA 5FRNA 1S5JA 4ELVA 3CM5A 4CJEA 3MXMA 4B8CA 3CM6A 2IAJA 5JS1A 4LY7A 4BACA 3OS2A 3VA0A 1GOBA 4KO0A 4Q5VA 3LWMA 3VA3A 4LH5A 4DLEA 2G8FA 3DRSA 3L3UA 1DLOA 3O4NA 5CZ2A 4CEFA 1RT6A 4CGIA 3OYJA 1JLBA 1T05A 2F8TA 4NCGA 2B4JA 4DQIA 4NCBA 3ZT0A 1C1BA 1VSKA 2BE2A 4DSIA 1RBRA 1X9SA 5EU7A 3NE6A 1RTIA 1NOZA 4RW7A 2ZD1A 3ULDA 3RMBA 2JGUA 4YFUA 2QXFA 3OYHA 3TARA 1SL1A 4DTPA 3K5MA 3DLGA 4FM0A 3TR8A 4KRFA 4DTJA 2NUBA 3AVAA 4OPJA 1LV5A 4O4GA 1HPZA 4KHQA 1DTQA 2BANA 3WNHA 4CGGA 2ETJA 4AHSA 4W5RA 4HUFA 1LW2A 3U3YA 4B9NA 3PX0A 4W5TA 5JS2A 2EHGA 3KK1A 2X6NA 1R0AA 2D0CA 3NF8A 1BCOA 4ICLA 3K5LA 1JLFA 2Z1JA 1NK7A 4HTUA 4ELTA 3NH0A 4W5OA 3HYFA 3KLFA 1KFDA 3EY1A 3TI0A 3TAMA 4PQUA 1S1VA 3AVFA 2VWJA 3MECA 1C6VA 3QNOA 1JLQA 2DTUA 5I42A 4DU1A 4M41A 2G8HA 3S9HA 4MQ3A 1S1XA 1BISA 4FZZA 3TAGA 4FJIA 2Z1IA 4OGCA 3SV4A 1WAJA 4DQRA 1RT3A 3LALA 3OYMA 1HQEA 3OJSA 1SL0A 4L8RB 5HRSA 4PA1A 3LDSA 1LWEA 4M3RA 3S3NA 4FK0A 4JS5A 3QLHA 3KLEA 4C8KA 4CK1A 3LP3A 3IS9A 3AO2A 4FW2A 4CEZA 2KW4A 3T1AA 4FJGA 1NJWA 3AO1A 4ZTFA 4DFMA 1L3TA 1TK8A 4IG3A 4CEBA 1RDAA 1HYVA 4KKOA 3KJVA 2HNZA 4DS4A 1HYSA 1GOAA 1REVA 3K2PA 1DTTA 1ZBFA 3JSMA 3D0PA 3KLHA 1TKZA 1FKOA 3DM2A 3SUQA 4DG1A 5C25A 2PY5A 3DOKA 4CJTA 2Z1HA 3V6DA 1QSLA 4M3WA 1U48A 2HMIA 1JL1A 4CJWA 1CZBA 2FBXA 3ISNC 1RILA 1T8EA 4F4KA 1NKEA 3V9WA 2YHBA 4B9SA 1ASVA 1B9FA 2E6LA 5DMRA 3RRHA 4FJ5A 1U4BA 4LSNA 4FJXA 2ITGA 1BIUA 1NOYA 1JLAA 1UA1A 4J2BA 3ZT2A 2P51A 3OYNA 3OYAA 2KTQA 2KFZA 3C94A 3SYZA 1IKVA 3I8DA 3EYZA 1NJZA 1N5YA 2IGIA 5J2QA 3AO3A 4CF8A 4CESA 3L2QA 4E19A 3L2VA 5HRRA 4OLBA 1KFSA 3T19A 4CF0A 1J54A 4CECA 3LP1A 4UQGA 3OYKA 1VSHA 1NK8A 4GVMA 3AV9A 1RDDA 4I7FA 1YTUA 1KRPA 2OPQA 4M3TA 2XRIA 5KI6A 3KIOA 1VSMA 3NF7A 3L2RA 3HSTB 1D8YA 2OA8A 1Q8IA 4BWMA 4M45A 1TKDA 3M8PA 4LH4A 3HPGA 2HHSA 4RG8A 1ITGA 4ELUA 1BQMA 1C1AA 3LAKA 4CJ3A 4CFBA 4XIUA 4M3YA 4CHOA 3LAMA 4EZ9A 4G1QA 2HHUA 3AVGA 3M8QA 1TGOA 4DSFA 4DS5A 4DF4A 4FXDA 1C1CA 2FBVA 4CIFA 2KQ2A 3K5NA 4IG0A 3NGIA 2HHXA 1LWCA 1RBUA 3AVNA 4E7JA 4FLWA 1RBTA 3VQ6A 5KTQA 4FJNA 3SNNA 3G10A 1L3UA 2X74A 4KTZA 1HMVA 1RCHA 3OS0A 1BIZA 4CEAA 4BDPA 3RR7A 4FLYA 4JLHA 3AVBA 4DFKA 5K14A 3NGZA 3SUOA 2P5GA 3WNEA 1VSIA 1EKEA 4BE1A 3DRRA 4FK2A 3O4QA 4EZ6A 4FM1A 4ID1A 2DY4A 5DK5A 1IKXA 1JXBA 4O44A 4RW4A 4BDYA 2QKBA 1QSYA 3KD5E 4FM2A 1HYZA 3S3OA 3VQEA 4FLZA 4CGFA 4CHPA 2G8IA 3E01A 4CJSA 4M3ZA 5HLFA 1BI4B 3HXMA 2I5JA 3D45A 3THVA 1FXXA 4B9TA 4FLUA 4B9LA 1LW0A 5HBMA 4CHQA 4E7IA 3SCXA 1BQNA 4CEDA 3QNNA 1L3VA 3UIQA 3SUPA 3V9SA 4CJRA 1BCMA 3OJUA 1ASUA 1WSIA 5I3UA 1QHTA 1VRTA 4JRQA 3LWLA 3NDKA 2HNDA 4B9VA 2RPIA 1BI4A 1JLGA 2IOCA 1SL2A 4KREA 3HPOA 2P5OA 2E6MA 1XHZA 3WNGA 4R5PA 1KVBA 4FW1A 2OZSA 2BGGA 4DTSA 1RNHA 3LP0A 1S9EA 1JL2A 1TV6A 4YNQA 4RW9A 1G15A 4CJKA 1TL3A 2AJQA 4DTNA 1S1WA 1I3AA 3SJJA 4DU3A 1TK5A 1VSFA 4CJFA 3V4IA 1O1WA 5D3GA 2LSNA 3QEWA 3V1OA 3SPYA 1NKBA 3ZT4A 4E3SA 4HVJA 3HP6A 1J5OA 4H4MA 4E7KA 1UWBA 4F3TA 1WSEA 2Q3SA 3ZT1A 3PY8A 2B6AA 1RT2A 4Z4CA 5CY4A 4M3UA 2VG5A 1RT1A 3HVTA 3V1RA 3RMCA 3KD1E 4CF2A 3L2UA 4KHYA 2X6SA 4Y1CA 5T7BA 3C6UA 1RBVA 4E0DA 3CYMA 3VQDA 4OJRA 4CJUA 3RTVA 4DQSA 3K58A 2O4IA 4DQQA 1VK0A 1TVRA 4Z0UA 1RTDA 4F2RA 3DLKA 4J2EA 2F8SA 5J1EA 3NF6A 3AVKA 4I9LA 4OGEA 1X9WA 4PY5A 3KKRA 3VQAA 1IH7A 4DFJA 1NK9A 2KZZA 1EP4A 3SQ2A 3ZSWA 3OYDA 3PO4A 4ZHRA 1A5VA 1IG9A 1K6YA 3MXJA 5SZTA 4NYFA 4PWDA 3ZT3A 5J2PA 1S1UA 3DOLA 4KHNA 1IO2A 1SKSA 1NKCA 4FLTA 3AVMA 1KVAA 4DSLA 4HCBA 4FYDA 1RTJA 2HNYA 2YKNA 3SZ2A 3K59A 1FK9A 3M8RA 4CEQA 3A2FA 4C8MA 2YNHA 4DFPA 3QEPA 3TANA 4E7LA 3DLHA 3SQ4A 1UA0A 1LWFA 1NJYA 4FZXC 4KAZA 3AA5X 3LZJA 1BL3A 3F73A 1Y97A 4TSXA 4W5QA 1LAWA 4DF8A 4KTWA 1QQCA 3ZCMA 4Q0BA 5SWMA 3V9ZA 2P1JA 3VQQA 3RRGA 3VQ8A 3HPHA 2GBZA 2YNIA 2QKKA 3PO5A 2HVHA 1QTMA 1C0TA 4KB1A 4B9MA 1VSJA 1WLJA 4FJHA 1ZBUA 2HB5A 2OPSA 4OKEA 1VRUA 4AHRA 3U6FA 2HW3A 4DTUA 4H8KA 2IDOA 4CJVA 2PYJA 3QEXA 1U47A 3U3GA 4FJKA 1A5WA 3BDPA 3TAFA 1S6PA 3AVCA 3EZ5A 2WOMA 4JS4A 2BDPA 3IAYA 3CQ8A 4OLAA 3OYEA 4CHNA 3SPZA 3P83D 2OPRA 3ITHA 4N47A 4NCAA 1NK0A 4C8NA 3MAQA 2FBTA 4I2PA 1FKPA 1YVUA 1KCFA 4DMNA 3O3GA 5KRTA 4F3OA 4C8LA 4HUEA 1QS4A 3I0SA 3VQ4A 3PV8A 1S9GA 1UAXA 1JLEA 1QSSA 4B08A 3V9UA 4KHUA 2RKIA 3KKSA 3VQ7A 2YNGA 5HP1A 4O0JA 4PUOA 3HP9A 4FVMA 1Q9YA 4K8ZA 4CK3A 3QEVA 2D0AA 1U49A 3HO1A 4O55A 3L3VA 4E1NA 3CFPA 4CGHA 2XY7A 3PX4A 3QO9A 3RWUA 4J2AA 3V1QA 4BDZA 3ZSQA 2W42A 2ZQBA 1ZBLA 4Y1DA 4CF1A 1B92A 2B5JA 3ASMA 2XY6A 3AA3A 4M3XA 2VG7A 3JYTA 4Z4FA 2FC0A 1HQUA 4AHCA 4CIEA 3K57A 5J2MA 1SKWA 3RR8A 1ZBHA 3PUFA 2XY8A 1U45A 4BE0A 1VSLA 3AA4A 4CEEA 4DTMA 2HHTA 1WSFA 4AH9A 5HRPA 3OS1A 5J2NA 1CXQA 2G8KA 1TKTA 2KZMA 4CERA 4HHTA 1U04A 1EETA 3SUNA 1RBSA 4BE2A 3TAQA 1XC9A 3AO4A 4DSKA 3RMAA 4N41A 4KV8A 2XO7A 4KB0A 4LSLA 3QERA 1D9DA 3QIPA 4KFBA 1EXQA 1A5XA 3PX6A 3MEGA 4CK2A 1T03A 1J9AA 2X78A 1SKRA 3VN5A 3FFIA 4O0IA 3KLGA 3TAEA 1RT5A 1KTQA 4LD0A 2A1SA 4AILC 3ALYA 1NJXA 3NFAA 1RT4A 4Z4HA 4AHTA 3SQ0A 3DLBA 3ZSYA 4OKKA 4KHSA 3DRPA 2RF2A 4E89A 2IS3A 3NHGA 4CJQA 1C0UA 3LPTA 4CFCA 1WN7A 3NH2A 3OYGA 1MU2A 2D0BA 1XI1A 4B9UA 4B3OA 3F9KA 1YT3A 5KGWA 3DMJA 3TABA 3V9XA 3OYFA 1ASWA 3KLIA 5CZ1A 4DQPA 4M42A 1Q9XA 1HNIA 1CXUA 3HT3A 1RT7A 4B8AB 1F21A 4IKFA 4FJ9A 4RW6A 1WSGA 1SV5A 3AVLA 4AHVA 3O3FA 3TWHA 4QCLA 1VSEA 1ZBIA 2GUIA 3KTQA 1GOCA 1B9DA 1TK0A 5FRMA 1TL1A 3P1GA 3VQCA 4E7HA 3T3FA 4CJ5A 2VWKA 3OYBA 3HJFA 2VG6A 4BWJA 3QESA 2Y1IA 3MEEA 3K5OA 3ZSRA 3SQ1A 5CYQA 1N6QA 3NBPA 3AVJA 4DTRA 1L5UA 3ZSZA 2OYQA 4FJ7A 1RDBA 4FCYA 1KVCA 4Z4EA 2KFNA 1UOCA 1YTAA 4CJLA 4CF9A 3KK2A 1X9MA 1T7PA 3LANA 4KPYA 3AVHA 4F8RA 3NGYA 3I0RA 3AO5A 1X1PA 4JRPA 4Z4IA 1VSDA 4DU4A 3OYCA 2HHVA 1LAVA 4CJ4A 2OPPA 4H4OA 4CFAA 3P5JA 3BGRA 3ZSVA 4FLVA 2A1RA 1XWLA 1WSHA 4CHYA 1KLMA 4DSEA 4K8XA 4IBNA 1WSJA 4KTQA 2YV0X 4MFBA 3DI6A 3G0ZA 2HHQA 1D5AA 5HROA 1EX4A 3VQ9A 3QINA 3OY9A 4NYNA 2PZSA 5KGXA 1KSPA 3HK2A 2Y1JA 2OZMA 3WNFA 3NAEA 3MEDA 1NK4A 2YKMA 4KI6A 1HJRA 2IC3A 2HVIA 4KHWA 1JXEA 2FBYA 2EX3A 3KK3A 3H08A 4Z4GA 3AVIA 1QE1A 3C95A 4N56A 4N5SA 3HM9A 4C8OA 4CIGA 2O4GA 2G8UA 2G8VA 4QAGA 3DLRA 2YHAA 4DSJA 1ZYQA 2DFHA 1C0MA 4CJPA 1NK5A 3CFOA 2G8WA 4EP5A 2DFFA 2R7YA 4ID5A 4CE9A 4DWIA 1IKYA 1W9HA 3DYAA 5C24A 1HRHA 4IDKA 2XHBA 4FJLA 4IFVA 3CG7A 1RTHA 2GV9A 4J2DA 4N76A 3NF9A 4F2SA 1CZ9A 1JKHA 4CFDA 3SV3A 3HVRA 4ZTJA 1S1TA 3B6PA 3IRXA 4AHUA 4HCCA 4FJJA 1I39A 1WAFA 3LPUA 1TAQA 3M8SA 3VQ5A 5HRNA 2DFEA 1SUQA 1RDCA 1BGXT 1Z25A 4OVLA 2JLEA 4RW8A 3L2WA 1W0HA 1XHXA 5E41A 3NH1A 1BHLA 3OYLA 3IG1A 2HHWA 3RMDA 1J53A 4WE1A 4DTXA 3V81A 3LZIA 4IFYA 1WNSA 4OPKA 3O3HA 4GW6A 4I2QA 2F96A 1S6QA 1IKWA 4E1MA 4FLXA 3QEIA 4QOZB 4OKJA 3ZSOA 5KRSA 2XY5A 3VQPA 1Z26A 3QIOA 1CLQA 3HL8A 2QK9A 3SI6A 3MXIA 4GMJB 3OYIA 3L8BA 3S3MA 4I9QA 2ATQA 4EP4A 1TKXA 4DLGA 4KI4A 3QETA
chains in the Genus database with same CATH superfamily
3CCJN 4YORA 1Q81O 2Z1GA 3AA2A 3ZSXA 2A41A 4PHTX 3LP2A 4DR2K 4A2AA 5CYMA 4CCHA 3A5OC 3MXMA 1GLDG 2IAJA 3M6GA 3ZLJA 1SZ2A 3OS2A 3TSQA 1GOBA 4KO0A 1GLFO 3ZX0A 4Q5VA 3VA0A 1VQPN 5CZ2A 1DLOA 3D7EO 1QQMA 3VPZA 3Q7CA 4DQIA 3U8XA 3DAWA 3F2KA 1VQ4N 3R3LA 2J4RA 5AQSA 3VERA 3ULDA 3MN9A 4AM6A 4DTPA 4FM0A 3TR8A 4DTJA 5AQQA 4OPJA 4BRHA 1LV5A 3CCRN 4O4GA 2O8FB 1RFQA 2OCEA 4B3RK 1LW2A 3U3YA 4W5TA 2QA4N 1R0AA 1MWMA 1NK7A 1ILYA 4W5OA 3KLFA 4DUZK 2ZF5O 3AVFA 2VWJA 5I42A 3C6AA 2BUPA 3TAGA 3OYMA 3OJSA 1SL0A 1LWEA 3S3NA 3HBTA 4C8KA 4CK1A 2KW4A 3T1AA 1N8RO 1TK8A 3H46O 1RDAA 1NJIO 1HYVA 3DXMA 3K2PA 3JSMA 2O8DB 5EOYA 3I33A 1TKZA 2A3ZA 3DM2A 3SUQA 4DG1A 2NZTA 2Z1HA 3CQYA 4JKFA 1P8ZA 4CJWA 4JD2B 5AQUA 2YHBA 3P39A 3K0SA 3RRHA 4FJ5A 4FJXA 2ITGA 1JLAA 4V19S 3HTVA 3OYNA 3OYAA 4BRNA 3SYZA 1IKVA 1X3NA 3MN7A 5AZJB 4CESA 3S41A 1KFSA 4FL9A 5FPNA 3H3OB 2HBKA 5AQKA 4M3TA 3O9TA 5KI6A 5F1XA 3NF7A 3L2RA 1E4FT 3HPGA 2HHSA 1ITGA 4NLBA 4ELUA 1C1AA 4BR4A 4M3YA 3LAMA 3WQTA 4EZ9A 4G1QA 2A40A 3CMEN 4DSFA 4DS5A 4CD3A 1LWCA 3MMVA 4FJNA 3OS0A 1HMVA 2YJFA 3RR7A 1BWFO 4H0XB 3WNEA 4JKEA 5IWAK 4BE1A 3O4QA 4EZ6A 3O9RA 5EY4A 4A59A 5DK5A 1IKXA 5FLXO 2QKBA 4YY3K 3E9OA 3S3OA 2GUPA 2P9KB 3UKRA 5EX5A 1XNQK 1SAZA 2I5JA 2P9LB 3THVA 4AF1A 4EAHD 4FLUA 4B9TA 1WBBA 1LW0A 1BQNA 4CEDA 3UIQA 1KAXA 3V9SA 4CJRA 4B9VA 4U7BA 1SL2A 4DV3K 3HPOA 2VGNA 1XHZA 3WNGA 3W0LA 4FW1A 3LM9A 3CPWM 1JL2A 1XC3A 2P9IB 1I3AA 1XMOK 1VSFA 5D3GA 5C15A 4H5VA 3SPYA 1NKBA 4HVJA 2GX9A 4E7KA 3PY8A 3CIPA 2FLOA 1KAYA 5CY4A 2VG5A 3LM2A 2QI2A 2P9UB 4NXNK 4IJAA 1YJWN 3L2UA 1IJJA 2X6SA 1RBVA 3QFPA 3VQDA 5LL6Z 4BGBA 4DQSA 4WFAL 3K58A 4DQQA 1RTDA 3DLKA 4J2EA 5AQOA 2VYPA 4OGEA 1W7AA 1X9WA 4FWKA 1EP4A 3PO4A 3ID6A 3MX2A 1LOTB 4FLTA 4CZGA 3K59A 3M8RA 3A2FA 3QEPA 2YNHA 3VEVA 3DLHA 3G6EN 4FZXC 4KAZA 3LZJA 1ZBSA 4O5FA 3V9ZA 3GDQA 3FFKB 3VQQA 1RDUA 3RRGA 2GBZA 4KB1A 1C0TA 3CJCA 1VSJA 2OPSA 3L4IA 3U6FA 4LF7K 4ISFA 2HW3A 3D2FB 3PIOL 1A5WA 4X66K 2ZM6K 3BZCA 4YOXA 3IAYA 4OLAA 3CQ8A 3OYEA 3ITHA 4NCAA 1FKPA 2D4WA 1KCFA 5AQZA 2O8CB 1QS4A 3VQ4A 3J8AA 3PV8A 4GV6A 4BRGA 4B08A 2RKIA 3VQ7A 1VQ5N 4PUOA 4FVMA 4CK3A 3L3VA 3T69A 4WQ5A 4JI0K 3ZSQA 4DV5K 1ZBLA 5BRFA 3QBWA 2QWMA 4LFAK 5JMVA 3K9KA 5KQDA 2OTLN 2XY6A 3U9DA 1BA0A 4A61A 4AHCA 3K57A 2OANA 1SKWA 3PUFA 3P38A 4CERA 2QWOA 1RBSA 4BR7A 4KV8A 1DGKN 3WXIA 3PX6A 3C0BA 3D6RA 4BG9A 3KLGA 4WQ4A 4O0IA 3TAEA 1RT5A 5BPMA 1NJXA 3SQ0A 3ZSYA 4KHSA 3J80O 2RF2A 3NHGA 1C0UA 3OYGA 1WN7A 4BRFA 1MU2A 2CGKA 1VQNN 2JWLA 3TABA 1ASWA 4NXMK 4IOCL 3KLIA 5CZ1A 2QWPA 1Q9XA 1RT7A 4DB3A 2YHXA 2UXBK 4FJ9A 1KAZA 4RW6A 4AHVA 3TWHA 1TK0A 3A8YA 5FRMA 1TL1A 5ADXA 3ENBA 4XH1A 1KQSM 2QWRA 5AZJA 4E7HA 3T3FA 3OYBA 4IDHA 3QESA 3MEEA 5CYQA 2HOEA 3NBPA 4FJ7A 4BC4A 1TUUA 4FCYA 4Z4EA 2YCHA 2KFNA 4CJLA 1YTAA 2PAVA 4CF9A 5GAGP 4WQ4C 5AQNA 4KPYA 3DXMB 3I0RA 4Z4IA 3EZWA 3VGMA 4CFAA 2A1RA 3BGRA 1TYQB 3SMPA 1WSJA 3EO3A 2E2NA 4JNEA 4BC5A 1D5AA 5KGXA 2NLXA 4BRQA 5BN9A 3MEDA 2VQEK 4KI6A 4KHWA 3KK3A 3IMXA 4N56A 2G8UA 3CHWA 2E8AA 3A5MC 4QAGA 1ZYQA 4IJNA 4CJPA 1NK5A 4C23A 2ZGYA 5ELZA 4EP5A 5C24A 4FJLA 4IDKA 5AZIB 1Q82O 3EL2A 4N76A 4F2SA 1CZ9A 2E2PA 4WFNL 3SV3A 4CW7B 4AHUA 3THXB 4IEEA 3VTHA 3LPUA 5CHIA 4IO8A 2DFEA 3NH1A 3RMDA 1J53A 3VMFB 3O3HA 4I2QA 5AQVA 1IKWA 4FLXA 4OKJA 2KHOA 5KRSA 1YUWA 3MXIA 3S3MA 4RWTA 5C2FA 2UXDK 4HUGA 4DTOA 4CHZA 1P90A 4W5NA 1RGIA 3IFRA 4CGDA 3CFRA 4FJMA 4CEOA 1NK6A 3C6TA 1D9FA 1ZXOA 1JLCA 4CJEA 4B8CA 1YHQN 3O9QA 5JS1A 4B1XB 4JKAA 1ESVA 4CEFA 1Z6RA 4CGIA 3OYJA 1T05A 4NCBA 3ZT0A 3CCMN 2BE2A 5TKWA 2VCPA 5AQRA 1X9SA 4LFBK 4G9ZA 3O8MA 2JGUA 4CZEA 3OYHA 4BRLA 3ULEB 2NUBA 4A2BA 1YXQA 2NRHA 1HPZA 4KHQA 2BANA 2ETJA 5MLCQ 1MDUB 4K41A 2ZJPL 3KK1A 4LF9K 2IIRA 4H0TB 4ICLA 1JLFA 2Z1JA 3NH0A 3HYFA 1M1KO 3EY1A 1HJOA 3TAMA 3B8AX 1C6VA 3QNOA 1JLQA 4O8KA 4M41A 3S9HA 3O4WA 1S1XA 4FZZA 3SV4A 1ATRA 1YITN 1RT3A 2HBJA 4L8RB 5HRSA 4M3RA 3TPQA 4JS5A 2ASOA 1KD1O 4K25A 3IS9A 1K8KA 1NJWA 3AO1A 4DFMA 5E26A 1L3TA 1Q18A 4CEBA 2HNZA 1HYSA 1V4SA 4X64K 1GOAA 1DTTA 1ZBFA 3D0PA 4DR1K 3KLHA 1OH8A 5BN8A 2PY5A 3V6DA 1QSLA 1QHAA 3FZKA 1U48A 3F9MA 1CZBA 1RILA 2YJEA 2NRWA 1T8EA 3CCQN 3V9WA 1ASVA 5DMRA 3WEEB 4H0YB 1NOYA 4FWOA 2FSNA 3FZLA 4RTFD 1UA1A 4J2BA 2P9NA 1Q7YO 2KTQA 4H03B 3CCLN 2KFZA 3EYZA 4HTLA 1N5YA 3G25A 5J2QA 4MDAA 4E19A 5HRRA 5LJVA 4OLBA 3IUCA 3T19A 4CF0A 5DM7L 1GLBG 3SBGA 2CH5A 4CECA 1YJNN 2ZJRL 1VSHA 1GLJO 4GVMA 2NRZA 3AV9A 1RDDA 1YTUA 3VEYA 5AZIA 2XRIA 1YVNA 2ASPA 1K73O 3RVCA 3HSTB 2OA8A 1Q8IA 4BWMA 2V51B 1TKDA 3VF6A 3M8PA 1OH7A 4NB4A 3H3NO 3LAKA 4XIUA 3T7ZA 3VEXA 5GINA 3C7NB 1OH6A 1TGOA 4FXDA 3M3ZA 4BRKA 2D1KA 2O8DA 4YOYA 2KQ2A 2HHXA 4IG0A 3WUHA 3NGIA 2Q31A 1RBUA 4E7JA 4JI6K 2HBLA 3VQ6A 1L3UA 2EWSA 1BIZA 4BDPA 1BUPA 4FLYA 3AVBA 3SUOA 4FWLA 4WYBA 3DRRA 4B1WB 4DUYK 4BDYA 4RW4A 2F9TA 2P9UA 3KD5E 3O08A 4F9OA 1QQOA 4CGFA 2G8IA 2FSKA 4M3ZA 3HXMA 3EKUA 4LF8K 2NRXA 5JLHA 1FXXA 3HZ6A 1IBLK 1L3VA 3VOVA 3OJUA 4JRQA 3LWLA 3NDKA 4DR5K 1TYQA 3SAFA 4EFHA 2P5OA 2E6MA 4R5PA 5HL7L 2BGGA 2OZSA 1O13A 1TV6A 3UB5A 4NLCA 4RW9A 4JEPA 1TL3A 3CCVN 1S1WA 3SJJA 5AQWA 4JK9A 1MA9B 4L3QA 4E3SA 1NGEA 3UKRB 1WSEA 3C6HA 1NGHA 2B6AA 5F0XA 4M3UA 3MCAB 3RMCA 4E0DA 3EE9A 4JKDA 3CYMA 4YOWA 4CJUA 2O4IA 4F2RA 3AAPA 5J1EA 3G4SN 3NF6A 3C65A 1XUPO 3HRGA 3KKRA 4PY5A 1IH7A 1Q86O 1NK9A 3OHRA 3OYDA 4ZHRA 1XNRK 3H1VX 1IG9A 1K6YA 4B3MK 1T6DA 4NYFA 5C10A 5KPTA 4PWDA 1S1UA 3DOLA 3THWB 4KHNA 1IO2A 3CI5A 1NKCA 1KVAA 4DSLA 5M1QA 4FYDA 2YKNA 4IFEA 1FK9A 4C8MA 1OVYA 3I8BA 1NJYA 3AA5X 4CZJA 2OTJN 1Y97A 4DF8A 4GV3A 3ZX2A 4Q0BA 4JI2K 2WUSA 2FF6A 4JKGA 3VQ8A 2YNIA 3THYA 4AHRA 1T6CA 4CJVA 4BQLA 1U47A 3U3GA 3TAFA 2BDPA 5JVGL 2E1ZA 3P83D 2OPRA 2KKZA 1J5EK 2FBTA 1D4XA 1YVUA 3O3GA 2NNWA 4HUEA 3BY5A 3NMUA 1HKCA 1S9GA 3H6EA 1QSSA 3V9UA 3AGKA 3ULEA 3VGKA 3HP9A 3J81O 3QEVA 1U49A 1KC8O 4O55A 3PX4A 3RWUA 4DCHA 3DLLL 4BDZA 2W42A 4JI8K 1IV0A 4KH5A 4M63C 1B92A 2B5JA 4Z4FA 2FC0A 5J2MA 5C0YA 3UKUB 2XY8A 3MN6A 1VSLA 4FOEA 1WSFA 3OS1A 1BA1A 2UUCK 2G8KA 4HWIA 1U04A 1EETA 4ISGA 1DEJA 3RMAA 4GY2B 2XO7A 3MX5A 4KB0A 4LSLA 4KFBA 1SKRA 2O8CA 1J9AA 3BEXA 3E9PA 4DV1K 1LCUA 3SMSA 4AHTA 4OKKA 5AQIA 4RCHA 4E89A 1G99A 4CJQA 3LPTA 3NH2A 4H5NA 3THXA 2I7PA 1XI1A 3F9KA 4JI5K 2FSJA 5KGWA 4JD2A 3V9XA 4DQPA 4M42A 5M1KA 5JLFA 4B8AB 1IBMK 2QM1A 3AVLA 1ZBIA 2E2OA 1VAZA 3L4QA 4H0OA 5BPNA 1WUAA 4CJ5A 4X65K 3MCPA 3SK3A 2UYTA 4MDBA 1BG3A 3AVJA 4DTRA 3ZSZA 1RDBA 2P9SB 2A6AA 1UOCA 1NGFA 1T7PA 4F8RA 3NGYA 3AO5A 4FWNA 3QMLA 4DU4A 4CJ4A 2OPPA 4H4OA 4FLVA 4AQYK 1R59O 1KLMA 3DI6A 2NRRA 3OY9A 2PZSA 3PLAA 1KSPA 2O8FA 2Y1JA 3LDOA 3NAEA 1HJRA 3UE5A 3E1YA 3H08A 4Z4GA 3AVIA 1QE1A 4N5SA 2HSTA 5LMUK 4O8UA 4CIGA 2YHAA 3SAHA 3MDQA 4LF5K 4XH4A 2G8WA 3KK7A 4QS7A 2R7YA 1W9HA 2XHBA 5M1FA 3CG7A 1NG9A 1RTHA 3NF9A 4IO9L 3EE8A 1I39A 1WAFA 5IT9O 1TAQA 2W6LA 4DR7K 3M8SA 3L6QA 5HRNA 1SS6A 1SUQA 4B3TK 4RW8A 4DR3K 1W0HA 3OYLA 1BHLA 4WE1A 4IEIA 4DTXA 3LZIA 4OPKA 3WQUA 1S6QA 4QOZB 1CLQA 2V52B 3VQPA 3QIOA 3BP8A 2QK9A 4B1VA 4I9QA 2ATQA 4DV7K 1TKXA 3P31A 3QETA 3OVNA 2E4LA 5C42A 2D0OA 1TAUA 3LDNA 1L3SA 2WONA 4FJ8A 4FPAA 5BR9A 4DQ8A 5FROA 4Y0WA 4BRCA 3KWIA 3NCIA 1QVFM 2YNFA 2RN2A 4OPAA 2GWJA 4KHPK 2PYLA 4FK4A 3DLEA 3VQBA 3TAPA 5FRNA 3CM5A 4LY7A 3CC2N 4BACA 3QFUA 3LWMA 3VA3A 4H5WA 4LH5A 3CC7N 3SBTA 3ZX3A 2G8FA 3BF1A 3DRSA 4BC3A 1RT6A 1JLBA 3FGUA 2F8TA 4CZKA 3I55N 2FF3B 3WXMB 4DSIA 2ZGZA 4AM7A 3NE6A 1NOZA 4RW7A 2ZD1A 2QW9A 2QXFA 4C1NK 5JVHL 3TARA 1SL1A 4KRFA 3AVAA 3LDLA 1S72N 1DTQA 4HUFA 4CVNE 4QS8A 2X6NA 3NF8A 1BCOA 3K5LA 2ASMA 3OBYA 4ELTA 1VHXA 4PQUA 4DHYA 3AGRA 1S1VA 2IVPA 2DTUA 4DU1A 4KBOA 4CD1A 5DM6L 4EIAA 2Z1IA 4OGCA 1WAJA 3ID8A 2V7ZA 3LALA 1HQEA 3D2EB 4PA1A 3LDSA 3CQXA 4FK0A 1NLVA 5FPDA 4FW2A 4CEZA 3NVKA 4ZTFA 4DR4K 4B3SK 4IG3A 4KKOA 3KJVA 1REVA 5KPRA 4BVPA 4Z94A 5C25A 5C12A 3DOKA 1SQKA 2ZWHA 2FBXA 3DJCA 4F4KA 4B9SA 3R1XA 1U2VB 1KXPA 2VGMA 3C94A 3O6WA 3I8DA 2ZJQL 4A62A 3L2QA 4FWMA 3FZHA 2DPNA 1VQLN 1BOTO 1GLCG 3WEEA 3FZFA 1J54A 3LP1A 1NK8A 1K8KB 3QB0A 1YJ9N 3NVMA 4I7FA 3VF2A 1XMQK 3TTDA 5AQYA 4BR9A 2HF3A 3CJBA 1HKBA 4LH4A 2YI1A 4UY8O 1BDGA 1BQMA 4CFBA 1N34K 3TSUA 2HHUA 3M8QA 4DF4A 2NRVA 1C1CA 4CIFA 3K5NA 3DXKA 3AVNA 4FLWA 1RBTA 3SNNA 3G10A 3QICA 2X74A 4CEAA 4JI7K 1OKJA 4JLHA 3CJ7A 5M1NA 3NGZA 4XH5A 2P5GA 2P9LA 3C7NA 1HUXA 2DY4A 4B1UB 1NGAA 3VQEA 4FLZA 3AY9A 4CJSA 3CC4N 1BI4B 4IOAL 3CERA 2W40A 3D45A 4BRDA 4B9LA 4JKGB 2QWNA 4CBWA 4CHQA 4JYAK 1QHTA 3THYB 2HNDA 2Q97A 2P9KA 2HBMA 2IOCA 4KREA 4JK7A 4JKHA 4DTSA 1DT9A 3LP0A 3OBWA 3AAQA 5AFUA 3IKMA 1G15A 4CJKA 3H45C 2AJQA 1T44A 3DXKB 3ATUA 5EXWA 3ZEUA 1S22A 1O1WA 3LDPA 2LSNA 3V1OA 3ZT4A 1J5OA 3HP6A 1UWBA 2UXCK 2Q3SA 2VQFK 4PKHA 4Z4CA 5AFUH 4FWQA 5AQJA 3HVTA 3V1RA 4CF2A 3PSIA 4Y1CA 3RSEB 4OJRA 1HNXK 4I9LA 3AVKA 3VQAA 4DFJA 3ZSWA 2QEXN 1NGGA 1NU0A 3ENOA 1A5VA 2FXUA 4QS9A 3MXJA 5ADXH 5SZTA 3ZT3A 1H1VA 1SKSA 1BU6O 2UU9K 4HCBA 1RTJA 4DFPA 3TANA 3HOSA 3EKSA 3SQ4A 2JWKA 4BREA 1LWFA 2P9IA 3CMAN 1BL3A 3F73A 4TSXA 2Q0UA 1LAWA 3KVGA 4KTWA 3WXJA 1QQCA 3ZCMA 4BRPA 5JICA 1NMDA 3HPHA 3U9ZA 3GE1A 1GLLO 2QKKA 1QTMA 2GTDA 4B9MA 1WLJA 3JXUA 1ZBUA 2HB5A 3GL1A 3VEOA 1QZ6A 2PYJA 4FWSA 3BDPA 1S6PA 3AVCA 4JS4A 2WOMA 2QTDA 4N47A 3CD6N 4K42A 3MAQA 4EHUA 2O8EB 3E66A 4CZLA 4DMNA 5KRTA 3I0SA 1UAXA 5HP1A 4O0JA 4BROA 3CFPA 3QO9A 4DKWA 3ASMA 5AQXA 3AA3A 4M3XA 4A5AA 3RR8A 2QWLA 4BE0A 4CEEA 2HHTA 3R9PA 4AH9A 1E4GT 1CXQA 4BVOA 2RE2A 4PKGA 3OTOK 5AQPA 4DSKA 3JS6A 2P9SA 3D2EA 2P9PA 1YI2N 4N41A 4CZFA 2W6KA 4GV9A 1D9DA 1WOQA 3QIPA 1EXQA 1V4TA 1T03A 3MEGA 1KTQA 2Q1NA 4LD0A 2A1SA 4CZIA 3ALYA 4BRIA 3NFAA 5FPEA 4Z4HA 2IVNA 1VQKN 2IS3A 1WBDA 1I94K 4CFCA 5M1PA 4B3OA 1S3XA 4H5RA 2YX6A 4FSVA 3OYFA 3HT3A 4ILHA 4IKFA 1JCGA 1SV5A 3FLCO 1U2VA 3O3FA 1GOCA 5E84A 2Q2RA 4K43A 3CJAA 1FW6A 3ENHA 1W2BM 2P9PB 2VWKA 5A2QO 5GIOA 5GADP 2VG6A 3EN9A 5GIPA 2Y1IA 3SQ1A 3K5OA 3ZSRA 1N6QA 3FR0A 4YDUA 1L5UA 2OYQA 1KVCA 3KK2A 3AVHA 1OH5A 1NWKA 4OO1J 1K9MO 4FPBA 4E1JA 4WFBL 1LAVA 5CR4A 2HHVA 3TTFA 3ZSVA 4A57A 1XWLA 4CHYA 4DSEA 4K8XA 4WQ5C 4GKKK 1ZC6A 2YV0X 3O1WA 3J7ZO 5HROA 3VQ9A 4CI6A 4JHDA 3M1FA 3JAMO 3HK2A 3VF4A 3SLCA 1HNZK 3WNFA 2YKMA 3J7AP 2PBDA 1QZ5A 2IVOA 2FBYA 2EX3A 4C8OA 2O4GA 1NMNA 2HMPA 1ATSA 1XQSC 4DV2K 1VQON 4LC9B 5M1OA 2HHHK 3CFOA 2DFFA 4DWIA 1IKYA 1K8AO 3ZETA 1HRHA 5BPLA 2W41A 4IFVA 4A5BA 4BRMA 4J2DA 2PFUA 3IDHA 1GLEG 1S1TA 3B6PA 3GBTA 3IRXA 4FJJA 4BQZA 4YOUA 1N36K 1HKGA 1Y64A 5LJWA 3VQ5A 5AR0A 2AP1A 4OVLA 1Z25A 2JLEA 5E41A 2HHWA 3IG1A 1WNSA 4GNIA 4IWVA 4GW6A 1NGIA 1Z26A 2WFBA 3A5LC 3OYIA 4EP4A 4DLGA 4KI4A 2I7NA 3B6OA 1HNVA 4I6MA 4CGJA 2D5RA 4O5BA 3LDQA 5FDLA 3VTIA 2O8BB 2WBNA 4BC2A 5BRDA 4DV4K 3ZEUB 2ZE2A 4FZYA 3N4QA 4PL8A 5HOOA 4BRAA 2HF4A 1KLNA 1S5JA 4ELVA 3BZKA 3CM6A 4YOTA 2BTFA 3SAGA 4JV5K 4DLEA 3ZETB 5BR8K 3O4NA 3L3UA 1NGCA 1NNEA 3HI0A 4NO7A 4NCGA 4CBXA 2B4JA 2F9WA 1N33K 1C1BA 1VSKA 3O1BA 1RBRA 5EU7A 1RTIA 4M7XA 3RMBA 4JI3K 4YFUA 4J8FA 3K5MA 3DLGA 3TTCA 2E2QA 4FWRA 3WNHA 4CGGA 4W5RA 4AHSA 5I9EB 5B8HA 3PX0A 4B9NA 2O8BA 5KQ8A 5JS2A 2EHGA 2D0CA 1HR0K 5AQFA 1T3VA 1YAGA 5GAHP 4HTUA 4BGAA 1KFDA 3TI0A 4BR0A 4YOVA 3WT0A 3MECA 4MLHA 2G8HA 4MQ3A 1BISA 3A0IX 4FJIA 1NBWA 3TU5A 5H1SQ 1IBKK 4DQRA 4B9QA 5KPZA 3QLHA 3KLEA 2E1YA 5GAEP 3LP3A 4BY9C 4OPHA 1VQ9N 3AO2A 4FJGA 4JAXA 4DS4A 4LF4K 3CCEN 2O8EA 1FKOA 2V7YA 1JJ2M 4CJTA 4M3WA 4B1ZA 2HMIA 1JL1A 4JN4A 4LF6K 4M7YA 3ISNC 1NKEA 1B9FA 2E6LA 1ATNA 1U4BA 4LSNA 3P4IA 3M5RA 3VEWA 1BIUA 3HSCA 3CCSN 3ZT2A 2P51A 4CBUA 4H5TA 4YDUC 1NJZA 2IGIA 1WB9A 3AO3A 4CF8A 4CZMA 3L2VA 1E3MA 4UQGA 3OYKA 3VENA 1NGJA 1KRPA 2OPQA 4ILGB 1W97L 1U6ZA 3KIOA 1VSMA 1D8YA 5C2DA 3AARA 4M45A 4MO4A 5AQLA 3U4LA 3FZMA 4RG8A 2VWBA 4CJ7A 5BRHA 4CJ3A 1FJGK 3T1HK 4CHOA 4OX9K 3AVGA 1IG8A 1EWQA 2FBVA 3CPEA 3O9UA 5KTQA 1VQ6N 2GEMA 1RCHA 4KTZA 2QXLA 3TSPA 4EHTA 3VESA 4DFKA 3HM8A 5K14A 2YHWA 1VSIA 1EKEA 3O9SA 1VQ7N 4FK2A 1NGBA 4FM1A 4MO5A 4ID1A 3A5NC 1JXBA 4O44A 3CCUN 1QSYA 4FM2A 1HYZA 2E20A 2F4VK 4CHPA 1HPMA 3E01A 1EWRA 5HLFA 1RDWX 5F2RA 5HBMA 3VETA 4E7IA 3SCXA 3QNNA 4ILJA 3SUPA 1BCMA 1ASUA 1WSIA 5I3UA 1VRTA 1N32K 4KH6A 1JCEA 2RPIA 3VEZA 2AA4A 1BI4A 1JLGA 2GWKA 1YF5L 4KH4A 1EQYA 2E5LK 1KVBA 5FPMA 3MK6A 1RNHA 1S9EA 4YNQA 4BG8A 2P9NB 4DTNA 4DU3A 4K0KK 5LMNK 1TK5A 4CJFA 3V4IA 2BH1A 3O80A 3PSFA 5AQHA 3QEWA 3H1QA 4H4MA 3BUZB 4F3TA 3ZT1A 1RT2A 1RT1A 3KD1E 5T7BA 3C6UA 3RTVA 3CXCM 2NRTA 3E9LA 1MWKA 1VK0A 1TVRA 4Z0UA 4ISEA 3CJ1A 2F8SA 3HOTA 3D2FA 3MWTA 1CZAN 2YHYA 2KZZA 3SQ2A 3PIPL 3CETA 5J2PA 1C0FA 4LFCK 3LL3A 3AVMA 3ATVA 2HNYA 4KHYA 3SZ2A 4CEQA 4E7LA 1OVQA 1UA0A 4CZHA 2WC9A 2D0PA 4W5QA 3W3DA 1C0GA 3DWLA 4U67L 5SWMA 3GG4A 2P1JA 3KZBA 3CF5L 5BREA 3PO5A 2HVHA 2Q0RA 4FJHA 4OKEA 1VRUA 4DTUA 4H8KA 2IDOA 3OA9A 4IOXA 3QEXA 4FJKA 3EZ5A 1DKGD 3SPZA 4IZ9A 4CHNA 4WCEL 4IXCA 3K9JA 4C8NA 1NK0A 4I2PA 2ITMA 4B1YB 4F3OA 3OW2M 4C8LA 3Q7BA 2WTUA 2UUBK 1JLEA 4KHUA 3KKSA 3KWGA 2YNGA 3R6MA 1Q9YA 4K8ZA 4XEIA 4DV6K 2D0AA 3HO1A 4DV0K 2XY7A 4E1NA 4CGHA 4JK8A 4J2AA 3V1QA 4BR5A 2ZQBA 4Y1DA 5AQTA 4CF1A 2UUAK 4JI1K 2VG7A 3JYTA 4CIEA 1HQUA 1X3MA 1ZBHA 4WF9L 1U45A 5LY3A 3AA4A 4DTMA 3KHYA 5HRPA 5J2NA 3N4PA 1GLAG 1TKTA 2CGLA 3RSEA 2KZMA 4HHTA 3SUNA 2E88A 3VGLA 4BE2A 3TAQA 4FOIA 1XC9A 3AO4A 5AQMA 3I56N 3QERA 1A5XA 4GKJK 4CK2A 1QQNA 2X78A 3VN5A 3FFIA 1Z05A 2QWQA 3MN5A 1VQMN 4AILC 1RT4A 3MWPA 3DLBA 3DRPA 1HX1A 1HLUA 1YIJN 4B9UA 2D0BA 4BR2A 5EVZA 3EEQA 1YT3A 2GELA 3DMJA 1VQ8N 1HNIA 1CXUA 2A42A 3FE1A 1TUYA 1F21A 3G71N 2CGJA 5CE3A 1WSGA 4QCLA 1VSEA 2GUIA 4C1NI 3KTQA 1B9DA 3SJHA 3P1GA 3VQCA 4FO0A 1EO1A 1NM1A 3UKUA 3HJFA 4I6MB 4FWPA 4BWJA 1JCFA 1X9JA 4DR6K 4JKCA 1BO5O 1X9MA 3LANA 4PL7A 3J7YP 4JRPA 1X1PA 1VSDA 2A5XA 4PKIA 3OYCA 4H0VB 4YHHK 3P5JA 4GVEA 1WSHA 4IBNA 4KTQA 4MFBA 1QVGM 3G0ZA 2HHQA 1EX4A 3ZYYX 3QINA 4NYNA 2KLAA 1J6ZA 2OZMA 1NK4A 2HVIA 2IC3A 1JXEA 3GOIA 3F5TA 3HM9A 3C95A 4JKBA 1M90O 3QBXA 4R79A 4MLEA 2G8VA 3DLRA 4DSJA 2DFHA 1C0MA 4JHDB 4ID5A 4CE9A 3DYAA 1HNWK 4JI4K 4FVUA 2GV9A 4X62K 1JKHA 2H3GX 4CFDA 3HVRA 3O5BA 3WXLA 4ZTJA 4HCCA 3T1YK 1RDCA 1BGXT 3L2WA 5TKYA 1XHXA 3V81A 4IFYA 2F96A 3L0QA 4E1MA 3QEIA 3THWA 3R8EA 3ZSOA 2Q36A 3QDKA 2XY5A 2CH6A 5AJ3K 1NGDA 3WXKA 3HL8A 3SI6A 4GMJB 5AQGA 3L8BA 2F7TA 2RHKA 3CJ9A 4H0PA 3BF3A
chains in the Genus database with same CATH topology
3B6OA 2E4LA 1HNVA 3OVNA 5C42A 4HUGA 4DTOA 1L3SA 4CGJA 2D5RA 4CHZA 2WONA 4FJ8A 4O5BA 1TAUA 5FDLA 4W5NA 4CGDA 5FROA 2Z1GA 3AA2A 3CFRA 4FJMA 3ZSXA 2ZE2A 3NCIA 4FZYA 2YNFA 2RN2A 3LP2A 4CEOA 5CYMA 1NK6A 3C6TA 2PYLA 1D9FA 4FK4A 3DLEA 3VQBA 3TAPA 1KLNA 1JLCA 4CCHA 5FRNA 1S5JA 4ELVA 3CM5A 4CJEA 3MXMA 4B8CA 3CM6A 2IAJA 5JS1A 4LY7A 4BACA 3OS2A 3VA0A 1GOBA 4KO0A 4Q5VA 3LWMA 3VA3A 4LH5A 4DLEA 2G8FA 3DRSA 3L3UA 1DLOA 3O4NA 5CZ2A 4CEFA 1RT6A 4CGIA 3OYJA 1JLBA 1T05A 2F8TA 4NCGA 2B4JA 4DQIA 4NCBA 3ZT0A 1C1BA 1VSKA 2BE2A 4DSIA 1RBRA 1X9SA 5EU7A 3NE6A 1RTIA 1NOZA 4RW7A 2ZD1A 3ULDA 3RMBA 2JGUA 4YFUA 2QXFA 3OYHA 3TARA 1SL1A 4DTPA 3K5MA 3DLGA 4FM0A 3TR8A 4KRFA 4DTJA 2NUBA 3AVAA 4OPJA 1LV5A 4O4GA 1HPZA 4KHQA 1DTQA 2BANA 3WNHA 4CGGA 2ETJA 4AHSA 4W5RA 4HUFA 1LW2A 3U3YA 4B9NA 3PX0A 4W5TA 5JS2A 2EHGA 3KK1A 2X6NA 1R0AA 2D0CA 3NF8A 1BCOA 4ICLA 3K5LA 1JLFA 2Z1JA 1NK7A 4HTUA 4ELTA 3NH0A 4W5OA 3HYFA 3KLFA 1KFDA 3EY1A 3TI0A 3TAMA 4PQUA 1S1VA 3AVFA 2VWJA 3MECA 1C6VA 3QNOA 1JLQA 2DTUA 5I42A 4DU1A 4M41A 2G8HA 3S9HA 4MQ3A 1S1XA 1BISA 4FZZA 3TAGA 4FJIA 2Z1IA 4OGCA 3SV4A 1WAJA 4DQRA 1RT3A 3LALA 3OYMA 1HQEA 3OJSA 1SL0A 4L8RB 5HRSA 4PA1A 3LDSA 1LWEA 4M3RA 3S3NA 4FK0A 4JS5A 3QLHA 3KLEA 4C8KA 4CK1A 3LP3A 3IS9A 3AO2A 4FW2A 4CEZA 2KW4A 3T1AA 4FJGA 1NJWA 3AO1A 4ZTFA 4DFMA 1L3TA 1TK8A 4IG3A 4CEBA 1RDAA 1HYVA 4KKOA 3KJVA 2HNZA 4DS4A 1HYSA 1GOAA 1REVA 3K2PA 1DTTA 1ZBFA 3JSMA 3D0PA 3KLHA 1TKZA 1FKOA 3DM2A 3SUQA 4DG1A 5C25A 2PY5A 3DOKA 4CJTA 2Z1HA 3V6DA 1QSLA 4M3WA 1U48A 2HMIA 1JL1A 4CJWA 1CZBA 2FBXA 3ISNC 1RILA 1T8EA 4F4KA 1NKEA 3V9WA 2YHBA 4B9SA 1ASVA 1B9FA 2E6LA 5DMRA 3RRHA 4FJ5A 1U4BA 4LSNA 4FJXA 2ITGA 1BIUA 1NOYA 1JLAA 1UA1A 4J2BA 3ZT2A 2P51A 3OYNA 3OYAA 2KTQA 2KFZA 3C94A 3SYZA 1IKVA 3I8DA 3EYZA 1NJZA 1N5YA 2IGIA 5J2QA 3AO3A 4CF8A 4CESA 3L2QA 4E19A 3L2VA 5HRRA 4OLBA 1KFSA 3T19A 4CF0A 1J54A 4CECA 3LP1A 4UQGA 3OYKA 1VSHA 1NK8A 4GVMA 3AV9A 1RDDA 4I7FA 1YTUA 1KRPA 2OPQA 4M3TA 2XRIA 5KI6A 3KIOA 1VSMA 3NF7A 3L2RA 3HSTB 1D8YA 2OA8A 1Q8IA 4BWMA 4M45A 1TKDA 3M8PA 4LH4A 3HPGA 2HHSA 4RG8A 1ITGA 4ELUA 1BQMA 1C1AA 3LAKA 4CJ3A 4CFBA 4XIUA 4M3YA 4CHOA 3LAMA 4EZ9A 4G1QA 2HHUA 3AVGA 3M8QA 1TGOA 4DSFA 4DS5A 4DF4A 4FXDA 1C1CA 2FBVA 4CIFA 2KQ2A 3K5NA 4IG0A 3NGIA 2HHXA 1LWCA 1RBUA 3AVNA 4E7JA 4FLWA 1RBTA 3VQ6A 5KTQA 4FJNA 3SNNA 3G10A 1L3UA 2X74A 4KTZA 1HMVA 1RCHA 3OS0A 1BIZA 4CEAA 4BDPA 3RR7A 4FLYA 4JLHA 3AVBA 4DFKA 5K14A 3NGZA 3SUOA 2P5GA 3WNEA 1VSIA 1EKEA 4BE1A 3DRRA 4FK2A 3O4QA 4EZ6A 4FM1A 4ID1A 2DY4A 5DK5A 1IKXA 1JXBA 4O44A 4RW4A 4BDYA 2QKBA 1QSYA 3KD5E 4FM2A 1HYZA 3S3OA 3VQEA 4FLZA 4CGFA 4CHPA 2G8IA 3E01A 4CJSA 4M3ZA 5HLFA 1BI4B 3HXMA 2I5JA 3D45A 3THVA 1FXXA 4B9TA 4FLUA 4B9LA 1LW0A 5HBMA 4CHQA 4E7IA 3SCXA 1BQNA 4CEDA 3QNNA 1L3VA 3UIQA 3SUPA 3V9SA 4CJRA 1BCMA 3OJUA 1ASUA 1WSIA 5I3UA 1QHTA 1VRTA 4JRQA 3LWLA 3NDKA 2HNDA 4B9VA 2RPIA 1BI4A 1JLGA 2IOCA 1SL2A 4KREA 3HPOA 2P5OA 2E6MA 1XHZA 3WNGA 4R5PA 1KVBA 4FW1A 2OZSA 2BGGA 4DTSA 1RNHA 3LP0A 1S9EA 1JL2A 1TV6A 4YNQA 4RW9A 1G15A 4CJKA 1TL3A 2AJQA 4DTNA 1S1WA 1I3AA 3SJJA 4DU3A 1TK5A 1VSFA 4CJFA 3V4IA 1O1WA 5D3GA 2LSNA 3QEWA 3V1OA 3SPYA 1NKBA 3ZT4A 4E3SA 4HVJA 3HP6A 1J5OA 4H4MA 4E7KA 1UWBA 4F3TA 1WSEA 2Q3SA 3ZT1A 3PY8A 2B6AA 1RT2A 4Z4CA 5CY4A 4M3UA 2VG5A 1RT1A 3HVTA 3V1RA 3RMCA 3KD1E 4CF2A 3L2UA 4KHYA 2X6SA 4Y1CA 5T7BA 3C6UA 1RBVA 4E0DA 3CYMA 3VQDA 4OJRA 4CJUA 3RTVA 4DQSA 3K58A 2O4IA 4DQQA 1VK0A 1TVRA 4Z0UA 1RTDA 4F2RA 3DLKA 4J2EA 2F8SA 5J1EA 3NF6A 3AVKA 4I9LA 4OGEA 1X9WA 4PY5A 3KKRA 3VQAA 1IH7A 4DFJA 1NK9A 2KZZA 1EP4A 3SQ2A 3ZSWA 3OYDA 3PO4A 4ZHRA 1A5VA 1IG9A 1K6YA 3MXJA 5SZTA 4NYFA 4PWDA 3ZT3A 5J2PA 1S1UA 3DOLA 4KHNA 1IO2A 1SKSA 1NKCA 4FLTA 3AVMA 1KVAA 4DSLA 4HCBA 4FYDA 1RTJA 2HNYA 2YKNA 3SZ2A 3K59A 1FK9A 3M8RA 4CEQA 3A2FA 4C8MA 2YNHA 4DFPA 3QEPA 3TANA 4E7LA 3DLHA 3SQ4A 1UA0A 1LWFA 1NJYA 4FZXC 4KAZA 3AA5X 3LZJA 1BL3A 3F73A 1Y97A 4TSXA 4W5QA 1LAWA 4DF8A 4KTWA 1QQCA 3ZCMA 4Q0BA 5SWMA 3V9ZA 2P1JA 3VQQA 3RRGA 3VQ8A 3HPHA 2GBZA 2YNIA 2QKKA 3PO5A 2HVHA 1QTMA 1C0TA 4KB1A 4B9MA 1VSJA 1WLJA 4FJHA 1ZBUA 2HB5A 2OPSA 4OKEA 1VRUA 4AHRA 3U6FA 2HW3A 4DTUA 4H8KA 2IDOA 4CJVA 2PYJA 3QEXA 1U47A 3U3GA 4FJKA 1A5WA 3BDPA 3TAFA 1S6PA 3AVCA 3EZ5A 2WOMA 4JS4A 2BDPA 3IAYA 3CQ8A 4OLAA 3OYEA 4CHNA 3SPZA 3P83D 2OPRA 3ITHA 4N47A 4NCAA 1NK0A 4C8NA 3MAQA 2FBTA 4I2PA 1FKPA 1YVUA 1KCFA 4DMNA 3O3GA 5KRTA 4F3OA 4C8LA 4HUEA 1QS4A 3I0SA 3VQ4A 3PV8A 1S9GA 1UAXA 1JLEA 1QSSA 4B08A 3V9UA 4KHUA 2RKIA 3KKSA 3VQ7A 2YNGA 5HP1A 4O0JA 4PUOA 3HP9A 4FVMA 1Q9YA 4K8ZA 4CK3A 3QEVA 2D0AA 1U49A 3HO1A 4O55A 3L3VA 4E1NA 3CFPA 4CGHA 2XY7A 3PX4A 3QO9A 3RWUA 4J2AA 3V1QA 4BDZA 3ZSQA 2W42A 2ZQBA 1ZBLA 4Y1DA 4CF1A 1B92A 2B5JA 3ASMA 2XY6A 3AA3A 4M3XA 2VG7A 3JYTA 4Z4FA 2FC0A 1HQUA 4AHCA 4CIEA 3K57A 5J2MA 1SKWA 3RR8A 1ZBHA 3PUFA 2XY8A 1U45A 4BE0A 1VSLA 3AA4A 4CEEA 4DTMA 2HHTA 1WSFA 4AH9A 5HRPA 3OS1A 5J2NA 1CXQA 2G8KA 1TKTA 2KZMA 4CERA 4HHTA 1U04A 1EETA 3SUNA 1RBSA 4BE2A 3TAQA 1XC9A 3AO4A 4DSKA 3RMAA 4N41A 4KV8A 2XO7A 4KB0A 4LSLA 3QERA 1D9DA 3QIPA 4KFBA 1EXQA 1A5XA 3PX6A 3MEGA 4CK2A 1T03A 1J9AA 2X78A 1SKRA 3VN5A 3FFIA 4O0IA 3KLGA 3TAEA 1RT5A 1KTQA 4LD0A 2A1SA 4AILC 3ALYA 1NJXA 3NFAA 1RT4A 4Z4HA 4AHTA 3SQ0A 3DLBA 3ZSYA 4OKKA 4KHSA 3DRPA 2RF2A 4E89A 2IS3A 3NHGA 4CJQA 1C0UA 3LPTA 4CFCA 1WN7A 3NH2A 3OYGA 1MU2A 2D0BA 1XI1A 4B9UA 4B3OA 3F9KA 1YT3A 5KGWA 3DMJA 3TABA 3V9XA 3OYFA 1ASWA 3KLIA 5CZ1A 4DQPA 4M42A 1Q9XA 1HNIA 1CXUA 3HT3A 1RT7A 4B8AB 1F21A 4IKFA 4FJ9A 4RW6A 1WSGA 1SV5A 3AVLA 4AHVA 3O3FA 3TWHA 4QCLA 1VSEA 1ZBIA 2GUIA 3KTQA 1GOCA 1B9DA 1TK0A 5FRMA 1TL1A 3P1GA 3VQCA 4E7HA 3T3FA 4CJ5A 2VWKA 3OYBA 3HJFA 2VG6A 4BWJA 3QESA 2Y1IA 3MEEA 3K5OA 3ZSRA 3SQ1A 5CYQA 1N6QA 3NBPA 3AVJA 4DTRA 1L5UA 3ZSZA 2OYQA 4FJ7A 1RDBA 4FCYA 1KVCA 4Z4EA 2KFNA 1UOCA 1YTAA 4CJLA 4CF9A 3KK2A 1X9MA 1T7PA 3LANA 4KPYA 3AVHA 4F8RA 3NGYA 3I0RA 3AO5A 1X1PA 4JRPA 4Z4IA 1VSDA 4DU4A 3OYCA 2HHVA 1LAVA 4CJ4A 2OPPA 4H4OA 4CFAA 3P5JA 3BGRA 3ZSVA 4FLVA 2A1RA 1XWLA 1WSHA 4CHYA 1KLMA 4DSEA 4K8XA 4IBNA 1WSJA 4KTQA 2YV0X 4MFBA 3DI6A 3G0ZA 2HHQA 1D5AA 5HROA 1EX4A 3VQ9A 3QINA 3OY9A 4NYNA 2PZSA 5KGXA 1KSPA 3HK2A 2Y1JA 2OZMA 3WNFA 3NAEA 3MEDA 1NK4A 2YKMA 4KI6A 1HJRA 2IC3A 2HVIA 4KHWA 1JXEA 2FBYA 2EX3A 3KK3A 3H08A 4Z4GA 3AVIA 1QE1A 3C95A 4N56A 4N5SA 3HM9A 4C8OA 4CIGA 2O4GA 2G8UA 2G8VA 4QAGA 3DLRA 2YHAA 4DSJA 1ZYQA 2DFHA 1C0MA 4CJPA 1NK5A 3CFOA 2G8WA 4EP5A 2DFFA 2R7YA 4ID5A 4CE9A 4DWIA 1IKYA 1W9HA 3DYAA 5C24A 1HRHA 4IDKA 2XHBA 4FJLA 4IFVA 3CG7A 1RTHA 2GV9A 4J2DA 4N76A 3NF9A 4F2SA 1CZ9A 1JKHA 4CFDA 3SV3A 3HVRA 4ZTJA 1S1TA 3B6PA 3IRXA 4AHUA 4HCCA 4FJJA 1I39A 1WAFA 3LPUA 1TAQA 3M8SA 3VQ5A 5HRNA 2DFEA 1SUQA 1RDCA 1BGXT 1Z25A 4OVLA 2JLEA 4RW8A 3L2WA 1W0HA 1XHXA 5E41A 3NH1A 1BHLA 3OYLA 3IG1A 2HHWA 3RMDA 1J53A 4WE1A 4DTXA 3V81A 3LZIA 4IFYA 1WNSA 4OPKA 3O3HA 4GW6A 4I2QA 2F96A 1S6QA 1IKWA 4E1MA 4FLXA 3QEIA 4QOZB 4OKJA 3ZSOA 5KRSA 2XY5A 3VQPA 1Z26A 3QIOA 1CLQA 3HL8A 2QK9A 3SI6A 3MXIA 4GMJB 3OYIA 3L8BA 3S3MA 4I9QA 2ATQA 4EP4A 1TKXA 4DLGA 4KI4A 3QETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6O A;  2E4L A;  1HNV A;  3OVN A;  5C42 A;  4HUG A;  4DTO A;  1L3S A;  4CGJ A;  2D5R A;  4CHZ A;  2WON A;  4FJ8 A;  4O5B A;  1TAU A;  5FDL A;  4W5N A;  4CGD A;  5FRO A;  2Z1G A;  3AA2 A;  3CFR A;  4FJM A;  3ZSX A;  2ZE2 A;  3NCI A;  4FZY A;  2YNF A;  2RN2 A;  3LP2 A;  4CEO A;  5CYM A;  1NK6 A;  3C6T A;  2PYL A;  1D9F A;  4FK4 A;  3DLE A;  3VQB A;  3TAP A;  1KLN A;  1JLC A;  4CCH A;  5FRN A;  1S5J A;  4ELV A;  3CM5 A;  4CJE A;  3MXM A;  4B8C A;  3CM6 A;  2IAJ A;  5JS1 A;  4LY7 A;  4BAC A;  3OS2 A;  3VA0 A;  1GOB A;  4KO0 A;  4Q5V A;  3LWM A;  3VA3 A;  4LH5 A;  4DLE A;  2G8F A;  3DRS A;  3L3U A;  1DLO A;  3O4N A;  5CZ2 A;  4CEF A;  1RT6 A;  4CGI A;  3OYJ A;  1JLB A;  1T05 A;  2F8T A;  4NCG A;  2B4J A;  4DQI A;  4NCB A;  3ZT0 A;  1C1B A;  1VSK A;  2BE2 A;  4DSI A;  1RBR A;  1X9S A;  5EU7 A;  3NE6 A;  1RTI A;  1NOZ A;  4RW7 A;  2ZD1 A;  3ULD A;  3RMB A;  2JGU A;  4YFU A;  2QXF A;  3OYH A;  3TAR A;  1SL1 A;  4DTP A;  3K5M A;  3DLG A;  4FM0 A;  3TR8 A;  4KRF A;  4DTJ A;  2NUB A;  3AVA A;  4OPJ A;  1LV5 A;  4O4G A;  1HPZ A;  4KHQ A;  1DTQ A;  2BAN A;  3WNH A;  4CGG A;  2ETJ A;  4AHS A;  4W5R A;  4HUF A;  1LW2 A;  3U3Y A;  4B9N A;  3PX0 A;  4W5T A;  5JS2 A;  2EHG A;  3KK1 A;  2X6N A;  1R0A A;  2D0C A;  3NF8 A;  1BCO A;  4ICL A;  3K5L A;  1JLF A;  2Z1J A;  1NK7 A;  4HTU A;  4ELT A;  3NH0 A;  4W5O A;  3HYF A;  3KLF A;  1KFD A;  3EY1 A;  3TI0 A;  3TAM A;  4PQU A;  1S1V A;  3AVF A;  2VWJ A;  3MEC A;  1C6V A;  3QNO A;  1JLQ A;  2DTU A;  5I42 A;  4DU1 A;  4M41 A;  2G8H A;  3S9H A;  4MQ3 A;  1S1X A;  1BIS A;  4FZZ A;  3TAG A;  4FJI A;  2Z1I A;  4OGC A;  3SV4 A;  1WAJ A;  4DQR A;  1RT3 A;  3LAL A;  3OYM A;  1HQE A;  3OJS A;  1SL0 A;  4L8R B;  5HRS A;  4PA1 A;  3LDS A;  1LWE A;  4M3R A;  3S3N A;  4FK0 A;  4JS5 A;  3QLH A;  3KLE A;  4C8K A;  4CK1 A;  3LP3 A;  3IS9 A;  3AO2 A;  4FW2 A;  4CEZ A;  2KW4 A;  3T1A A;  4FJG A;  1NJW A;  3AO1 A;  4ZTF A;  4DFM A;  1L3T A;  1TK8 A;  4IG3 A;  4CEB A;  1RDA A;  1HYV A;  4KKO A;  3KJV A;  2HNZ A;  4DS4 A;  1HYS A;  1GOA A;  1REV A;  3K2P A;  1DTT A;  1ZBF A;  3JSM A;  3D0P A;  3KLH A;  1TKZ A;  1FKO A;  3DM2 A;  3SUQ A;  4DG1 A;  5C25 A;  2PY5 A;  3DOK A;  4CJT A;  2Z1H A;  3V6D A;  1QSL A;  4M3W A;  1U48 A;  2HMI A;  1JL1 A;  4CJW A;  1CZB A;  2FBX A;  3ISN C;  1RIL A;  1T8E A;  4F4K A;  1NKE A;  3V9W A;  2YHB A;  4B9S A;  1ASV A;  1B9F A;  2E6L A;  5DMR A;  3RRH A;  4FJ5 A;  1U4B A;  4LSN A;  4FJX A;  2ITG A;  1BIU A;  1NOY A;  1JLA A;  1UA1 A;  4J2B A;  3ZT2 A;  2P51 A;  3OYN A;  3OYA A;  2KTQ A;  2KFZ A;  3C94 A;  3SYZ A;  1IKV A;  3I8D A;  3EYZ A;  1NJZ A;  1N5Y A;  2IGI A;  5J2Q A;  3AO3 A;  4CF8 A;  4CES A;  3L2Q A;  4E19 A;  3L2V A;  5HRR A;  4OLB A;  1KFS A;  3T19 A;  4CF0 A;  1J54 A;  4CEC A;  3LP1 A;  4UQG A;  3OYK A;  1VSH A;  1NK8 A;  4GVM A;  3AV9 A;  1RDD A;  4I7F A;  1YTU A;  1KRP A;  2OPQ A;  4M3T A;  2XRI A;  5KI6 A;  3KIO A;  1VSM A;  3NF7 A;  3L2R A;  3HST B;  1D8Y A;  2OA8 A;  1Q8I A;  4BWM A;  4M45 A;  1TKD A;  3M8P A;  4LH4 A;  3HPG A;  2HHS A;  4RG8 A;  1ITG A;  4ELU A;  1BQM A;  1C1A A;  3LAK A;  4CJ3 A;  4CFB A;  4XIU A;  4M3Y A;  4CHO A;  3LAM A;  4EZ9 A;  4G1Q A;  2HHU A;  3AVG A;  3M8Q A;  1TGO A;  4DSF A;  4DS5 A;  4DF4 A;  4FXD A;  1C1C A;  2FBV A;  4CIF A;  2KQ2 A;  3K5N A;  4IG0 A;  3NGI A;  2HHX A;  1LWC A;  1RBU A;  3AVN A;  4E7J A;  4FLW A;  1RBT A;  3VQ6 A;  5KTQ A;  4FJN A;  3SNN A;  3G10 A;  1L3U A;  2X74 A;  4KTZ A;  1HMV A;  1RCH A;  3OS0 A;  1BIZ A;  4CEA A;  4BDP A;  3RR7 A;  4FLY A;  4JLH A;  3AVB A;  4DFK A;  5K14 A;  3NGZ A;  3SUO A;  2P5G A;  3WNE A;  1VSI A;  1EKE A;  4BE1 A;  3DRR A;  4FK2 A;  3O4Q A;  4EZ6 A;  4FM1 A;  4ID1 A;  2DY4 A;  5DK5 A;  1IKX A;  1JXB A;  4O44 A;  4RW4 A;  4BDY A;  2QKB A;  1QSY A;  3KD5 E;  4FM2 A;  1HYZ A;  3S3O A;  3VQE A;  4FLZ A;  4CGF A;  4CHP A;  2G8I A;  3E01 A;  4CJS A;  4M3Z A;  5HLF A;  1BI4 B;  3HXM A;  2I5J A;  3D45 A;  3THV A;  1FXX A;  4B9T A;  4FLU A;  4B9L A;  1LW0 A;  5HBM A;  4CHQ A;  4E7I A;  3SCX A;  1BQN A;  4CED A;  3QNN A;  1L3V A;  3UIQ A;  3SUP A;  3V9S A;  4CJR A;  1BCM A;  3OJU A;  1ASU A;  1WSI A;  5I3U A;  1QHT A;  1VRT A;  4JRQ A;  3LWL A;  3NDK A;  2HND A;  4B9V A;  2RPI A;  1BI4 A;  1JLG A;  2IOC A;  1SL2 A;  4KRE A;  3HPO A;  2P5O A;  2E6M A;  1XHZ A;  3WNG A;  4R5P A;  1KVB A;  4FW1 A;  2OZS A;  2BGG A;  4DTS A;  1RNH A;  3LP0 A;  1S9E A;  1JL2 A;  1TV6 A;  4YNQ A;  4RW9 A;  1G15 A;  4CJK A;  1TL3 A;  2AJQ A;  4DTN A;  1S1W A;  1I3A A;  3SJJ A;  4DU3 A;  1TK5 A;  1VSF A;  4CJF A;  3V4I A;  1O1W A;  5D3G A;  2LSN A;  3QEW A;  3V1O A;  3SPY A;  1NKB A;  3ZT4 A;  4E3S A;  4HVJ A;  3HP6 A;  1J5O A;  4H4M A;  4E7K A;  1UWB A;  4F3T A;  1WSE A;  2Q3S A;  3ZT1 A;  3PY8 A;  2B6A A;  1RT2 A;  4Z4C A;  5CY4 A;  4M3U A;  2VG5 A;  1RT1 A;  3HVT A;  3V1R A;  3RMC A;  3KD1 E;  4CF2 A;  3L2U A;  4KHY A;  2X6S A;  4Y1C A;  5T7B A;  3C6U A;  1RBV A;  4E0D A;  3CYM A;  3VQD A;  4OJR A;  4CJU A;  3RTV A;  4DQS A;  3K58 A;  2O4I A;  4DQQ A;  1VK0 A;  1TVR A;  4Z0U A;  1RTD A;  4F2R A;  3DLK A;  4J2E A;  2F8S A;  5J1E A;  3NF6 A;  3AVK A;  4I9L A;  4OGE A;  1X9W A;  4PY5 A;  3KKR A;  3VQA A;  1IH7 A;  4DFJ A;  1NK9 A;  2KZZ A;  1EP4 A;  3SQ2 A;  3ZSW A;  3OYD A;  3PO4 A;  4ZHR A;  1A5V A;  1IG9 A;  1K6Y A;  3MXJ A;  5SZT A;  4NYF A;  4PWD A;  3ZT3 A;  5J2P A;  1S1U A;  3DOL A;  4KHN A;  1IO2 A;  1SKS A;  1NKC A;  4FLT A;  3AVM A;  1KVA A;  4DSL A;  4HCB A;  4FYD A;  1RTJ A;  2HNY A;  2YKN A;  3SZ2 A;  3K59 A;  1FK9 A;  3M8R A;  4CEQ A;  3A2F A;  4C8M A;  2YNH A;  4DFP A;  3QEP A;  3TAN A;  4E7L A;  3DLH A;  3SQ4 A;  1UA0 A;  1LWF A;  1NJY A;  4FZX C;  4KAZ A;  3AA5 X;  3LZJ A;  1BL3 A;  3F73 A;  1Y97 A;  4TSX A;  4W5Q A;  1LAW A;  4DF8 A;  4KTW A;  1QQC A;  3ZCM A;  4Q0B A;  5SWM A;  3V9Z A;  2P1J A;  3VQQ A;  3RRG A;  3VQ8 A;  3HPH A;  2GBZ A;  2YNI A;  2QKK A;  3PO5 A;  2HVH A;  1QTM A;  1C0T A;  4KB1 A;  4B9M A;  1VSJ A;  1WLJ A;  4FJH A;  1ZBU A;  2HB5 A;  2OPS A;  4OKE A;  1VRU A;  4AHR A;  3U6F A;  2HW3 A;  4DTU A;  4H8K A;  2IDO A;  4CJV A;  2PYJ A;  3QEX A;  1U47 A;  3U3G A;  4FJK A;  1A5W A;  3BDP A;  3TAF A;  1S6P A;  3AVC A;  3EZ5 A;  2WOM A;  4JS4 A;  2BDP A;  3IAY A;  3CQ8 A;  4OLA A;  3OYE A;  4CHN A;  3SPZ A;  3P83 D;  2OPR A;  3ITH A;  4N47 A;  4NCA A;  1NK0 A;  4C8N A;  3MAQ A;  2FBT A;  4I2P A;  1FKP A;  1YVU A;  1KCF A;  4DMN A;  3O3G A;  5KRT A;  4F3O A;  4C8L A;  4HUE A;  1QS4 A;  3I0S A;  3VQ4 A;  3PV8 A;  1S9G A;  1UAX A;  1JLE A;  1QSS A;  4B08 A;  3V9U A;  4KHU A;  2RKI A;  3KKS A;  3VQ7 A;  2YNG A;  5HP1 A;  4O0J A;  4PUO A;  3HP9 A;  4FVM A;  1Q9Y A;  4K8Z A;  4CK3 A;  3QEV A;  2D0A A;  1U49 A;  3HO1 A;  4O55 A;  3L3V A;  4E1N A;  3CFP A;  4CGH A;  2XY7 A;  3PX4 A;  3QO9 A;  3RWU A;  4J2A A;  3V1Q A;  4BDZ A;  3ZSQ A;  2W42 A;  2ZQB A;  1ZBL A;  4Y1D A;  4CF1 A;  1B92 A;  2B5J A;  3ASM A;  2XY6 A;  3AA3 A;  4M3X A;  2VG7 A;  3JYT A;  4Z4F A;  2FC0 A;  1HQU A;  4AHC A;  4CIE A;  3K57 A;  5J2M A;  1SKW A;  3RR8 A;  1ZBH A;  3PUF A;  2XY8 A;  1U45 A;  4BE0 A;  1VSL A;  3AA4 A;  4CEE A;  4DTM A;  2HHT A;  1WSF A;  4AH9 A;  5HRP A;  3OS1 A;  5J2N A;  1CXQ A;  2G8K A;  1TKT A;  2KZM A;  4CER A;  4HHT A;  1U04 A;  1EET A;  3SUN A;  1RBS A;  4BE2 A;  3TAQ A;  1XC9 A;  3AO4 A;  4DSK A;  3RMA A;  4N41 A;  4KV8 A;  2XO7 A;  4KB0 A;  4LSL A;  3QER A;  1D9D A;  3QIP A;  4KFB A;  1EXQ A;  1A5X A;  3PX6 A;  3MEG A;  4CK2 A;  1T03 A;  1J9A A;  2X78 A;  1SKR A;  3VN5 A;  3FFI A;  4O0I A;  3KLG A;  3TAE A;  1RT5 A;  1KTQ A;  4LD0 A;  2A1S A;  4AIL C;  3ALY A;  1NJX A;  3NFA A;  1RT4 A;  4Z4H A;  4AHT A;  3SQ0 A;  3DLB A;  3ZSY A;  4OKK A;  4KHS A;  3DRP A;  2RF2 A;  4E89 A;  2IS3 A;  3NHG A;  4CJQ A;  1C0U A;  3LPT A;  4CFC A;  1WN7 A;  3NH2 A;  3OYG A;  1MU2 A;  2D0B A;  1XI1 A;  4B9U A;  4B3O A;  3F9K A;  1YT3 A;  5KGW A;  3DMJ A;  3TAB A;  3V9X A;  3OYF A;  1ASW A;  3KLI A;  5CZ1 A;  4DQP A;  4M42 A;  1Q9X A;  1HNI A;  1CXU A;  3HT3 A;  1RT7 A;  4B8A B;  1F21 A;  4IKF A;  4FJ9 A;  4RW6 A;  1WSG A;  1SV5 A;  3AVL A;  4AHV A;  3O3F A;  3TWH A;  4QCL A;  1VSE A;  1ZBI A;  2GUI A;  3KTQ A;  1GOC A;  1B9D A;  1TK0 A;  5FRM A;  1TL1 A;  3P1G A;  3VQC A;  4E7H A;  3T3F A;  4CJ5 A;  2VWK A;  3OYB A;  3HJF A;  2VG6 A;  4BWJ A;  3QES A;  2Y1I A;  3MEE A;  3K5O A;  3ZSR A;  3SQ1 A;  5CYQ A;  1N6Q A;  3NBP A;  3AVJ A;  4DTR A;  1L5U A;  3ZSZ A;  2OYQ A;  4FJ7 A;  1RDB A;  4FCY A;  1KVC A;  4Z4E A;  2KFN A;  1UOC A;  1YTA A;  4CJL A;  4CF9 A;  3KK2 A;  1X9M A;  1T7P A;  3LAN A;  4KPY A;  3AVH A;  4F8R A;  3NGY A;  3I0R A;  3AO5 A;  1X1P A;  4JRP A;  4Z4I A;  1VSD A;  4DU4 A;  3OYC A;  2HHV A;  1LAV A;  4CJ4 A;  2OPP A;  4H4O A;  4CFA A;  3P5J A;  3BGR A;  3ZSV A;  4FLV A;  2A1R A;  1XWL A;  1WSH A;  4CHY A;  1KLM A;  4DSE A;  4K8X A;  4IBN A;  1WSJ A;  4KTQ A;  2YV0 X;  4MFB A;  3DI6 A;  3G0Z A;  2HHQ A;  1D5A A;  5HRO A;  1EX4 A;  3VQ9 A;  3QIN A;  3OY9 A;  4NYN A;  2PZS A;  5KGX A;  1KSP A;  3HK2 A;  2Y1J A;  2OZM A;  3WNF A;  3NAE A;  3MED A;  1NK4 A;  2YKM A;  4KI6 A;  1HJR A;  2IC3 A;  2HVI A;  4KHW A;  1JXE A;  2FBY A;  2EX3 A;  3KK3 A;  3H08 A;  4Z4G A;  3AVI A;  1QE1 A;  3C95 A;  4N56 A;  4N5S A;  3HM9 A;  4C8O A;  4CIG A;  2O4G A;  2G8U A;  2G8V A;  4QAG A;  3DLR A;  2YHA A;  4DSJ A;  1ZYQ A;  2DFH A;  1C0M A;  4CJP A;  1NK5 A;  3CFO A;  2G8W A;  4EP5 A;  2DFF A;  2R7Y A;  4ID5 A;  4CE9 A;  4DWI A;  1IKY A;  1W9H A;  3DYA A;  5C24 A;  1HRH A;  4IDK A;  2XHB A;  4FJL A;  4IFV A;  3CG7 A;  1RTH A;  2GV9 A;  4J2D A;  4N76 A;  3NF9 A;  4F2S A;  1CZ9 A;  1JKH A;  4CFD A;  3SV3 A;  3HVR A;  4ZTJ A;  1S1T A;  3B6P A;  3IRX A;  4AHU A;  4HCC A;  4FJJ A;  1I39 A;  1WAF A;  3LPU A;  1TAQ A;  3M8S A;  3VQ5 A;  5HRN A;  2DFE A;  1SUQ A;  1RDC A;  1BGX T;  1Z25 A;  4OVL A;  2JLE A;  4RW8 A;  3L2W A;  1W0H A;  1XHX A;  5E41 A;  3NH1 A;  1BHL A;  3OYL A;  3IG1 A;  2HHW A;  3RMD A;  1J53 A;  4WE1 A;  4DTX A;  3V81 A;  3LZI A;  4IFY A;  1WNS A;  4OPK A;  3O3H A;  4GW6 A;  4I2Q A;  2F96 A;  1S6Q A;  1IKW A;  4E1M A;  4FLX A;  3QEI A;  4QOZ B;  4OKJ A;  3ZSO A;  5KRS A;  2XY5 A;  3VQP A;  1Z26 A;  3QIO A;  1CLQ A;  3HL8 A;  2QK9 A;  3SI6 A;  3MXI A;  4GMJ B;  3OYI A;  3L8B A;  3S3M A;  4I9Q A;  2ATQ A;  4EP4 A;  1TKX A;  4DLG A;  4KI4 A;  3QET A; 
#chains in the Genus database with same CATH topology
 3CCJ N;  4YOR A;  1Q81 O;  2Z1G A;  3AA2 A;  3ZSX A;  2A41 A;  4PHT X;  3LP2 A;  4DR2 K;  4A2A A;  5CYM A;  4CCH A;  3A5O C;  3MXM A;  1GLD G;  2IAJ A;  3M6G A;  3ZLJ A;  1SZ2 A;  3OS2 A;  3TSQ A;  1GOB A;  4KO0 A;  1GLF O;  3ZX0 A;  4Q5V A;  3VA0 A;  1VQP N;  5CZ2 A;  1DLO A;  3D7E O;  1QQM A;  3VPZ A;  3Q7C A;  4DQI A;  3U8X A;  3DAW A;  3F2K A;  1VQ4 N;  3R3L A;  2J4R A;  5AQS A;  3VER A;  3ULD A;  3MN9 A;  4AM6 A;  4DTP A;  4FM0 A;  3TR8 A;  4DTJ A;  5AQQ A;  4OPJ A;  4BRH A;  1LV5 A;  3CCR N;  4O4G A;  2O8F B;  1RFQ A;  2OCE A;  4B3R K;  1LW2 A;  3U3Y A;  4W5T A;  2QA4 N;  1R0A A;  1MWM A;  1NK7 A;  1ILY A;  4W5O A;  3KLF A;  4DUZ K;  2ZF5 O;  3AVF A;  2VWJ A;  5I42 A;  3C6A A;  2BUP A;  3TAG A;  3OYM A;  3OJS A;  1SL0 A;  1LWE A;  3S3N A;  3HBT A;  4C8K A;  4CK1 A;  2KW4 A;  3T1A A;  1N8R O;  1TK8 A;  3H46 O;  1RDA A;  1NJI O;  1HYV A;  3DXM A;  3K2P A;  3JSM A;  2O8D B;  5EOY A;  3I33 A;  1TKZ A;  2A3Z A;  3DM2 A;  3SUQ A;  4DG1 A;  2NZT A;  2Z1H A;  3CQY A;  4JKF A;  1P8Z A;  4CJW A;  4JD2 B;  5AQU A;  2YHB A;  3P39 A;  3K0S A;  3RRH A;  4FJ5 A;  4FJX A;  2ITG A;  1JLA A;  4V19 S;  3HTV A;  3OYN A;  3OYA A;  4BRN A;  3SYZ A;  1IKV A;  1X3N A;  3MN7 A;  5AZJ B;  4CES A;  3S41 A;  1KFS A;  4FL9 A;  5FPN A;  3H3O B;  2HBK A;  5AQK A;  4M3T A;  3O9T A;  5KI6 A;  5F1X A;  3NF7 A;  3L2R A;  1E4F T;  3HPG A;  2HHS A;  1ITG A;  4NLB A;  4ELU A;  1C1A A;  4BR4 A;  4M3Y A;  3LAM A;  3WQT A;  4EZ9 A;  4G1Q A;  2A40 A;  3CME N;  4DSF A;  4DS5 A;  4CD3 A;  1LWC A;  3MMV A;  4FJN A;  3OS0 A;  1HMV A;  2YJF A;  3RR7 A;  1BWF O;  4H0X B;  3WNE A;  4JKE A;  5IWA K;  4BE1 A;  3O4Q A;  4EZ6 A;  3O9R A;  5EY4 A;  4A59 A;  5DK5 A;  1IKX A;  5FLX O;  2QKB A;  4YY3 K;  3E9O A;  3S3O A;  2GUP A;  2P9K B;  3UKR A;  5EX5 A;  1XNQ K;  1SAZ A;  2I5J A;  2P9L B;  3THV A;  4AF1 A;  4EAH D;  4FLU A;  4B9T A;  1WBB A;  1LW0 A;  1BQN A;  4CED A;  3UIQ A;  1KAX A;  3V9S A;  4CJR A;  4B9V A;  4U7B A;  1SL2 A;  4DV3 K;  3HPO A;  2VGN A;  1XHZ A;  3WNG A;  3W0L A;  4FW1 A;  3LM9 A;  3CPW M;  1JL2 A;  1XC3 A;  2P9I B;  1I3A A;  1XMO K;  1VSF A;  5D3G A;  5C15 A;  4H5V A;  3SPY A;  1NKB A;  4HVJ A;  2GX9 A;  4E7K A;  3PY8 A;  3CIP A;  2FLO A;  1KAY A;  5CY4 A;  2VG5 A;  3LM2 A;  2QI2 A;  2P9U B;  4NXN K;  4IJA A;  1YJW N;  3L2U A;  1IJJ A;  2X6S A;  1RBV A;  3QFP A;  3VQD A;  5LL6 Z;  4BGB A;  4DQS A;  4WFA L;  3K58 A;  4DQQ A;  1RTD A;  3DLK A;  4J2E A;  5AQO A;  2VYP A;  4OGE A;  1W7A A;  1X9W A;  4FWK A;  1EP4 A;  3PO4 A;  3ID6 A;  3MX2 A;  1LOT B;  4FLT A;  4CZG A;  3K59 A;  3M8R A;  3A2F A;  3QEP A;  2YNH A;  3VEV A;  3DLH A;  3G6E N;  4FZX C;  4KAZ A;  3LZJ A;  1ZBS A;  4O5F A;  3V9Z A;  3GDQ A;  3FFK B;  3VQQ A;  1RDU A;  3RRG A;  2GBZ A;  4KB1 A;  1C0T A;  3CJC A;  1VSJ A;  2OPS A;  3L4I A;  3U6F A;  4LF7 K;  4ISF A;  2HW3 A;  3D2F B;  3PIO L;  1A5W A;  4X66 K;  2ZM6 K;  3BZC A;  4YOX A;  3IAY A;  4OLA A;  3CQ8 A;  3OYE A;  3ITH A;  4NCA A;  1FKP A;  2D4W A;  1KCF A;  5AQZ A;  2O8C B;  1QS4 A;  3VQ4 A;  3J8A A;  3PV8 A;  4GV6 A;  4BRG A;  4B08 A;  2RKI A;  3VQ7 A;  1VQ5 N;  4PUO A;  4FVM A;  4CK3 A;  3L3V A;  3T69 A;  4WQ5 A;  4JI0 K;  3ZSQ A;  4DV5 K;  1ZBL A;  5BRF A;  3QBW A;  2QWM A;  4LFA K;  5JMV A;  3K9K A;  5KQD A;  2OTL N;  2XY6 A;  3U9D A;  1BA0 A;  4A61 A;  4AHC A;  3K57 A;  2OAN A;  1SKW A;  3PUF A;  3P38 A;  4CER A;  2QWO A;  1RBS A;  4BR7 A;  4KV8 A;  1DGK N;  3WXI A;  3PX6 A;  3C0B A;  3D6R A;  4BG9 A;  3KLG A;  4WQ4 A;  4O0I A;  3TAE A;  1RT5 A;  5BPM A;  1NJX A;  3SQ0 A;  3ZSY A;  4KHS A;  3J80 O;  2RF2 A;  3NHG A;  1C0U A;  3OYG A;  1WN7 A;  4BRF A;  1MU2 A;  2CGK A;  1VQN N;  2JWL A;  3TAB A;  1ASW A;  4NXM K;  4IOC L;  3KLI A;  5CZ1 A;  2QWP A;  1Q9X A;  1RT7 A;  4DB3 A;  2YHX A;  2UXB K;  4FJ9 A;  1KAZ A;  4RW6 A;  4AHV A;  3TWH A;  1TK0 A;  3A8Y A;  5FRM A;  1TL1 A;  5ADX A;  3ENB A;  4XH1 A;  1KQS M;  2QWR A;  5AZJ A;  4E7H A;  3T3F A;  3OYB A;  4IDH A;  3QES A;  3MEE A;  5CYQ A;  2HOE A;  3NBP A;  4FJ7 A;  4BC4 A;  1TUU A;  4FCY A;  4Z4E A;  2YCH A;  2KFN A;  4CJL A;  1YTA A;  2PAV A;  4CF9 A;  5GAG P;  4WQ4 C;  5AQN A;  4KPY A;  3DXM B;  3I0R A;  4Z4I A;  3EZW A;  3VGM A;  4CFA A;  2A1R A;  3BGR A;  1TYQ B;  3SMP A;  1WSJ A;  3EO3 A;  2E2N A;  4JNE A;  4BC5 A;  1D5A A;  5KGX A;  2NLX A;  4BRQ A;  5BN9 A;  3MED A;  2VQE K;  4KI6 A;  4KHW A;  3KK3 A;  3IMX A;  4N56 A;  2G8U A;  3CHW A;  2E8A A;  3A5M C;  4QAG A;  1ZYQ A;  4IJN A;  4CJP A;  1NK5 A;  4C23 A;  2ZGY A;  5ELZ A;  4EP5 A;  5C24 A;  4FJL A;  4IDK A;  5AZI B;  1Q82 O;  3EL2 A;  4N76 A;  4F2S A;  1CZ9 A;  2E2P A;  4WFN L;  3SV3 A;  4CW7 B;  4AHU A;  3THX B;  4IEE A;  3VTH A;  3LPU A;  5CHI A;  4IO8 A;  2DFE A;  3NH1 A;  3RMD A;  1J53 A;  3VMF B;  3O3H A;  4I2Q A;  5AQV A;  1IKW A;  4FLX A;  4OKJ A;  2KHO A;  5KRS A;  1YUW A;  3MXI A;  3S3M A;  4RWT A;  5C2F A;  2UXD K;  4HUG A;  4DTO A;  4CHZ A;  1P90 A;  4W5N A;  1RGI A;  3IFR A;  4CGD A;  3CFR A;  4FJM A;  4CEO A;  1NK6 A;  3C6T A;  1D9F A;  1ZXO A;  1JLC A;  4CJE A;  4B8C A;  1YHQ N;  3O9Q A;  5JS1 A;  4B1X B;  4JKA A;  1ESV A;  4CEF A;  1Z6R A;  4CGI A;  3OYJ A;  1T05 A;  4NCB A;  3ZT0 A;  3CCM N;  2BE2 A;  5TKW A;  2VCP A;  5AQR A;  1X9S A;  4LFB K;  4G9Z A;  3O8M A;  2JGU A;  4CZE A;  3OYH A;  4BRL A;  3ULE B;  2NUB A;  4A2B A;  1YXQ A;  2NRH A;  1HPZ A;  4KHQ A;  2BAN A;  2ETJ A;  5MLC Q;  1MDU B;  4K41 A;  2ZJP L;  3KK1 A;  4LF9 K;  2IIR A;  4H0T B;  4ICL A;  1JLF A;  2Z1J A;  3NH0 A;  3HYF A;  1M1K O;  3EY1 A;  1HJO A;  3TAM A;  3B8A X;  1C6V A;  3QNO A;  1JLQ A;  4O8K A;  4M41 A;  3S9H A;  3O4W A;  1S1X A;  4FZZ A;  3SV4 A;  1ATR A;  1YIT N;  1RT3 A;  2HBJ A;  4L8R B;  5HRS A;  4M3R A;  3TPQ A;  4JS5 A;  2ASO A;  1KD1 O;  4K25 A;  3IS9 A;  1K8K A;  1NJW A;  3AO1 A;  4DFM A;  5E26 A;  1L3T A;  1Q18 A;  4CEB A;  2HNZ A;  1HYS A;  1V4S A;  4X64 K;  1GOA A;  1DTT A;  1ZBF A;  3D0P A;  4DR1 K;  3KLH A;  1OH8 A;  5BN8 A;  2PY5 A;  3V6D A;  1QSL A;  1QHA A;  3FZK A;  1U48 A;  3F9M A;  1CZB A;  1RIL A;  2YJE A;  2NRW A;  1T8E A;  3CCQ N;  3V9W A;  1ASV A;  5DMR A;  3WEE B;  4H0Y B;  1NOY A;  4FWO A;  2FSN A;  3FZL A;  4RTF D;  1UA1 A;  4J2B A;  2P9N A;  1Q7Y O;  2KTQ A;  4H03 B;  3CCL N;  2KFZ A;  3EYZ A;  4HTL A;  1N5Y A;  3G25 A;  5J2Q A;  4MDA A;  4E19 A;  5HRR A;  5LJV A;  4OLB A;  3IUC A;  3T19 A;  4CF0 A;  5DM7 L;  1GLB G;  3SBG A;  2CH5 A;  4CEC A;  1YJN N;  2ZJR L;  1VSH A;  1GLJ O;  4GVM A;  2NRZ A;  3AV9 A;  1RDD A;  1YTU A;  3VEY A;  5AZI A;  2XRI A;  1YVN A;  2ASP A;  1K73 O;  3RVC A;  3HST B;  2OA8 A;  1Q8I A;  4BWM A;  2V51 B;  1TKD A;  3VF6 A;  3M8P A;  1OH7 A;  4NB4 A;  3H3N O;  3LAK A;  4XIU A;  3T7Z A;  3VEX A;  5GIN A;  3C7N B;  1OH6 A;  1TGO A;  4FXD A;  3M3Z A;  4BRK A;  2D1K A;  2O8D A;  4YOY A;  2KQ2 A;  2HHX A;  4IG0 A;  3WUH A;  3NGI A;  2Q31 A;  1RBU A;  4E7J A;  4JI6 K;  2HBL A;  3VQ6 A;  1L3U A;  2EWS A;  1BIZ A;  4BDP A;  1BUP A;  4FLY A;  3AVB A;  3SUO A;  4FWL A;  4WYB A;  3DRR A;  4B1W B;  4DUY K;  4BDY A;  4RW4 A;  2F9T A;  2P9U A;  3KD5 E;  3O08 A;  4F9O A;  1QQO A;  4CGF A;  2G8I A;  2FSK A;  4M3Z A;  3HXM A;  3EKU A;  4LF8 K;  2NRX A;  5JLH A;  1FXX A;  3HZ6 A;  1IBL K;  1L3V A;  3VOV A;  3OJU A;  4JRQ A;  3LWL A;  3NDK A;  4DR5 K;  1TYQ A;  3SAF A;  4EFH A;  2P5O A;  2E6M A;  4R5P A;  5HL7 L;  2BGG A;  2OZS A;  1O13 A;  1TV6 A;  3UB5 A;  4NLC A;  4RW9 A;  4JEP A;  1TL3 A;  3CCV N;  1S1W A;  3SJJ A;  5AQW A;  4JK9 A;  1MA9 B;  4L3Q A;  4E3S A;  1NGE A;  3UKR B;  1WSE A;  3C6H A;  1NGH A;  2B6A A;  5F0X A;  4M3U A;  3MCA B;  3RMC A;  4E0D A;  3EE9 A;  4JKD A;  3CYM A;  4YOW A;  4CJU A;  2O4I A;  4F2R A;  3AAP A;  5J1E A;  3G4S N;  3NF6 A;  3C65 A;  1XUP O;  3HRG A;  3KKR A;  4PY5 A;  1IH7 A;  1Q86 O;  1NK9 A;  3OHR A;  3OYD A;  4ZHR A;  1XNR K;  3H1V X;  1IG9 A;  1K6Y A;  4B3M K;  1T6D A;  4NYF A;  5C10 A;  5KPT A;  4PWD A;  1S1U A;  3DOL A;  3THW B;  4KHN A;  1IO2 A;  3CI5 A;  1NKC A;  1KVA A;  4DSL A;  5M1Q A;  4FYD A;  2YKN A;  4IFE A;  1FK9 A;  4C8M A;  1OVY A;  3I8B A;  1NJY A;  3AA5 X;  4CZJ A;  2OTJ N;  1Y97 A;  4DF8 A;  4GV3 A;  3ZX2 A;  4Q0B A;  4JI2 K;  2WUS A;  2FF6 A;  4JKG A;  3VQ8 A;  2YNI A;  3THY A;  4AHR A;  1T6C A;  4CJV A;  4BQL A;  1U47 A;  3U3G A;  3TAF A;  2BDP A;  5JVG L;  2E1Z A;  3P83 D;  2OPR A;  2KKZ A;  1J5E K;  2FBT A;  1D4X A;  1YVU A;  3O3G A;  2NNW A;  4HUE A;  3BY5 A;  3NMU A;  1HKC A;  1S9G A;  3H6E A;  1QSS A;  3V9U A;  3AGK A;  3ULE A;  3VGK A;  3HP9 A;  3J81 O;  3QEV A;  1U49 A;  1KC8 O;  4O55 A;  3PX4 A;  3RWU A;  4DCH A;  3DLL L;  4BDZ A;  2W42 A;  4JI8 K;  1IV0 A;  4KH5 A;  4M63 C;  1B92 A;  2B5J A;  4Z4F A;  2FC0 A;  5J2M A;  5C0Y A;  3UKU B;  2XY8 A;  3MN6 A;  1VSL A;  4FOE A;  1WSF A;  3OS1 A;  1BA1 A;  2UUC K;  2G8K A;  4HWI A;  1U04 A;  1EET A;  4ISG A;  1DEJ A;  3RMA A;  4GY2 B;  2XO7 A;  3MX5 A;  4KB0 A;  4LSL A;  4KFB A;  1SKR A;  2O8C A;  1J9A A;  3BEX A;  3E9P A;  4DV1 K;  1LCU A;  3SMS A;  4AHT A;  4OKK A;  5AQI A;  4RCH A;  4E89 A;  1G99 A;  4CJQ A;  3LPT A;  3NH2 A;  4H5N A;  3THX A;  2I7P A;  1XI1 A;  3F9K A;  4JI5 K;  2FSJ A;  5KGW A;  4JD2 A;  3V9X A;  4DQP A;  4M42 A;  5M1K A;  5JLF A;  4B8A B;  1IBM K;  2QM1 A;  3AVL A;  1ZBI A;  2E2O A;  1VAZ A;  3L4Q A;  4H0O A;  5BPN A;  1WUA A;  4CJ5 A;  4X65 K;  3MCP A;  3SK3 A;  2UYT A;  4MDB A;  1BG3 A;  3AVJ A;  4DTR A;  3ZSZ A;  1RDB A;  2P9S B;  2A6A A;  1UOC A;  1NGF A;  1T7P A;  4F8R A;  3NGY A;  3AO5 A;  4FWN A;  3QML A;  4DU4 A;  4CJ4 A;  2OPP A;  4H4O A;  4FLV A;  4AQY K;  1R59 O;  1KLM A;  3DI6 A;  2NRR A;  3OY9 A;  2PZS A;  3PLA A;  1KSP A;  2O8F A;  2Y1J A;  3LDO A;  3NAE A;  1HJR A;  3UE5 A;  3E1Y A;  3H08 A;  4Z4G A;  3AVI A;  1QE1 A;  4N5S A;  2HST A;  5LMU K;  4O8U A;  4CIG A;  2YHA A;  3SAH A;  3MDQ A;  4LF5 K;  4XH4 A;  2G8W A;  3KK7 A;  4QS7 A;  2R7Y A;  1W9H A;  2XHB A;  5M1F A;  3CG7 A;  1NG9 A;  1RTH A;  3NF9 A;  4IO9 L;  3EE8 A;  1I39 A;  1WAF A;  5IT9 O;  1TAQ A;  2W6L A;  4DR7 K;  3M8S A;  3L6Q A;  5HRN A;  1SS6 A;  1SUQ A;  4B3T K;  4RW8 A;  4DR3 K;  1W0H A;  3OYL A;  1BHL A;  4WE1 A;  4IEI A;  4DTX A;  3LZI A;  4OPK A;  3WQU A;  1S6Q A;  4QOZ B;  1CLQ A;  2V52 B;  3VQP A;  3QIO A;  3BP8 A;  2QK9 A;  4B1V A;  4I9Q A;  2ATQ A;  4DV7 K;  1TKX A;  3P31 A;  3QET A;  3OVN A;  2E4L A;  5C42 A;  2D0O A;  1TAU A;  3LDN A;  1L3S A;  2WON A;  4FJ8 A;  4FPA A;  5BR9 A;  4DQ8 A;  5FRO A;  4Y0W A;  4BRC A;  3KWI A;  3NCI A;  1QVF M;  2YNF A;  2RN2 A;  4OPA A;  2GWJ A;  4KHP K;  2PYL A;  4FK4 A;  3DLE A;  3VQB A;  3TAP A;  5FRN A;  3CM5 A;  4LY7 A;  3CC2 N;  4BAC A;  3QFU A;  3LWM A;  3VA3 A;  4H5W A;  4LH5 A;  3CC7 N;  3SBT A;  3ZX3 A;  2G8F A;  3BF1 A;  3DRS A;  4BC3 A;  1RT6 A;  1JLB A;  3FGU A;  2F8T A;  4CZK A;  3I55 N;  2FF3 B;  3WXM B;  4DSI A;  2ZGZ A;  4AM7 A;  3NE6 A;  1NOZ A;  4RW7 A;  2ZD1 A;  2QW9 A;  2QXF A;  4C1N K;  5JVH L;  3TAR A;  1SL1 A;  4KRF A;  3AVA A;  3LDL A;  1S72 N;  1DTQ A;  4HUF A;  4CVN E;  4QS8 A;  2X6N A;  3NF8 A;  1BCO A;  3K5L A;  2ASM A;  3OBY A;  4ELT A;  1VHX A;  4PQU A;  4DHY A;  3AGR A;  1S1V A;  2IVP A;  2DTU A;  4DU1 A;  4KBO A;  4CD1 A;  5DM6 L;  4EIA A;  2Z1I A;  4OGC A;  1WAJ A;  3ID8 A;  2V7Z A;  3LAL A;  1HQE A;  3D2E B;  4PA1 A;  3LDS A;  3CQX A;  4FK0 A;  1NLV A;  5FPD A;  4FW2 A;  4CEZ A;  3NVK A;  4ZTF A;  4DR4 K;  4B3S K;  4IG3 A;  4KKO A;  3KJV A;  1REV A;  5KPR A;  4BVP A;  4Z94 A;  5C25 A;  5C12 A;  3DOK A;  1SQK A;  2ZWH A;  2FBX A;  3DJC A;  4F4K A;  4B9S A;  3R1X A;  1U2V B;  1KXP A;  2VGM A;  3C94 A;  3O6W A;  3I8D A;  2ZJQ L;  4A62 A;  3L2Q A;  4FWM A;  3FZH A;  2DPN A;  1VQL N;  1BOT O;  1GLC G;  3WEE A;  3FZF A;  1J54 A;  3LP1 A;  1NK8 A;  1K8K B;  3QB0 A;  1YJ9 N;  3NVM A;  4I7F A;  3VF2 A;  1XMQ K;  3TTD A;  5AQY A;  4BR9 A;  2HF3 A;  3CJB A;  1HKB A;  4LH4 A;  2YI1 A;  4UY8 O;  1BDG A;  1BQM A;  4CFB A;  1N34 K;  3TSU A;  2HHU A;  3M8Q A;  4DF4 A;  2NRV A;  1C1C A;  4CIF A;  3K5N A;  3DXK A;  3AVN A;  4FLW A;  1RBT A;  3SNN A;  3G10 A;  3QIC A;  2X74 A;  4CEA A;  4JI7 K;  1OKJ A;  4JLH A;  3CJ7 A;  5M1N A;  3NGZ A;  4XH5 A;  2P5G A;  2P9L A;  3C7N A;  1HUX A;  2DY4 A;  4B1U B;  1NGA A;  3VQE A;  4FLZ A;  3AY9 A;  4CJS A;  3CC4 N;  1BI4 B;  4IOA L;  3CER A;  2W40 A;  3D45 A;  4BRD A;  4B9L A;  4JKG B;  2QWN A;  4CBW A;  4CHQ A;  4JYA K;  1QHT A;  3THY B;  2HND A;  2Q97 A;  2P9K A;  2HBM A;  2IOC A;  4KRE A;  4JK7 A;  4JKH A;  4DTS A;  1DT9 A;  3LP0 A;  3OBW A;  3AAQ A;  5AFU A;  3IKM A;  1G15 A;  4CJK A;  3H45 C;  2AJQ A;  1T44 A;  3DXK B;  3ATU A;  5EXW A;  3ZEU A;  1S22 A;  1O1W A;  3LDP A;  2LSN A;  3V1O A;  3ZT4 A;  1J5O A;  3HP6 A;  1UWB A;  2UXC K;  2Q3S A;  2VQF K;  4PKH A;  4Z4C A;  5AFU H;  4FWQ A;  5AQJ A;  3HVT A;  3V1R A;  4CF2 A;  3PSI A;  4Y1C A;  3RSE B;  4OJR A;  1HNX K;  4I9L A;  3AVK A;  3VQA A;  4DFJ A;  3ZSW A;  2QEX N;  1NGG A;  1NU0 A;  3ENO A;  1A5V A;  2FXU A;  4QS9 A;  3MXJ A;  5ADX H;  5SZT A;  3ZT3 A;  1H1V A;  1SKS A;  1BU6 O;  2UU9 K;  4HCB A;  1RTJ A;  4DFP A;  3TAN A;  3HOS A;  3EKS A;  3SQ4 A;  2JWK A;  4BRE A;  1LWF A;  2P9I A;  3CMA N;  1BL3 A;  3F73 A;  4TSX A;  2Q0U A;  1LAW A;  3KVG A;  4KTW A;  3WXJ A;  1QQC A;  3ZCM A;  4BRP A;  5JIC A;  1NMD A;  3HPH A;  3U9Z A;  3GE1 A;  1GLL O;  2QKK A;  1QTM A;  2GTD A;  4B9M A;  1WLJ A;  3JXU A;  1ZBU A;  2HB5 A;  3GL1 A;  3VEO A;  1QZ6 A;  2PYJ A;  4FWS A;  3BDP A;  1S6P A;  3AVC A;  4JS4 A;  2WOM A;  2QTD A;  4N47 A;  3CD6 N;  4K42 A;  3MAQ A;  4EHU A;  2O8E B;  3E66 A;  4CZL A;  4DMN A;  5KRT A;  3I0S A;  1UAX A;  5HP1 A;  4O0J A;  4BRO A;  3CFP A;  3QO9 A;  4DKW A;  3ASM A;  5AQX A;  3AA3 A;  4M3X A;  4A5A A;  3RR8 A;  2QWL A;  4BE0 A;  4CEE A;  2HHT A;  3R9P A;  4AH9 A;  1E4G T;  1CXQ A;  4BVO A;  2RE2 A;  4PKG A;  3OTO K;  5AQP A;  4DSK A;  3JS6 A;  2P9S A;  3D2E A;  2P9P A;  1YI2 N;  4N41 A;  4CZF A;  2W6K A;  4GV9 A;  1D9D A;  1WOQ A;  3QIP A;  1EXQ A;  1V4T A;  1T03 A;  3MEG A;  1KTQ A;  2Q1N A;  4LD0 A;  2A1S A;  4CZI A;  3ALY A;  4BRI A;  3NFA A;  5FPE A;  4Z4H A;  2IVN A;  1VQK N;  2IS3 A;  1WBD A;  1I94 K;  4CFC A;  5M1P A;  4B3O A;  1S3X A;  4H5R A;  2YX6 A;  4FSV A;  3OYF A;  3HT3 A;  4ILH A;  4IKF A;  1JCG A;  1SV5 A;  3FLC O;  1U2V A;  3O3F A;  1GOC A;  5E84 A;  2Q2R A;  4K43 A;  3CJA A;  1FW6 A;  3ENH A;  1W2B M;  2P9P B;  2VWK A;  5A2Q O;  5GIO A;  5GAD P;  2VG6 A;  3EN9 A;  5GIP A;  2Y1I A;  3SQ1 A;  3K5O A;  3ZSR A;  1N6Q A;  3FR0 A;  4YDU A;  1L5U A;  2OYQ A;  1KVC A;  3KK2 A;  3AVH A;  1OH5 A;  1NWK A;  4OO1 J;  1K9M O;  4FPB A;  4E1J A;  4WFB L;  1LAV A;  5CR4 A;  2HHV A;  3TTF A;  3ZSV A;  4A57 A;  1XWL A;  4CHY A;  4DSE A;  4K8X A;  4WQ5 C;  4GKK K;  1ZC6 A;  2YV0 X;  3O1W A;  3J7Z O;  5HRO A;  3VQ9 A;  4CI6 A;  4JHD A;  3M1F A;  3JAM O;  3HK2 A;  3VF4 A;  3SLC A;  1HNZ K;  3WNF A;  2YKM A;  3J7A P;  2PBD A;  1QZ5 A;  2IVO A;  2FBY A;  2EX3 A;  4C8O A;  2O4G A;  1NMN A;  2HMP A;  1ATS A;  1XQS C;  4DV2 K;  1VQO N;  4LC9 B;  5M1O A;  2HHH K;  3CFO A;  2DFF A;  4DWI A;  1IKY A;  1K8A O;  3ZET A;  1HRH A;  5BPL A;  2W41 A;  4IFV A;  4A5B A;  4BRM A;  4J2D A;  2PFU A;  3IDH A;  1GLE G;  1S1T A;  3B6P A;  3GBT A;  3IRX A;  4FJJ A;  4BQZ A;  4YOU A;  1N36 K;  1HKG A;  1Y64 A;  5LJW A;  3VQ5 A;  5AR0 A;  2AP1 A;  4OVL A;  1Z25 A;  2JLE A;  5E41 A;  2HHW A;  3IG1 A;  1WNS A;  4GNI A;  4IWV A;  4GW6 A;  1NGI A;  1Z26 A;  2WFB A;  3A5L C;  3OYI A;  4EP4 A;  4DLG A;  4KI4 A;  2I7N A;  3B6O A;  1HNV A;  4I6M A;  4CGJ A;  2D5R A;  4O5B A;  3LDQ A;  5FDL A;  3VTI A;  2O8B B;  2WBN A;  4BC2 A;  5BRD A;  4DV4 K;  3ZEU B;  2ZE2 A;  4FZY A;  3N4Q A;  4PL8 A;  5HOO A;  4BRA A;  2HF4 A;  1KLN A;  1S5J A;  4ELV A;  3BZK A;  3CM6 A;  4YOT A;  2BTF A;  3SAG A;  4JV5 K;  4DLE A;  3ZET B;  5BR8 K;  3O4N A;  3L3U A;  1NGC A;  1NNE A;  3HI0 A;  4NO7 A;  4NCG A;  4CBX A;  2B4J A;  2F9W A;  1N33 K;  1C1B A;  1VSK A;  3O1B A;  1RBR A;  5EU7 A;  1RTI A;  4M7X A;  3RMB A;  4JI3 K;  4YFU A;  4J8F A;  3K5M A;  3DLG A;  3TTC A;  2E2Q A;  4FWR A;  3WNH A;  4CGG A;  4W5R A;  4AHS A;  5I9E B;  5B8H A;  3PX0 A;  4B9N A;  2O8B A;  5KQ8 A;  5JS2 A;  2EHG A;  2D0C A;  1HR0 K;  5AQF A;  1T3V A;  1YAG A;  5GAH P;  4HTU A;  4BGA A;  1KFD A;  3TI0 A;  4BR0 A;  4YOV A;  3WT0 A;  3MEC A;  4MLH A;  2G8H A;  4MQ3 A;  1BIS A;  3A0I X;  4FJI A;  1NBW A;  3TU5 A;  5H1S Q;  1IBK K;  4DQR A;  4B9Q A;  5KPZ A;  3QLH A;  3KLE A;  2E1Y A;  5GAE P;  3LP3 A;  4BY9 C;  4OPH A;  1VQ9 N;  3AO2 A;  4FJG A;  4JAX A;  4DS4 A;  4LF4 K;  3CCE N;  2O8E A;  1FKO A;  2V7Y A;  1JJ2 M;  4CJT A;  4M3W A;  4B1Z A;  2HMI A;  1JL1 A;  4JN4 A;  4LF6 K;  4M7Y A;  3ISN C;  1NKE A;  1B9F A;  2E6L A;  1ATN A;  1U4B A;  4LSN A;  3P4I A;  3M5R A;  3VEW A;  1BIU A;  3HSC A;  3CCS N;  3ZT2 A;  2P51 A;  4CBU A;  4H5T A;  4YDU C;  1NJZ A;  2IGI A;  1WB9 A;  3AO3 A;  4CF8 A;  4CZM A;  3L2V A;  1E3M A;  4UQG A;  3OYK A;  3VEN A;  1NGJ A;  1KRP A;  2OPQ A;  4ILG B;  1W97 L;  1U6Z A;  3KIO A;  1VSM A;  1D8Y A;  5C2D A;  3AAR A;  4M45 A;  4MO4 A;  5AQL A;  3U4L A;  3FZM A;  4RG8 A;  2VWB A;  4CJ7 A;  5BRH A;  4CJ3 A;  1FJG K;  3T1H K;  4CHO A;  4OX9 K;  3AVG A;  1IG8 A;  1EWQ A;  2FBV A;  3CPE A;  3O9U A;  5KTQ A;  1VQ6 N;  2GEM A;  1RCH A;  4KTZ A;  2QXL A;  3TSP A;  4EHT A;  3VES A;  4DFK A;  3HM8 A;  5K14 A;  2YHW A;  1VSI A;  1EKE A;  3O9S A;  1VQ7 N;  4FK2 A;  1NGB A;  4FM1 A;  4MO5 A;  4ID1 A;  3A5N C;  1JXB A;  4O44 A;  3CCU N;  1QSY A;  4FM2 A;  1HYZ A;  2E20 A;  2F4V K;  4CHP A;  1HPM A;  3E01 A;  1EWR A;  5HLF A;  1RDW X;  5F2R A;  5HBM A;  3VET A;  4E7I A;  3SCX A;  3QNN A;  4ILJ A;  3SUP A;  1BCM A;  1ASU A;  1WSI A;  5I3U A;  1VRT A;  1N32 K;  4KH6 A;  1JCE A;  2RPI A;  3VEZ A;  2AA4 A;  1BI4 A;  1JLG A;  2GWK A;  1YF5 L;  4KH4 A;  1EQY A;  2E5L K;  1KVB A;  5FPM A;  3MK6 A;  1RNH A;  1S9E A;  4YNQ A;  4BG8 A;  2P9N B;  4DTN A;  4DU3 A;  4K0K K;  5LMN K;  1TK5 A;  4CJF A;  3V4I A;  2BH1 A;  3O80 A;  3PSF A;  5AQH A;  3QEW A;  3H1Q A;  4H4M A;  3BUZ B;  4F3T A;  3ZT1 A;  1RT2 A;  1RT1 A;  3KD1 E;  5T7B A;  3C6U A;  3RTV A;  3CXC M;  2NRT A;  3E9L A;  1MWK A;  1VK0 A;  1TVR A;  4Z0U A;  4ISE A;  3CJ1 A;  2F8S A;  3HOT A;  3D2F A;  3MWT A;  1CZA N;  2YHY A;  2KZZ A;  3SQ2 A;  3PIP L;  3CET A;  5J2P A;  1C0F A;  4LFC K;  3LL3 A;  3AVM A;  3ATV A;  2HNY A;  4KHY A;  3SZ2 A;  4CEQ A;  4E7L A;  1OVQ A;  1UA0 A;  4CZH A;  2WC9 A;  2D0P A;  4W5Q A;  3W3D A;  1C0G A;  3DWL A;  4U67 L;  5SWM A;  3GG4 A;  2P1J A;  3KZB A;  3CF5 L;  5BRE A;  3PO5 A;  2HVH A;  2Q0R A;  4FJH A;  4OKE A;  1VRU A;  4DTU A;  4H8K A;  2IDO A;  3OA9 A;  4IOX A;  3QEX A;  4FJK A;  3EZ5 A;  1DKG D;  3SPZ A;  4IZ9 A;  4CHN A;  4WCE L;  4IXC A;  3K9J A;  4C8N A;  1NK0 A;  4I2P A;  2ITM A;  4B1Y B;  4F3O A;  3OW2 M;  4C8L A;  3Q7B A;  2WTU A;  2UUB K;  1JLE A;  4KHU A;  3KKS A;  3KWG A;  2YNG A;  3R6M A;  1Q9Y A;  4K8Z A;  4XEI A;  4DV6 K;  2D0A A;  3HO1 A;  4DV0 K;  2XY7 A;  4E1N A;  4CGH A;  4JK8 A;  4J2A A;  3V1Q A;  4BR5 A;  2ZQB A;  4Y1D A;  5AQT A;  4CF1 A;  2UUA K;  4JI1 K;  2VG7 A;  3JYT A;  4CIE A;  1HQU A;  1X3M A;  1ZBH A;  4WF9 L;  1U45 A;  5LY3 A;  3AA4 A;  4DTM A;  3KHY A;  5HRP A;  5J2N A;  3N4P A;  1GLA G;  1TKT A;  2CGL A;  3RSE A;  2KZM A;  4HHT A;  3SUN A;  2E88 A;  3VGL A;  4BE2 A;  3TAQ A;  4FOI A;  1XC9 A;  3AO4 A;  5AQM A;  3I56 N;  3QER A;  1A5X A;  4GKJ K;  4CK2 A;  1QQN A;  2X78 A;  3VN5 A;  3FFI A;  1Z05 A;  2QWQ A;  3MN5 A;  1VQM N;  4AIL C;  1RT4 A;  3MWP A;  3DLB A;  3DRP A;  1HX1 A;  1HLU A;  1YIJ N;  4B9U A;  2D0B A;  4BR2 A;  5EVZ A;  3EEQ A;  1YT3 A;  2GEL A;  3DMJ A;  1VQ8 N;  1HNI A;  1CXU A;  2A42 A;  3FE1 A;  1TUY A;  1F21 A;  3G71 N;  2CGJ A;  5CE3 A;  1WSG A;  4QCL A;  1VSE A;  2GUI A;  4C1N I;  3KTQ A;  1B9D A;  3SJH A;  3P1G A;  3VQC A;  4FO0 A;  1EO1 A;  1NM1 A;  3UKU A;  3HJF A;  4I6M B;  4FWP A;  4BWJ A;  1JCF A;  1X9J A;  4DR6 K;  4JKC A;  1BO5 O;  1X9M A;  3LAN A;  4PL7 A;  3J7Y P;  4JRP A;  1X1P A;  1VSD A;  2A5X A;  4PKI A;  3OYC A;  4H0V B;  4YHH K;  3P5J A;  4GVE A;  1WSH A;  4IBN A;  4KTQ A;  4MFB A;  1QVG M;  3G0Z A;  2HHQ A;  1EX4 A;  3ZYY X;  3QIN A;  4NYN A;  2KLA A;  1J6Z A;  2OZM A;  1NK4 A;  2HVI A;  2IC3 A;  1JXE A;  3GOI A;  3F5T A;  3HM9 A;  3C95 A;  4JKB A;  1M90 O;  3QBX A;  4R79 A;  4MLE A;  2G8V A;  3DLR A;  4DSJ A;  2DFH A;  1C0M A;  4JHD B;  4ID5 A;  4CE9 A;  3DYA A;  1HNW K;  4JI4 K;  4FVU A;  2GV9 A;  4X62 K;  1JKH A;  2H3G X;  4CFD A;  3HVR A;  3O5B A;  3WXL A;  4ZTJ A;  4HCC A;  3T1Y K;  1RDC A;  1BGX T;  3L2W A;  5TKY A;  1XHX A;  3V81 A;  4IFY A;  2F96 A;  3L0Q A;  4E1M A;  3QEI A;  3THW A;  3R8E A;  3ZSO A;  2Q36 A;  3QDK A;  2XY5 A;  2CH6 A;  5AJ3 K;  1NGD A;  3WXK A;  3HL8 A;  3SI6 A;  4GMJ B;  5AQG A;  3L8B A;  2F7T A;  2RHK A;  3CJ9 A;  4H0P A;  3BF3 A; 
#chains in the Genus database with same CATH homology
 3B6O A;  2E4L A;  1HNV A;  3OVN A;  5C42 A;  4HUG A;  4DTO A;  1L3S A;  4CGJ A;  2D5R A;  4CHZ A;  2WON A;  4FJ8 A;  4O5B A;  1TAU A;  5FDL A;  4W5N A;  4CGD A;  5FRO A;  2Z1G A;  3AA2 A;  3CFR A;  4FJM A;  3ZSX A;  2ZE2 A;  3NCI A;  4FZY A;  2YNF A;  2RN2 A;  3LP2 A;  4CEO A;  5CYM A;  1NK6 A;  3C6T A;  2PYL A;  1D9F A;  4FK4 A;  3DLE A;  3VQB A;  3TAP A;  1KLN A;  1JLC A;  4CCH A;  5FRN A;  1S5J A;  4ELV A;  3CM5 A;  4CJE A;  3MXM A;  4B8C A;  3CM6 A;  2IAJ A;  5JS1 A;  4LY7 A;  4BAC A;  3OS2 A;  3VA0 A;  1GOB A;  4KO0 A;  4Q5V A;  3LWM A;  3VA3 A;  4LH5 A;  4DLE A;  2G8F A;  3DRS A;  3L3U A;  1DLO A;  3O4N A;  5CZ2 A;  4CEF A;  1RT6 A;  4CGI A;  3OYJ A;  1JLB A;  1T05 A;  2F8T A;  4NCG A;  2B4J A;  4DQI A;  4NCB A;  3ZT0 A;  1C1B A;  1VSK A;  2BE2 A;  4DSI A;  1RBR A;  1X9S A;  5EU7 A;  3NE6 A;  1RTI A;  1NOZ A;  4RW7 A;  2ZD1 A;  3ULD A;  3RMB A;  2JGU A;  4YFU A;  2QXF A;  3OYH A;  3TAR A;  1SL1 A;  4DTP A;  3K5M A;  3DLG A;  4FM0 A;  3TR8 A;  4KRF A;  4DTJ A;  2NUB A;  3AVA A;  4OPJ A;  1LV5 A;  4O4G A;  1HPZ A;  4KHQ A;  1DTQ A;  2BAN A;  3WNH A;  4CGG A;  2ETJ A;  4AHS A;  4W5R A;  4HUF A;  1LW2 A;  3U3Y A;  4B9N A;  3PX0 A;  4W5T A;  5JS2 A;  2EHG A;  3KK1 A;  2X6N A;  1R0A A;  2D0C A;  3NF8 A;  1BCO A;  4ICL A;  3K5L A;  1JLF A;  2Z1J A;  1NK7 A;  4HTU A;  4ELT A;  3NH0 A;  4W5O A;  3HYF A;  3KLF A;  1KFD A;  3EY1 A;  3TI0 A;  3TAM A;  4PQU A;  1S1V A;  3AVF A;  2VWJ A;  3MEC A;  1C6V A;  3QNO A;  1JLQ A;  2DTU A;  5I42 A;  4DU1 A;  4M41 A;  2G8H A;  3S9H A;  4MQ3 A;  1S1X A;  1BIS A;  4FZZ A;  3TAG A;  4FJI A;  2Z1I A;  4OGC A;  3SV4 A;  1WAJ A;  4DQR A;  1RT3 A;  3LAL A;  3OYM A;  1HQE A;  3OJS A;  1SL0 A;  4L8R B;  5HRS A;  4PA1 A;  3LDS A;  1LWE A;  4M3R A;  3S3N A;  4FK0 A;  4JS5 A;  3QLH A;  3KLE A;  4C8K A;  4CK1 A;  3LP3 A;  3IS9 A;  3AO2 A;  4FW2 A;  4CEZ A;  2KW4 A;  3T1A A;  4FJG A;  1NJW A;  3AO1 A;  4ZTF A;  4DFM A;  1L3T A;  1TK8 A;  4IG3 A;  4CEB A;  1RDA A;  1HYV A;  4KKO A;  3KJV A;  2HNZ A;  4DS4 A;  1HYS A;  1GOA A;  1REV A;  3K2P A;  1DTT A;  1ZBF A;  3JSM A;  3D0P A;  3KLH A;  1TKZ A;  1FKO A;  3DM2 A;  3SUQ A;  4DG1 A;  5C25 A;  2PY5 A;  3DOK A;  4CJT A;  2Z1H A;  3V6D A;  1QSL A;  4M3W A;  1U48 A;  2HMI A;  1JL1 A;  4CJW A;  1CZB A;  2FBX A;  3ISN C;  1RIL A;  1T8E A;  4F4K A;  1NKE A;  3V9W A;  2YHB A;  4B9S A;  1ASV A;  1B9F A;  2E6L A;  5DMR A;  3RRH A;  4FJ5 A;  1U4B A;  4LSN A;  4FJX A;  2ITG A;  1BIU A;  1NOY A;  1JLA A;  1UA1 A;  4J2B A;  3ZT2 A;  2P51 A;  3OYN A;  3OYA A;  2KTQ A;  2KFZ A;  3C94 A;  3SYZ A;  1IKV A;  3I8D A;  3EYZ A;  1NJZ A;  1N5Y A;  2IGI A;  5J2Q A;  3AO3 A;  4CF8 A;  4CES A;  3L2Q A;  4E19 A;  3L2V A;  5HRR A;  4OLB A;  1KFS A;  3T19 A;  4CF0 A;  1J54 A;  4CEC A;  3LP1 A;  4UQG A;  3OYK A;  1VSH A;  1NK8 A;  4GVM A;  3AV9 A;  1RDD A;  4I7F A;  1YTU A;  1KRP A;  2OPQ A;  4M3T A;  2XRI A;  5KI6 A;  3KIO A;  1VSM A;  3NF7 A;  3L2R A;  3HST B;  1D8Y A;  2OA8 A;  1Q8I A;  4BWM A;  4M45 A;  1TKD A;  3M8P A;  4LH4 A;  3HPG A;  2HHS A;  4RG8 A;  1ITG A;  4ELU A;  1BQM A;  1C1A A;  3LAK A;  4CJ3 A;  4CFB A;  4XIU A;  4M3Y A;  4CHO A;  3LAM A;  4EZ9 A;  4G1Q A;  2HHU A;  3AVG A;  3M8Q A;  1TGO A;  4DSF A;  4DS5 A;  4DF4 A;  4FXD A;  1C1C A;  2FBV A;  4CIF A;  2KQ2 A;  3K5N A;  4IG0 A;  3NGI A;  2HHX A;  1LWC A;  1RBU A;  3AVN A;  4E7J A;  4FLW A;  1RBT A;  3VQ6 A;  5KTQ A;  4FJN A;  3SNN A;  3G10 A;  1L3U A;  2X74 A;  4KTZ A;  1HMV A;  1RCH A;  3OS0 A;  1BIZ A;  4CEA A;  4BDP A;  3RR7 A;  4FLY A;  4JLH A;  3AVB A;  4DFK A;  5K14 A;  3NGZ A;  3SUO A;  2P5G A;  3WNE A;  1VSI A;  1EKE A;  4BE1 A;  3DRR A;  4FK2 A;  3O4Q A;  4EZ6 A;  4FM1 A;  4ID1 A;  2DY4 A;  5DK5 A;  1IKX A;  1JXB A;  4O44 A;  4RW4 A;  4BDY A;  2QKB A;  1QSY A;  3KD5 E;  4FM2 A;  1HYZ A;  3S3O A;  3VQE A;  4FLZ A;  4CGF A;  4CHP A;  2G8I A;  3E01 A;  4CJS A;  4M3Z A;  5HLF A;  1BI4 B;  3HXM A;  2I5J A;  3D45 A;  3THV A;  1FXX A;  4B9T A;  4FLU A;  4B9L A;  1LW0 A;  5HBM A;  4CHQ A;  4E7I A;  3SCX A;  1BQN A;  4CED A;  3QNN A;  1L3V A;  3UIQ A;  3SUP A;  3V9S A;  4CJR A;  1BCM A;  3OJU A;  1ASU A;  1WSI A;  5I3U A;  1QHT A;  1VRT A;  4JRQ A;  3LWL A;  3NDK A;  2HND A;  4B9V A;  2RPI A;  1BI4 A;  1JLG A;  2IOC A;  1SL2 A;  4KRE A;  3HPO A;  2P5O A;  2E6M A;  1XHZ A;  3WNG A;  4R5P A;  1KVB A;  4FW1 A;  2OZS A;  2BGG A;  4DTS A;  1RNH A;  3LP0 A;  1S9E A;  1JL2 A;  1TV6 A;  4YNQ A;  4RW9 A;  1G15 A;  4CJK A;  1TL3 A;  2AJQ A;  4DTN A;  1S1W A;  1I3A A;  3SJJ A;  4DU3 A;  1TK5 A;  1VSF A;  4CJF A;  3V4I A;  1O1W A;  5D3G A;  2LSN A;  3QEW A;  3V1O A;  3SPY A;  1NKB A;  3ZT4 A;  4E3S A;  4HVJ A;  3HP6 A;  1J5O A;  4H4M A;  4E7K A;  1UWB A;  4F3T A;  1WSE A;  2Q3S A;  3ZT1 A;  3PY8 A;  2B6A A;  1RT2 A;  4Z4C A;  5CY4 A;  4M3U A;  2VG5 A;  1RT1 A;  3HVT A;  3V1R A;  3RMC A;  3KD1 E;  4CF2 A;  3L2U A;  4KHY A;  2X6S A;  4Y1C A;  5T7B A;  3C6U A;  1RBV A;  4E0D A;  3CYM A;  3VQD A;  4OJR A;  4CJU A;  3RTV A;  4DQS A;  3K58 A;  2O4I A;  4DQQ A;  1VK0 A;  1TVR A;  4Z0U A;  1RTD A;  4F2R A;  3DLK A;  4J2E A;  2F8S A;  5J1E A;  3NF6 A;  3AVK A;  4I9L A;  4OGE A;  1X9W A;  4PY5 A;  3KKR A;  3VQA A;  1IH7 A;  4DFJ A;  1NK9 A;  2KZZ A;  1EP4 A;  3SQ2 A;  3ZSW A;  3OYD A;  3PO4 A;  4ZHR A;  1A5V A;  1IG9 A;  1K6Y A;  3MXJ A;  5SZT A;  4NYF A;  4PWD A;  3ZT3 A;  5J2P A;  1S1U A;  3DOL A;  4KHN A;  1IO2 A;  1SKS A;  1NKC A;  4FLT A;  3AVM A;  1KVA A;  4DSL A;  4HCB A;  4FYD A;  1RTJ A;  2HNY A;  2YKN A;  3SZ2 A;  3K59 A;  1FK9 A;  3M8R A;  4CEQ A;  3A2F A;  4C8M A;  2YNH A;  4DFP A;  3QEP A;  3TAN A;  4E7L A;  3DLH A;  3SQ4 A;  1UA0 A;  1LWF A;  1NJY A;  4FZX C;  4KAZ A;  3AA5 X;  3LZJ A;  1BL3 A;  3F73 A;  1Y97 A;  4TSX A;  4W5Q A;  1LAW A;  4DF8 A;  4KTW A;  1QQC A;  3ZCM A;  4Q0B A;  5SWM A;  3V9Z A;  2P1J A;  3VQQ A;  3RRG A;  3VQ8 A;  3HPH A;  2GBZ A;  2YNI A;  2QKK A;  3PO5 A;  2HVH A;  1QTM A;  1C0T A;  4KB1 A;  4B9M A;  1VSJ A;  1WLJ A;  4FJH A;  1ZBU A;  2HB5 A;  2OPS A;  4OKE A;  1VRU A;  4AHR A;  3U6F A;  2HW3 A;  4DTU A;  4H8K A;  2IDO A;  4CJV A;  2PYJ A;  3QEX A;  1U47 A;  3U3G A;  4FJK A;  1A5W A;  3BDP A;  3TAF A;  1S6P A;  3AVC A;  3EZ5 A;  2WOM A;  4JS4 A;  2BDP A;  3IAY A;  3CQ8 A;  4OLA A;  3OYE A;  4CHN A;  3SPZ A;  3P83 D;  2OPR A;  3ITH A;  4N47 A;  4NCA A;  1NK0 A;  4C8N A;  3MAQ A;  2FBT A;  4I2P A;  1FKP A;  1YVU A;  1KCF A;  4DMN A;  3O3G A;  5KRT A;  4F3O A;  4C8L A;  4HUE A;  1QS4 A;  3I0S A;  3VQ4 A;  3PV8 A;  1S9G A;  1UAX A;  1JLE A;  1QSS A;  4B08 A;  3V9U A;  4KHU A;  2RKI A;  3KKS A;  3VQ7 A;  2YNG A;  5HP1 A;  4O0J A;  4PUO A;  3HP9 A;  4FVM A;  1Q9Y A;  4K8Z A;  4CK3 A;  3QEV A;  2D0A A;  1U49 A;  3HO1 A;  4O55 A;  3L3V A;  4E1N A;  3CFP A;  4CGH A;  2XY7 A;  3PX4 A;  3QO9 A;  3RWU A;  4J2A A;  3V1Q A;  4BDZ A;  3ZSQ A;  2W42 A;  2ZQB A;  1ZBL A;  4Y1D A;  4CF1 A;  1B92 A;  2B5J A;  3ASM A;  2XY6 A;  3AA3 A;  4M3X A;  2VG7 A;  3JYT A;  4Z4F A;  2FC0 A;  1HQU A;  4AHC A;  4CIE A;  3K57 A;  5J2M A;  1SKW A;  3RR8 A;  1ZBH A;  3PUF A;  2XY8 A;  1U45 A;  4BE0 A;  1VSL A;  3AA4 A;  4CEE A;  4DTM A;  2HHT A;  1WSF A;  4AH9 A;  5HRP A;  3OS1 A;  5J2N A;  1CXQ A;  2G8K A;  1TKT A;  2KZM A;  4CER A;  4HHT A;  1U04 A;  1EET A;  3SUN A;  1RBS A;  4BE2 A;  3TAQ A;  1XC9 A;  3AO4 A;  4DSK A;  3RMA A;  4N41 A;  4KV8 A;  2XO7 A;  4KB0 A;  4LSL A;  3QER A;  1D9D A;  3QIP A;  4KFB A;  1EXQ A;  1A5X A;  3PX6 A;  3MEG A;  4CK2 A;  1T03 A;  1J9A A;  2X78 A;  1SKR A;  3VN5 A;  3FFI A;  4O0I A;  3KLG A;  3TAE A;  1RT5 A;  1KTQ A;  4LD0 A;  2A1S A;  4AIL C;  3ALY A;  1NJX A;  3NFA A;  1RT4 A;  4Z4H A;  4AHT A;  3SQ0 A;  3DLB A;  3ZSY A;  4OKK A;  4KHS A;  3DRP A;  2RF2 A;  4E89 A;  2IS3 A;  3NHG A;  4CJQ A;  1C0U A;  3LPT A;  4CFC A;  1WN7 A;  3NH2 A;  3OYG A;  1MU2 A;  2D0B A;  1XI1 A;  4B9U A;  4B3O A;  3F9K A;  1YT3 A;  5KGW A;  3DMJ A;  3TAB A;  3V9X A;  3OYF A;  1ASW A;  3KLI A;  5CZ1 A;  4DQP A;  4M42 A;  1Q9X A;  1HNI A;  1CXU A;  3HT3 A;  1RT7 A;  4B8A B;  1F21 A;  4IKF A;  4FJ9 A;  4RW6 A;  1WSG A;  1SV5 A;  3AVL A;  4AHV A;  3O3F A;  3TWH A;  4QCL A;  1VSE A;  1ZBI A;  2GUI A;  3KTQ A;  1GOC A;  1B9D A;  1TK0 A;  5FRM A;  1TL1 A;  3P1G A;  3VQC A;  4E7H A;  3T3F A;  4CJ5 A;  2VWK A;  3OYB A;  3HJF A;  2VG6 A;  4BWJ A;  3QES A;  2Y1I A;  3MEE A;  3K5O A;  3ZSR A;  3SQ1 A;  5CYQ A;  1N6Q A;  3NBP A;  3AVJ A;  4DTR A;  1L5U A;  3ZSZ A;  2OYQ A;  4FJ7 A;  1RDB A;  4FCY A;  1KVC A;  4Z4E A;  2KFN A;  1UOC A;  1YTA A;  4CJL A;  4CF9 A;  3KK2 A;  1X9M A;  1T7P A;  3LAN A;  4KPY A;  3AVH A;  4F8R A;  3NGY A;  3I0R A;  3AO5 A;  1X1P A;  4JRP A;  4Z4I A;  1VSD A;  4DU4 A;  3OYC A;  2HHV A;  1LAV A;  4CJ4 A;  2OPP A;  4H4O A;  4CFA A;  3P5J A;  3BGR A;  3ZSV A;  4FLV A;  2A1R A;  1XWL A;  1WSH A;  4CHY A;  1KLM A;  4DSE A;  4K8X A;  4IBN A;  1WSJ A;  4KTQ A;  2YV0 X;  4MFB A;  3DI6 A;  3G0Z A;  2HHQ A;  1D5A A;  5HRO A;  1EX4 A;  3VQ9 A;  3QIN A;  3OY9 A;  4NYN A;  2PZS A;  5KGX A;  1KSP A;  3HK2 A;  2Y1J A;  2OZM A;  3WNF A;  3NAE A;  3MED A;  1NK4 A;  2YKM A;  4KI6 A;  1HJR A;  2IC3 A;  2HVI A;  4KHW A;  1JXE A;  2FBY A;  2EX3 A;  3KK3 A;  3H08 A;  4Z4G A;  3AVI A;  1QE1 A;  3C95 A;  4N56 A;  4N5S A;  3HM9 A;  4C8O A;  4CIG A;  2O4G A;  2G8U A;  2G8V A;  4QAG A;  3DLR A;  2YHA A;  4DSJ A;  1ZYQ A;  2DFH A;  1C0M A;  4CJP A;  1NK5 A;  3CFO A;  2G8W A;  4EP5 A;  2DFF A;  2R7Y A;  4ID5 A;  4CE9 A;  4DWI A;  1IKY A;  1W9H A;  3DYA A;  5C24 A;  1HRH A;  4IDK A;  2XHB A;  4FJL A;  4IFV A;  3CG7 A;  1RTH A;  2GV9 A;  4J2D A;  4N76 A;  3NF9 A;  4F2S A;  1CZ9 A;  1JKH A;  4CFD A;  3SV3 A;  3HVR A;  4ZTJ A;  1S1T A;  3B6P A;  3IRX A;  4AHU A;  4HCC A;  4FJJ A;  1I39 A;  1WAF A;  3LPU A;  1TAQ A;  3M8S A;  3VQ5 A;  5HRN A;  2DFE A;  1SUQ A;  1RDC A;  1BGX T;  1Z25 A;  4OVL A;  2JLE A;  4RW8 A;  3L2W A;  1W0H A;  1XHX A;  5E41 A;  3NH1 A;  1BHL A;  3OYL A;  3IG1 A;  2HHW A;  3RMD A;  1J53 A;  4WE1 A;  4DTX A;  3V81 A;  3LZI A;  4IFY A;  1WNS A;  4OPK A;  3O3H A;  4GW6 A;  4I2Q A;  2F96 A;  1S6Q A;  1IKW A;  4E1M A;  4FLX A;  3QEI A;  4QOZ B;  4OKJ A;  3ZSO A;  5KRS A;  2XY5 A;  3VQP A;  1Z26 A;  3QIO A;  1CLQ A;  3HL8 A;  2QK9 A;  3SI6 A;  3MXI A;  4GMJ B;  3OYI A;  3L8B A;  3S3M A;  4I9Q A;  2ATQ A;  4EP4 A;  1TKX A;  4DLG A;  4KI4 A;  3QET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...