4AHSA

Parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
154
structure length
150
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Parallel Screening of Low Molecular Weight Fragment Libraries: Do Differences in Methodology Affect Hit Identification?
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 60
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ahsA00
2G8WA 5KI6A 4WE1A 2FBTA 3LP0A 4MFBA 3CQ8A 3AA2A 4AHCA 2WOMA 3K58A 3U6FA 3LPTA 1JLBA 1RTIA 4CJEA 1ZBHA 3ZT4A 1QTMA 2YNIA 1D9FA 1RBUA 4Z4HA 3QEXA 1HQEA 1QSYA 4I9LA 4NYFA 4OPKA 2HHXA 2XY6A 4B8CA 3FFIA 4J2BA 1QQCA 3TAPA 2Q3SA 3DMJA 3ZT2A 3HL8A 4CF1A 3NCIA 4FJGA 1JLQA 3EY1A 1NKBA 5E41A 2RKIA 3NBPA 2Z1GA 3HJFA 4DFJA 3L3UA 1A5WA 4OPJA 1WNSA 3DI6A 1WSHA 3G0ZA 5FRMA 3V9XA 2X6NA 1VSHA 3RMAA 4B9TA 1C1CA 2ITGA 4CIFA 3QEPA 1X9WA 2IS3A 1T05A 4PWDA 1RBRA 2X78A 1HYSA 4FLXA 4DFKA 2Z1JA 1FXXA 4Z0UA 1NK0A 3ZCMA 2PZSA 3V1RA 4E7LA 2HVHA 1KVBA 4M3RA 1YT3A 4C8KA 3HK2A 3SNNA 4HCBA 4ICLA 3TAEA 1RT7A 3OJUA 1C0TA 4BE1A 2OZMA 1CXQA 2HHTA 4O44A 4H8KA 4OKJA 2XY8A 4KTZA 4K8XA 3HO1A 3O4NA 1J54A 1UAXA 1NJYA 4I2QA 2IGIA 4C8LA 3DRSA 3NGYA 1SUQA 4CFCA 3SYZA 1B9DA 2YNHA 4RW9A 4NCBA 4KHWA 2O4IA 1DLOA 1SKWA 3QNNA 2HVIA 4CK1A 4KFBA 4IFVA 3OYBA 2G8FA 3SUQA 3NH1A 4GW6A 3VQEA 4R5PA 1NOZA 3AVNA 4UQGA 5D3GA 3HVRA 3ZSQA 3OS2A 1NK8A 5FDLA 1JLEA 4FM1A 3KKSA 5SZTA 2E6MA 2KFNA 2FBXA 5J2NA 2HHSA 3MAQA 3KLIA 3M8RA 1NKCA 1VSLA 4CJVA 1RTJA 2ZQBA 1KSPA 3O3FA 4E19A 1WSIA 1NK9A 4RW8A 3ZT3A 1HNIA 4DTPA 4B9UA 4HUEA 1WSEA 2YKNA 5EU7A 3ZT0A 4DTXA 3WNEA 4KI6A 3HP6A 1S6PA 4E1MA 4KRFA 4CESA 2D5RA 2X6SA 3MEEA 3TAQA 2A1RA 4W5OA 4CGFA 3ZSOA 4CEZA 1RDCA 4Z4FA 4FLUA 3NGIA 3C6TA 1NJXA 1WAFA 3CYMA 2IOCA 4CFBA 3LZIA 4J2EA 4PUOA 2KQ2A 3DYAA 4FJ9A 3KJVA 4BDZA 3TABA 3CG7A 2FC0A 1ZBLA 1WLJA 3VQ6A 3THVA 1L3UA 4FJKA 4MQ3A 2DFEA 1JLFA 5KRSA 1SL0A 4FM0A 3HP9A 3KIOA 2B4JA 3HPHA 5C25A 1U4BA 1VRUA 3RWUA 1LW2A 2VWKA 4IKFA 2GUIA 4KHSA 1TK0A 4DTOA 1VSEA 4HUFA 3NH2A 3OYEA 2D0CA 3VQQA 4DTRA 1EETA 1S5JA 4KO0A 4CF9A 2PY5A 1Q8IA 1GOBA 3F9KA 4CEEA 2F8SA 4CGHA 5HRNA 2HW3A 3LPUA 4O0JA 5HRSA 1QE1A 1G15A 5KTQA 4F4KA 4NYNA 3L8BA 5DK5A 1RT3A 4CJKA 3OYLA 3K5MA 1C0UA 4CJ5A 3DLGA 3SUOA 4M3ZA 4W5TA 1JXEA 4DF4A 2XY7A 3K57A 3SPZA 3PO4A 5CYMA 4KI4A 4FVMA 1IG9A 3NH0A 1ZYQA 1DTQA 1LWEA 4KAZA 3TR8A 1RT6A 3C6UA 3PUFA 4CEQA 4KTQA 4KREA 3SQ4A 3M8SA 1F21A 1HYZA 4FJXA 3V9WA 1UOCA 4QAGA 3AVJA 3CFPA 2B6AA 3AVHA 1EXQA 1HQUA 3AVKA 4CEBA 4CJTA 3OYNA 3OYFA 3O3GA 3CFRA 1RCHA 4CJ3A 3K5OA 4HHTA 4M42A 3OYJA 4CEDA 1JLAA 4FJ7A 4LH4A 4DSIA 3P5JA 3QIPA 4HUGA 4PQUA 4W5QA 4M3YA 2PYLA 4FXDA 1WSGA 3NGZA 2O4GA 3NF9A 2IC3A 4FLYA 4QCLA 3LP2A 1NK7A 4F3TA 3JSMA 2BGGA 4I7FA 2E6LA 3F73A 1NJWA 3ZSYA 5J1EA 1TL3A 3KK1A 2OZSA 5CYQA 2HHWA 2AJQA 4XIUA 4BDPA 2Y1JA 5HRRA 4KHYA 3LZJA 4CERA 1HYVA 3NFAA 3PX4A 4E0DA 3TWHA 1N6QA 4FJHA 3I8DA 2HMIA 2F96A 4F2RA 3K5NA 3L2QA 2VG5A 3L2WA 5FRNA 4OKKA 2PYJA 3B6PA 5CY4A 2X74A 4IFYA 4C8MA 3NE6A 1KRPA 3RRGA 3KD1E 2F8TA 4BACA 4G1QA 3LP1A 4DTUA 3SUPA 3TI0A 1TKDA 4M3UA 4CF2A 1VSKA 3SUNA 3QNOA 4B8AB 2OPQA 3MXMA 1LAVA 1BL3A 4OVLA 4L8RB 1VK0A 4CHYA 4AHSA 4IDKA 3DLKA 4CE9A 4DS4A 3IAYA 4FJIA 3LALA 1U48A 4K8ZA 3AO4A 3OY9A 3VQ8A 1EKEA 3CFOA 3QEVA 3SJJA 3S3NA 4CFDA 1WSJA 5KGXA 3HXMA 3QERA 3S3OA 3OYIA 4KB0A 1UA0A 1C1BA 4B08A 3S9HA 3SI6A 4M3XA 4CEOA 1SL2A 4AHRA 1J53A 1JLCA 3OJSA 2RPIA 2FBYA 3SQ0A 4O0IA 1LAWA 3B6OA 4AHVA 4E7KA 5HROA 1GOAA 1KTQA 3T1AA 3NHGA 4DWIA 2DFFA 1Y97A 1VSFA 2IAJA 3IRXA 2EX3A 4OLBA 1RDDA 4DQPA 1RBSA 1FKPA 1VRTA 2LSNA 4IG0A 4CJPA 3HVTA 5T7BA 3V4IA 4CJLA 3RTVA 3V81A 3TANA 1BHLA 1GOCA 3K59A 3AVGA 1BIUA 2OPSA 2YV0X 4E7JA 1DTTA 4DSFA 4FK2A 5HP1A 3QEIA 4CEFA 4DTNA 1EX4A 3PY8A 1RNHA 4FJNA 3K5LA 3P1GA 4BE2A 1TKZA 3KLFA 3KLHA 1ASWA 4DS5A 1BIZA 3QEWA 3VQAA 1S1XA 2KTQA 5J2PA 4C8OA 3KK2A 1S1VA 1Z25A 2QXFA 1HPZA 4B9SA 2YNGA 4FW2A 2VG7A 4JLHA 1VSJA 1I3AA 2HNDA 5HRPA 1T03A 4DSLA 4JS4A 1HNVA 4KB1A 5CZ2A 5JS2A 2HNYA 4ZHRA 1I39A 4ZTFA 2G8HA 2KZMA 1T7PA 2DTUA 4CK3A 3O3HA 5HBMA 1HRHA 4Z4GA 4CJFA 3RMBA 3PO5A 4M41A 3ALYA 4ID1A 3E01A 3LP3A 2ATQA 2FBVA 2G8VA 3UIQA 1TL1A 3VA0A 3OS1A 1SKRA 4KV8A 3HM9A 3AO2A 3KKRA 3ZSVA 3PX0A 2YNFA 4LSLA 1RT5A 3CM5A 3BDPA 1D9DA 4B9NA 4DTMA 3KTQA 4HCCA 1IKYA 2VG6A 4E7IA 3JYTA 3DM2A 1SKSA 3MEDA 3HPOA 1SL1A 1J9AA 2G8IA 1LW0A 3ZT1A 1CZBA 2YHBA 4CF0A 3ISNC 3T3FA 2Y1IA 4LH5A 4EP5A 1RT2A 1TKTA 4CHOA 4E1NA 1BGXT 2XRIA 3VQ9A 2XHBA 4W5NA 1NK6A 3RRHA 1HMVA 1JL2A 2VWJA 3U3GA 2OPRA 4M3WA 1JXBA 3DLEA 1MU2A 1L3SA 3WNHA 3TAFA 4FJLA 1S6QA 1RDBA 1Z26A 2WONA 4AHUA 4CJWA 1BISA 3QLHA 1YTAA 3AA3A 3VQCA 4EP4A 4JS5A 1XHXA 2KW4A 3QESA 3OYGA 3RR7A 3L2UA 4M3TA 4OGCA 3V9UA 1RILA 2KZZA 1QS4A 4OLAA 1JLGA 4DLGA 4DU4A 4CHZA 4FK0A 1ZBFA 2BANA 2BDPA 1KLMA 3ZSWA 1U47A 1BI4B 3VQDA 3V9ZA 4RG8A 4FJJA 4KHQA 3C95A 3LAKA 3OYKA 3QO9A 1IH7A 2G8UA 1FKOA 3D45A 3O4QA 4O5BA 2GBZA 2ZE2A 2OYQA 4B9LA 4Q0BA 1RT4A 2I5JA 1VSIA 4GVMA 3DRPA 5CZ1A 3V1QA 3V6DA 1NK4A 5J2QA 4LSNA 3A2FA 1IO2A 4DQSA 4CHNA 4ELVA 1W9HA 1RDAA 1A5XA 4CJRA 1R0AA 4I2PA 3NF6A 3MEGA 1IKXA 3NF7A 4IG3A 1BCMA 4FLVA 4FJ5A 4E89A 3OYAA 1S1WA 1EP4A 3ZSZA 4KHNA 3M8PA 4CF8A 3RR8A 3NAEA 3SCXA 4FLZA 4BE0A 3T19A 4FCYA 1U49A 4FZZA 4DFPA 3L2RA 4FZYA 1WSFA 5C24A 1ASUA 3RMDA 1BCOA 4BWMA 1VSMA 3QETA 3TARA 4CGGA 4E7HA 3OYMA 4CGIA 5I42A 4J2AA 1KVAA 4B3OA 4FW1A 3SZ2A 3VA3A 2EHGA 3OYCA 4O55A 2P1JA 1RBTA 1K6YA 4YFUA 1SV5A 2HNZA 5DMRA 1CXUA 1KVCA 3HT3A 3L2VA 2BE2A 4W5RA 3AVFA 2P51A 2A1SA 3DRRA 5KRTA 3LWLA 3H08A 2KFZA 1Q9XA 4BWJA 4FJMA 4CIEA 4ELUA 1TK8A 3PV8A 4CCHA 2GV9A 4AILC 4CHQA 1NJZA 4F3OA 1S1UA 4KPYA 3M8QA 2Z1HA 2QKKA 3EYZA 1NOYA 3VQBA 3SQ1A 4RW6A 4CK2A 2NUBA 4DMNA 3AVLA 2JGUA 3EZ5A 4EZ9A 2HHUA 1UWBA 4I9QA 4CFAA 1RTDA 4CJQA 4DSJA 1N5YA 1ASVA 3VQPA 2XO7A 2RF2A 4EZ6A 4FJ8A 1REVA 4DQRA 2D0BA 3WNGA 4CGJA 1KFDA 1X1PA 1D5AA 3CM6A 4KTWA 4LD0A 4DTSA 1KCFA 4QOZB 3SPYA 4RW7A 1CZ9A 1VSDA 2HHQA 4IBNA 1B92A 1JKHA 3S3MA 1BQMA 1X9MA 4C8NA 1NKEA 4OGEA 2QK9A 4DG1A 1WAJA 2G8KA 2JLEA 4FK4A 4CIGA 4NCAA 3AV9A 3KK3A 3KD5E 2HHVA 1FK9A 1LV5A 1S1TA 3SV4A 5JS1A 2IDOA 4JRPA 1XHZA 4OJRA 1BI4A 1L3VA 3ZSXA 3LWMA 1NK5A 4J2DA 4CECA 4DU3A 1X9SA 2P5OA 4GMJB 4DU1A 3SQ2A 3AO5A 2ETJA 4M45A 1LWCA 3VQ5A 3NDKA 4Z4EA 4ELTA 4KKOA 4ID5A 1Q9YA 4F2SA 1LWFA 4F8RA 3D0PA 3RMCA 4CJUA 1TAQA 4TSXA 4FYDA 1TKXA 2ZD1A 4DLEA 3DOLA 3AVBA 1TK5A 3VQ4A 1O1WA 3AA5X 4FM2A 3U3YA 2HB5A 2B5JA 4AHTA 3OYDA 3IS9A 1KFSA 3I0SA 3VN5A 1TV6A 3AVCA 4H4OA 1IKVA 4NCGA 4B9VA 4PA1A 2QKBA 3AA4A 3L3VA 3KLEA 4PY5A 4BDYA 3WNFA 4FLWA 3AVIA 3VQ7A 2XY5A 4B9MA 3IG1A 4N5SA 2D0AA 1U45A 1JL1A 4DTJA 1RTHA 1U04A 1IKWA 4N56A 1C1AA 2DFHA 4CGDA 4KHUA 4YNQA 3AO1A 3TAGA 3DLHA 3SV3A 5KGWA 1BQNA 1HJRA 1S9EA 4HTUA 5J2MA 1L5UA 2R7YA 1C0MA 4HVJA 4FLTA 1A5VA 3ITHA 4Z4IA 3MXIA 1TAUA 4RW4A 4Y1DA 3TAMA 2RN2A 1CLQA 2YKMA 5I3UA 3BGRA 4DQIA 2P5GA 4N41A 1KLNA 1ZBIA 3ZSRA 1YVUA 5FROA 3HSTB 1ZBUA 1XC9A 1T8EA 4ZTJA 1ITGA 3QIOA 4FZXC 3K2PA 3G10A 4N47A 4DSEA 4DFMA 1UA1A 5C42A 3OVNA 2E4LA 3HYFA 4H4MA 3P83D 4CJ4A 3AVAA 4CEAA 4E3SA 3LDSA 1TVRA 2W42A 1RBVA 3AO3A 3OYHA 4JRQA 3OS0A 3KLGA 1L3TA 4LY7A 1B9FA 1XWLA 3ULDA 4OKEA 3MECA 5HLFA 1QHTA 1C6VA 1D8YA 3DLBA 2OPPA 4N76A 2YHAA 5K14A 3PX6A 2Z1IA 3ASMA 3DLRA 3LANA 3QINA 4Y1CA 1QSSA 4Q5VA 1QSLA 2DY4A 1RT1A 4CHPA 3MXJA 1W0HA 3LAMA 3V1OA 1XI1A 4AH9A 4CJSA 4Z4CA 1J5OA 1YTUA 3HPGA 3NF8A 4DQQA 3AVMA 3C94A 1TGOA 4DF8A 3I0RA 4O4GA 3V9SA 2OA8A 1WN7A 4DSKA 3DOKA 5SWMA 1S9GA
chains in the Genus database with same CATH superfamily
3SAGA 3AA2A 4LFCK 1RTIA 2YNIA 1QSYA 5C0YA 4OX9K 4I9LA 2XY6A 4B8CA 3ENOA 3CQYA 4FSVA 4J2BA 2Q3SA 4MDBA 4OPAA 1NGAA 2Z1GA 4FOIA 4H0OA 1VQPN 3HJFA 5AQMA 3WXLA 3ID8A 4JNEA 4OPJA 1WSHA 3G0ZA 2ZGZA 2HBLA 5AQUA 4B9TA 1C1CA 1TUUA 3OA9A 3QEPA 2AA4A 1D4XA 2X78A 4BC4A 3G4SN 1YITN 4IJNA 3CC2N 4E7LA 2HVHA 3HK2A 4C8KA 3TAEA 5EXWA 3OJUA 1C0TA 2OZMA 1CXQA 1T6DA 3FZMA 4O44A 2XY8A 4K8XA 5MLCQ 3CMAN 3DRSA 2P9IA 4CFCA 1HJOA 5BN8A 1SKWA 3OYBA 1KXPA 3G25A 4GW6A 4R5PA 1NOZA 3WUHA 3ZSQA 4L3QA 4QS8A 4R79A 4FM1A 1FW6A 2KFNA 2E6MA 3EKSA 1KD1O 1BO5O 5CHIA 1NKCA 1VSLA 2ZQBA 4B9QA 2ASOA 2P9LA 4E19A 3O3FA 1HNWK 3ZT3A 4X62K 4JI2K 4DTPA 1KQSM 3C0BA 4DTXA 2VQEK 4E1MA 3ZX0A 4KRFA 3TAQA 2X6SA 2A1RA 4W5OA 3L4QA 3ZSOA 3NGIA 3VF2A 2IVPA 3CYMA 2IOCA 1Q7YO 3AY9A 4FJ9A 3KJVA 1ZBLA 1WLJA 3A5LC 3VENA 1BDGA 2RHKA 4FM0A 1YI2N 3KIOA 3H3NO 5C25A 2O8DB 1HKGA 5EVZA 2HF3A 1TK0A 2O8FB 1SS6A 3OYEA 3VQQA 4PKHA 1WB9A 2HBJA 3ZYYX 2PY5A 4JKBA 4CEEA 1X9JA 2F8SA 2HW3A 3I55N 3LPUA 4O0JA 1G15A 1NGJA 3OYLA 3DLGA 4M3ZA 2YJFA 2IVNA 4DF4A 3PO4A 1NWKA 4FVMA 3NH0A 1LWEA 4KAZA 3C6UA 1NJXA 4IEEA 1EXQA 3CFRA 4CJTA 3MK6A 1RCHA 4EAHD 4FWRA 3OYJA 1NGDA 5I9EB 1FJGK 3CJCA 1GLEG 5TKYA 2UXBK 4W5QA 3CQXA 2D0OA 1WSGA 3NGZA 3RVCA 5F2RA 1Z6RA 3I33A 3LP2A 1NK7A 3SLCA 2BGGA 5F1XA 1H1VA 4ILGB 4FWKA 3ZSYA 5J1EA 2OZSA 3GBTA 5HRRA 4AM7A 3NFAA 3PX4A 4FJHA 4A5AA 1HKCA 1VQ9N 1U6ZA 1K9MO 5FRNA 4DV0K 3CF5L 2OTLN 4JI3K 2QXLA 4IEIA 1TKDA 3OHRA 3UKRA 1IBKK 2JWLA 4B8AB 1LAVA 2V51B 4CHYA 4K8ZA 4M63C 3IAYA 2Q31A 3LALA 1U48A 4JK7A 4DCHA 1YXQA 3S9HA 5JVHL 1UA0A 4M3XA 3WEEB 4CEOA 1SL2A 2VYPA 1J53A 3OJSA 2RPIA 1LAWA 4QS7A 4AHVA 1GLBG 5HROA 1GOAA 3T1AA 4A2AA 4OLBA 2EX3A 1FKPA 2LSNA 2CH6A 5AQHA 1JCFA 2OPSA 3O5BA 1OH8A 4CZFA 4FK2A 3DXKB 4C1NK 4DTNA 1DEJA 3PY8A 3VMFB 3KLFA 4DS5A 3QEWA 3KK2A 3PIOL 3ZETB 2VG7A 2HNDA 5HRPA 4ZHRA 4ZTFA 4K25A 2G8HA 1T7PA 1K8KA 3O8MA 3PO5A 3ALYA 3UIQA 2ATQA 1TL1A 2NRTA 1SKRA 4KV8A 2WC9A 3KKRA 3ZSVA 4JI5K 2F9TA 2HOEA 1D9DA 3KTQA 3Q7BA 4EHUA 1IKYA 3JYTA 3DM2A 1SKSA 2W41A 5GIPA 1VQ4N 1SL1A 3HPOA 1J9AA 2G8IA 1LW0A 4JI7K 3ZT1A 5ADXH 2Y1IA 3DLLL 4RCHA 3RRHA 2RE2A 4FWPA 1VQ6N 4M3WA 1JXBA 3EKUA 1RDBA 1S22A 1Z26A 3SI6A 3CD6N 2AP1A 1XHXA 1XQSC 2KW4A 3CPWM 3L2UA 3V9UA 3I56N 4FWNA 1JLGA 4CBXA 3ZSWA 3V9ZA 3UKUB 3QO9A 1IH7A 3O4QA 5IWAK 2OYQA 3VEYA 3TSQA 3O9SA 4Q0BA 4GVMA 1BOTO 2A40A 3A2FA 2E1YA 2QI2A 4CHNA 1R0AA 4I2PA 3THWB 1ATRA 3MEGA 4E89A 3C6AA 4GKKK 1VQLN 3PIPL 1Z05A 4RTFD 3NAEA 3SCXA 5AQYA 4BE0A 2HMPA 3OBWA 1K8AO 1WSFA 4XH5A 4IWVA 1ASUA 4DV6K 4BWMA 3M6GA 1V4SA 5KQDA 4B3OA 3SZ2A 3DJCA 3E9PA 1QQNA 4K43A 1KVCA 3HT3A 2BE2A 3AVFA 4JD2A 2KFZA 1Q9XA 2QTDA 4BWJA 4X66K 2HSTA 3PV8A 4CCHA 3N4PA 4YOTA 1NJZA 5FPDA 5AFUH 4YOYA 1NM1A 4I6MA 3VQBA 4EZ9A 2HHUA 3CJBA 3OW2M 1ASVA 1EO1A 3VQPA 2XO7A 4JAXA 4EZ6A 4FJ8A 3EL2A 3KHYA 3O1WA 4DV7K 4QOZB 2E2QA 3SPYA 4RW7A 4CJ7A 1JKHA 3S3MA 2GWKA 1X9MA 3CJ7A 3MN5A 1WAJA 2JLEA 4CIGA 3KK3A 3KD5E 1FK9A 3SV4A 1WOQA 4OJRA 3O6WA 1BI4A 2HBMA 3LWMA 1NK5A 1NGFA 4GMJB 3SQ2A 3M3ZA 3VQ5A 3NDKA 2NRXA 1W7AA 4KKOA 1Q9YA 1LWFA 4FWLA 5AR0A 4CJUA 3A8YA 1TKXA 2ZD1A 3CHWA 1TK5A 4YY3K 3AA5X 2O8CA 5LL6Z 2NRVA 1OH5A 3CPEA 2P9NA 4NCGA 5BPMA 1YJ9N 1GLFO 4PA1A 1MWKA 2XY5A 2D0AA 5GAEP 4CBUA 5TKWA 1C1AA 3WXKA 3AO1A 1IG8A 1C0MA 3LDPA 4FLTA 5AQIA 2QWPA 1E3MA 3CCMN 2F4VK 4GVEA 4FZXC 4FOEA 5BRHA 1UA1A 4BR2A 1XUPO 3SBGA 4CEAA 4E3SA 1TVRA 2Q2RA 3KVGA 2YHXA 2W42A 3AO3A 3OYHA 3CCVN 3OS0A 3KLGA 4CZMA 4LY7A 3ULDA 1D8YA 4BRLA 4IZ9A 4DR2K 2Z1IA 3DLRA 2QM1A 1QSSA 4DV3K 1W0HA 1J5OA 4CJSA 1RDUA 3AVMA 4BR0A 3P4IA 3G6EN 1WN7A 4H0XB 4O8KA 5M1OA 1NGIA 5SWMA 2YHYA 4BRQA 2G8WA 5KI6A 4WE1A 3CQ8A 4AHCA 3K58A 3U6FA 4IOAL 3LPTA 4CJEA 3ZT4A 1QTMA 1RBUA 1C0FA 2V7ZA 3W0LA 2HHXA 3DMJA 3EY1A 1NKBA 5E41A 3FZKA 3L3UA 1A5WA 3DI6A 1BA1A 3MN7A 5FPEA 3W3DA 5FRMA 1E4GT 1EQYA 2X6NA 3V9XA 4KH4A 2IS3A 4FLXA 4DFKA 5BPLA 1ATNA 3WQTA 1HUXA 1NK0A 2PZSA 1OVYA 2CGJA 4M3RA 1QZ5A 1YT3A 3HZ6A 3CCLN 2P9KA 2HHTA 4H8KA 4BRFA 3HO1A 3LM2A 1NJYA 3L6QA 1BWFO 3VTHA 1W97L 3SYZA 1BA0A 4RW9A 1VQMN 4NXNK 3LL3A 3HI0A 3QNNA 3ZLJA 4JYAK 4H0YB 4KFBA 3SUQA 4UQGA 3AVNA 3HVRA 1K73O 4JKDA 5FDLA 1JLEA 4B1WB 2FBXA 3ENHA 1C0GA 3HRGA 1WSIA 2E5LK 4RW8A 4B9UA 4HUEA 4MLEA 1JCGA 4FWQA 5AQTA 2ZF5O 3ZT0A 3K0SA 3WNEA 1S6PA 2W6LA 1MWMA 4CESA 3MEEA 2E88A 4JK9A 1WAFA 4YHHK 4PUOA 4JHDA 1T44A 1BU6O 3TABA 4HTLA 2UYTA 3VQ6A 3QFUA 2HBKA 1L3UA 3EZWA 2DFEA 3O4WA 1HNXK 1RFQA 3HP9A 3U4LA 3CJ1A 2B4JA 1U4BA 3HTVA 3RWUA 3CETA 5AQVA 4IKFA 1SQKA 4DV5K 4DTOA 5HL7L 1N33K 3SK3A 5AZJA 3LDNA 1S5JA 5AQPA 1QHAA 4KO0A 4BRAA 3C7NB 1E4FT 3BF1A 1KAXA 1RDWX 4NYNA 3GL1A 3SUOA 3K5MA 1C0UA 4CJ5A 5AQQA 3T7ZA 1JXEA 3K57A 5CYMA 1ILYA 5LMUK 4FJXA 1HYZA 1XMQK 2E2OA 3QBWA 1HQUA 3OYFA 4ISFA 3OYNA 4HHTA 4M42A 5BRDA 1N8RO 1JLAA 4FJ7A 3H46O 3P5JA 3AGKA 4CI6A 4M3YA 3THYB 2O4GA 4FLYA 3O08A 4F3TA 3TTCA 2O8CB 2E6LA 4NO7A 5CYQA 2AJQA 4CERA 3HOSA 4E0DA 3TWHA 3I8DA 3K5NA 2VG5A 1VQNN 2PYJA 4A59A 4IFYA 4C8MA 3NE6A 2J4RA 4DTUA 3SUPA 5AQRA 4LF6K 3ID6A 4OVLA 2IVOA 4JKEA 4JI4K 4X64K 2I7NA 4FJIA 4BQZA 1XC3A 3OY9A 3S3NA 3SJJA 3CCRN 4CFDA 3OYIA 2WUSA 4B08A 5EX5A 3DXMA 4BRGA 4GV3A 3BF3A 4M7XA 4DHYA 1JLCA 4PKGA 4E7KA 3ZEUA 3NHGA 3JAMO 1RBSA 3EE8A 4A2BA 3EE9A 1VRTA 4CJPA 2FSKA 4CJLA 2O8EA 3QICA 1BHLA 1GOCA 3AVGA 1BIUA 2YV0X 4CZIA 5HP1A 3D2FA 1EX4A 1NNEA 5AQZA 3P1GA 1ASWA 3FGUA 1S1XA 5EOYA 1S1VA 4B3TK 4JLHA 3S41A 1I3AA 4MLHA 4KB1A 2PAVA 4DR1K 1HNVA 2GUPA 5CZ2A 5AZIB 4CZGA 5AJ3K 2NNWA 3O3HA 4Z4GA 4CJFA 3RMBA 3CMEN 3H1QA 4ISEA 2PFUA 2E8AA 3F2KA 1NLVA 4B1VA 3AO2A 3KK7A 2FSJA 3CM5A 4B9NA 4DTMA 5BR9A 4HCCA 4FPAA 1QZ6A 3RSEA 3THXB 3LDQA 4IXCA 3CCEN 5DM6L 1G99A 1BGXT 2XRIA 3VQ9A 2O8BB 4W5NA 2Q0UA 1JL2A 2VWJA 3U3GA 2OPRA 4BROA 4LF4K 3WNHA 2PYLA 1BISA 3QLHA 1LOTB 4DR7K 4BG9A 3MX2A 1YJNN 4AM6A 4DLGA 4RWTA 2P9UA 4FK0A 2P9SA 3VTIA 2BDPA 2P9PB 2FF3B 3R3LA 3OYKA 4EFHA 2ZJQL 1QVGM 2G8UA 4O5BA 2W40A 2GBZA 4B9LA 3UB5A 3AGRA 4ELVA 1RDAA 4CJRA 3SAFA 2OCEA 4CD1A 4GY2B 1BCMA 1NGBA 1OKJA 2CH5A 5KPTA 5C2DA 3OYAA 4WQ5A 3ZSZA 2Q0RA 4JI6K 1U49A 4FZYA 5ELZA 3L4IA 4DV2K 4BRDA 1BCOA 3TARA 4CGIA 1KVAA 3GOIA 1TYQB 4FW1A 5JMVA 1RBTA 3TSUA 4BRHA 2HNZA 5DMRA 3DRRA 2A1SA 5JVGL 4ELUA 3H6EA 1TK8A 4AILC 2NRHA 4JK8A 2WFBA 3MDQA 4PHTX 4PL8A 2QKKA 4BR4A 2ZWHA 4JN4A 4CK2A 1UWBA 4I9QA 4CFAA 2UU9K 3VGMA 4J8FA 4BRNA 1KAZA 4JKAA 1KFDA 4H0TB 4WQ4A 4XEIA 4BC3A 1B92A 4JKGA 1BQMA 4M7YA 1NKEA 4LF8K 4OGEA 1YVNA 2G8KA 4FK4A 3AV9A 3D7EO 2HHVA 1LV5A 3BZCA 3VF4A 4BVOA 1YF5L 2ETJA 4M45A 1JCEA 4FL9A 4F2SA 2NRRA 2V52B 4F8RA 4FYDA 4LF9K 1VQ8N 3DOLA 1NJIO 2QW9A 1P8ZA 3CJ9A 4FM2A 2HB5A 1NGEA 2QWRA 5AQSA 3IS9A 2VGMA 3FZLA 4CBWA 1IKVA 2HHHK 3L3VA 4PY5A 4FLWA 1YIJN 4B9MA 3IG1A 1U45A 1ZBSA 1RTHA 1NMDA 2DFHA 4YNQA 3TAGA 3DLHA 3SV3A 5J2MA 3SBTA 4HVJA 3PSIA 4Y1DA 3TAMA 4CZLA 2P9IB 5I3UA 3BGRA 1DKGD 2GWJA 2YCHA 3F5TA 1VHXA 4ZTJA 1T8EA 4DSEA 3G10A 4DFMA 5C42A 3OVNA 4CJ4A 4DUYK 3LDSA 4G9ZA 3U9ZA 3ULEA 2ZGYA 4DR3K 5C15A 2P9LB 3SJHA 1XWLA 5HLFA 4H5NA 3O80A 5BPNA 2EWSA 3R1XA 2H3GX 2YHAA 4IFEA 1HPMA 3PX6A 3LANA 4Y1CA 3H1VX 3O1BA 2JWKA 4Q5VA 1QSLA 1RT1A 3LAMA 4DQQA 3TTFA 4OO1J 3WXMB 1N32K 3DOKA 2FBTA 4FWMA 5KQ8A 4XH1A 1JLBA 3BZKA 3IMXA 4NYFA 4B1XB 4OPKA 1Q82O 2D1KA 1KAYA 2UUBK 3HL8A 5M1PA 5JLHA 3NCIA 4LF7K 4DFJA 4BRPA 5LJVA 1WNSA 3J7ZO 3D2EA 3HOTA 1VSHA 2ITGA 1X9WA 4NXMK 1T05A 3WXIA 4PWDA 1RBRA 2Z1JA 3MWTA 4FO0A 2A3ZA 3EEQA 3V1RA 1KVBA 3SNNA 4ICLA 3K9KA 4BGAA 4OKJA 4KTZA 3O4NA 1J54A 1UAXA 2IGIA 3NGYA 1SUQA 1DLOA 3ZX3A 1VQ5N 3CIPA 3DAWA 2HVIA 4CK1A 4IFVA 3J8AA 2NZTA 1OH7A 4DUZK 3VQEA 5D3GA 1NK8A 3J81O 3KLIA 5AQGA 4CJVA 1KSPA 2KLAA 1HNIA 3Q7CA 5E84A 4ILHA 2YKNA 5EU7A 5E26A 4B1ZA 4KI6A 3R9PA 3MCPA 2QWMA 3C6HA 3M1FA 3UKRB 2D5RA 4CGFA 1RDCA 4Z4FA 3C6TA 3LZIA 4CFBA 4J2EA 3SMPA 4WCEL 4BDZA 5GAGP 4H5WA 5JICA 3MWPA 3THVA 4FJKA 1ATSA 1JLFA 1X3MA 1OVQA 1VRUA 2UUCK 4NB4A 2GUIA 2E2NA 1VSEA 1NMNA 2D0CA 1EETA 1Q8IA 3F9KA 4CGHA 3VERA 5ADXA 1MDUB 5KTQA 3L8BA 4OPHA 1RT3A 4CJKA 4W5TA 3MX5A 2XY7A 2OANA 4KI4A 1VQON 1ZYQA 1DTQA 4KTQA 4EIAA 3PUFA 3M8SA 1UOCA 1YTUA 1VAZA 4CEBA 3LDOA 4CJ3A 2E20A 2F9WA 4LH4A 1K8KB 4DSIA 4HUGA 2GELA 4FXDA 2IC3A 4QCLA 3QFPA 4F9OA 3JSMA 4I7FA 3GE1A 2A42A 3F73A 2HHWA 2VGNA 3BY5A 4FWOA 2Y1JA 2D0PA 1HYVA 1N6QA 2HMIA 2F96A 4F2RA 3L0QA 3L2WA 1DGKN 3B6PA 4A62A 5CY4A 2X74A 1WUAA 1KRPA 2F8TA 4BACA 3LP1A 3OBYA 5M1NA 3TI0A 3FFKB 2CGKA 1GLDG 3MCAB 1EWRA 2OPQA 4DR5K 1BL3A 1VK0A 3DLKA 4CE9A 1S72N 3AO4A 3R8EA 3CFOA 1MA9B 3A5NC 3CC4N 1WSJA 3QERA 4FVUA 3S3OA 4KB0A 1C1BA 4WQ5C 1R59O 2O8DA 3P38A 3B6OA 4GV6A 2KKZA 1KTQA 5AFUA 2NRZA 1BG3A 1VSFA 2IAJA 2O8FA 4DQPA 3HVTA 5T7BA 3V4IA 3RTVA 3TANA 4U7BA 3K59A 3VGLA 4E7JA 3KZBA 3K5LA 4BE2A 2YX6A 1BIZA 3VQAA 4C8OA 1Z25A 4B9SA 1HPZA 3OTOK 5EY4A 5HOOA 4IO8A 1VSJA 3E9LA 4YDUA 1T03A 4DB3A 4JS4A 5JS2A 4IDHA 1I39A 2DTUA 4JD2B 4CK3A 1HRHA 1IJJA 1NGHA 4ID1A 3E01A 3LP3A 2D4WA 2FBVA 3HSCA 2G8VA 4JI8K 4WQ4C 3AAPA 1XNQK 1RT5A 4I6MB 4JKFA 2VG6A 4C23A 4GNIA 3LDLA 2E1ZA 3ISNC 4V19S 1RT2A 1TKTA 3GDQA 4CHOA 4E1NA 2XHBA 1HMVA 2ASMA 1WBBA 4IJAA 4H5VA 1YHQN 1MU2A 1S6QA 4AHUA 4EP4A 5LMNK 3VQCA 3QESA 1NG9A 3OYGA 4IOCL 4GKJK 3SAHA 4OLAA 2V7YA 3VEVA 4XH4A 4DU4A 2BUPA 4CHZA 2BANA 3QDKA 1KLMA 3QBXA 1BI4B 3WEEA 4RG8A 4FJJA 3LAKA 3MN6A 3QMLA 3KWGA 5GADP 1VSIA 3DRPA 5CZ1A 5AQOA 4B3MK 3VGKA 3M5RA 2FLOA 4DQSA 2A41A 1W9HA 4WFBL 2P9NB 4IG3A 3DXKA 4FJ5A 4YOXA 3O9QA 5H1SQ 4KHNA 3M8PA 4CF8A 3T19A 4FCYA 4FZZA 2BTFA 5GIOA 5C24A 3G71N 4B1UB 3RMDA 1VSMA 4CGGA 3WXJA 4J2AA 4BG8A 3ZETA 4O5FA 2OTJN 3VA3A 3BP8A 4O55A 4BRCA 1YAGA 2P1JA 4JV5K 1CXUA 4W5RA 5KRTA 3LWLA 2QWLA 4U67L 3H08A 3FE1A 1S3XA 2GV9A 3O9TA 1VQKN 3U8XA 1HKBA 2Z1HA 3EYZA 1NOYA 4BY9C 2GX9A 2QWNA 3SQ1A 2NUBA 1ESVA 3AVLA 2JGUA 4DMNA 3EZ5A 1P90A 1RTDA 3R6MA 4DSJA 1N5YA 1U2VA 4BC5A 1REVA 2QEXN 2D0BA 3N4QA 2FF6A 1YUWA 4CGJA 3A5MC 3CM6A 4LD0A 4DR4K 2A6AA 1KCFA 4O8UA 1VSDA 3CXCM 4IBNA 1GLLO 4FPBA 4C8NA 1XMOK 3E9OA 3NVKA 4NCAA 5BN9A 5JS1A 4JI1K 2IDOA 1L3VA 3ZSXA 4KH6A 4CECA 1X9SA 2P5OA 4DU1A 4YORA 3AO5A 3UKUA 1LWCA 3TSPA 1DT9A 5FPMA 4ID5A 2CGLA 3IKMA 2WBNA 4TSXA 3IFRA 3AVBA 1O1WA 3U3YA 3WT0A 2B5JA 4AHTA 3THWA 3I0SA 3VN5A 4H03B 3AVCA 4H0VB 5GAHP 4BDYA 3E66A 4DTJA 1IKWA 5LY3A 3CERA 4CZEA 4N56A 2P9KB 4CGDA 4KHUA 1S9EA 4HTUA 4Z4IA 2R7YA 1A5VA 3ITHA 4JEPA 3VETA 4MO5A 2RN2A 4N41A 4DQIA 3A0IX 1KLNA 1ZBIA 3E1YA 3ZSRA 5FROA 2YI1A 1ZBUA 1ITGA 4H0PA 4N47A 4A61A 4C1NI 3ZX2A 3P83D 5DM7L 1RBVA 4JRQA 4KHPK 3T1YK 1B9FA 4OKEA 1QHTA 2YHWA 2PBDA 4B3RK 3IUCA 5K14A 3CCJN 2NLXA 3ASMA 5BREA 5IT9O 2DY4A 3WQUA 3V1OA 4AH9A 4JHDB 4Z4CA 5C10A 2IIRA 1TGOA 3V9SA 4BR5A 3LP0A 3VEOA 4MFBA 1Q18A 2WOMA 1ZBHA 4BR9A 1D9FA 4Z4HA 3QEXA 1HQEA 1IBMK 3P31A 3FFIA 1QQCA 3TAPA 4LFAK 3ZT2A 4CF1A 4FJGA 4K0KK 1JLQA 1T6CA 3O9UA 2RKIA 3NBPA 5AZJB 3CC7N 3T1HK 1N36K 4BVPA 5AQJA 3U9DA 4BR7A 4MDAA 2VQFK 3RMAA 2FSNA 4CIFA 4JKHA 1HYSA 1FXXA 4Z0UA 3ZCMA 4LF5K 4WYBA 1GLAG 3K9JA 4HCBA 2A5XA 1W2BM 1XNRK 1RT7A 4BE1A 2ZJPL 4A5BA 1J6ZA 4AQYK 1ZXOA 3IDHA 4I2QA 3CI5A 4CZJA 4C8LA 4KHWA 5B8HA 2O4IA 1B9DA 2YNHA 4NCBA 1HR0K 2G8FA 3NH1A 2ZJRL 3OS2A 1QVFM 3KKSA 5SZTA 1KC8O 5J2NA 2HHSA 3MAQA 3M8RA 1RTJA 1QQOA 1NK9A 3CJAA 3A5OC 4MO4A 4H5RA 1WSEA 3TU5A 3HP6A 2ASPA 4CW7B 3ATUA 4B1YB 4UY8O 4CEZA 1O13A 3VF6A 4EHTA 4YOVA 4FLUA 2F7TA 2KQ2A 3DYAA 1N34K 3HM8A 3CG7A 2FC0A 1Y64A 3VESA 5BRFA 3DXMB 4MQ3A 3PSFA 5KRSA 1SL0A 3D6RA 2GTDA 3HPHA 1LW2A 2VWKA 2DPNA 5AQLA 3ZEUB 2UUAK 5KPRA 4KHSA 3CCQN 4YDUC 4HUFA 3NH2A 4DTRA 1U2VB 1ZC6A 5FLXO 4CF9A 2O8EB 1GOBA 5HRNA 5HRSA 1QE1A 3D2FB 4F4KA 1IBLK 5DK5A 5FPNA 1SZ2A 4DV4K 3SPZA 1T3VA 5AQNA 1IG9A 3TR8A 1RT6A 4CEQA 4KREA 5AQFA 1NGGA 3SQ4A 1HNZK 1F21A 3V9WA 4QAGA 3AVJA 3CFPA 2B6AA 3AVHA 2P5GA 3AVKA 3O3GA 3K5OA 4CEDA 2NRWA 1NU0A 1EWQA 4Y0WA 3QIPA 4PQUA 4B3SK 5GINA 3NF9A 4BQLA 3FLCO 4YOUA 3CCSN 4BRMA 3NVMA 2YJEA 1NJWA 3MN9A 2Q36A 1TL3A 3RSEB 3KK1A 4XIUA 4BDPA 5KPZA 3LZJA 4KHYA 3L2QA 4OKKA 3ENBA 3RRGA 4PL7A 4DV1K 3KD1E 4G1QA 4M3UA 4CF2A 1VSKA 3SUNA 3QNOA 3MXMA 4L8RB 4AHSA 4IDKA 4DS4A 4HWIA 2FXUA 3QEVA 3VQ8A 1EKEA 4BRIA 2P9UB 3QB0A 5KGXA 3MMVA 3HXMA 2Q1NA 2P9SB 3J80O 5M1FA 4AHRA 4BREA 1QQMA 2FBYA 3SQ0A 4O0IA 3HBTA 4DQ8A 3EN9A 4DWIA 2WTUA 2DFFA 1Y97A 3IRXA 1RDDA 4IG0A 3V81A 2ITMA 4DSFA 3C7NA 1DTTA 4ILJA 3QEIA 4CEFA 3O9RA 2UXDK 4FJNA 1RNHA 4PKIA 1HX1A 1TKZA 3EO3A 1V4TA 3KLHA 3NMUA 2KTQA 5J2PA 3VEWA 3VEZA 4GV9A 2QA4N 2QXFA 4DKWA 5LJWA 2YNGA 4FW2A 3AARA 4DSLA 2HNYA 3VOVA 5F0XA 2KZMA 1GLCG 2VWBA 4K42A 5HBMA 4K41A 1Q81O 4M41A 4E1JA 3VA0A 3THYA 3OS1A 3HM9A 3JXUA 3LM9A 5BR8K 3PX0A 2YNFA 4LSLA 3BDPA 3TPQA 3TTDA 4Z94A 4E7IA 1JJ2M 3MEDA 1CZBA 4WFNL 2YHBA 3PLAA 4CF0A 3T3FA 4LH5A 4EP5A 1I94K 1HLUA 1NK6A 4IOXA 4A57A 3DLEA 1L3SA 3TAFA 1GLJO 4FJLA 1SAZA 2WONA 4CJWA 1NK4A 1YTAA 3AA3A 4JKGB 3T69A 4JS5A 3RR7A 4M3TA 4OGCA 1RILA 2KZZA 1QS4A 2UXCK 4QS9A 1ZBFA 1U47A 3VQDA 3VPZA 4YOWA 2QWQA 4KHQA 3C95A 1OH6A 4NLBA 1FKOA 3D45A 3FZFA 2BH1A 5C12A 2ZE2A 1RT4A 2I5JA 3V1QA 3V6DA 5J2QA 4LSNA 3FR0A 1IO2A 5JLFA 1A5XA 3NF6A 1IKXA 3NF7A 4FLVA 1S1WA 1EP4A 4LFBK 1LCUA 3RR8A 4FLZA 4DFPA 3L2RA 2I7PA 2W6KA 3QETA 4E7HA 2HF4A 3OYMA 5I42A 4CZHA 1VQ7N 2EHGA 3OYCA 1M90O 3BEXA 1K6YA 3P39A 4YFUA 1SV5A 5AZIA 3L2VA 2VCPA 4ISGA 1BUPA 2P51A 2E2PA 4FJMA 4CIEA 4CHQA 5M1KA 4F3OA 1S1UA 4KPYA 3M8QA 2GEMA 4RW6A 3ULEB 3THXA 3DWLA 4CJQA 1NGCA 5C2FA 5CE3A 2RF2A 3VEXA 4DQRA 2O8BA 3WNGA 4JI0K 1X1PA 1D5AA 4KTWA 3JS6A 4DTSA 1X3NA 4NLCA 1CZ9A 2HHQA 2Q97A 2QK9A 1TUYA 5AQXA 4DG1A 3H45C 1S1TA 4JRPA 1XHZA 5AQKA 2P9PA 3F9MA 4J2DA 4DU3A 3UE5A 4X65K 4Z4EA 3J7AP 5CR4A 4ELTA 3H3OB 3D0PA 3RMCA 1TAQA 4DLEA 4WF9L 3FZHA 1IV0A 3VQ4A 3D2EB 3SMSA 4BRKA 3OYDA 1KFSA 2ZM6K 3GG4A 1TV6A 4H4OA 4CD3A 4B9VA 3BUZB 2QKBA 3AA4A 3KLEA 3WNFA 4KBOA 3AVIA 3VQ7A 1WBDA 3B8AX 4N5SA 1JL1A 1U04A 4KH5A 1TYQA 3CCUN 3AAQA 1NBWA 5KGWA 1BQNA 1HJRA 4BC2A 1L5UA 1TAUA 3MXIA 4RW4A 1M1KO 1CLQA 2YKMA 3I8BA 4CZKA 1YVUA 1Q86O 3HSTB 4CVNE 1XC9A 3KWIA 3QIOA 3K2PA 2KHOA 4FWSA 2E4LA 3HYFA 4H4MA 3AVAA 5A2QO 3ATVA 1J5EK 2QWOA 5AQWA 4AF1A 1L3TA 3MECA 1C6VA 1YJWN 4WFAL 1CZAN 1RGIA 4JKCA 3DLBA 2OPPA 4N76A 4IO9L 3QINA 4H5TA 4LC9B 5M1QA 4BGBA 4DR6K 4CHPA 3MXJA 1XI1A 3HPGA 3NF8A 3C94A 4DF8A 4DSKA 3I0RA 4O4GA 2OA8A 3C65A 3J7YP 1S9GA
chains in the Genus database with same CATH topology
2G8WA 5KI6A 4WE1A 2FBTA 3LP0A 4MFBA 3CQ8A 3AA2A 4AHCA 2WOMA 3K58A 3U6FA 3LPTA 1JLBA 1RTIA 4CJEA 1ZBHA 3ZT4A 1QTMA 2YNIA 1D9FA 1RBUA 4Z4HA 3QEXA 1HQEA 1QSYA 4I9LA 4NYFA 4OPKA 2HHXA 2XY6A 4B8CA 3FFIA 4J2BA 1QQCA 3TAPA 2Q3SA 3DMJA 3ZT2A 3HL8A 4CF1A 3NCIA 4FJGA 1JLQA 3EY1A 1NKBA 5E41A 2RKIA 3NBPA 2Z1GA 3HJFA 4DFJA 3L3UA 1A5WA 4OPJA 1WNSA 3DI6A 1WSHA 3G0ZA 5FRMA 3V9XA 2X6NA 1VSHA 3RMAA 4B9TA 1C1CA 2ITGA 4CIFA 3QEPA 1X9WA 2IS3A 1T05A 4PWDA 1RBRA 2X78A 1HYSA 4FLXA 4DFKA 2Z1JA 1FXXA 4Z0UA 1NK0A 3ZCMA 2PZSA 3V1RA 4E7LA 2HVHA 1KVBA 4M3RA 1YT3A 4C8KA 3HK2A 3SNNA 4HCBA 4ICLA 3TAEA 1RT7A 3OJUA 1C0TA 4BE1A 2OZMA 1CXQA 2HHTA 4O44A 4H8KA 4OKJA 2XY8A 4KTZA 4K8XA 3HO1A 3O4NA 1J54A 1UAXA 1NJYA 4I2QA 2IGIA 4C8LA 3DRSA 3NGYA 1SUQA 4CFCA 3SYZA 1B9DA 2YNHA 4RW9A 4NCBA 4KHWA 2O4IA 1DLOA 1SKWA 3QNNA 2HVIA 4CK1A 4KFBA 4IFVA 3OYBA 2G8FA 3SUQA 3NH1A 4GW6A 3VQEA 4R5PA 1NOZA 3AVNA 4UQGA 5D3GA 3HVRA 3ZSQA 3OS2A 1NK8A 5FDLA 1JLEA 4FM1A 3KKSA 5SZTA 2E6MA 2KFNA 2FBXA 5J2NA 2HHSA 3MAQA 3KLIA 3M8RA 1NKCA 1VSLA 4CJVA 1RTJA 2ZQBA 1KSPA 3O3FA 4E19A 1WSIA 1NK9A 4RW8A 3ZT3A 1HNIA 4DTPA 4B9UA 4HUEA 1WSEA 2YKNA 5EU7A 3ZT0A 4DTXA 3WNEA 4KI6A 3HP6A 1S6PA 4E1MA 4KRFA 4CESA 2D5RA 2X6SA 3MEEA 3TAQA 2A1RA 4W5OA 4CGFA 3ZSOA 4CEZA 1RDCA 4Z4FA 4FLUA 3NGIA 3C6TA 1NJXA 1WAFA 3CYMA 2IOCA 4CFBA 3LZIA 4J2EA 4PUOA 2KQ2A 3DYAA 4FJ9A 3KJVA 4BDZA 3TABA 3CG7A 2FC0A 1ZBLA 1WLJA 3VQ6A 3THVA 1L3UA 4FJKA 4MQ3A 2DFEA 1JLFA 5KRSA 1SL0A 4FM0A 3HP9A 3KIOA 2B4JA 3HPHA 5C25A 1U4BA 1VRUA 3RWUA 1LW2A 2VWKA 4IKFA 2GUIA 4KHSA 1TK0A 4DTOA 1VSEA 4HUFA 3NH2A 3OYEA 2D0CA 3VQQA 4DTRA 1EETA 1S5JA 4KO0A 4CF9A 2PY5A 1Q8IA 1GOBA 3F9KA 4CEEA 2F8SA 4CGHA 5HRNA 2HW3A 3LPUA 4O0JA 5HRSA 1QE1A 1G15A 5KTQA 4F4KA 4NYNA 3L8BA 5DK5A 1RT3A 4CJKA 3OYLA 3K5MA 1C0UA 4CJ5A 3DLGA 3SUOA 4M3ZA 4W5TA 1JXEA 4DF4A 2XY7A 3K57A 3SPZA 3PO4A 5CYMA 4KI4A 4FVMA 1IG9A 3NH0A 1ZYQA 1DTQA 1LWEA 4KAZA 3TR8A 1RT6A 3C6UA 3PUFA 4CEQA 4KTQA 4KREA 3SQ4A 3M8SA 1F21A 1HYZA 4FJXA 3V9WA 1UOCA 4QAGA 3AVJA 3CFPA 2B6AA 3AVHA 1EXQA 1HQUA 3AVKA 4CEBA 4CJTA 3OYNA 3OYFA 3O3GA 3CFRA 1RCHA 4CJ3A 3K5OA 4HHTA 4M42A 3OYJA 4CEDA 1JLAA 4FJ7A 4LH4A 4DSIA 3P5JA 3QIPA 4HUGA 4PQUA 4W5QA 4M3YA 2PYLA 4FXDA 1WSGA 3NGZA 2O4GA 3NF9A 2IC3A 4FLYA 4QCLA 3LP2A 1NK7A 4F3TA 3JSMA 2BGGA 4I7FA 2E6LA 3F73A 1NJWA 3ZSYA 5J1EA 1TL3A 3KK1A 2OZSA 5CYQA 2HHWA 2AJQA 4XIUA 4BDPA 2Y1JA 5HRRA 4KHYA 3LZJA 4CERA 1HYVA 3NFAA 3PX4A 4E0DA 3TWHA 1N6QA 4FJHA 3I8DA 2HMIA 2F96A 4F2RA 3K5NA 3L2QA 2VG5A 3L2WA 5FRNA 4OKKA 2PYJA 3B6PA 5CY4A 2X74A 4IFYA 4C8MA 3NE6A 1KRPA 3RRGA 3KD1E 2F8TA 4BACA 4G1QA 3LP1A 4DTUA 3SUPA 3TI0A 1TKDA 4M3UA 4CF2A 1VSKA 3SUNA 3QNOA 4B8AB 2OPQA 3MXMA 1LAVA 1BL3A 4OVLA 4L8RB 1VK0A 4CHYA 4AHSA 4IDKA 3DLKA 4CE9A 4DS4A 3IAYA 4FJIA 3LALA 1U48A 4K8ZA 3AO4A 3OY9A 3VQ8A 1EKEA 3CFOA 3QEVA 3SJJA 3S3NA 4CFDA 1WSJA 5KGXA 3HXMA 3QERA 3S3OA 3OYIA 4KB0A 1UA0A 1C1BA 4B08A 3S9HA 3SI6A 4M3XA 4CEOA 1SL2A 4AHRA 1J53A 1JLCA 3OJSA 2RPIA 2FBYA 3SQ0A 4O0IA 1LAWA 3B6OA 4AHVA 4E7KA 5HROA 1GOAA 1KTQA 3T1AA 3NHGA 4DWIA 2DFFA 1Y97A 1VSFA 2IAJA 3IRXA 2EX3A 4OLBA 1RDDA 4DQPA 1RBSA 1FKPA 1VRTA 2LSNA 4IG0A 4CJPA 3HVTA 5T7BA 3V4IA 4CJLA 3RTVA 3V81A 3TANA 1BHLA 1GOCA 3K59A 3AVGA 1BIUA 2OPSA 2YV0X 4E7JA 1DTTA 4DSFA 4FK2A 5HP1A 3QEIA 4CEFA 4DTNA 1EX4A 3PY8A 1RNHA 4FJNA 3K5LA 3P1GA 4BE2A 1TKZA 3KLFA 3KLHA 1ASWA 4DS5A 1BIZA 3QEWA 3VQAA 1S1XA 2KTQA 5J2PA 4C8OA 3KK2A 1S1VA 1Z25A 2QXFA 1HPZA 4B9SA 2YNGA 4FW2A 2VG7A 4JLHA 1VSJA 1I3AA 2HNDA 5HRPA 1T03A 4DSLA 4JS4A 1HNVA 4KB1A 5CZ2A 5JS2A 2HNYA 4ZHRA 1I39A 4ZTFA 2G8HA 2KZMA 1T7PA 2DTUA 4CK3A 3O3HA 5HBMA 1HRHA 4Z4GA 4CJFA 3RMBA 3PO5A 4M41A 3ALYA 4ID1A 3E01A 3LP3A 2ATQA 2FBVA 2G8VA 3UIQA 1TL1A 3VA0A 3OS1A 1SKRA 4KV8A 3HM9A 3AO2A 3KKRA 3ZSVA 3PX0A 2YNFA 4LSLA 1RT5A 3CM5A 3BDPA 1D9DA 4B9NA 4DTMA 3KTQA 4HCCA 1IKYA 2VG6A 4E7IA 3JYTA 3DM2A 1SKSA 3MEDA 3HPOA 1SL1A 1J9AA 2G8IA 1LW0A 3ZT1A 1CZBA 2YHBA 4CF0A 3ISNC 3T3FA 2Y1IA 4LH5A 4EP5A 1RT2A 1TKTA 4CHOA 4E1NA 1BGXT 2XRIA 3VQ9A 2XHBA 4W5NA 1NK6A 3RRHA 1HMVA 1JL2A 2VWJA 3U3GA 2OPRA 4M3WA 1JXBA 3DLEA 1MU2A 1L3SA 3WNHA 3TAFA 4FJLA 1S6QA 1RDBA 1Z26A 2WONA 4AHUA 4CJWA 1BISA 3QLHA 1YTAA 3AA3A 3VQCA 4EP4A 4JS5A 1XHXA 2KW4A 3QESA 3OYGA 3RR7A 3L2UA 4M3TA 4OGCA 3V9UA 1RILA 2KZZA 1QS4A 4OLAA 1JLGA 4DLGA 4DU4A 4CHZA 4FK0A 1ZBFA 2BANA 2BDPA 1KLMA 3ZSWA 1U47A 1BI4B 3VQDA 3V9ZA 4RG8A 4FJJA 4KHQA 3C95A 3LAKA 3OYKA 3QO9A 1IH7A 2G8UA 1FKOA 3D45A 3O4QA 4O5BA 2GBZA 2ZE2A 2OYQA 4B9LA 4Q0BA 1RT4A 2I5JA 1VSIA 4GVMA 3DRPA 5CZ1A 3V1QA 3V6DA 1NK4A 5J2QA 4LSNA 3A2FA 1IO2A 4DQSA 4CHNA 4ELVA 1W9HA 1RDAA 1A5XA 4CJRA 1R0AA 4I2PA 3NF6A 3MEGA 1IKXA 3NF7A 4IG3A 1BCMA 4FLVA 4FJ5A 4E89A 3OYAA 1S1WA 1EP4A 3ZSZA 4KHNA 3M8PA 4CF8A 3RR8A 3NAEA 3SCXA 4FLZA 4BE0A 3T19A 4FCYA 1U49A 4FZZA 4DFPA 3L2RA 4FZYA 1WSFA 5C24A 1ASUA 3RMDA 1BCOA 4BWMA 1VSMA 3QETA 3TARA 4CGGA 4E7HA 3OYMA 4CGIA 5I42A 4J2AA 1KVAA 4B3OA 4FW1A 3SZ2A 3VA3A 2EHGA 3OYCA 4O55A 2P1JA 1RBTA 1K6YA 4YFUA 1SV5A 2HNZA 5DMRA 1CXUA 1KVCA 3HT3A 3L2VA 2BE2A 4W5RA 3AVFA 2P51A 2A1SA 3DRRA 5KRTA 3LWLA 3H08A 2KFZA 1Q9XA 4BWJA 4FJMA 4CIEA 4ELUA 1TK8A 3PV8A 4CCHA 2GV9A 4AILC 4CHQA 1NJZA 4F3OA 1S1UA 4KPYA 3M8QA 2Z1HA 2QKKA 3EYZA 1NOYA 3VQBA 3SQ1A 4RW6A 4CK2A 2NUBA 4DMNA 3AVLA 2JGUA 3EZ5A 4EZ9A 2HHUA 1UWBA 4I9QA 4CFAA 1RTDA 4CJQA 4DSJA 1N5YA 1ASVA 3VQPA 2XO7A 2RF2A 4EZ6A 4FJ8A 1REVA 4DQRA 2D0BA 3WNGA 4CGJA 1KFDA 1X1PA 1D5AA 3CM6A 4KTWA 4LD0A 4DTSA 1KCFA 4QOZB 3SPYA 4RW7A 1CZ9A 1VSDA 2HHQA 4IBNA 1B92A 1JKHA 3S3MA 1BQMA 1X9MA 4C8NA 1NKEA 4OGEA 2QK9A 4DG1A 1WAJA 2G8KA 2JLEA 4FK4A 4CIGA 4NCAA 3AV9A 3KK3A 3KD5E 2HHVA 1FK9A 1LV5A 1S1TA 3SV4A 5JS1A 2IDOA 4JRPA 1XHZA 4OJRA 1BI4A 1L3VA 3ZSXA 3LWMA 1NK5A 4J2DA 4CECA 4DU3A 1X9SA 2P5OA 4GMJB 4DU1A 3SQ2A 3AO5A 2ETJA 4M45A 1LWCA 3VQ5A 3NDKA 4Z4EA 4ELTA 4KKOA 4ID5A 1Q9YA 4F2SA 1LWFA 4F8RA 3D0PA 3RMCA 4CJUA 1TAQA 4TSXA 4FYDA 1TKXA 2ZD1A 4DLEA 3DOLA 3AVBA 1TK5A 3VQ4A 1O1WA 3AA5X 4FM2A 3U3YA 2HB5A 2B5JA 4AHTA 3OYDA 3IS9A 1KFSA 3I0SA 3VN5A 1TV6A 3AVCA 4H4OA 1IKVA 4NCGA 4B9VA 4PA1A 2QKBA 3AA4A 3L3VA 3KLEA 4PY5A 4BDYA 3WNFA 4FLWA 3AVIA 3VQ7A 2XY5A 4B9MA 3IG1A 4N5SA 2D0AA 1U45A 1JL1A 4DTJA 1RTHA 1U04A 1IKWA 4N56A 1C1AA 2DFHA 4CGDA 4KHUA 4YNQA 3AO1A 3TAGA 3DLHA 3SV3A 5KGWA 1BQNA 1HJRA 1S9EA 4HTUA 5J2MA 1L5UA 2R7YA 1C0MA 4HVJA 4FLTA 1A5VA 3ITHA 4Z4IA 3MXIA 1TAUA 4RW4A 4Y1DA 3TAMA 2RN2A 1CLQA 2YKMA 5I3UA 3BGRA 4DQIA 2P5GA 4N41A 1KLNA 1ZBIA 3ZSRA 1YVUA 5FROA 3HSTB 1ZBUA 1XC9A 1T8EA 4ZTJA 1ITGA 3QIOA 4FZXC 3K2PA 3G10A 4N47A 4DSEA 4DFMA 1UA1A 5C42A 3OVNA 2E4LA 3HYFA 4H4MA 3P83D 4CJ4A 3AVAA 4CEAA 4E3SA 3LDSA 1TVRA 2W42A 1RBVA 3AO3A 3OYHA 4JRQA 3OS0A 3KLGA 1L3TA 4LY7A 1B9FA 1XWLA 3ULDA 4OKEA 3MECA 5HLFA 1QHTA 1C6VA 1D8YA 3DLBA 2OPPA 4N76A 2YHAA 5K14A 3PX6A 2Z1IA 3ASMA 3DLRA 3LANA 3QINA 4Y1CA 1QSSA 4Q5VA 1QSLA 2DY4A 1RT1A 4CHPA 3MXJA 1W0HA 3LAMA 3V1OA 1XI1A 4AH9A 4CJSA 4Z4CA 1J5OA 1YTUA 3HPGA 3NF8A 4DQQA 3AVMA 3C94A 1TGOA 4DF8A 3I0RA 4O4GA 3V9SA 2OA8A 1WN7A 4DSKA 3DOKA 5SWMA 1S9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G8W A;  5KI6 A;  4WE1 A;  2FBT A;  3LP0 A;  4MFB A;  3CQ8 A;  3AA2 A;  4AHC A;  2WOM A;  3K58 A;  3U6F A;  3LPT A;  1JLB A;  1RTI A;  4CJE A;  1ZBH A;  3ZT4 A;  1QTM A;  2YNI A;  1D9F A;  1RBU A;  4Z4H A;  3QEX A;  1HQE A;  1QSY A;  4I9L A;  4NYF A;  4OPK A;  2HHX A;  2XY6 A;  4B8C A;  3FFI A;  4J2B A;  1QQC A;  3TAP A;  2Q3S A;  3DMJ A;  3ZT2 A;  3HL8 A;  4CF1 A;  3NCI A;  4FJG A;  1JLQ A;  3EY1 A;  1NKB A;  5E41 A;  2RKI A;  3NBP A;  2Z1G A;  3HJF A;  4DFJ A;  3L3U A;  1A5W A;  4OPJ A;  1WNS A;  3DI6 A;  1WSH A;  3G0Z A;  5FRM A;  3V9X A;  2X6N A;  1VSH A;  3RMA A;  4B9T A;  1C1C A;  2ITG A;  4CIF A;  3QEP A;  1X9W A;  2IS3 A;  1T05 A;  4PWD A;  1RBR A;  2X78 A;  1HYS A;  4FLX A;  4DFK A;  2Z1J A;  1FXX A;  4Z0U A;  1NK0 A;  3ZCM A;  2PZS A;  3V1R A;  4E7L A;  2HVH A;  1KVB A;  4M3R A;  1YT3 A;  4C8K A;  3HK2 A;  3SNN A;  4HCB A;  4ICL A;  3TAE A;  1RT7 A;  3OJU A;  1C0T A;  4BE1 A;  2OZM A;  1CXQ A;  2HHT A;  4O44 A;  4H8K A;  4OKJ A;  2XY8 A;  4KTZ A;  4K8X A;  3HO1 A;  3O4N A;  1J54 A;  1UAX A;  1NJY A;  4I2Q A;  2IGI A;  4C8L A;  3DRS A;  3NGY A;  1SUQ A;  4CFC A;  3SYZ A;  1B9D A;  2YNH A;  4RW9 A;  4NCB A;  4KHW A;  2O4I A;  1DLO A;  1SKW A;  3QNN A;  2HVI A;  4CK1 A;  4KFB A;  4IFV A;  3OYB A;  2G8F A;  3SUQ A;  3NH1 A;  4GW6 A;  3VQE A;  4R5P A;  1NOZ A;  3AVN A;  4UQG A;  5D3G A;  3HVR A;  3ZSQ A;  3OS2 A;  1NK8 A;  5FDL A;  1JLE A;  4FM1 A;  3KKS A;  5SZT A;  2E6M A;  2KFN A;  2FBX A;  5J2N A;  2HHS A;  3MAQ A;  3KLI A;  3M8R A;  1NKC A;  1VSL A;  4CJV A;  1RTJ A;  2ZQB A;  1KSP A;  3O3F A;  4E19 A;  1WSI A;  1NK9 A;  4RW8 A;  3ZT3 A;  1HNI A;  4DTP A;  4B9U A;  4HUE A;  1WSE A;  2YKN A;  5EU7 A;  3ZT0 A;  4DTX A;  3WNE A;  4KI6 A;  3HP6 A;  1S6P A;  4E1M A;  4KRF A;  4CES A;  2D5R A;  2X6S A;  3MEE A;  3TAQ A;  2A1R A;  4W5O A;  4CGF A;  3ZSO A;  4CEZ A;  1RDC A;  4Z4F A;  4FLU A;  3NGI A;  3C6T A;  1NJX A;  1WAF A;  3CYM A;  2IOC A;  4CFB A;  3LZI A;  4J2E A;  4PUO A;  2KQ2 A;  3DYA A;  4FJ9 A;  3KJV A;  4BDZ A;  3TAB A;  3CG7 A;  2FC0 A;  1ZBL A;  1WLJ A;  3VQ6 A;  3THV A;  1L3U A;  4FJK A;  4MQ3 A;  2DFE A;  1JLF A;  5KRS A;  1SL0 A;  4FM0 A;  3HP9 A;  3KIO A;  2B4J A;  3HPH A;  5C25 A;  1U4B A;  1VRU A;  3RWU A;  1LW2 A;  2VWK A;  4IKF A;  2GUI A;  4KHS A;  1TK0 A;  4DTO A;  1VSE A;  4HUF A;  3NH2 A;  3OYE A;  2D0C A;  3VQQ A;  4DTR A;  1EET A;  1S5J A;  4KO0 A;  4CF9 A;  2PY5 A;  1Q8I A;  1GOB A;  3F9K A;  4CEE A;  2F8S A;  4CGH A;  5HRN A;  2HW3 A;  3LPU A;  4O0J A;  5HRS A;  1QE1 A;  1G15 A;  5KTQ A;  4F4K A;  4NYN A;  3L8B A;  5DK5 A;  1RT3 A;  4CJK A;  3OYL A;  3K5M A;  1C0U A;  4CJ5 A;  3DLG A;  3SUO A;  4M3Z A;  4W5T A;  1JXE A;  4DF4 A;  2XY7 A;  3K57 A;  3SPZ A;  3PO4 A;  5CYM A;  4KI4 A;  4FVM A;  1IG9 A;  3NH0 A;  1ZYQ A;  1DTQ A;  1LWE A;  4KAZ A;  3TR8 A;  1RT6 A;  3C6U A;  3PUF A;  4CEQ A;  4KTQ A;  4KRE A;  3SQ4 A;  3M8S A;  1F21 A;  1HYZ A;  4FJX A;  3V9W A;  1UOC A;  4QAG A;  3AVJ A;  3CFP A;  2B6A A;  3AVH A;  1EXQ A;  1HQU A;  3AVK A;  4CEB A;  4CJT A;  3OYN A;  3OYF A;  3O3G A;  3CFR A;  1RCH A;  4CJ3 A;  3K5O A;  4HHT A;  4M42 A;  3OYJ A;  4CED A;  1JLA A;  4FJ7 A;  4LH4 A;  4DSI A;  3P5J A;  3QIP A;  4HUG A;  4PQU A;  4W5Q A;  4M3Y A;  2PYL A;  4FXD A;  1WSG A;  3NGZ A;  2O4G A;  3NF9 A;  2IC3 A;  4FLY A;  4QCL A;  3LP2 A;  1NK7 A;  4F3T A;  3JSM A;  2BGG A;  4I7F A;  2E6L A;  3F73 A;  1NJW A;  3ZSY A;  5J1E A;  1TL3 A;  3KK1 A;  2OZS A;  5CYQ A;  2HHW A;  2AJQ A;  4XIU A;  4BDP A;  2Y1J A;  5HRR A;  4KHY A;  3LZJ A;  4CER A;  1HYV A;  3NFA A;  3PX4 A;  4E0D A;  3TWH A;  1N6Q A;  4FJH A;  3I8D A;  2HMI A;  2F96 A;  4F2R A;  3K5N A;  3L2Q A;  2VG5 A;  3L2W A;  5FRN A;  4OKK A;  2PYJ A;  3B6P A;  5CY4 A;  2X74 A;  4IFY A;  4C8M A;  3NE6 A;  1KRP A;  3RRG A;  3KD1 E;  2F8T A;  4BAC A;  4G1Q A;  3LP1 A;  4DTU A;  3SUP A;  3TI0 A;  1TKD A;  4M3U A;  4CF2 A;  1VSK A;  3SUN A;  3QNO A;  4B8A B;  2OPQ A;  3MXM A;  1LAV A;  1BL3 A;  4OVL A;  4L8R B;  1VK0 A;  4CHY A;  4AHS A;  4IDK A;  3DLK A;  4CE9 A;  4DS4 A;  3IAY A;  4FJI A;  3LAL A;  1U48 A;  4K8Z A;  3AO4 A;  3OY9 A;  3VQ8 A;  1EKE A;  3CFO A;  3QEV A;  3SJJ A;  3S3N A;  4CFD A;  1WSJ A;  5KGX A;  3HXM A;  3QER A;  3S3O A;  3OYI A;  4KB0 A;  1UA0 A;  1C1B A;  4B08 A;  3S9H A;  3SI6 A;  4M3X A;  4CEO A;  1SL2 A;  4AHR A;  1J53 A;  1JLC A;  3OJS A;  2RPI A;  2FBY A;  3SQ0 A;  4O0I A;  1LAW A;  3B6O A;  4AHV A;  4E7K A;  5HRO A;  1GOA A;  1KTQ A;  3T1A A;  3NHG A;  4DWI A;  2DFF A;  1Y97 A;  1VSF A;  2IAJ A;  3IRX A;  2EX3 A;  4OLB A;  1RDD A;  4DQP A;  1RBS A;  1FKP A;  1VRT A;  2LSN A;  4IG0 A;  4CJP A;  3HVT A;  5T7B A;  3V4I A;  4CJL A;  3RTV A;  3V81 A;  3TAN A;  1BHL A;  1GOC A;  3K59 A;  3AVG A;  1BIU A;  2OPS A;  2YV0 X;  4E7J A;  1DTT A;  4DSF A;  4FK2 A;  5HP1 A;  3QEI A;  4CEF A;  4DTN A;  1EX4 A;  3PY8 A;  1RNH A;  4FJN A;  3K5L A;  3P1G A;  4BE2 A;  1TKZ A;  3KLF A;  3KLH A;  1ASW A;  4DS5 A;  1BIZ A;  3QEW A;  3VQA A;  1S1X A;  2KTQ A;  5J2P A;  4C8O A;  3KK2 A;  1S1V A;  1Z25 A;  2QXF A;  1HPZ A;  4B9S A;  2YNG A;  4FW2 A;  2VG7 A;  4JLH A;  1VSJ A;  1I3A A;  2HND A;  5HRP A;  1T03 A;  4DSL A;  4JS4 A;  1HNV A;  4KB1 A;  5CZ2 A;  5JS2 A;  2HNY A;  4ZHR A;  1I39 A;  4ZTF A;  2G8H A;  2KZM A;  1T7P A;  2DTU A;  4CK3 A;  3O3H A;  5HBM A;  1HRH A;  4Z4G A;  4CJF A;  3RMB A;  3PO5 A;  4M41 A;  3ALY A;  4ID1 A;  3E01 A;  3LP3 A;  2ATQ A;  2FBV A;  2G8V A;  3UIQ A;  1TL1 A;  3VA0 A;  3OS1 A;  1SKR A;  4KV8 A;  3HM9 A;  3AO2 A;  3KKR A;  3ZSV A;  3PX0 A;  2YNF A;  4LSL A;  1RT5 A;  3CM5 A;  3BDP A;  1D9D A;  4B9N A;  4DTM A;  3KTQ A;  4HCC A;  1IKY A;  2VG6 A;  4E7I A;  3JYT A;  3DM2 A;  1SKS A;  3MED A;  3HPO A;  1SL1 A;  1J9A A;  2G8I A;  1LW0 A;  3ZT1 A;  1CZB A;  2YHB A;  4CF0 A;  3ISN C;  3T3F A;  2Y1I A;  4LH5 A;  4EP5 A;  1RT2 A;  1TKT A;  4CHO A;  4E1N A;  1BGX T;  2XRI A;  3VQ9 A;  2XHB A;  4W5N A;  1NK6 A;  3RRH A;  1HMV A;  1JL2 A;  2VWJ A;  3U3G A;  2OPR A;  4M3W A;  1JXB A;  3DLE A;  1MU2 A;  1L3S A;  3WNH A;  3TAF A;  4FJL A;  1S6Q A;  1RDB A;  1Z26 A;  2WON A;  4AHU A;  4CJW A;  1BIS A;  3QLH A;  1YTA A;  3AA3 A;  3VQC A;  4EP4 A;  4JS5 A;  1XHX A;  2KW4 A;  3QES A;  3OYG A;  3RR7 A;  3L2U A;  4M3T A;  4OGC A;  3V9U A;  1RIL A;  2KZZ A;  1QS4 A;  4OLA A;  1JLG A;  4DLG A;  4DU4 A;  4CHZ A;  4FK0 A;  1ZBF A;  2BAN A;  2BDP A;  1KLM A;  3ZSW A;  1U47 A;  1BI4 B;  3VQD A;  3V9Z A;  4RG8 A;  4FJJ A;  4KHQ A;  3C95 A;  3LAK A;  3OYK A;  3QO9 A;  1IH7 A;  2G8U A;  1FKO A;  3D45 A;  3O4Q A;  4O5B A;  2GBZ A;  2ZE2 A;  2OYQ A;  4B9L A;  4Q0B A;  1RT4 A;  2I5J A;  1VSI A;  4GVM A;  3DRP A;  5CZ1 A;  3V1Q A;  3V6D A;  1NK4 A;  5J2Q A;  4LSN A;  3A2F A;  1IO2 A;  4DQS A;  4CHN A;  4ELV A;  1W9H A;  1RDA A;  1A5X A;  4CJR A;  1R0A A;  4I2P A;  3NF6 A;  3MEG A;  1IKX A;  3NF7 A;  4IG3 A;  1BCM A;  4FLV A;  4FJ5 A;  4E89 A;  3OYA A;  1S1W A;  1EP4 A;  3ZSZ A;  4KHN A;  3M8P A;  4CF8 A;  3RR8 A;  3NAE A;  3SCX A;  4FLZ A;  4BE0 A;  3T19 A;  4FCY A;  1U49 A;  4FZZ A;  4DFP A;  3L2R A;  4FZY A;  1WSF A;  5C24 A;  1ASU A;  3RMD A;  1BCO A;  4BWM A;  1VSM A;  3QET A;  3TAR A;  4CGG A;  4E7H A;  3OYM A;  4CGI A;  5I42 A;  4J2A A;  1KVA A;  4B3O A;  4FW1 A;  3SZ2 A;  3VA3 A;  2EHG A;  3OYC A;  4O55 A;  2P1J A;  1RBT A;  1K6Y A;  4YFU A;  1SV5 A;  2HNZ A;  5DMR A;  1CXU A;  1KVC A;  3HT3 A;  3L2V A;  2BE2 A;  4W5R A;  3AVF A;  2P51 A;  2A1S A;  3DRR A;  5KRT A;  3LWL A;  3H08 A;  2KFZ A;  1Q9X A;  4BWJ A;  4FJM A;  4CIE A;  4ELU A;  1TK8 A;  3PV8 A;  4CCH A;  2GV9 A;  4AIL C;  4CHQ A;  1NJZ A;  4F3O A;  1S1U A;  4KPY A;  3M8Q A;  2Z1H A;  2QKK A;  3EYZ A;  1NOY A;  3VQB A;  3SQ1 A;  4RW6 A;  4CK2 A;  2NUB A;  4DMN A;  3AVL A;  2JGU A;  3EZ5 A;  4EZ9 A;  2HHU A;  1UWB A;  4I9Q A;  4CFA A;  1RTD A;  4CJQ A;  4DSJ A;  1N5Y A;  1ASV A;  3VQP A;  2XO7 A;  2RF2 A;  4EZ6 A;  4FJ8 A;  1REV A;  4DQR A;  2D0B A;  3WNG A;  4CGJ A;  1KFD A;  1X1P A;  1D5A A;  3CM6 A;  4KTW A;  4LD0 A;  4DTS A;  1KCF A;  4QOZ B;  3SPY A;  4RW7 A;  1CZ9 A;  1VSD A;  2HHQ A;  4IBN A;  1B92 A;  1JKH A;  3S3M A;  1BQM A;  1X9M A;  4C8N A;  1NKE A;  4OGE A;  2QK9 A;  4DG1 A;  1WAJ A;  2G8K A;  2JLE A;  4FK4 A;  4CIG A;  4NCA A;  3AV9 A;  3KK3 A;  3KD5 E;  2HHV A;  1FK9 A;  1LV5 A;  1S1T A;  3SV4 A;  5JS1 A;  2IDO A;  4JRP A;  1XHZ A;  4OJR A;  1BI4 A;  1L3V A;  3ZSX A;  3LWM A;  1NK5 A;  4J2D A;  4CEC A;  4DU3 A;  1X9S A;  2P5O A;  4GMJ B;  4DU1 A;  3SQ2 A;  3AO5 A;  2ETJ A;  4M45 A;  1LWC A;  3VQ5 A;  3NDK A;  4Z4E A;  4ELT A;  4KKO A;  4ID5 A;  1Q9Y A;  4F2S A;  1LWF A;  4F8R A;  3D0P A;  3RMC A;  4CJU A;  1TAQ A;  4TSX A;  4FYD A;  1TKX A;  2ZD1 A;  4DLE A;  3DOL A;  3AVB A;  1TK5 A;  3VQ4 A;  1O1W A;  3AA5 X;  4FM2 A;  3U3Y A;  2HB5 A;  2B5J A;  4AHT A;  3OYD A;  3IS9 A;  1KFS A;  3I0S A;  3VN5 A;  1TV6 A;  3AVC A;  4H4O A;  1IKV A;  4NCG A;  4B9V A;  4PA1 A;  2QKB A;  3AA4 A;  3L3V A;  3KLE A;  4PY5 A;  4BDY A;  3WNF A;  4FLW A;  3AVI A;  3VQ7 A;  2XY5 A;  4B9M A;  3IG1 A;  4N5S A;  2D0A A;  1U45 A;  1JL1 A;  4DTJ A;  1RTH A;  1U04 A;  1IKW A;  4N56 A;  1C1A A;  2DFH A;  4CGD A;  4KHU A;  4YNQ A;  3AO1 A;  3TAG A;  3DLH A;  3SV3 A;  5KGW A;  1BQN A;  1HJR A;  1S9E A;  4HTU A;  5J2M A;  1L5U A;  2R7Y A;  1C0M A;  4HVJ A;  4FLT A;  1A5V A;  3ITH A;  4Z4I A;  3MXI A;  1TAU A;  4RW4 A;  4Y1D A;  3TAM A;  2RN2 A;  1CLQ A;  2YKM A;  5I3U A;  3BGR A;  4DQI A;  2P5G A;  4N41 A;  1KLN A;  1ZBI A;  3ZSR A;  1YVU A;  5FRO A;  3HST B;  1ZBU A;  1XC9 A;  1T8E A;  4ZTJ A;  1ITG A;  3QIO A;  4FZX C;  3K2P A;  3G10 A;  4N47 A;  4DSE A;  4DFM A;  1UA1 A;  5C42 A;  3OVN A;  2E4L A;  3HYF A;  4H4M A;  3P83 D;  4CJ4 A;  3AVA A;  4CEA A;  4E3S A;  3LDS A;  1TVR A;  2W42 A;  1RBV A;  3AO3 A;  3OYH A;  4JRQ A;  3OS0 A;  3KLG A;  1L3T A;  4LY7 A;  1B9F A;  1XWL A;  3ULD A;  4OKE A;  3MEC A;  5HLF A;  1QHT A;  1C6V A;  1D8Y A;  3DLB A;  2OPP A;  4N76 A;  2YHA A;  5K14 A;  3PX6 A;  2Z1I A;  3ASM A;  3DLR A;  3LAN A;  3QIN A;  4Y1C A;  1QSS A;  4Q5V A;  1QSL A;  2DY4 A;  1RT1 A;  4CHP A;  3MXJ A;  1W0H A;  3LAM A;  3V1O A;  1XI1 A;  4AH9 A;  4CJS A;  4Z4C A;  1J5O A;  1YTU A;  3HPG A;  3NF8 A;  4DQQ A;  3AVM A;  3C94 A;  1TGO A;  4DF8 A;  3I0R A;  4O4G A;  3V9S A;  2OA8 A;  1WN7 A;  4DSK A;  3DOK A;  5SWM A;  1S9G A; 
#chains in the Genus database with same CATH topology
 3SAG A;  3AA2 A;  4LFC K;  1RTI A;  2YNI A;  1QSY A;  5C0Y A;  4OX9 K;  4I9L A;  2XY6 A;  4B8C A;  3ENO A;  3CQY A;  4FSV A;  4J2B A;  2Q3S A;  4MDB A;  4OPA A;  1NGA A;  2Z1G A;  4FOI A;  4H0O A;  1VQP N;  3HJF A;  5AQM A;  3WXL A;  3ID8 A;  4JNE A;  4OPJ A;  1WSH A;  3G0Z A;  2ZGZ A;  2HBL A;  5AQU A;  4B9T A;  1C1C A;  1TUU A;  3OA9 A;  3QEP A;  2AA4 A;  1D4X A;  2X78 A;  4BC4 A;  3G4S N;  1YIT N;  4IJN A;  3CC2 N;  4E7L A;  2HVH A;  3HK2 A;  4C8K A;  3TAE A;  5EXW A;  3OJU A;  1C0T A;  2OZM A;  1CXQ A;  1T6D A;  3FZM A;  4O44 A;  2XY8 A;  4K8X A;  5MLC Q;  3CMA N;  3DRS A;  2P9I A;  4CFC A;  1HJO A;  5BN8 A;  1SKW A;  3OYB A;  1KXP A;  3G25 A;  4GW6 A;  4R5P A;  1NOZ A;  3WUH A;  3ZSQ A;  4L3Q A;  4QS8 A;  4R79 A;  4FM1 A;  1FW6 A;  2KFN A;  2E6M A;  3EKS A;  1KD1 O;  1BO5 O;  5CHI A;  1NKC A;  1VSL A;  2ZQB A;  4B9Q A;  2ASO A;  2P9L A;  4E19 A;  3O3F A;  1HNW K;  3ZT3 A;  4X62 K;  4JI2 K;  4DTP A;  1KQS M;  3C0B A;  4DTX A;  2VQE K;  4E1M A;  3ZX0 A;  4KRF A;  3TAQ A;  2X6S A;  2A1R A;  4W5O A;  3L4Q A;  3ZSO A;  3NGI A;  3VF2 A;  2IVP A;  3CYM A;  2IOC A;  1Q7Y O;  3AY9 A;  4FJ9 A;  3KJV A;  1ZBL A;  1WLJ A;  3A5L C;  3VEN A;  1BDG A;  2RHK A;  4FM0 A;  1YI2 N;  3KIO A;  3H3N O;  5C25 A;  2O8D B;  1HKG A;  5EVZ A;  2HF3 A;  1TK0 A;  2O8F B;  1SS6 A;  3OYE A;  3VQQ A;  4PKH A;  1WB9 A;  2HBJ A;  3ZYY X;  2PY5 A;  4JKB A;  4CEE A;  1X9J A;  2F8S A;  2HW3 A;  3I55 N;  3LPU A;  4O0J A;  1G15 A;  1NGJ A;  3OYL A;  3DLG A;  4M3Z A;  2YJF A;  2IVN A;  4DF4 A;  3PO4 A;  1NWK A;  4FVM A;  3NH0 A;  1LWE A;  4KAZ A;  3C6U A;  1NJX A;  4IEE A;  1EXQ A;  3CFR A;  4CJT A;  3MK6 A;  1RCH A;  4EAH D;  4FWR A;  3OYJ A;  1NGD A;  5I9E B;  1FJG K;  3CJC A;  1GLE G;  5TKY A;  2UXB K;  4W5Q A;  3CQX A;  2D0O A;  1WSG A;  3NGZ A;  3RVC A;  5F2R A;  1Z6R A;  3I33 A;  3LP2 A;  1NK7 A;  3SLC A;  2BGG A;  5F1X A;  1H1V A;  4ILG B;  4FWK A;  3ZSY A;  5J1E A;  2OZS A;  3GBT A;  5HRR A;  4AM7 A;  3NFA A;  3PX4 A;  4FJH A;  4A5A A;  1HKC A;  1VQ9 N;  1U6Z A;  1K9M O;  5FRN A;  4DV0 K;  3CF5 L;  2OTL N;  4JI3 K;  2QXL A;  4IEI A;  1TKD A;  3OHR A;  3UKR A;  1IBK K;  2JWL A;  4B8A B;  1LAV A;  2V51 B;  4CHY A;  4K8Z A;  4M63 C;  3IAY A;  2Q31 A;  3LAL A;  1U48 A;  4JK7 A;  4DCH A;  1YXQ A;  3S9H A;  5JVH L;  1UA0 A;  4M3X A;  3WEE B;  4CEO A;  1SL2 A;  2VYP A;  1J53 A;  3OJS A;  2RPI A;  1LAW A;  4QS7 A;  4AHV A;  1GLB G;  5HRO A;  1GOA A;  3T1A A;  4A2A A;  4OLB A;  2EX3 A;  1FKP A;  2LSN A;  2CH6 A;  5AQH A;  1JCF A;  2OPS A;  3O5B A;  1OH8 A;  4CZF A;  4FK2 A;  3DXK B;  4C1N K;  4DTN A;  1DEJ A;  3PY8 A;  3VMF B;  3KLF A;  4DS5 A;  3QEW A;  3KK2 A;  3PIO L;  3ZET B;  2VG7 A;  2HND A;  5HRP A;  4ZHR A;  4ZTF A;  4K25 A;  2G8H A;  1T7P A;  1K8K A;  3O8M A;  3PO5 A;  3ALY A;  3UIQ A;  2ATQ A;  1TL1 A;  2NRT A;  1SKR A;  4KV8 A;  2WC9 A;  3KKR A;  3ZSV A;  4JI5 K;  2F9T A;  2HOE A;  1D9D A;  3KTQ A;  3Q7B A;  4EHU A;  1IKY A;  3JYT A;  3DM2 A;  1SKS A;  2W41 A;  5GIP A;  1VQ4 N;  1SL1 A;  3HPO A;  1J9A A;  2G8I A;  1LW0 A;  4JI7 K;  3ZT1 A;  5ADX H;  2Y1I A;  3DLL L;  4RCH A;  3RRH A;  2RE2 A;  4FWP A;  1VQ6 N;  4M3W A;  1JXB A;  3EKU A;  1RDB A;  1S22 A;  1Z26 A;  3SI6 A;  3CD6 N;  2AP1 A;  1XHX A;  1XQS C;  2KW4 A;  3CPW M;  3L2U A;  3V9U A;  3I56 N;  4FWN A;  1JLG A;  4CBX A;  3ZSW A;  3V9Z A;  3UKU B;  3QO9 A;  1IH7 A;  3O4Q A;  5IWA K;  2OYQ A;  3VEY A;  3TSQ A;  3O9S A;  4Q0B A;  4GVM A;  1BOT O;  2A40 A;  3A2F A;  2E1Y A;  2QI2 A;  4CHN A;  1R0A A;  4I2P A;  3THW B;  1ATR A;  3MEG A;  4E89 A;  3C6A A;  4GKK K;  1VQL N;  3PIP L;  1Z05 A;  4RTF D;  3NAE A;  3SCX A;  5AQY A;  4BE0 A;  2HMP A;  3OBW A;  1K8A O;  1WSF A;  4XH5 A;  4IWV A;  1ASU A;  4DV6 K;  4BWM A;  3M6G A;  1V4S A;  5KQD A;  4B3O A;  3SZ2 A;  3DJC A;  3E9P A;  1QQN A;  4K43 A;  1KVC A;  3HT3 A;  2BE2 A;  3AVF A;  4JD2 A;  2KFZ A;  1Q9X A;  2QTD A;  4BWJ A;  4X66 K;  2HST A;  3PV8 A;  4CCH A;  3N4P A;  4YOT A;  1NJZ A;  5FPD A;  5AFU H;  4YOY A;  1NM1 A;  4I6M A;  3VQB A;  4EZ9 A;  2HHU A;  3CJB A;  3OW2 M;  1ASV A;  1EO1 A;  3VQP A;  2XO7 A;  4JAX A;  4EZ6 A;  4FJ8 A;  3EL2 A;  3KHY A;  3O1W A;  4DV7 K;  4QOZ B;  2E2Q A;  3SPY A;  4RW7 A;  4CJ7 A;  1JKH A;  3S3M A;  2GWK A;  1X9M A;  3CJ7 A;  3MN5 A;  1WAJ A;  2JLE A;  4CIG A;  3KK3 A;  3KD5 E;  1FK9 A;  3SV4 A;  1WOQ A;  4OJR A;  3O6W A;  1BI4 A;  2HBM A;  3LWM A;  1NK5 A;  1NGF A;  4GMJ B;  3SQ2 A;  3M3Z A;  3VQ5 A;  3NDK A;  2NRX A;  1W7A A;  4KKO A;  1Q9Y A;  1LWF A;  4FWL A;  5AR0 A;  4CJU A;  3A8Y A;  1TKX A;  2ZD1 A;  3CHW A;  1TK5 A;  4YY3 K;  3AA5 X;  2O8C A;  5LL6 Z;  2NRV A;  1OH5 A;  3CPE A;  2P9N A;  4NCG A;  5BPM A;  1YJ9 N;  1GLF O;  4PA1 A;  1MWK A;  2XY5 A;  2D0A A;  5GAE P;  4CBU A;  5TKW A;  1C1A A;  3WXK A;  3AO1 A;  1IG8 A;  1C0M A;  3LDP A;  4FLT A;  5AQI A;  2QWP A;  1E3M A;  3CCM N;  2F4V K;  4GVE A;  4FZX C;  4FOE A;  5BRH A;  1UA1 A;  4BR2 A;  1XUP O;  3SBG A;  4CEA A;  4E3S A;  1TVR A;  2Q2R A;  3KVG A;  2YHX A;  2W42 A;  3AO3 A;  3OYH A;  3CCV N;  3OS0 A;  3KLG A;  4CZM A;  4LY7 A;  3ULD A;  1D8Y A;  4BRL A;  4IZ9 A;  4DR2 K;  2Z1I A;  3DLR A;  2QM1 A;  1QSS A;  4DV3 K;  1W0H A;  1J5O A;  4CJS A;  1RDU A;  3AVM A;  4BR0 A;  3P4I A;  3G6E N;  1WN7 A;  4H0X B;  4O8K A;  5M1O A;  1NGI A;  5SWM A;  2YHY A;  4BRQ A;  2G8W A;  5KI6 A;  4WE1 A;  3CQ8 A;  4AHC A;  3K58 A;  3U6F A;  4IOA L;  3LPT A;  4CJE A;  3ZT4 A;  1QTM A;  1RBU A;  1C0F A;  2V7Z A;  3W0L A;  2HHX A;  3DMJ A;  3EY1 A;  1NKB A;  5E41 A;  3FZK A;  3L3U A;  1A5W A;  3DI6 A;  1BA1 A;  3MN7 A;  5FPE A;  3W3D A;  5FRM A;  1E4G T;  1EQY A;  2X6N A;  3V9X A;  4KH4 A;  2IS3 A;  4FLX A;  4DFK A;  5BPL A;  1ATN A;  3WQT A;  1HUX A;  1NK0 A;  2PZS A;  1OVY A;  2CGJ A;  4M3R A;  1QZ5 A;  1YT3 A;  3HZ6 A;  3CCL N;  2P9K A;  2HHT A;  4H8K A;  4BRF A;  3HO1 A;  3LM2 A;  1NJY A;  3L6Q A;  1BWF O;  3VTH A;  1W97 L;  3SYZ A;  1BA0 A;  4RW9 A;  1VQM N;  4NXN K;  3LL3 A;  3HI0 A;  3QNN A;  3ZLJ A;  4JYA K;  4H0Y B;  4KFB A;  3SUQ A;  4UQG A;  3AVN A;  3HVR A;  1K73 O;  4JKD A;  5FDL A;  1JLE A;  4B1W B;  2FBX A;  3ENH A;  1C0G A;  3HRG A;  1WSI A;  2E5L K;  4RW8 A;  4B9U A;  4HUE A;  4MLE A;  1JCG A;  4FWQ A;  5AQT A;  2ZF5 O;  3ZT0 A;  3K0S A;  3WNE A;  1S6P A;  2W6L A;  1MWM A;  4CES A;  3MEE A;  2E88 A;  4JK9 A;  1WAF A;  4YHH K;  4PUO A;  4JHD A;  1T44 A;  1BU6 O;  3TAB A;  4HTL A;  2UYT A;  3VQ6 A;  3QFU A;  2HBK A;  1L3U A;  3EZW A;  2DFE A;  3O4W A;  1HNX K;  1RFQ A;  3HP9 A;  3U4L A;  3CJ1 A;  2B4J A;  1U4B A;  3HTV A;  3RWU A;  3CET A;  5AQV A;  4IKF A;  1SQK A;  4DV5 K;  4DTO A;  5HL7 L;  1N33 K;  3SK3 A;  5AZJ A;  3LDN A;  1S5J A;  5AQP A;  1QHA A;  4KO0 A;  4BRA A;  3C7N B;  1E4F T;  3BF1 A;  1KAX A;  1RDW X;  4NYN A;  3GL1 A;  3SUO A;  3K5M A;  1C0U A;  4CJ5 A;  5AQQ A;  3T7Z A;  1JXE A;  3K57 A;  5CYM A;  1ILY A;  5LMU K;  4FJX A;  1HYZ A;  1XMQ K;  2E2O A;  3QBW A;  1HQU A;  3OYF A;  4ISF A;  3OYN A;  4HHT A;  4M42 A;  5BRD A;  1N8R O;  1JLA A;  4FJ7 A;  3H46 O;  3P5J A;  3AGK A;  4CI6 A;  4M3Y A;  3THY B;  2O4G A;  4FLY A;  3O08 A;  4F3T A;  3TTC A;  2O8C B;  2E6L A;  4NO7 A;  5CYQ A;  2AJQ A;  4CER A;  3HOS A;  4E0D A;  3TWH A;  3I8D A;  3K5N A;  2VG5 A;  1VQN N;  2PYJ A;  4A59 A;  4IFY A;  4C8M A;  3NE6 A;  2J4R A;  4DTU A;  3SUP A;  5AQR A;  4LF6 K;  3ID6 A;  4OVL A;  2IVO A;  4JKE A;  4JI4 K;  4X64 K;  2I7N A;  4FJI A;  4BQZ A;  1XC3 A;  3OY9 A;  3S3N A;  3SJJ A;  3CCR N;  4CFD A;  3OYI A;  2WUS A;  4B08 A;  5EX5 A;  3DXM A;  4BRG A;  4GV3 A;  3BF3 A;  4M7X A;  4DHY A;  1JLC A;  4PKG A;  4E7K A;  3ZEU A;  3NHG A;  3JAM O;  1RBS A;  3EE8 A;  4A2B A;  3EE9 A;  1VRT A;  4CJP A;  2FSK A;  4CJL A;  2O8E A;  3QIC A;  1BHL A;  1GOC A;  3AVG A;  1BIU A;  2YV0 X;  4CZI A;  5HP1 A;  3D2F A;  1EX4 A;  1NNE A;  5AQZ A;  3P1G A;  1ASW A;  3FGU A;  1S1X A;  5EOY A;  1S1V A;  4B3T K;  4JLH A;  3S41 A;  1I3A A;  4MLH A;  4KB1 A;  2PAV A;  4DR1 K;  1HNV A;  2GUP A;  5CZ2 A;  5AZI B;  4CZG A;  5AJ3 K;  2NNW A;  3O3H A;  4Z4G A;  4CJF A;  3RMB A;  3CME N;  3H1Q A;  4ISE A;  2PFU A;  2E8A A;  3F2K A;  1NLV A;  4B1V A;  3AO2 A;  3KK7 A;  2FSJ A;  3CM5 A;  4B9N A;  4DTM A;  5BR9 A;  4HCC A;  4FPA A;  1QZ6 A;  3RSE A;  3THX B;  3LDQ A;  4IXC A;  3CCE N;  5DM6 L;  1G99 A;  1BGX T;  2XRI A;  3VQ9 A;  2O8B B;  4W5N A;  2Q0U A;  1JL2 A;  2VWJ A;  3U3G A;  2OPR A;  4BRO A;  4LF4 K;  3WNH A;  2PYL A;  1BIS A;  3QLH A;  1LOT B;  4DR7 K;  4BG9 A;  3MX2 A;  1YJN N;  4AM6 A;  4DLG A;  4RWT A;  2P9U A;  4FK0 A;  2P9S A;  3VTI A;  2BDP A;  2P9P B;  2FF3 B;  3R3L A;  3OYK A;  4EFH A;  2ZJQ L;  1QVG M;  2G8U A;  4O5B A;  2W40 A;  2GBZ A;  4B9L A;  3UB5 A;  3AGR A;  4ELV A;  1RDA A;  4CJR A;  3SAF A;  2OCE A;  4CD1 A;  4GY2 B;  1BCM A;  1NGB A;  1OKJ A;  2CH5 A;  5KPT A;  5C2D A;  3OYA A;  4WQ5 A;  3ZSZ A;  2Q0R A;  4JI6 K;  1U49 A;  4FZY A;  5ELZ A;  3L4I A;  4DV2 K;  4BRD A;  1BCO A;  3TAR A;  4CGI A;  1KVA A;  3GOI A;  1TYQ B;  4FW1 A;  5JMV A;  1RBT A;  3TSU A;  4BRH A;  2HNZ A;  5DMR A;  3DRR A;  2A1S A;  5JVG L;  4ELU A;  3H6E A;  1TK8 A;  4AIL C;  2NRH A;  4JK8 A;  2WFB A;  3MDQ A;  4PHT X;  4PL8 A;  2QKK A;  4BR4 A;  2ZWH A;  4JN4 A;  4CK2 A;  1UWB A;  4I9Q A;  4CFA A;  2UU9 K;  3VGM A;  4J8F A;  4BRN A;  1KAZ A;  4JKA A;  1KFD A;  4H0T B;  4WQ4 A;  4XEI A;  4BC3 A;  1B92 A;  4JKG A;  1BQM A;  4M7Y A;  1NKE A;  4LF8 K;  4OGE A;  1YVN A;  2G8K A;  4FK4 A;  3AV9 A;  3D7E O;  2HHV A;  1LV5 A;  3BZC A;  3VF4 A;  4BVO A;  1YF5 L;  2ETJ A;  4M45 A;  1JCE A;  4FL9 A;  4F2S A;  2NRR A;  2V52 B;  4F8R A;  4FYD A;  4LF9 K;  1VQ8 N;  3DOL A;  1NJI O;  2QW9 A;  1P8Z A;  3CJ9 A;  4FM2 A;  2HB5 A;  1NGE A;  2QWR A;  5AQS A;  3IS9 A;  2VGM A;  3FZL A;  4CBW A;  1IKV A;  2HHH K;  3L3V A;  4PY5 A;  4FLW A;  1YIJ N;  4B9M A;  3IG1 A;  1U45 A;  1ZBS A;  1RTH A;  1NMD A;  2DFH A;  4YNQ A;  3TAG A;  3DLH A;  3SV3 A;  5J2M A;  3SBT A;  4HVJ A;  3PSI A;  4Y1D A;  3TAM A;  4CZL A;  2P9I B;  5I3U A;  3BGR A;  1DKG D;  2GWJ A;  2YCH A;  3F5T A;  1VHX A;  4ZTJ A;  1T8E A;  4DSE A;  3G10 A;  4DFM A;  5C42 A;  3OVN A;  4CJ4 A;  4DUY K;  3LDS A;  4G9Z A;  3U9Z A;  3ULE A;  2ZGY A;  4DR3 K;  5C15 A;  2P9L B;  3SJH A;  1XWL A;  5HLF A;  4H5N A;  3O80 A;  5BPN A;  2EWS A;  3R1X A;  2H3G X;  2YHA A;  4IFE A;  1HPM A;  3PX6 A;  3LAN A;  4Y1C A;  3H1V X;  3O1B A;  2JWK A;  4Q5V A;  1QSL A;  1RT1 A;  3LAM A;  4DQQ A;  3TTF A;  4OO1 J;  3WXM B;  1N32 K;  3DOK A;  2FBT A;  4FWM A;  5KQ8 A;  4XH1 A;  1JLB A;  3BZK A;  3IMX A;  4NYF A;  4B1X B;  4OPK A;  1Q82 O;  2D1K A;  1KAY A;  2UUB K;  3HL8 A;  5M1P A;  5JLH A;  3NCI A;  4LF7 K;  4DFJ A;  4BRP A;  5LJV A;  1WNS A;  3J7Z O;  3D2E A;  3HOT A;  1VSH A;  2ITG A;  1X9W A;  4NXM K;  1T05 A;  3WXI A;  4PWD A;  1RBR A;  2Z1J A;  3MWT A;  4FO0 A;  2A3Z A;  3EEQ A;  3V1R A;  1KVB A;  3SNN A;  4ICL A;  3K9K A;  4BGA A;  4OKJ A;  4KTZ A;  3O4N A;  1J54 A;  1UAX A;  2IGI A;  3NGY A;  1SUQ A;  1DLO A;  3ZX3 A;  1VQ5 N;  3CIP A;  3DAW A;  2HVI A;  4CK1 A;  4IFV A;  3J8A A;  2NZT A;  1OH7 A;  4DUZ K;  3VQE A;  5D3G A;  1NK8 A;  3J81 O;  3KLI A;  5AQG A;  4CJV A;  1KSP A;  2KLA A;  1HNI A;  3Q7C A;  5E84 A;  4ILH A;  2YKN A;  5EU7 A;  5E26 A;  4B1Z A;  4KI6 A;  3R9P A;  3MCP A;  2QWM A;  3C6H A;  3M1F A;  3UKR B;  2D5R A;  4CGF A;  1RDC A;  4Z4F A;  3C6T A;  3LZI A;  4CFB A;  4J2E A;  3SMP A;  4WCE L;  4BDZ A;  5GAG P;  4H5W A;  5JIC A;  3MWP A;  3THV A;  4FJK A;  1ATS A;  1JLF A;  1X3M A;  1OVQ A;  1VRU A;  2UUC K;  4NB4 A;  2GUI A;  2E2N A;  1VSE A;  1NMN A;  2D0C A;  1EET A;  1Q8I A;  3F9K A;  4CGH A;  3VER A;  5ADX A;  1MDU B;  5KTQ A;  3L8B A;  4OPH A;  1RT3 A;  4CJK A;  4W5T A;  3MX5 A;  2XY7 A;  2OAN A;  4KI4 A;  1VQO N;  1ZYQ A;  1DTQ A;  4KTQ A;  4EIA A;  3PUF A;  3M8S A;  1UOC A;  1YTU A;  1VAZ A;  4CEB A;  3LDO A;  4CJ3 A;  2E20 A;  2F9W A;  4LH4 A;  1K8K B;  4DSI A;  4HUG A;  2GEL A;  4FXD A;  2IC3 A;  4QCL A;  3QFP A;  4F9O A;  3JSM A;  4I7F A;  3GE1 A;  2A42 A;  3F73 A;  2HHW A;  2VGN A;  3BY5 A;  4FWO A;  2Y1J A;  2D0P A;  1HYV A;  1N6Q A;  2HMI A;  2F96 A;  4F2R A;  3L0Q A;  3L2W A;  1DGK N;  3B6P A;  4A62 A;  5CY4 A;  2X74 A;  1WUA A;  1KRP A;  2F8T A;  4BAC A;  3LP1 A;  3OBY A;  5M1N A;  3TI0 A;  3FFK B;  2CGK A;  1GLD G;  3MCA B;  1EWR A;  2OPQ A;  4DR5 K;  1BL3 A;  1VK0 A;  3DLK A;  4CE9 A;  1S72 N;  3AO4 A;  3R8E A;  3CFO A;  1MA9 B;  3A5N C;  3CC4 N;  1WSJ A;  3QER A;  4FVU A;  3S3O A;  4KB0 A;  1C1B A;  4WQ5 C;  1R59 O;  2O8D A;  3P38 A;  3B6O A;  4GV6 A;  2KKZ A;  1KTQ A;  5AFU A;  2NRZ A;  1BG3 A;  1VSF A;  2IAJ A;  2O8F A;  4DQP A;  3HVT A;  5T7B A;  3V4I A;  3RTV A;  3TAN A;  4U7B A;  3K59 A;  3VGL A;  4E7J A;  3KZB A;  3K5L A;  4BE2 A;  2YX6 A;  1BIZ A;  3VQA A;  4C8O A;  1Z25 A;  4B9S A;  1HPZ A;  3OTO K;  5EY4 A;  5HOO A;  4IO8 A;  1VSJ A;  3E9L A;  4YDU A;  1T03 A;  4DB3 A;  4JS4 A;  5JS2 A;  4IDH A;  1I39 A;  2DTU A;  4JD2 B;  4CK3 A;  1HRH A;  1IJJ A;  1NGH A;  4ID1 A;  3E01 A;  3LP3 A;  2D4W A;  2FBV A;  3HSC A;  2G8V A;  4JI8 K;  4WQ4 C;  3AAP A;  1XNQ K;  1RT5 A;  4I6M B;  4JKF A;  2VG6 A;  4C23 A;  4GNI A;  3LDL A;  2E1Z A;  3ISN C;  4V19 S;  1RT2 A;  1TKT A;  3GDQ A;  4CHO A;  4E1N A;  2XHB A;  1HMV A;  2ASM A;  1WBB A;  4IJA A;  4H5V A;  1YHQ N;  1MU2 A;  1S6Q A;  4AHU A;  4EP4 A;  5LMN K;  3VQC A;  3QES A;  1NG9 A;  3OYG A;  4IOC L;  4GKJ K;  3SAH A;  4OLA A;  2V7Y A;  3VEV A;  4XH4 A;  4DU4 A;  2BUP A;  4CHZ A;  2BAN A;  3QDK A;  1KLM A;  3QBX A;  1BI4 B;  3WEE A;  4RG8 A;  4FJJ A;  3LAK A;  3MN6 A;  3QML A;  3KWG A;  5GAD P;  1VSI A;  3DRP A;  5CZ1 A;  5AQO A;  4B3M K;  3VGK A;  3M5R A;  2FLO A;  4DQS A;  2A41 A;  1W9H A;  4WFB L;  2P9N B;  4IG3 A;  3DXK A;  4FJ5 A;  4YOX A;  3O9Q A;  5H1S Q;  4KHN A;  3M8P A;  4CF8 A;  3T19 A;  4FCY A;  4FZZ A;  2BTF A;  5GIO A;  5C24 A;  3G71 N;  4B1U B;  3RMD A;  1VSM A;  4CGG A;  3WXJ A;  4J2A A;  4BG8 A;  3ZET A;  4O5F A;  2OTJ N;  3VA3 A;  3BP8 A;  4O55 A;  4BRC A;  1YAG A;  2P1J A;  4JV5 K;  1CXU A;  4W5R A;  5KRT A;  3LWL A;  2QWL A;  4U67 L;  3H08 A;  3FE1 A;  1S3X A;  2GV9 A;  3O9T A;  1VQK N;  3U8X A;  1HKB A;  2Z1H A;  3EYZ A;  1NOY A;  4BY9 C;  2GX9 A;  2QWN A;  3SQ1 A;  2NUB A;  1ESV A;  3AVL A;  2JGU A;  4DMN A;  3EZ5 A;  1P90 A;  1RTD A;  3R6M A;  4DSJ A;  1N5Y A;  1U2V A;  4BC5 A;  1REV A;  2QEX N;  2D0B A;  3N4Q A;  2FF6 A;  1YUW A;  4CGJ A;  3A5M C;  3CM6 A;  4LD0 A;  4DR4 K;  2A6A A;  1KCF A;  4O8U A;  1VSD A;  3CXC M;  4IBN A;  1GLL O;  4FPB A;  4C8N A;  1XMO K;  3E9O A;  3NVK A;  4NCA A;  5BN9 A;  5JS1 A;  4JI1 K;  2IDO A;  1L3V A;  3ZSX A;  4KH6 A;  4CEC A;  1X9S A;  2P5O A;  4DU1 A;  4YOR A;  3AO5 A;  3UKU A;  1LWC A;  3TSP A;  1DT9 A;  5FPM A;  4ID5 A;  2CGL A;  3IKM A;  2WBN A;  4TSX A;  3IFR A;  3AVB A;  1O1W A;  3U3Y A;  3WT0 A;  2B5J A;  4AHT A;  3THW A;  3I0S A;  3VN5 A;  4H03 B;  3AVC A;  4H0V B;  5GAH P;  4BDY A;  3E66 A;  4DTJ A;  1IKW A;  5LY3 A;  3CER A;  4CZE A;  4N56 A;  2P9K B;  4CGD A;  4KHU A;  1S9E A;  4HTU A;  4Z4I A;  2R7Y A;  1A5V A;  3ITH A;  4JEP A;  3VET A;  4MO5 A;  2RN2 A;  4N41 A;  4DQI A;  3A0I X;  1KLN A;  1ZBI A;  3E1Y A;  3ZSR A;  5FRO A;  2YI1 A;  1ZBU A;  1ITG A;  4H0P A;  4N47 A;  4A61 A;  4C1N I;  3ZX2 A;  3P83 D;  5DM7 L;  1RBV A;  4JRQ A;  4KHP K;  3T1Y K;  1B9F A;  4OKE A;  1QHT A;  2YHW A;  2PBD A;  4B3R K;  3IUC A;  5K14 A;  3CCJ N;  2NLX A;  3ASM A;  5BRE A;  5IT9 O;  2DY4 A;  3WQU A;  3V1O A;  4AH9 A;  4JHD B;  4Z4C A;  5C10 A;  2IIR A;  1TGO A;  3V9S A;  4BR5 A;  3LP0 A;  3VEO A;  4MFB A;  1Q18 A;  2WOM A;  1ZBH A;  4BR9 A;  1D9F A;  4Z4H A;  3QEX A;  1HQE A;  1IBM K;  3P31 A;  3FFI A;  1QQC A;  3TAP A;  4LFA K;  3ZT2 A;  4CF1 A;  4FJG A;  4K0K K;  1JLQ A;  1T6C A;  3O9U A;  2RKI A;  3NBP A;  5AZJ B;  3CC7 N;  3T1H K;  1N36 K;  4BVP A;  5AQJ A;  3U9D A;  4BR7 A;  4MDA A;  2VQF K;  3RMA A;  2FSN A;  4CIF A;  4JKH A;  1HYS A;  1FXX A;  4Z0U A;  3ZCM A;  4LF5 K;  4WYB A;  1GLA G;  3K9J A;  4HCB A;  2A5X A;  1W2B M;  1XNR K;  1RT7 A;  4BE1 A;  2ZJP L;  4A5B A;  1J6Z A;  4AQY K;  1ZXO A;  3IDH A;  4I2Q A;  3CI5 A;  4CZJ A;  4C8L A;  4KHW A;  5B8H A;  2O4I A;  1B9D A;  2YNH A;  4NCB A;  1HR0 K;  2G8F A;  3NH1 A;  2ZJR L;  3OS2 A;  1QVF M;  3KKS A;  5SZT A;  1KC8 O;  5J2N A;  2HHS A;  3MAQ A;  3M8R A;  1RTJ A;  1QQO A;  1NK9 A;  3CJA A;  3A5O C;  4MO4 A;  4H5R A;  1WSE A;  3TU5 A;  3HP6 A;  2ASP A;  4CW7 B;  3ATU A;  4B1Y B;  4UY8 O;  4CEZ A;  1O13 A;  3VF6 A;  4EHT A;  4YOV A;  4FLU A;  2F7T A;  2KQ2 A;  3DYA A;  1N34 K;  3HM8 A;  3CG7 A;  2FC0 A;  1Y64 A;  3VES A;  5BRF A;  3DXM B;  4MQ3 A;  3PSF A;  5KRS A;  1SL0 A;  3D6R A;  2GTD A;  3HPH A;  1LW2 A;  2VWK A;  2DPN A;  5AQL A;  3ZEU B;  2UUA K;  5KPR A;  4KHS A;  3CCQ N;  4YDU C;  4HUF A;  3NH2 A;  4DTR A;  1U2V B;  1ZC6 A;  5FLX O;  4CF9 A;  2O8E B;  1GOB A;  5HRN A;  5HRS A;  1QE1 A;  3D2F B;  4F4K A;  1IBL K;  5DK5 A;  5FPN A;  1SZ2 A;  4DV4 K;  3SPZ A;  1T3V A;  5AQN A;  1IG9 A;  3TR8 A;  1RT6 A;  4CEQ A;  4KRE A;  5AQF A;  1NGG A;  3SQ4 A;  1HNZ K;  1F21 A;  3V9W A;  4QAG A;  3AVJ A;  3CFP A;  2B6A A;  3AVH A;  2P5G A;  3AVK A;  3O3G A;  3K5O A;  4CED A;  2NRW A;  1NU0 A;  1EWQ A;  4Y0W A;  3QIP A;  4PQU A;  4B3S K;  5GIN A;  3NF9 A;  4BQL A;  3FLC O;  4YOU A;  3CCS N;  4BRM A;  3NVM A;  2YJE A;  1NJW A;  3MN9 A;  2Q36 A;  1TL3 A;  3RSE B;  3KK1 A;  4XIU A;  4BDP A;  5KPZ A;  3LZJ A;  4KHY A;  3L2Q A;  4OKK A;  3ENB A;  3RRG A;  4PL7 A;  4DV1 K;  3KD1 E;  4G1Q A;  4M3U A;  4CF2 A;  1VSK A;  3SUN A;  3QNO A;  3MXM A;  4L8R B;  4AHS A;  4IDK A;  4DS4 A;  4HWI A;  2FXU A;  3QEV A;  3VQ8 A;  1EKE A;  4BRI A;  2P9U B;  3QB0 A;  5KGX A;  3MMV A;  3HXM A;  2Q1N A;  2P9S B;  3J80 O;  5M1F A;  4AHR A;  4BRE A;  1QQM A;  2FBY A;  3SQ0 A;  4O0I A;  3HBT A;  4DQ8 A;  3EN9 A;  4DWI A;  2WTU A;  2DFF A;  1Y97 A;  3IRX A;  1RDD A;  4IG0 A;  3V81 A;  2ITM A;  4DSF A;  3C7N A;  1DTT A;  4ILJ A;  3QEI A;  4CEF A;  3O9R A;  2UXD K;  4FJN A;  1RNH A;  4PKI A;  1HX1 A;  1TKZ A;  3EO3 A;  1V4T A;  3KLH A;  3NMU A;  2KTQ A;  5J2P A;  3VEW A;  3VEZ A;  4GV9 A;  2QA4 N;  2QXF A;  4DKW A;  5LJW A;  2YNG A;  4FW2 A;  3AAR A;  4DSL A;  2HNY A;  3VOV A;  5F0X A;  2KZM A;  1GLC G;  2VWB A;  4K42 A;  5HBM A;  4K41 A;  1Q81 O;  4M41 A;  4E1J A;  3VA0 A;  3THY A;  3OS1 A;  3HM9 A;  3JXU A;  3LM9 A;  5BR8 K;  3PX0 A;  2YNF A;  4LSL A;  3BDP A;  3TPQ A;  3TTD A;  4Z94 A;  4E7I A;  1JJ2 M;  3MED A;  1CZB A;  4WFN L;  2YHB A;  3PLA A;  4CF0 A;  3T3F A;  4LH5 A;  4EP5 A;  1I94 K;  1HLU A;  1NK6 A;  4IOX A;  4A57 A;  3DLE A;  1L3S A;  3TAF A;  1GLJ O;  4FJL A;  1SAZ A;  2WON A;  4CJW A;  1NK4 A;  1YTA A;  3AA3 A;  4JKG B;  3T69 A;  4JS5 A;  3RR7 A;  4M3T A;  4OGC A;  1RIL A;  2KZZ A;  1QS4 A;  2UXC K;  4QS9 A;  1ZBF A;  1U47 A;  3VQD A;  3VPZ A;  4YOW A;  2QWQ A;  4KHQ A;  3C95 A;  1OH6 A;  4NLB A;  1FKO A;  3D45 A;  3FZF A;  2BH1 A;  5C12 A;  2ZE2 A;  1RT4 A;  2I5J A;  3V1Q A;  3V6D A;  5J2Q A;  4LSN A;  3FR0 A;  1IO2 A;  5JLF A;  1A5X A;  3NF6 A;  1IKX A;  3NF7 A;  4FLV A;  1S1W A;  1EP4 A;  4LFB K;  1LCU A;  3RR8 A;  4FLZ A;  4DFP A;  3L2R A;  2I7P A;  2W6K A;  3QET A;  4E7H A;  2HF4 A;  3OYM A;  5I42 A;  4CZH A;  1VQ7 N;  2EHG A;  3OYC A;  1M90 O;  3BEX A;  1K6Y A;  3P39 A;  4YFU A;  1SV5 A;  5AZI A;  3L2V A;  2VCP A;  4ISG A;  1BUP A;  2P51 A;  2E2P A;  4FJM A;  4CIE A;  4CHQ A;  5M1K A;  4F3O A;  1S1U A;  4KPY A;  3M8Q A;  2GEM A;  4RW6 A;  3ULE B;  3THX A;  3DWL A;  4CJQ A;  1NGC A;  5C2F A;  5CE3 A;  2RF2 A;  3VEX A;  4DQR A;  2O8B A;  3WNG A;  4JI0 K;  1X1P A;  1D5A A;  4KTW A;  3JS6 A;  4DTS A;  1X3N A;  4NLC A;  1CZ9 A;  2HHQ A;  2Q97 A;  2QK9 A;  1TUY A;  5AQX A;  4DG1 A;  3H45 C;  1S1T A;  4JRP A;  1XHZ A;  5AQK A;  2P9P A;  3F9M A;  4J2D A;  4DU3 A;  3UE5 A;  4X65 K;  4Z4E A;  3J7A P;  5CR4 A;  4ELT A;  3H3O B;  3D0P A;  3RMC A;  1TAQ A;  4DLE A;  4WF9 L;  3FZH A;  1IV0 A;  3VQ4 A;  3D2E B;  3SMS A;  4BRK A;  3OYD A;  1KFS A;  2ZM6 K;  3GG4 A;  1TV6 A;  4H4O A;  4CD3 A;  4B9V A;  3BUZ B;  2QKB A;  3AA4 A;  3KLE A;  3WNF A;  4KBO A;  3AVI A;  3VQ7 A;  1WBD A;  3B8A X;  4N5S A;  1JL1 A;  1U04 A;  4KH5 A;  1TYQ A;  3CCU N;  3AAQ A;  1NBW A;  5KGW A;  1BQN A;  1HJR A;  4BC2 A;  1L5U A;  1TAU A;  3MXI A;  4RW4 A;  1M1K O;  1CLQ A;  2YKM A;  3I8B A;  4CZK A;  1YVU A;  1Q86 O;  3HST B;  4CVN E;  1XC9 A;  3KWI A;  3QIO A;  3K2P A;  2KHO A;  4FWS A;  2E4L A;  3HYF A;  4H4M A;  3AVA A;  5A2Q O;  3ATV A;  1J5E K;  2QWO A;  5AQW A;  4AF1 A;  1L3T A;  3MEC A;  1C6V A;  1YJW N;  4WFA L;  1CZA N;  1RGI A;  4JKC A;  3DLB A;  2OPP A;  4N76 A;  4IO9 L;  3QIN A;  4H5T A;  4LC9 B;  5M1Q A;  4BGB A;  4DR6 K;  4CHP A;  3MXJ A;  1XI1 A;  3HPG A;  3NF8 A;  3C94 A;  4DF8 A;  4DSK A;  3I0R A;  4O4G A;  2OA8 A;  3C65 A;  3J7Y P;  1S9G A; 
#chains in the Genus database with same CATH homology
 2G8W A;  5KI6 A;  4WE1 A;  2FBT A;  3LP0 A;  4MFB A;  3CQ8 A;  3AA2 A;  4AHC A;  2WOM A;  3K58 A;  3U6F A;  3LPT A;  1JLB A;  1RTI A;  4CJE A;  1ZBH A;  3ZT4 A;  1QTM A;  2YNI A;  1D9F A;  1RBU A;  4Z4H A;  3QEX A;  1HQE A;  1QSY A;  4I9L A;  4NYF A;  4OPK A;  2HHX A;  2XY6 A;  4B8C A;  3FFI A;  4J2B A;  1QQC A;  3TAP A;  2Q3S A;  3DMJ A;  3ZT2 A;  3HL8 A;  4CF1 A;  3NCI A;  4FJG A;  1JLQ A;  3EY1 A;  1NKB A;  5E41 A;  2RKI A;  3NBP A;  2Z1G A;  3HJF A;  4DFJ A;  3L3U A;  1A5W A;  4OPJ A;  1WNS A;  3DI6 A;  1WSH A;  3G0Z A;  5FRM A;  3V9X A;  2X6N A;  1VSH A;  3RMA A;  4B9T A;  1C1C A;  2ITG A;  4CIF A;  3QEP A;  1X9W A;  2IS3 A;  1T05 A;  4PWD A;  1RBR A;  2X78 A;  1HYS A;  4FLX A;  4DFK A;  2Z1J A;  1FXX A;  4Z0U A;  1NK0 A;  3ZCM A;  2PZS A;  3V1R A;  4E7L A;  2HVH A;  1KVB A;  4M3R A;  1YT3 A;  4C8K A;  3HK2 A;  3SNN A;  4HCB A;  4ICL A;  3TAE A;  1RT7 A;  3OJU A;  1C0T A;  4BE1 A;  2OZM A;  1CXQ A;  2HHT A;  4O44 A;  4H8K A;  4OKJ A;  2XY8 A;  4KTZ A;  4K8X A;  3HO1 A;  3O4N A;  1J54 A;  1UAX A;  1NJY A;  4I2Q A;  2IGI A;  4C8L A;  3DRS A;  3NGY A;  1SUQ A;  4CFC A;  3SYZ A;  1B9D A;  2YNH A;  4RW9 A;  4NCB A;  4KHW A;  2O4I A;  1DLO A;  1SKW A;  3QNN A;  2HVI A;  4CK1 A;  4KFB A;  4IFV A;  3OYB A;  2G8F A;  3SUQ A;  3NH1 A;  4GW6 A;  3VQE A;  4R5P A;  1NOZ A;  3AVN A;  4UQG A;  5D3G A;  3HVR A;  3ZSQ A;  3OS2 A;  1NK8 A;  5FDL A;  1JLE A;  4FM1 A;  3KKS A;  5SZT A;  2E6M A;  2KFN A;  2FBX A;  5J2N A;  2HHS A;  3MAQ A;  3KLI A;  3M8R A;  1NKC A;  1VSL A;  4CJV A;  1RTJ A;  2ZQB A;  1KSP A;  3O3F A;  4E19 A;  1WSI A;  1NK9 A;  4RW8 A;  3ZT3 A;  1HNI A;  4DTP A;  4B9U A;  4HUE A;  1WSE A;  2YKN A;  5EU7 A;  3ZT0 A;  4DTX A;  3WNE A;  4KI6 A;  3HP6 A;  1S6P A;  4E1M A;  4KRF A;  4CES A;  2D5R A;  2X6S A;  3MEE A;  3TAQ A;  2A1R A;  4W5O A;  4CGF A;  3ZSO A;  4CEZ A;  1RDC A;  4Z4F A;  4FLU A;  3NGI A;  3C6T A;  1NJX A;  1WAF A;  3CYM A;  2IOC A;  4CFB A;  3LZI A;  4J2E A;  4PUO A;  2KQ2 A;  3DYA A;  4FJ9 A;  3KJV A;  4BDZ A;  3TAB A;  3CG7 A;  2FC0 A;  1ZBL A;  1WLJ A;  3VQ6 A;  3THV A;  1L3U A;  4FJK A;  4MQ3 A;  2DFE A;  1JLF A;  5KRS A;  1SL0 A;  4FM0 A;  3HP9 A;  3KIO A;  2B4J A;  3HPH A;  5C25 A;  1U4B A;  1VRU A;  3RWU A;  1LW2 A;  2VWK A;  4IKF A;  2GUI A;  4KHS A;  1TK0 A;  4DTO A;  1VSE A;  4HUF A;  3NH2 A;  3OYE A;  2D0C A;  3VQQ A;  4DTR A;  1EET A;  1S5J A;  4KO0 A;  4CF9 A;  2PY5 A;  1Q8I A;  1GOB A;  3F9K A;  4CEE A;  2F8S A;  4CGH A;  5HRN A;  2HW3 A;  3LPU A;  4O0J A;  5HRS A;  1QE1 A;  1G15 A;  5KTQ A;  4F4K A;  4NYN A;  3L8B A;  5DK5 A;  1RT3 A;  4CJK A;  3OYL A;  3K5M A;  1C0U A;  4CJ5 A;  3DLG A;  3SUO A;  4M3Z A;  4W5T A;  1JXE A;  4DF4 A;  2XY7 A;  3K57 A;  3SPZ A;  3PO4 A;  5CYM A;  4KI4 A;  4FVM A;  1IG9 A;  3NH0 A;  1ZYQ A;  1DTQ A;  1LWE A;  4KAZ A;  3TR8 A;  1RT6 A;  3C6U A;  3PUF A;  4CEQ A;  4KTQ A;  4KRE A;  3SQ4 A;  3M8S A;  1F21 A;  1HYZ A;  4FJX A;  3V9W A;  1UOC A;  4QAG A;  3AVJ A;  3CFP A;  2B6A A;  3AVH A;  1EXQ A;  1HQU A;  3AVK A;  4CEB A;  4CJT A;  3OYN A;  3OYF A;  3O3G A;  3CFR A;  1RCH A;  4CJ3 A;  3K5O A;  4HHT A;  4M42 A;  3OYJ A;  4CED A;  1JLA A;  4FJ7 A;  4LH4 A;  4DSI A;  3P5J A;  3QIP A;  4HUG A;  4PQU A;  4W5Q A;  4M3Y A;  2PYL A;  4FXD A;  1WSG A;  3NGZ A;  2O4G A;  3NF9 A;  2IC3 A;  4FLY A;  4QCL A;  3LP2 A;  1NK7 A;  4F3T A;  3JSM A;  2BGG A;  4I7F A;  2E6L A;  3F73 A;  1NJW A;  3ZSY A;  5J1E A;  1TL3 A;  3KK1 A;  2OZS A;  5CYQ A;  2HHW A;  2AJQ A;  4XIU A;  4BDP A;  2Y1J A;  5HRR A;  4KHY A;  3LZJ A;  4CER A;  1HYV A;  3NFA A;  3PX4 A;  4E0D A;  3TWH A;  1N6Q A;  4FJH A;  3I8D A;  2HMI A;  2F96 A;  4F2R A;  3K5N A;  3L2Q A;  2VG5 A;  3L2W A;  5FRN A;  4OKK A;  2PYJ A;  3B6P A;  5CY4 A;  2X74 A;  4IFY A;  4C8M A;  3NE6 A;  1KRP A;  3RRG A;  3KD1 E;  2F8T A;  4BAC A;  4G1Q A;  3LP1 A;  4DTU A;  3SUP A;  3TI0 A;  1TKD A;  4M3U A;  4CF2 A;  1VSK A;  3SUN A;  3QNO A;  4B8A B;  2OPQ A;  3MXM A;  1LAV A;  1BL3 A;  4OVL A;  4L8R B;  1VK0 A;  4CHY A;  4AHS A;  4IDK A;  3DLK A;  4CE9 A;  4DS4 A;  3IAY A;  4FJI A;  3LAL A;  1U48 A;  4K8Z A;  3AO4 A;  3OY9 A;  3VQ8 A;  1EKE A;  3CFO A;  3QEV A;  3SJJ A;  3S3N A;  4CFD A;  1WSJ A;  5KGX A;  3HXM A;  3QER A;  3S3O A;  3OYI A;  4KB0 A;  1UA0 A;  1C1B A;  4B08 A;  3S9H A;  3SI6 A;  4M3X A;  4CEO A;  1SL2 A;  4AHR A;  1J53 A;  1JLC A;  3OJS A;  2RPI A;  2FBY A;  3SQ0 A;  4O0I A;  1LAW A;  3B6O A;  4AHV A;  4E7K A;  5HRO A;  1GOA A;  1KTQ A;  3T1A A;  3NHG A;  4DWI A;  2DFF A;  1Y97 A;  1VSF A;  2IAJ A;  3IRX A;  2EX3 A;  4OLB A;  1RDD A;  4DQP A;  1RBS A;  1FKP A;  1VRT A;  2LSN A;  4IG0 A;  4CJP A;  3HVT A;  5T7B A;  3V4I A;  4CJL A;  3RTV A;  3V81 A;  3TAN A;  1BHL A;  1GOC A;  3K59 A;  3AVG A;  1BIU A;  2OPS A;  2YV0 X;  4E7J A;  1DTT A;  4DSF A;  4FK2 A;  5HP1 A;  3QEI A;  4CEF A;  4DTN A;  1EX4 A;  3PY8 A;  1RNH A;  4FJN A;  3K5L A;  3P1G A;  4BE2 A;  1TKZ A;  3KLF A;  3KLH A;  1ASW A;  4DS5 A;  1BIZ A;  3QEW A;  3VQA A;  1S1X A;  2KTQ A;  5J2P A;  4C8O A;  3KK2 A;  1S1V A;  1Z25 A;  2QXF A;  1HPZ A;  4B9S A;  2YNG A;  4FW2 A;  2VG7 A;  4JLH A;  1VSJ A;  1I3A A;  2HND A;  5HRP A;  1T03 A;  4DSL A;  4JS4 A;  1HNV A;  4KB1 A;  5CZ2 A;  5JS2 A;  2HNY A;  4ZHR A;  1I39 A;  4ZTF A;  2G8H A;  2KZM A;  1T7P A;  2DTU A;  4CK3 A;  3O3H A;  5HBM A;  1HRH A;  4Z4G A;  4CJF A;  3RMB A;  3PO5 A;  4M41 A;  3ALY A;  4ID1 A;  3E01 A;  3LP3 A;  2ATQ A;  2FBV A;  2G8V A;  3UIQ A;  1TL1 A;  3VA0 A;  3OS1 A;  1SKR A;  4KV8 A;  3HM9 A;  3AO2 A;  3KKR A;  3ZSV A;  3PX0 A;  2YNF A;  4LSL A;  1RT5 A;  3CM5 A;  3BDP A;  1D9D A;  4B9N A;  4DTM A;  3KTQ A;  4HCC A;  1IKY A;  2VG6 A;  4E7I A;  3JYT A;  3DM2 A;  1SKS A;  3MED A;  3HPO A;  1SL1 A;  1J9A A;  2G8I A;  1LW0 A;  3ZT1 A;  1CZB A;  2YHB A;  4CF0 A;  3ISN C;  3T3F A;  2Y1I A;  4LH5 A;  4EP5 A;  1RT2 A;  1TKT A;  4CHO A;  4E1N A;  1BGX T;  2XRI A;  3VQ9 A;  2XHB A;  4W5N A;  1NK6 A;  3RRH A;  1HMV A;  1JL2 A;  2VWJ A;  3U3G A;  2OPR A;  4M3W A;  1JXB A;  3DLE A;  1MU2 A;  1L3S A;  3WNH A;  3TAF A;  4FJL A;  1S6Q A;  1RDB A;  1Z26 A;  2WON A;  4AHU A;  4CJW A;  1BIS A;  3QLH A;  1YTA A;  3AA3 A;  3VQC A;  4EP4 A;  4JS5 A;  1XHX A;  2KW4 A;  3QES A;  3OYG A;  3RR7 A;  3L2U A;  4M3T A;  4OGC A;  3V9U A;  1RIL A;  2KZZ A;  1QS4 A;  4OLA A;  1JLG A;  4DLG A;  4DU4 A;  4CHZ A;  4FK0 A;  1ZBF A;  2BAN A;  2BDP A;  1KLM A;  3ZSW A;  1U47 A;  1BI4 B;  3VQD A;  3V9Z A;  4RG8 A;  4FJJ A;  4KHQ A;  3C95 A;  3LAK A;  3OYK A;  3QO9 A;  1IH7 A;  2G8U A;  1FKO A;  3D45 A;  3O4Q A;  4O5B A;  2GBZ A;  2ZE2 A;  2OYQ A;  4B9L A;  4Q0B A;  1RT4 A;  2I5J A;  1VSI A;  4GVM A;  3DRP A;  5CZ1 A;  3V1Q A;  3V6D A;  1NK4 A;  5J2Q A;  4LSN A;  3A2F A;  1IO2 A;  4DQS A;  4CHN A;  4ELV A;  1W9H A;  1RDA A;  1A5X A;  4CJR A;  1R0A A;  4I2P A;  3NF6 A;  3MEG A;  1IKX A;  3NF7 A;  4IG3 A;  1BCM A;  4FLV A;  4FJ5 A;  4E89 A;  3OYA A;  1S1W A;  1EP4 A;  3ZSZ A;  4KHN A;  3M8P A;  4CF8 A;  3RR8 A;  3NAE A;  3SCX A;  4FLZ A;  4BE0 A;  3T19 A;  4FCY A;  1U49 A;  4FZZ A;  4DFP A;  3L2R A;  4FZY A;  1WSF A;  5C24 A;  1ASU A;  3RMD A;  1BCO A;  4BWM A;  1VSM A;  3QET A;  3TAR A;  4CGG A;  4E7H A;  3OYM A;  4CGI A;  5I42 A;  4J2A A;  1KVA A;  4B3O A;  4FW1 A;  3SZ2 A;  3VA3 A;  2EHG A;  3OYC A;  4O55 A;  2P1J A;  1RBT A;  1K6Y A;  4YFU A;  1SV5 A;  2HNZ A;  5DMR A;  1CXU A;  1KVC A;  3HT3 A;  3L2V A;  2BE2 A;  4W5R A;  3AVF A;  2P51 A;  2A1S A;  3DRR A;  5KRT A;  3LWL A;  3H08 A;  2KFZ A;  1Q9X A;  4BWJ A;  4FJM A;  4CIE A;  4ELU A;  1TK8 A;  3PV8 A;  4CCH A;  2GV9 A;  4AIL C;  4CHQ A;  1NJZ A;  4F3O A;  1S1U A;  4KPY A;  3M8Q A;  2Z1H A;  2QKK A;  3EYZ A;  1NOY A;  3VQB A;  3SQ1 A;  4RW6 A;  4CK2 A;  2NUB A;  4DMN A;  3AVL A;  2JGU A;  3EZ5 A;  4EZ9 A;  2HHU A;  1UWB A;  4I9Q A;  4CFA A;  1RTD A;  4CJQ A;  4DSJ A;  1N5Y A;  1ASV A;  3VQP A;  2XO7 A;  2RF2 A;  4EZ6 A;  4FJ8 A;  1REV A;  4DQR A;  2D0B A;  3WNG A;  4CGJ A;  1KFD A;  1X1P A;  1D5A A;  3CM6 A;  4KTW A;  4LD0 A;  4DTS A;  1KCF A;  4QOZ B;  3SPY A;  4RW7 A;  1CZ9 A;  1VSD A;  2HHQ A;  4IBN A;  1B92 A;  1JKH A;  3S3M A;  1BQM A;  1X9M A;  4C8N A;  1NKE A;  4OGE A;  2QK9 A;  4DG1 A;  1WAJ A;  2G8K A;  2JLE A;  4FK4 A;  4CIG A;  4NCA A;  3AV9 A;  3KK3 A;  3KD5 E;  2HHV A;  1FK9 A;  1LV5 A;  1S1T A;  3SV4 A;  5JS1 A;  2IDO A;  4JRP A;  1XHZ A;  4OJR A;  1BI4 A;  1L3V A;  3ZSX A;  3LWM A;  1NK5 A;  4J2D A;  4CEC A;  4DU3 A;  1X9S A;  2P5O A;  4GMJ B;  4DU1 A;  3SQ2 A;  3AO5 A;  2ETJ A;  4M45 A;  1LWC A;  3VQ5 A;  3NDK A;  4Z4E A;  4ELT A;  4KKO A;  4ID5 A;  1Q9Y A;  4F2S A;  1LWF A;  4F8R A;  3D0P A;  3RMC A;  4CJU A;  1TAQ A;  4TSX A;  4FYD A;  1TKX A;  2ZD1 A;  4DLE A;  3DOL A;  3AVB A;  1TK5 A;  3VQ4 A;  1O1W A;  3AA5 X;  4FM2 A;  3U3Y A;  2HB5 A;  2B5J A;  4AHT A;  3OYD A;  3IS9 A;  1KFS A;  3I0S A;  3VN5 A;  1TV6 A;  3AVC A;  4H4O A;  1IKV A;  4NCG A;  4B9V A;  4PA1 A;  2QKB A;  3AA4 A;  3L3V A;  3KLE A;  4PY5 A;  4BDY A;  3WNF A;  4FLW A;  3AVI A;  3VQ7 A;  2XY5 A;  4B9M A;  3IG1 A;  4N5S A;  2D0A A;  1U45 A;  1JL1 A;  4DTJ A;  1RTH A;  1U04 A;  1IKW A;  4N56 A;  1C1A A;  2DFH A;  4CGD A;  4KHU A;  4YNQ A;  3AO1 A;  3TAG A;  3DLH A;  3SV3 A;  5KGW A;  1BQN A;  1HJR A;  1S9E A;  4HTU A;  5J2M A;  1L5U A;  2R7Y A;  1C0M A;  4HVJ A;  4FLT A;  1A5V A;  3ITH A;  4Z4I A;  3MXI A;  1TAU A;  4RW4 A;  4Y1D A;  3TAM A;  2RN2 A;  1CLQ A;  2YKM A;  5I3U A;  3BGR A;  4DQI A;  2P5G A;  4N41 A;  1KLN A;  1ZBI A;  3ZSR A;  1YVU A;  5FRO A;  3HST B;  1ZBU A;  1XC9 A;  1T8E A;  4ZTJ A;  1ITG A;  3QIO A;  4FZX C;  3K2P A;  3G10 A;  4N47 A;  4DSE A;  4DFM A;  1UA1 A;  5C42 A;  3OVN A;  2E4L A;  3HYF A;  4H4M A;  3P83 D;  4CJ4 A;  3AVA A;  4CEA A;  4E3S A;  3LDS A;  1TVR A;  2W42 A;  1RBV A;  3AO3 A;  3OYH A;  4JRQ A;  3OS0 A;  3KLG A;  1L3T A;  4LY7 A;  1B9F A;  1XWL A;  3ULD A;  4OKE A;  3MEC A;  5HLF A;  1QHT A;  1C6V A;  1D8Y A;  3DLB A;  2OPP A;  4N76 A;  2YHA A;  5K14 A;  3PX6 A;  2Z1I A;  3ASM A;  3DLR A;  3LAN A;  3QIN A;  4Y1C A;  1QSS A;  4Q5V A;  1QSL A;  2DY4 A;  1RT1 A;  4CHP A;  3MXJ A;  1W0H A;  3LAM A;  3V1O A;  1XI1 A;  4AH9 A;  4CJS A;  4Z4C A;  1J5O A;  1YTU A;  3HPG A;  3NF8 A;  4DQQ A;  3AVM A;  3C94 A;  1TGO A;  4DF8 A;  3I0R A;  4O4G A;  3V9S A;  2OA8 A;  1WN7 A;  4DSK A;  3DOK A;  5SWM A;  1S9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...