4AHXA

Flo5a showing a trinuclear gadolinium cluster on its surface
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
258
structure length
258
Chain Sequence
GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLOCCULATION PROTEIN FLO5
publication title Complex Gadolinium-Oxo Clusters Formed Along Concave Protein Surfaces.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Sugar binding protein
total genus 57
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4ahxA02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ahxA01
2XJVA 2XJSA 4AI1A 4D3WA 4AFAA 4COVA 4A3XA 4AF9A 5A3LA 4COWA 4AI2A 4AFCA 4GQ7A 4ASLA 4AHYA 2XJTA 2XJRA 4AI0A 4CP0A 2XJUA 4CP1A 4COYA 4AHWA 4COUA 4AFBA 4COZA 4AHXA 2XJQA 4AI3A 4AHZA 2XJPA 4LHNA 4LHLA 4CP2A 5A3MA 4LHKA
chains in the Genus database with same CATH superfamily
2BGOA 4L8QA 2XJSA 4PT6A 4UW3A 2JWPA 2A7AA 2ZEWA 1VPHA 3WDVA 1KDKA 4XF4A 4AQ6A 4BCUA 1W9WA 3RSJA 4FPGA 3WP5A 4AF9A 2UURA 5I8YA 1QIQA 4B29A 1RMU3 4LEJA 3RZJA 3SEEA 4QIWP 3F95A 4FPLA 2LS6A 3FKIL 1IQDC 3VBFB 3LSEA 1JU4A 4AI0A 1SCRA 4JKMA 5KHKA 1UPIA 2CAUA 2EAAA 4ORFA 2VBDA 4TN7A 1PZ9A 1V00A 4WVZA 4C1WA 2E9QA 2RS53 3B9CA 2XL7A 3IDEA 4LOSA 4XAEA 1MZEA 4D7SA 4RSUA 1Z78A 3PIP1 1GQPA 2DVFA 2Q8CA 4KBBA 4Y4RA 1W9SA 4QB1A 4LR4A 4BXXL 1ZZ6A 5DQ0A 2TEPA 4BLJA 1LRHA 1QJY2 2D5FA 3WP3A 1I6XA 1C57A 1PGW2 2GN7A 4FFFA 2DYCA 1LKPA 2Y34A 4HZFA 1RUH1 3OGVA 1GOHA 1UIKA 2R7EB 2L9LA 4LTAA 4S2FA 2X05A 4F8AA 3AVSA 1LJ7A 3MQKB 1H9PA 1PO22 1QQP2 3A21A 1CZTA 1CD3G 4HPKB 4RR3A 3W20A 2WA4A 1NXGA 1NCQA 4MADA 3PHMA 2XHNA 3E5UA 5A7OA 2JD4A 2W1UA 5FZFA 4CDQC 2P2KA 1SG3A 8RXNA 1S2KA 1AX2A 2OQ7A 2NYYA 3MW2A 5C9AC 4XCAA 4COUA 3T0DA 2K46A 5DDJ1 3PJYA 7RXNA 1P8JA 3S5AA 3POBA 2JIJA 1GNHA 1J1TA 2J1AA 3GZAA 4GB33 5BUVA 2YYOA 3U4XA 5A3MA 1PGL2 3V65A 1MQTA 1V9U3 5AVPA 1W8HA 4JGZB 1G9DA 2OVUA 1T9PA 4CXXA 3O14A 1O5LA 3I4ML 5KR7A 1N47A 4GXLA 3VDCA 2DVGA 2VZTA 3GTKL 3CEWA 3GZTB 1UZ0A 5FPLA 5JMCA 5I8TA 3H3UA 2XDVA 4PF1A 5F8PA 2B7YA 3WF0A 1Z7S1 5IP9L 5JDBA 2VL4A 1V6JA 5CBLA 2LTNA 3VD3A 2PHRA 1FXZA 4JDOA 4JGYA 2JKXA 2N7GA 1PIV2 3KB5A 4RGGA 1BKZA 1Q3EA 1RUJ3 3NNMA 1QNYA 1GWKA 2NLRA 2B39A 2O0OA 4JQTA 4CCKA 3PKJA 3Q8FA 3TN93 3WXPA 3VBOC 1RYQA 3WDTA 1E5IA 1AYM2 3J8F3 5T5PA 5LW9A 1K45A 1H30A 1LHUA 5AVAA 2DU1A 3JQWA 3RZDL 2WB1P 3ZFFC 5FZCA 5FJ8L 2BFUL 4H3WA 4RGAA 1VALA 5K9YA 2WS91 5IFPA 2VXJA 4E4ZA 2P6CA 4DXZA 4NWVA 3RZ6A 5IATA 2Y0SP 4XGHA 4BHPA 4Y20B 5CFDB 1N3QA 3BCWA 5EYXA 1JUIA 4E6YA 5A6QA 4Y1XA 1WW4A 3NNLA 4E4SA 3EO6A 1WMXA 1CPNA 1DGWA 3WW1A 3AFKA 5J96B 1J1LA 3BTYA 3W5MA 2YU2A 3WDUA 1UMHA 4N43A 5DZGA 4FPOB 2HVYC 3QH6A 3RI9A 3SNMA 1HQLA 4Y5SA 4IV3A 4PIZA 2JG8A 5AI2A 2R042 5LBBA 3RMXA 2ARCA 2ORZA 1PZ7A 1YFYA 3SH4A 1SBEA 4XOGA 5CAZA 2OZ6A 5BPXA 3RJRA 4FQZA 3LPGA 1CJDA 2R062 3U11A 1RUE3 1DU3D 2XVLA 1PX3A 1US2A 3O12A 3BB6A 4M3CB 4Q4X1 2WQZC 1BQPA 4XZPA 1VBE2 2D3RA 4AHYA 5DAWA 5C44L 5FQ0B 5I0RA 3EJKA 3NJXA 3QD6A 1LTLA 5C3QA 1W2TA 3BOWA 4NOTA 1ZZCA 2WAQP 5FPZA 2VQTA 3D6EA 2O5JD 4WZCA 2ZHMA 3WW2A 1RMU1 1TMF2 2ARAA 4UXAA 3ZXGA 1PMJX 1R1A3 4WVVA 1UZZA 3PMSA 4XURA 2VVDA 1JUHA 4KG8A 3AYAA 3CHXA 4HSJA 2PAMA 3KGLA 1NA1A 4TPUA 1SFOL 2VW1A 4AXOA 2XWBB 3KYUA 2A6WA 3OUHA 5C8WA 1ZM1A 1W6MA 2WNVA 3O1SA 1U12A 2QTWB 3T2PA 4AR4A 2CU5A 2B9VA 4NJ4A 2X29A 4J1XA 5FO8B 2ZGMA 4Q4Y1 2P6HA 1X9TA 2PLV3 4N7IA 4YVWC 3MICA 1AUYA 2R072 3UKVA 1ZBA3 2XJRA 5FWEA 5F6KA 4AG4A 2PHUA 4DEVA 3LWOB 3H1YA 5JSOA 1RB8G 4EN6B 4HVRA 1VZIA 1W2UA 3ES1A 4XDOA 3ACFA 4MXVA 5L19A 1LAJA 2XH6A 1DYKA 1NX9A 2QE3A 4BQ3A 2ZKNA 3E6BA 4X8PA 1WZXA 3N36A 3VDDB 2I45A 3J7NA 1TWAL 2D6LX 2JDKA 5LA1A 3QVDA 4UFJA 1GQHA 4Y1YA 3VZOA 5CIRA 4IGOA 4NAOA 5LEKA 1JYXA 3SCFA 1B09A 1SLLA 5FYBA 2J42A 2OXBA 4LK7A 3JB4C 4A6OA 2QQMA 4GB31 2LCQA 5EV7A 5B4NA 2FD8A 4HFSA 1W2AX 1K83L 1RUF2 1V9U1 4LIUA 5D1IA 3NNGA 1IPSA 1W6OB 2XKOA 3R4SA 4E8DA 4IV1C 4LIVA 2JDAA 3MYXA 4QX5A 1N1YA 5FK8A 4CTEA 2CHHA 5FYTA 5E89A 3WVJA 1HRV2 2WAOA 4P00B 3SH5A 1A78A 4LLOA 4Q29A 2JDUA 5FZ8A 5FR3A 2JA7L 2Y0IA 2LALA 3PTYA 3PUIA 2JE8A 5G05L 4CU9A 1RUJ1 2VVFA 2HWF1 4AI1A 4Y3OA 4UF0A 3TN91 1NZIA 1VE0A 2MNGA 5KC5A 2BTVC 2YFUA 1BYHA 4N9IA 5FXVA 3M3EA 3N9MA 1RUD2 3J8F1 4WBBA 4YG3A 3O0VA 4OHZA 3H8RA 5I0TA 4JCKA 4LLFA 4P9IA 4CA9A 4KWKA 1DF0A 4J1WA 3I2GA 3DYPA 2RS33 4NPLA 3B9IA 4UOJA 2JDYA 3WG2A 4HETA 2R93L 5CNAA 5DG2A 4N53A 3S14L 4I02A 2R16A 3S15L 1AL23 1DGWX 4V196 1H8TC 2P3JA 3DXUA 4NIIA 2IXKA 2WZPP 1LKMA 1TE1B 1OLQA 3AXEA 4LBLA 3TB0A 3ZSLA 2ZACA 5AI3A 3LWVB 2FDKA 4XAAA 2G19A 3MF6A 5ABJB 3K2OA 5JMOA 3ME2A 4NPRA 3RYRA 3RMYA 1TWFL 3WNPA 1I3HA 2D44A 2VMFA 4E4DX 1BBT3 1IPJA 2E6VA 3ZDVA 3ZPYA 2NZ9A 3MO4A 4QU2A 5L9RA 3DECA 2MHFA 5FP9A 2ZOEB 3VKMA 2OPWA 3OJBA 1EPZA 4IE7A 1Y43B 2ADDA 3ILRA 4C8DA 4CPBD 3OPTA 5IVBA 2BU9A 4IEUA 3MV11 4QPWA 1F9KA 4WM7A 3WCSA 5JOXA 2XONA 2HWD2 1RUE1 4D6QA 4Q0QA 1YYNA 3OUIA 2VPVA 4ATEA 2OQ6A 2ZAHA 1VRH2 1O3TA 1YXWA 3U75A 4MGQA 5FUPA 1QYBA 3RJ2X 5CEHA 2B63L 2PFWA 3ZIWA 1ACCA 2HWE2 1A8DA 1NLSA 3JB8A 1D0GA 4MGTA 4HSLA 2VVEA 2P3YA 1W6NA 1LECA 1R1A1 5LA2A 3JUUA 2QUOA 3PU3A 1OUXA 2A6ZA 1VR3A 2BVVA 2HH9A 2J1EA 2VTXJ 3ACHA 1UXXX 4HG6B 5DUXA 3UGFA 4NHXA 5LY2A 2AH2A 4AR5A 1NE4A 5FXXA 2VMEA 2RHPA 4AFDA 4WM8B 2V0EA 2VH9A 3AB0A 3AP7A 4IEVA 4MGYE 4MOAA 4LMFA 1F35A 3HN3A 3I97A 1UYXA 4M0NA 2PLV1 1ZBA1 3ELNA 2R30A 3H9AA 4JTOA 5DAVA 1YO8A 1OF3A 2UY9A 4IE6A 2ZGPA 2Q30A 4X6RB 3OYWA 5BNOA 5GZGA 4MGSA 1QJY3 3WWLA 1WUVA 3MUZ1 1PK6B 4BQ2A 2K9ZA 5IVVA 1KGYA 2IXLA 5GADc 1W3XA 1FHHA 3ZFGB 1OOPB 2EIGA 1SLIA 2GMPA 5FLIA 1G8WA 1PO23 1QQP3 5JIAA 1UY3A 4AFCA 4CZSA 4FOQA 2PSMC 1PO11 3FFQA 3TAYA 3VBUB 3P3PA 1PFWA 4F3JA 2GC3A 1BQ9A 3KF5A 3NJYA 4YZ1A 4GD4A 5FZ9A 4CDXC 5E6HA 2XQRA 3HQRA 5FO7B 3ZN5A 5F9TA 5F7UA 4Y7NL 4COZA 3B08B 1R64A 1RYYA 5JZGA 4CSWA 2VOVA 3LF7A 1YFWA 3ZXEA 2YZ4A 1XSRA 2WSVA 5J1XA 4QGMA 2D6KA 2A5ZA 3GNEA 1PMIA 2P1BA 3NV2A 4JX0A 1C8M1 2NQYA 1BZWA 1AJKA 3DPRA 2UU8A 5DAXA 4CCDA 2FDJA 4QPGB 2UYBA 1W9YA 4XJUA 3USUB 5FZOA 3IZOA 3CQZL 4KG0A 3KT7A 2BP6A 4NIDA 4ZPIA 3PTRB 4AZZA 1LODA 2D98A 5A6XA 2FCTA 1OQDA 1XB9A 1SLCA 4D8MA 2PAKA 1PIV3 2WFPA 5IK4A 3UL2A 1DHKB 1N3PA 4XMIA 3BTXA 2ZZJA 1ND3A 3BTAA 1RL3A 3VHPA 4HLTA 5F1RA 1R0IA 1FATA 2JI1A 5A6YA 2JKBA 3MZHA 1AYM3 2XHKA 1ZBE1 2RS31 2JA8L 1X36A 4TLGA 3VPBE 1CAUB 1JBCA 2F4LA 1K12A 1SFPA 1T9OA 3LPEB 2RVAA 3OSDA 4HANA 4AFAA 5M5XL 2YUEA 5CU1A 5EJ3A 5HCHA 1ODHA 3T2TA 1GKBA 3ILFA 3ES4A 4XE9A 5IYYA 1VZGA 4B7KA 1IS3A 1AYN2 1PMHX 4J25A 1ND2A 1WCUA 5A33A 1NCRA 3FE5A 3HPNA 1JZ3A 1BBT1 5BNNA 5C33A 2WRAA 1W3VA 1XNTA 2G9ZA 3GTPL 3ZXKA 2BBVA 3DKQA 4QXHA 2DCZA 1VLNA 1CN1A 1OWCA 1OLME 2BGCA 3KWVA 4HK8A 3VBRB 2BEOA 2XBO1 3IPVB 4POFA 2GAUA 2R043 4XC9A 4Z2AA 2EIDA 3GCWA 3OEBA 5FLJA 2JG9B 2JICA 3GBWA 4OFGA 3T3YA 3ZOIA 1RUG2 1DQ5A 3KYVA 4G6BA 1O59A 3ACGA 2R063 1UPSA 2RE9A 4DXSA 5K2ME 1CIWA 1Y9MA 1Y1WL 4UBGA 2FCVA 4LKSA 4AK3A 1VBE3 1VBD2 2YBKA 4K8RB 2IWGB 4PF5A 3GF6A 3LIHA 4LBQA 1D2QA 1PM7A 4AVBA 2AUSB 1VBC1 4KGGA 5LWBA 4LBOA 2Y33A 3NNJA 3PO3L 3HOXL 1GP5A 1H2NA 4HPKA 2WT0A 3OOXA 3MW4A 4O9EA 4A45A 4XHBA 5C3RA 4BK5A 1AR72 1TMF3 4MHRA 2JDHA 3GALA 4CRQA 4EYUA 3E5XA 1HDKA 1T6GC 4ZKTB 1RTVA 4QU1A 3LEMA 2IC1A 2W1WA 3ZSKA 3HNBM 2W46A 4QX0A 4BQ4A 1QMJA 5J98B 1B35A 2AGSA 2UWBA 1CAXA 3AZWA 4GWNA 5F32A 1ENRA 5A32A 4UBHA 2IXJA 1HQWA 4JGZA 1S2BA 4SBVA 5F5QA 4UW4A 3CMGA 4OQ8A 2LROA 1FX5A 1GP6A 2VMCA 1LOFA 4RR3C 1QJY1 2XGXA 2DVDA 2XWJB 1NCQC 4N7UA 1XOYA 1YQCA 3E1F1 1ZRFA 4HKLA 3M3QA 3EMRA 2QQJA 3MSUA 2W92A 3JD72 1B13A 3OBAA 3R0RA 3TNPB 3O1OA 1QQP1 2CKAA 3GBFA 4DB5A 4PIYA 4XQWA 2SBAA 3JR7A 4QX2A 2VJXA 2XVGA 3I2FA 4CP9B 1QH7A 3VKNA 1SMWA 4BIFA 1HXS2 1DYPA 1POV0 1F4AA 5CZKA 5A7WA 1DX8A 2BGPA 3M4OL 1RVF1 2JXAA 1UYZA 4R9BA 3T4HB 2JDNA 1MQTC 3OY8B 2QQWA 2UY8A 5A7NA 4LO4B 5FMOS 2ZXQA 2GH2A 4IEZA 1PGL1 5LBCA 4UFHA 1H2KA 3QACA 1RUF3 4X6AL 4K8FA 5IYBL 3WNOA 3U4SA 1EPWA 2W08A 1WD3A 4XABA 3ORJA 1MS1A 2Q4SA 4XILA 5BY5A 4XFAA 4JGYC 4PI0A 4PBPA 3K3NA 1C09A 4ITCA 3AP5A 5CFDA 1JXNA 1FV3A 1HRV3 2M4VA 1MS8A 1SDDB 1YFUA 1ZA4A 2WT1A 3MGUA 4ZONA 5FJHA 3S7EA 4BMBA 3RZLA 1QXRA 3RZOL 3BPZA 5JXIA 1ULEA 1JYIA 3A7QA 2J1UA 1LHOA 1WW5A 4ZXEA 2V72A 3JZVA 4BXFA 5AC92 4RXNA 2YY1A 4PQ9A 5A3LA 4UW6A 1B2JA 2QZ2A 3AMPA 5I0UA 1QJU2 2VECA 3O1TA 3AXDA 1RUD3 1AYM1 2J1RA 2FDGA 4IEXA 5BYNA 2VD7A 3NV3A 5JLVA 2GALA 2VGDA 4CP0A 2FZ2A 5J48A 4QXKA 1BCXA 3AZVA 3HBZA 4KI5M 4QM8A 5CKNA 1PFUA 4M3CA 1XRUA 3FUOA 3NAPB 4BA6A 1BVP1 4INDA 5HBAA 1BLZA 1CQ9A 4LHNA 1OC1A 1OH4A 2C24A 2B42B 3CF6E 2VCBA 3FHIB 3K4AA 3NV4A 4RS5A 4CEYA 2WUHA 4N43C 2IFWA 1DQ0A 5GAEc 3WHTA 4BDVB 1PVC1 2A6XA 2HEYF 2JG8C 2VZOA 1GOFA 4IV3C 4LNVA 4XHXA 1GU3A 5GKAC 1JZ5A 3RZTA 3A23A 3GHNA 1GICA 1XE7A 2GNMA 3SS2A 3M3OA 4YGDA 3ZFEB 4CCCA 3PMEA 4TLFA 1MPXA 2C0ZA 3KCXA 2E2IL 2QQVA 5A1LA 1CX4A 1CZVA 2AUYA 2PYTA 2R041 1V6IA 2FCUA 3KV6A 5FP7A 3H42B 2QQIA 3V64A 2AYJA 3THDA 1WLDA 2R061 2HWD3 4IUGA 2BVBA 3USSA 4AHXA 5CYYA 4ZZ8A 4A3IL 1UX6A 2Q5TA 1R092 4CCOA 3KVAA 1W8UA 1OQ1A 3WNNA 5L73A 2RR11 3WD5A 3FC0A 1SDWA 1VRH3 3GJBA 4A44A 2A1XA 1COV2 1UQXA 3CL1A 4BMEA 1A3KA 3UGHA 1JHJA 5I93A 3T2QA 1UY4A 2VTXA 4M0HA 4XFHA 1CAWB 3VBHB 5JI7A 4EN9B 3TEZA 2HWE3 2Z79A 1UZVA 1NA1C 2D93A 1TMF1 5MGNA 1EY2A 4QPIA 1BE7A 3WF2A 3RZGA 3BI3A 1XE8A 2IVJA 2WNVC 3N7MA 1QU0A 2I07B 1ENSA 2BV4A 5KHHA 2A71A 4P9YA 1CAVB 4XFCA 1DGRN 3PWFA 3ZG6A 1ODMA 3VL9A 1HB2A 3P3NA 1BJQA 4EROA 3GBGA 3IDAA 4MGKE 4DIQA 5JOWA 2PPTA 4CDQB 2FQPA 4I0BA 2V4AA 2PN5A 1MS5A 5H9RA 1LOBA 1OD5A 5JSRA 4O7XA 2Q1FA 4AE2A 2EY4E 2R071 5C3EL 3BVCA 4XZUG 4XXBB 5IT6A 2PA7A 1QJEA 2W1SA 5M0TA 3OGGA 4XFIA 3P5BA 4OLLA 1NUKA 4JHZA 4YYOA 4COWA 4Z2WA 3T1LA 2BNNA 3BN6A 3KS7A 2OUJA 4FAHA 1HRI2 1YFXA 2WQ4A 5FY8A 3R4DB 2IXHA 3CU7A 3IBMA 4DUXA 2D6OX 1EYBA 2E7QA 1YI7A 1I50L 1FPN2 4CUGA 4M01A 4IESA 4C90A 3RZKA 2YFZA 3NJVA 5M5YL 4FXGB 2XJPA 3MW3A 5B2GB 3U37A 3ALQA 4B8EA 5F3IA 1HB4A 2RS11 1R0GA 1IS6A 3VBOB 1RUF1 4AR2A 1RXGA 1EUTA 4W4ZA 4R8HA 1WA6X 5FTTC 5JXHA 1C5HA 3RYGA 5H9SA 4RHV2 5JR7B 3ZFFB 1ENQA 4XFFA 1HRV1 1APNA 1V6KA 1UY2A 3BALA 3MF9A 1JYVA 4JZRA 5I8SA 1HJGA 2PMWB 4QGNA 3V0AB 3T2OA 3ZVXA 1SBDA 4DZGA 2Z5WA 4PJYA 2PQQA 4QDQA 2DUOA 4PCRA 4WV8A 5CB7A 2WYSA 5JOYA 4TTGA 1CWPA 4Y4YA 1OVPA 2OPKA 2OUHA 1HKDA 1RUD1 3O1PA 1IG3A 4N53C 1YUDA 3GJAA 2RDRA 2OKXA 2NVTL 2BZDA 5IHRA 2ZGKA 3OGRA 3I59A 4DUVA 4YWMA 5F37A 1Y9QA 2VZUA 1AJOA 4ZU7A 3VHNA 2E32A 5IYDL 5DAQA 1XSQA 5JWPA 4JKKA 5I0SA 5E1RA 5FP4A 3UYJA 3POEA 1XYOA 2VG9A 2RMU2 2OYZA 3VB9A 1AR61 1DZRA 3POSA 4D0QA 4YM2A 3MIFA 1AYN3 5A3NA 3RS6A 3C7EA 2HLEA 1C28A 5FPUA 1IROA 2BNMA 5H9PA 3GZUC 3MDPA 5GALA 4GS7D 3GHMA 4AHWA 4A7ZA 1S2EA 3N7JA 4Q0SA 3M4FA 3PJQA 4HN0A 1FMD2 2PTMA 4WM7C 2EVXA 1E5SA 2VOXA 1CJPA 1X8MA 2VUML 4S2GA 3AMMA 4SLIA 3RYPA 2WL1A 3T4VA 5EFUA 2HWD1 2E53A 2E51A 2W52A 4AVVA 1YK5A 1GANA 1XXNA 3IIAA 3NO8A 1U5YA 3M3YL 4YM3A 4DOUA 3AYEA 2EXHA 4LA2A 1F5JA 1RUG3 4ZU5A 4AOCA 4QWNA 5L9VA 1SPPB 4EZ4A 4HOOA 1R0FA 3AYCA 4ZS3A 3J7LA 1VBD3 3ZXLA 5A70A 2TUNA 4DEQA 4POGA 4YVWB 2HWE1 4KU7A 4FPEA 2D6MA 4JAGA 2VL6A 3K3OA 3GCXA 3B3QE 3B01A 4DXRA 1B2OA 5L7OA 2WJSA 2GNTA 5FZEA 5GLVA 4XF0A 3ROUA 1AR73 2PHTA 2VOTA 5FLML 5JVH1 2ZBJA 2XJVA 5IP7L 1Y3TA 2FZ1A 3M8LA 3QCWA 3WHUA 3ZIXA 2Y6GA 2D5HA 2HKXA 2YBPA 4FOYA 5I0DA 4L92A 5LEJA 1AR92 4RQPB 3U07A 5H1Sc 4AVSA 4MGZE 4OMCA 4UFKA 4GMP0 1KJLA 3FN9A 3GXUA 5BNOC 3N4MA 1QHDA 1RIRA 4P14A 4AEDA 1FI2A 5IVEA 1GR3A 3I2KA 1G86A 4CDWB 1NE6A 3NFPI 1MS3A 3AMHA 1S0IA 2ZMKA 3E97A 3LAGA 2XL9A 2D97A 4PLOA 3S5QA 2VTFA 2VUJA 5JI9A 3HMYA 4KMQA 4NHMA 4I30A 4W6XA 1YUXA 3POFA 3SC7X 1QXPA 4L0PA 4PDWA 1L7QA 3WQBA 2MEV3 4HMZA 1GZ9A 1H2MA 2YC4A 3JD73 4QX7A 3VZKA 1NOVA 1VRBA 4HVOA 4OYUA 2E2HL 4C3IL 1IQAA 4QQHA 1FNYA 5JZGC 3LWRB 2VZ1A 4GAZA 1B71A 4A3FL 2BQPA 1RB9A 1HXS3 3RZMA 5JXGA 2ZGOA 4RD7A 1VCXA 2WZR1 3OGSA 1WA4A 3A4UA 3DPRC 1J84A 5DZFA 1TME2 1K5JA 1PNFA 3NMBA 2R0HA 1CAUA 2P3KA 2VCAA 1GP4A 3H9CA 4M3CE 4P5YA 5FZ3A 5TSWA 1US3A 5J09A 4MO3M 3UK9A 2E7AA 4A4AA 3RVHA 4UY81 2HWC2 2OA2A 4JKLA 2DFBA 3K46A 4JAAA 1DQ6A 4K1ZA 3GTGL 3WP4A 3BODA 1N1SA 5FOJB 4XIOA 1ND3C 3AVRA 5BNQA 3S1NL 1UMIA 1F5FA 2VW0A 4K21A 3K4DA 3LWQB 3KGZA 3H50A 3RG0A 5GLTA 5DPNA 1VIWB 4CU7A 4QD2A 3GZEA 5AC93 5AFEA 4ZY9A 3IWZA 3FL7A 3S1QL 2WFF1 1QJU3 3I2DA 4QHZA 3UT0A 1O8PA 4NIAA 4NVPA 5FREA 4YZ2A 5EJZB 1QCVA 1NY72 5M5WL 5T55A 3ITQA 1ND2C 3ON7A 5FIXA 1NCRC 3MPPG 4YW6A 1GNYA 1W9TA 5JCTA 3OTFA 5BNNC 4ARYA 1E5RA 1A8MA 1QEXA 3URFA 4F83A 3MV01 1DDLA 4JC1A 1AYN1 3B0AB 1C1LA 2VAUA 4GH4A 2QBXA 1OHFA 4DQAA 2F4PA 4P9XA 4AWDA 1E57A 1ZRCA 1TWCL 1OLMA 1BFYA 1TG7A 2GN3A 2YPJA 4CVUA 2YROA 5FRAA 3JQXA 5APAA 4A3ZA 3MIHA 3PIGA 4B3NA 1UNBA 2WN2A 4N90A 2RS51 2D6NA 4XJ9A 5FZ7A 3HAXC 1OWBA 1WGPA 4K20A 4U2AA 1QJX2 3KV4A 2PVXA 2C5DA 1ZRDA 2C6BA 5HXVA 2WAAA 2XPJA 1WCSA 4AR6A 1DYOA 5T52A 3WP6A 4CE8A 5FZAA 4DINB 2WYFA 4IERA 2YU1A 4S2HA 1J3QA 2V73A 4CEWA 2WWSA 3WG1A 1OSGA 3K48A 1RUG1 2CDOA 2JB8A 5B4XA 3WCRA 2YHJA 3DEMA 3WEZA 1JYWA 3OBRA 3AZZA 4WVMB 1R093 2HBTA 4TSVA 5FZ1A 3UGGA 4ATFA 5K0UA 4AEJA 3T30A 1VBD1 2ID4A 3CBNA 4GALA 1REEA 2WO2A 4XEZA 1UZYA 4QDRA 1COV3 3AP6A 1JI6A 4A6SA 1XE0A 4D69A 4FP2A 2WNUA 5FYHA 2NVXL 1AXZA 3ETPA 2M6PA 1UU6A 2QQKA 2ZMLA 4JTNA 5FMOL 3MEPA 1C3HA 1H1MA 1AR71 3AMQA 2CYFA 3Q8EA 4Y22A 4B1LA 1B35C 1VB2A 3L2HA 2R7ZL 1LCLA 3VBSA 1VJ2A 1IGOA 3MFCA 4LKFA 3ZXJA 1KQRA 1D2SA 1W6QB 1W6PB 1ZRRA 4YM1A 3KMHA 4JGZC 4BOWA 2RM22 2XJQA 1YJLA 2ETEA 4C3HL 2JD9A 1LOFC 4M4PA 3NV1A 3B7MA 2XXZA 4XIKA 4Q4W2 2ZIXA 4YM0A 4W6WA 4BQYA 2NN8A 4CDXB 5FPXA 2WWJA 1NXD1 1OA3A 5KWRA 1BMV2 4E2GA 3NKGA 1UXZA 4U36A 5EIOC 3LOIA 1WCML 3AP9A 3N3HA 4UI9L 5E8AA 5CFCA 5ACA2 1LNSA 3O1VA 3AMNA 4LO7A 1LOGA 2LW8A 2Y38A 3CJIA 5T5OA 4Y24A 2HEVF 2CY6A 1UOBA 1VBB2 1YC61 3LQCA 1GV9A 1M4WA 1WBFA 4AQTA 3M1HA 1U5IA 2FHRA 1MZFA 2VE1A 4RL7A 2VW2A 5CKQA 3WF1A 2EA7A 1HRI3 1ULDA 5KXBA 4Q0VA 3HN1A 2PHFA 1HXS1 5C5TA 4OUMA 2VOWA 2C6AA 4FFGA 4XDPA 4QAWA 5C4WB 3GTLL 2GC0A 1FPN3 5FLHA 5GZFA 3WQ1A 5DABA 3WW3A 3UV9A 2IVIB 2NP0A 4P9WA 5MFZA 2JI2A 1OT5A 1YHFA 5CFDC 2MPFA 3SEPA 4A3CL 5DMYA 5IAXA 1V0AA 3PNAA 2V09A 3IKWA 5FZHA 2JIGA 4YVSB 5KHJA 1EUUA 4RHV3 3S16L 4FPKA 1LHWA 5C71A 2OIIA 4MXWA 1K5MA 4E4HA 4ME3A 4XUPA 1N1TA 3POWA 4LA3A 1K3IA 2RJKA 1SFYA 4PHZA 2J9UB 1ZRIA 4QQOA 4UT5A 1SHWB 1SMMA 4RYDA 3QLQA 4CUCA 4LUKA 2VUDA 1S24A 1QJU1 5JXJA 2G9FA 3ZYRA 1SZBA 2DUQA 4XF1A 4CUBA 4A3GL 1S0FA 2BRTA 2R1BA 1EV12 3A0NA 5EYYA 4RS5C 2ZX2A 2IZWA 4QPYA 5EINC 2CWSA 4CEYC 2W3JA 3DL3A 3FLTA 5JSPA 2C1FA 3AL6A 4TYSA 2RDSA 2A73B 1D4M2 2I2SA 3OPWA 3ST7A 2YXSA 2HR5A 1TVGA 4MYEA 3SISA 2CGPA 2RMU3 4DY3A 2JJ6A 4FAGA 4QKFA 2QDNA 3PUQA 5A3WA 3VKOA 1YQ8A 3VBHA 2DVAA 4MX3A 1ENXA 1CAWA 4S2DA 1MR5A 3ZYPA 5FO9B 1AXKA 2WZEA 3LGRA 3ZYGA 1UWWA 5SV8A 3J7MA 1U0AA 3HQXA 4UWDA 2ZTNA 4A3EL 1NYWA 3ZYIB 5GLUA 4FPHA 1FMD3 3QBQA 2VNOA 3S30A 3KT4A 4X6QB 3PIJA 2AEYA 3U10A 2FDHA 5HPOA 1FV2A 5H9QA 5FFOC 1J3RA 1G9FA 2D3PA 2G4IA 3CQOA 4R9DA 2WO3A 5T54A 3TNQA 1VBA2 3HWJA 5BNPB 1O91A 2LM3A 2VNRA 4YGCA 2W91A 1R091 3K51A 4A93L 3POGA 5F6LB 4Z8BA 5FZ4A 1NAEA 1C1FA 2OZJA 3V0BA 4A3KL 3LEGA 4XJZA 3AKQA 3TEYA 3E6DA 5IVJA 4FOWA 4QPIC 2Y26A 4YZ4A 1COV1 1D7PM 1JHNA 1UF2C 3DF0A 1GZWB 2SLIA 4LBNA 4BM8A 1XU1A 3VV1A 4I3GA 4CCEA 1KEXA 4BQ5A 3O1MA 3OG2A 1Z7S2 5K7PA 3TEWA 2ZHNA 4YZ3A 4RR3B 2A6HD 1RINA 2K2SA 3UETA 1NCQB 2WT2A 4IEWA 1OLRA 3TEXA 1VAKA 1SFNA 2JE9A 5FAXA 4PBOA 1Q8SA 1OPOA 3S1ML 1TEIA 5IYCL 1LKOA 2FMDA 4Q8LA 3PL5A 3ATGA 2E33A 1DLCA 2Z42A 3PURA 2VC9A 1AR93 5FV3A 1ASJ2 3ZN6A 2PQSA 5JVG1 1PZXA 4NRQA 1MZ5A 4LJHA 3RI8A 3KVBA 4CDUA 2Z2SB 3W21A 1MQTB 3WOGA 3NQHA 1FOD2 2C4XA 2WINB 3AZYA 4YW7A 3S7IA 4BBSL 4R4XA 4HK9A 4FPFA 4B7EA 4XVHA 5JAXA 2B8MA 3VLBB 3AJZA 1I3QL 4JDNA 2QKDA 4W50A 3LEIA 3M70A 4KQ7A 4XMAA 4AYUA 4U671 5C4JL 1UX7A 4K9SA 3GGLA 4ZN3B 1AR82 1YNAA 3Q8CA 4A7YA 1HRI1 4JGYB 5MFPA 4AGRA 3O1UA 1UOJA 4JRLA 5LBFA 1O3SA 1R0JA 1LR5A 2Q8DA 1I5PA 3HJYB 1KDMA 2D6PA 5D8AA 1LTEA 5BV6A 4LE3A 4A3XA 1AL21 2W68A 1JYNA 3PLQA 3H9BA 2DSXA 2H6CA 3RWKX 1S0CA 1KJRA 1XYPA 1YI9A 1S0JA 3C8XA 2BW8A 1UOGA 4L2NA 5FBZA 1XQNA 1TME3 1FNZA 3G6JB 3DN7A 4FO9A 3NL1A 1BK0A 3F2ZA 3P1IA 2VZ3A 4NO4A 1OA2A 5IUQA 4BJ0A 4ASMB 5ABJC 1MS9A 4YW4A 2VY0A 3S6PA 4RHV1 2XUMA 2XQXA 2BPA2 2ZGNA 3I3EA 3HOVL 2HWC3 4G4FA 4QKDA 4IEPA 1RUNA 3D0SA 1Z0HA 3VBFA 2BFUS 2GP3A 3OD4A 3EB7A 2X5IB 4H2AA 1W8TA 2DV9A 3WT3A 4MGIE 1GOGA 1ZNPA 2PHLA 4EN8B 1AX1A 3BGAA 1NT0A 3TWIA 1FHMA 4A3BL 1J83A 4IV3B 2JG8B 1MS4A 1ZZ7A 4K40A 1W90A 3IAQA 3I2IA 3P8BA 5C4XL 1XNBA 1AL0G 5CG8A 5F2WA 1PVXA 3SITA 3H99A 2PHXA 3PU8A 1SACA 1IPKA 1DFQA 1IG0A 2WKKA 1LGCA 4A3DL 4Q4Y2 5F2SA 4B4PA 4XFGA 1RHI2 4C0BA 4DUWA 2Q1MA 3TYJA 3VKLA 2J7MA 2NPIA 4W6YA 2XKPA 1YJKA 2ARBA 2ZHLA 2ZZQA 3CLPA 2O14A 3HOUL 1KXGA 3MIEA 4KL1A 2ET7A 4DS0A 3IM0A 3SQOA 3PUAA 2CL2A 3RPQA 1GLHA 1FMD1 5KHIA 2BWAA 4KH9A 4HT1T 1QJX3 3M7AA 1GNZA 2XLAA 3B93A 4IXLA 3VD5A 3I4NL 1EP0A 2Z3RB 2EALA 1NA1B 2WNEA 4ZU4A 3H8OA 2EXIA 4RQPA 4AFMA 5C8CB 1PGW1 2WNVB 1W6MB 2MEV2 5FY4A 2VUAA 1WLCA 2WO7A 4LPLA 1DGLA 1PO21 1QOSA 3A22A 3CKHA 3D5OA 4CDWA 3GM8A 4W8JA 2ERSA 3WNKA 3FDJA 4NHKA 4UAPA 2XUEA 5IWFA 1NG0A 5L7OC 3ENRA 4LT5A 3KYXA 1DCSA 2GH8A 3HT1A 4LBQD 2EIBA 1O6UA 4NRPA 4QB2A 3U78A 3VZMA 2DU0A 5DAPA 1Y4WA 1CR7A 4FXKB 2OT7A 2HWF2 4LHSA 1WW7A 3M3CA 5FYYA 1S1AA 4LQRA 5EJ1B 4AEDC 5C3SA 1AR91 2JEMA 3FLRA 2RM23 4Y20A 3H0OA 4RA0A 3H1WA 4AQSA 1QGLA 2ZX0A 4Q4W3 5MF6A 3KM5A 4PDWC 5DXDA 5ANNA 1IZ3A 3ZMNA 4YW3A 3QQCE 2BJSA 1KS4A 1PIV1 3KCCA 4KBZA 2KN9A 1CONA 4BQXA 2XOMA 3WUCA 2Y6FA 5ACA3 4MZUA 5J36A 4GWJA 4BISA 3WX5A 2BOIA 4GQ7A 3VUOA 1VBB3 2XG3A 3LIGA 5A1AA 2B9UA 5FP3A 4KWUA 3LA7A 1WBLA 1Y9GA 4YNIA 3Q8AA 4CP1A 1CGPA 4PLMA 4UF0B 4EN0A 1F31A 5F5IA 4Z92B 1SQ4A 1LULA 3GDBA 5FYUA 3IU3I 1HV0A 3DGTA 1O4YA 1QY4A 2RJ2A 2W94A 4YSFA 2VZRA 5CISA 5FQ0A 3U14A 1HJFA 4FPCA 4JVAA 3KLSA 2QNKA 3E6CC 3LDRA 2F17A 1S0BA 4H7LA 2TBVA 4AW7A 3VD4A 2ZX3A 2G9GA 2XVKA 4LORA 4N53B 3ZKYA 5JPNB 3E5QA 1YQ5A 3MFAA 3LDBA 3RGBA 5J3UA 5IVFA 1ZRPA 5E16A 4J6GA 2WABA 4TWTA 5FP8A 3WINE 4CU8A 3PKIA 3UNPA 1AXYA 4NIGA 4AGGA 3J7Y1 1VMHA 2GC1A 2WO1A 4COYA 3Q9OA 1POQA 1R9TL 4K9FA 4Q0PA 3CZJA 4AFBA 2IUWA 1DP0A 3DYMA 4IGPA 2RFKB 1ZVFA 4C2M1 5GJ6A 3OB8A 4AVTA 3THCA 4XTPA 2DVBA 2RDQA 4L11A 4LO6B 1XU2A 3LFIA 4QQPA 1VBE1 2RV9A 1VMFA 2BBAA 4I3PA 3AK0A 4WM7B 1L3JA 4C3JL 1NY71 2WN3A 1KS5A 1KFXL 4GH4C 3MLKA 3ETQA 4MV2A 1EV13 1CESA 5C70A 4LK6A 4CCMA 1DVBA 3AZXA 1QH6A 1WJVA 2X09A 3KQ4B 2MS3A 5FY7A 3VDDA 1YUZA 1VAMA 1D4M3 5DUUA 4D6SA 2P37A 3HEIA 1KRIA 1VAVA 5FZMA 1LGBA 3N7KA 2CDPA 5F5AA 1VZHA 1W39A 1NQJA 3U1XA 1Q8OA 2YMZA 1W6NB 5IJRA 4C91A 2B5HA 1QJX1 1PO12 4H7MA 3LEKA 4A42A 2RDNA 4MSVA 1JZ4A 1ZA7A 2WIIB 4LBMA 4CEWC 5C9AB 3WQ7A 4MLOA 3KF3A 3IIIA 3KT1A 1W6OA 5A1FA 2D40A 5FZBA 4KGQA 1X8EA 2QCSB 5BXXA 2Y0OA 3K35A 4EN7B 5LZ6A 5K0UC 4ET7A 3R4UA 1LGNA 2WLQA 4E2QA 2R92L 5F39A 4E27A 2DF7A 2QZ3A 4IETA 1F2NA 1VBA3 2AQCA 5IAVA 5LA0A 1POV3 1DLLA 2WNUC 3LB9A 5RXNA 4EE2A 5GZCA 3MIBA 1YV1A 4NWWA 1SCSA 3OYWB 1DG6A 4URTA 1UU4A 3POYA 1Y7BA 4YRDA 2AR6A 4YW2A 1GZCA 1G9CA 3VBSC 4YFZA 1BHGA 5A3PA 3RZHA 2VMHA 4JAFA 5FY9A 3T1MA 3BKZA 4MG2A 1Z7S3 3MBWA 1XJAA 4LUMA 4IEOA 1XNKA 4DY5A 3VD9A 2ILMA 4DNYA 4OHVA 4CXWA 1H7VA 2WBKA 3N9QA 3SKJE 2Z4FA 1JN2P 4AAPA 4UFLA 5LY1A 2RM21 2JB4A 3EHKA 2BUKA 3CJXA 5FUNA 3PZAA 1RUI2 2DTYA 1ZBE2 1XPWA 4UYBA 4BIOA 5CFCC 4A3ML 1ASJ3 1DQ2A 5ABJA 2WQ8A 4HKOA 4Q4W1 3CJIC 1BMV1 1YK4A 2EXJA 1A6CA 3C7FA 4XBLA 3DPRB 4QX3A 5FZKA 4YVSA 4ZHNA 4NHYA 1C4RA 1FOD3 2RJLA 3OUJA 4F7ZA 2A6VA 5ACA1 3PIO1 4GA9A 1H2LA 2HYKA 3ZMOA 1LOAA 4MUVA 5A7PA 1BK1A 1VBB1 4H14A 3ZXAC 2AZ5A 1QDCA 5FKBA 1AR83 3LSDA 1DIWA 2DCYA 4XYXA 3S0MA 1HQNA 4XETA 3D3AA 1OURA 2Q1ZB 4HKWA 5CADA 3I2OA 1ND3B 2GMMA 4P02B 3MIDA 2R0FA 3B69A 1JW6A 4R4ZA 5A6ZA 3LA3A 3CNAA 5DM61 2CTVA 2AYHA 5F5CA 1OD3A 4QDSA 3KHCA 2JA6L 1MZ6A 1OKOA 4CUAA 1YLLA 5FWJA 1M06G 1K5MC 1V6OA 3SH3A 3JCIA 2J1SA 3AYDA 3BTZA 3RNSA 2WNOA 3KHBA 3JBG2 4BBRL 3OEAA 5FYVA 1ND2B 1JZ7A 1RUC2 2A6ED 3S1RL 1NCRB 1O4TA 4YWLA 1YEWA 4LITA 5EXOA 4QXBA 5A33B 2ZGQA 3S57A 1VBC2 1TWHL 4E9KA 5BNNB 1J58A 2D7FA 2X10A 4OVEA 2KXLA 4WM8A 3ZLIA 1JYBA 2QFEA 3TRSB 4MVTA 2WA3A 2ZJCA 3HJRA 2Y6HA 1RC6A 3LCPA 2ZEXA 1LU2A 3D4KA 4AEMA 1VRH1 3ZYHA 1UOFA 1VB4A 4P9LA 2C9KA 4M00A 1WKYA 4JHTA 3PO2L 1MVQA 1WW6A 4JRAA 2DWRA 1LOCA 1EV11 1R1ZA 3FMGA 1PK6A 2YGLA 3D82A 5BNPA 1JZ6A 3LWPB 3VBHC 3ZFGA 1E5HA 1OOPA 4FP3A 4Q4Y3 5T5JA 1H4GA 1D4M1 2BERA 1RHI3 1L7RA 3R05A 5M3ML 1QWRA 4IEYA 4XCBA 4H55A 3VBUA 4O61A 3T0BA 3WNMA 1HLCA 4LBQB 4WVWA 3KSCA 5KC6A 1UYYA 1AVBA 4IW3A 1GZWA 5IVYA 4BLIA 2M4YA 4YG0A 4IEQA 4UW5A 3SLIA 4XQDA 3R6SA 3HNMA 4AEKA 1X7NA 1Q8PA 4YW5A 2P17A 5KBFA 2FDIA 1KD7A 3VGIA 4XUNA 1FT9A 2CNAA 2ZGUA 4YLZA 4OI2A 3WUDA 1C5IA 2EICA 1RVF2 1W8OA 3ZN4A 2HWB2 2CKCA 4FOVA 4QPGA 1OBNA 1E8JA 4HXCA 3SHRA 3W5NA 1CIYA 3USUA 1B35B 1DQ4A 1W99A 2E31A 2ZKLA 1CAXB 3HR9A 2E26A 3NJZA 3VL8A 1EAH2 4OI4A 2B5ID 1VBA1 3VHOA 3RZZA 3WDXA 4V2VA 3K7AL 2H12A 1BXHA 1POV1 1SLTA 1S0DA 2Y64A 4IV1B 5A32B 3VDAA 2O8QA 4A2UA 4XXAA 2C26A 1JTZX 4RFT0 4EJRA 1O3RA 3H1MA 3ZR5A 5HCFA 3HOYL 2WC2A 2VOKA 3J7HA 4AGVA 3H3VM 3LNLA 1W06A 1DGRA 1GWMA 1Q8VA 2O8OA 3DV8A 3LE0A 4NMIA 3THTA 2CV6A 3U0ZA 5LRSA 2JI3A 3NVCA 1H4HA 1OMIA 4GWMA 1I1EA 2PMZP 1STMA 3ASIA 4KWLA 2PXJA 1REFA 2GNDA 3NWKA 3WG4A 2HWF3 3LZZA 5JUVA 3P6BA 3L9JT 1XNDA 5A7WB 4XPVA 3W58A 5FJKA 3NW4A 4CDUC 5J7MA 4BY1L 4ZZ5A 2JA5L 5T3NA 4Y5Z0 5LK5A 4ES9A 1ASJ1 3MIGA 2V0FA 4E8CA 2UWAA 2PHDA 5FMDA 3IB3A 2BNOA 4OUEA 5A80A 2OW4A 4Q8KA 1WD4A 2DUPA 4OI1A 1H8TB 2J22A 1G7YA 1XYNA 2V5YA 3W9AA 1FOD1 1KFUL 4P5HA 1W0PA 3ZX7A 3I54A 4BK4A 2ERJA 1ZX5A 4XBQA 2ZPXA 1JH5A 2EXKA 1MEC2 2KKDA 2VNVA 4BE3A 4CXYA 2YBSA 4FPYA 1IS4A 4C1XA 5D8AC 1HIXA 1W2NA 3VBRA 2CGOA 1PGSA 3FHAA 2A70A 1PVC2 3IPVA 2ZGSA 3OBTA 4MH0E 1AR81 2X5IA 3WQ0A 1HW5A 4DFSA 2LUWA 1V70A 3H7JA 3I2JA 4L9BA 5DN2A 5LATA 5K8SA 3FJSA 2JG9A 2D3SA 4JDMA 4FFHA 1BVVA 4Q4V2 4AHZA 1LHNA 1OPMA 3RFRA 4AYBP 3M2MA 1J3PA 3ZYJB 5HV4A 3RWNA 2JDMA 5FYSA 3O7OA 2YPDA 4D7TA 5GZEA 2HYXA 1OI6A 5CG9A 3OGJA 2AACA 5DG1A 4XW3A 2WZ8A 3GTQL 1XC6A 2G1MA 3VD7A 5C7GA 3VBFC 2D43A 1OA4A 2RR12 3HBKA 1OKQA 1RDVA 2ORXA 3WG3A 1UYPA 2QVSB 4GJZA 4RS5B 2BE5D 5FXZA 4CEYB 4AR3A 1ZYBA 2KA3A 2VO5A 2AREA 2Y60A 3C7HA 3N9LA 4OMDA 4XJAA 1G9AA 3POIA 2KM2A 2VZPA 2WDBA 3N9PA 2VZQA 1NLRA 4LO5B 3FX3A 4I01A 2Q8OA 2GZWA 4BU2A 4LOTA 3VKFC 3GTOL 3MUY1 3BU0A 3VZLA 4CYDA 4XBNA 5GAGc 1YCIA 1R082 3ZN6B 1BQ8A 2VU9A 4KNCA 3PVOA 5FDBA 2E7TA 5C5UA 5C8CA 3MLLA 5JVVA 1G9BA 3DUIA 5JOZA 4BY7L 4ZXKA 4O65A 4QHBA 3IAPA 4Z82A 3PVBB 4AI2A 1RHI1 2A68D 4X8NA 5T5LA 1XNAA 5EP9A 5FUIA 5FZ0A 3LD8A 3RQ0A 4CP9A 2JECA 3J7Z1 2ZX4A 2E2JL 4GMP3 1CX1A 4D7YA 1JYTA 3LWCA 2JDPA 3OY8A 5FY1A 4IE5A 1UN1A 4QPIB 3MHZA 4RQPC 5FOBB 1RXFA 3KYYA 1VP6A 1O5UA 5D21A 1PO13 2W39A 1W0OA 1IRNA 3VZNA 4B8CD 4JADA 4OHXA 4CU6A 1IW7D 3WZ1A 3C2UA 1N1VA 3B94A 1D4VB 1X33A 4CDWC 4QX1A 5GLZA 4NRMA 4WZFA 1F4LA 1BEV2 4DO0A 4Y5TA 3OD0A 4FFIA 2MEV1 4ONUA 2RS12 1WMDA 3JD71 2V3BB 4PQQA 1X82A 2JX9A 3CZUA 3B5LB 1C8M3 5HCAA 1TNRA 3TOJA 2CWMA 3PDQA 1Y1VL 1UIJA 2ZS6B 1K42A 3J9SA 1WLTA 5GM0A 1HB3A 5AN9H 5FZIA 4OZOA 1AHSA 2HBUA 3D0JA 4CPBA 5FYIA 3MI8A 4LHLA 3FUQA 4YG6A 3RDIA 2VM9A 3HOZL 1HN0A 1GUIA 4GWIA 5FXWA 1QKQA 4EZHA 2J1TA 2A3YA 2VULA 2VZVA 4NE9A 4LE4A 4GZ9A 2W47A 3T09A 4FTBA 2VMDA 1RJ7A 5G04L 2PVEA 3NAPA 2YV8A 1OQEA 1ZZ9A 4AQ2A 3VN4A 4RGKA 1KITA 4V1PA 5FMBA 2DDUA 1RUI3 1ZBE3 3ZKUA 2B4KA 4BB3A 4URAA 1ONAA 5A3UA 2P34A 4XUOA 1ZREA 4L99A 4D6RA 3I4IA 1SMVA 4P9GA 5C6CA 4Z07A 4META 4M4RA 4AI3A 1V6MA 3ZFEA 5AC91 1AR62 1YRZA 4K7JA 3INAA 3ZXDA 2ZAAA 5FBJA 4YWAA 5FYCA 3J4UH 1O8SA 2K0GA 3AC0A 4GJYA 3WR0A 2VNGA 4BQ1A 3H0GL 3WF4A 4I2OA 1D0HA 4W65A 4BPZA 4HONA 4FTEA 2J1VA 1QXJA 4QQ2A 5M3FL 3KZ4C 4Z1VA 1QOOA 3PL0A 2XBO3 5T50A 1ULCA 3I7DA 2NYDA 4P9JA 5L9BA 5IFTA 2UYAA 3HD8B 5ISLA 3I59B 2XJUA 3WY6A 1RUH2 2ERFA 5FZDA 2YDEA 2L0ZA 1RYTA 1U5XA 2VR4A 1QNWA 4YGBA 3WV6A 2F6BA 4IDZA 2GSYA 5J37A 3ZDSA 4Q1PA 5ANQA 1RUOA 5EPAA 2OX0A 3JBG3 4KWJA 3TBDA 1ULFA 5CKMA 1HN1A 5EHDA 4B4RA 3ACIA 3H97A 1RUC3 1CAVA 5A7QA 1JODA 4BQWA 4QGLA 1W2OA 3N7LA 5EQUA 1VBC3 1SLBA 1S0EA 1PHMA 3FBYA 5DDJ2 5F3GA 2I74A 1VMJA 3KCYA 2YC0A 3WF3A 4CDQA 2OS2A 2P5BA 4XF9A 3AL5A 3ABZA 4JAEA 2LRPA 5C9AA 2DURA 4JV4A 1ULGA 4ARXA 2QQPA 3V56A 2DBNA 3G7DA 2AENA 5KXCA 5LCWL 1Q56A 1PX4A 2R49A 1RDGA 3VDDC 3B00A 2W5FA 3HOBA 3VHRA 3BOPA 4XQ4A 3A0KA 3B02A 5F3CA 1SEFA 2NMNA 3CO2A 4ZS2A 2ZEZA 5FZ6A 2H0BA 5EWSA 4OUSA 3H3LA 2ZCWA 3WDYA 1NKGA 1JS9A 1YWKA 4K6BA 6RXNA 2ZMNA 3AX4A 2C9AA 2NVQL 1I9RA 1QJZA 3MPBA 3QH7A 4GMP1 3KYWA 3BUCA 3GTJL 2Z69A 4V2WA 1H1IA 4AL9A 3I3QA 5CVRA 2QQUA 4EWEA 4Q0UA 1W0NA 5L7OB 1V6LA 2XMLA 3H7YA 1H1AA 1UKGA 4R9CA 3C3VA 1UY1A 3VBOA 1NNQA 2DCTA 5C3PA 4XJWA 1GWLA 4CCJA 4NAMA 5KXEA 5L36A 1NXMA 2A75A 2WS92 2WSUA 2WZR2 5MLC3 1RVF3 2HWB3 4BZ4A 3VDBA 1ULPA 1CADA 3C7OA 2VUCA 1LESA 3ZFFA 1XNCA 4NHLA 1IOAA 3Q8BA 3WNLA 1XBFA 3HJWB 5FZLA 1UL9A 3V0AA 1EAH3 1GFF2 2RG4A 4AEDB 3RRDA 5IK8A 4DRVA 3LOBA 1LB2A 4JQRA 3ZXFA 3O0XA 4LULA 4BWOA 2E63A 4QMAA 1Q8QA 1MVEA 2EIEA 1FPN1 1RJ8A 4PDWB 3SKVA 3W59A 4ES8A 3P2AA 1NZCA 3FZ3A 1V6NA 2KD7A 5C4WC 3AKTA 4YARA 4AVAA 2NVYL 3EBRA 3BYWA 5FK7A 1UD1A 1JZ2A 1R0HA 2NMOA 4EWDA 2XLFA 2VMGA 2FMYA 4EV0A 2DTWA 5KXDA 4HBNA 4Q4X2 2YC2A 1GQGA 3FHQA 4AAXA 3I49A 4GKXA 2CSGA 4G3YC 5D2AA 2WFF2 3N9OA 1CPMA 1JOBA 3HQUA 1RUI1 2FBEA 3IDCB 4YVSC 2W1QA 1CAAA 4E2SA 4OQ9A 3S2DL 2QQLA 4OCTA 1NQDA 2WR9A 1UAIA 4FVVA 4COVA 1RMU2 2ZA9A 4QKNA 3UJQA 5JR2A 2HEWF 1Q43A 3N9NA 4N43B 4XFBA 3EYPA 2APOB 1J59A 1IU6A 1MEC3 2R1DA 4KU8A 4MHUA 1CZSA 1UY0A 5SV5A 4A3JL 2Y6KA 2VBBA 1LKNA 4FSJA 1TQ5A 1PVC3 1S55A 5FMCA 5GZDA 2IXIA 2RS52 3UESA 5JPMB 3I3BA 4OI0A 3MPSA 1BRFA 5FKCA 2Z3QB 4IE4A 1HB1A 1SBFA 1DQ1A 2ES3A 2W2IA 3K75B 2GMEA 1NXEA 2VQUA 4Q4V3 1SPPA 2ZHKA 3IMMA 3PVEA 4A3LL 2RMU1 4OHWA 3WLUA 2Y8KA 3FLPA 2VQAA 1HX6A 3LPFA 3NRUA 4M3CF 4QXCA 2W0XA 4YVWA 1OVSA 3SMHA 3AP4A 1UW8A 1PM4A 1TWGL 2ENRA 1DZQA 1ALYA 2BOJA 3HVDA 3O5SA 4NPMA 3JBG1 4WM8C 3O1RA 2VMIA 4ASLA 4I09A 1X50A 2RR13 3K4ZA 1ZZ8A 3KV5A 4GH4B 4QKBA 1RUC1 1S30A 1W04A 4NR1A 4AVCA 1U5ZA 1RWDA 2RDVA 1GSLA 1F8VA 4FT8A 1OFSA 4FQ4A 4B1MA 1YQ6A 1URXA 1S0GA 5FPVA 4GB32 1A34A 1ST8A 4IE0A 5LB6A 4PI2A 2A3WA 4XTMA 3ZPOA 4NROA 1V9U2 4DRRA 3S17L 5IVCA 5FYZA 1PK6C 1G6NA 2JENA 2JDZA 5BNPC 1UO9A 1JYCA 3FBMA 2C6SA 4QT6A 3ZFGC 2ZX1A 3DYOA 4BYYA 1OOPC 4Y52L 4UFIA 1R083 4XDQA 4YGEA 4CEWB 1IKPA 2Q0AA 1I6HL 5A7SA 3N35A 3VBUC 4R9AA 5KHGA 2GNBA 2YGMA 4XJ8A 4Q2FA 1L7LA 1UKRA 4N8MA 2VZSA 4IV1A 4Q1RA 5LASA 2CR8A 2B45X 4K1YA 1LU1A 1RUJ2 4D94A 5K0UB 2R073 2QQOA 2X8KA 3TN92 1TZOA 3GYDA 4R52A 4NIHA 2DCJA 1W8ZA 3I3DA 4GKYA 1S2ZA 3NKTA 1ZZBA 3J8F2 5FPAA 4Q26A 2WNUB 4IGQA 4B4QA 5HCBA 5K4LA 5F3EA 1H6XA 5EZWA 4QHOA 4QPGC 3D8CA 4Y22B 1IHMA 2H0VA 1OF4A 4YFWA 2GDFA 5LRRA 3UKNA 3VBSB 2BWCA 4CCNA 4ZN1B 1ULOA 2DFCA 2GU9A 4XF3A 2HWB1 4OHYA 1PNGA 2A69D 1JOPA 4I0AA 3T0AA 4TVMA 1UU5A 3M3IA 2Y6LA 3HT2A 3SXWA 1BEV3 3POJA 3WW4A 1EAH1 2WWUA 1UCXA 4TZDA 4Y33A 2VQ0A 1X9PA 2RS13 1H8TA 1S4CA 1JU3A 1W03A 4TXWA 5FCCA 4DXTA 5CFCB 4K3UA 3IMNA 1WMFA 2YU9L 3CJIB 5IW0A 1YQ2A 3SCHA 3JU9A 3RYKA 3IT8A 3AFGA 3X29B 3BIEA 4RFRB 4FI9A 3L2YA 2PELA 3PUSA 3SCGA 2P3IA 4DPNA 1TME1 2PYAA 3CIHA 1O4ZA 1GYKA 4LBKA 1RUE2 2GMGA 1O3QA 3JXSA 3UJOA 2TNFA 4D3WA 1W28A 2ZABA 3AKPA 3BU7A 1QF3A 1FYUA 3T08A 5I91A 2DBIA 2HWC1 4UFMA 5CA6A 5FY5A 5E88A 1WCDJ 3PUHA 2XB6C 2XJTA 5DUWA 3CDZB 3QOPA 3ZR6A 4BXSV 2X53S 4QQLA 4A7KA 3FWEA 2ZGRA 2VXRA 3VBRC 2Y6JA 3J26N 3BPSA 1R1A2 2X5IC 3PVNA 1C8NA 1JOJA 1W8NA 2PHWA 5GAHc 2ZGLA 1MEC1 1LOEA 4YZ5A 2FDFA 3I3MA 2XR4A 1AR63 3KQRA 1K5MB 2JG9C 2M6OA 2R6QA 3DXTA 4MXWB 3VZJA 4LKEA 5FZGA 3ECQA 4OZXA 2XLGA 1P7PA 1QQTA 2GC2A 2QL0A 5IY0A 3S2HL 1F4HA 2ZGTA 2YB7A 2YG0A 2PLV2 4AI8A 1H9WA 1HV1A 1I5ZA 4Q4V1 5EIYB 1ZBA2 3DCQA 3I2HA 1UZWA 1AF9A 1N3OA 1O7FA 3LDKA 4WVMA 4XUQA 3WSOA 1OFNA 5HV0A 2AEZA 4FCAA 1OXCA 4PIXA 1OH3A 2O1QA 3I8TA 3OPZA 4A41A 2ADEA 4GIQA 4NN0A 5AFBA 4QM9A 1RUH3 3IDBB 3WNXA 3ZYBA 4ISQA 5HXMA 1H8VA 3ZYFA 1H0BA 1SMUA 4P08A 1QJFA 3AM2A 4WFN1 1REDA 5DZEA 4HVQA 1W05A 4CP2A 1T9QA 3WDWA 1W9FA 4PLNA 5DUVA 1RITA 2V4VA 1LEDA 3WWNB 1NLQA 4ASKA 2BDRA 4Q5OA 2Q8EA 3ZSMA 1W6PA 1W6QA 1GBGA 3AKRA 3EQEA 4IQPA 2W95A 2ZEYA 2ATFA 1DBNA 4NUBA 5DDJ3 2VCMA 3ZM8A 3ZSEA 4EWAA 5C8CC 4ISRA 2UWCA 4CDXA 4Y1ZA 3ACLA 1C8M2 3LFMA 1TNFA 2A6YA 2WLPA 1T2XA 3NSTA 1R081 1W8WA 3BIWE 4HN1A 5BNOB 4O9GA 3KD4A 4C0HA 1CVNA 1LEMA 1OUSA 1IU5A 2P4EA 3OBZA 3OF1A 5LA9A 3THPA 4BH9A 5DM71 5IK7A 2DCKA 2ARXA 5C3OA 4GULA 1GZTA 2A3XA 4IL7A 3HAGA 3K77A 3V0BB 5A3TA 1GMMA 1WWYA 5IK5A 1W8FA 2CGNA 5ERLA 4QB6A 3ZSJA 2QDRA 4XUTA 2B46X 3EXUA 4N9HA 5C4WA 5JIUA 3H8XA 2VCCA 1YIPA 4XACA 5LBEA 1PFYA 2JE7A 5JZGB 3KV9A 4HL0A 4LO8A 4Q27A 2BYVE 2EF6A 1MS0A 2HJIA 3MLJA 1WCKA 2RS32 3HOWL 1QOTA 3APBA 4DMIA 1AX0A 5LK7B 3UKTA 2PAEA 1PFVA 1MACA 1WMEA 3ZO0B 3O0WA 1AL22 2EAKA 3GTML 4LKDA 3HIFA 1JZ8A 1Z92B 4Y1VA 1DZTA 2WS93 1IS5A 1AZDA 1SLAA 2WZR3 3C7GA 4XXPA 1BEV1 5FYMA 3HKZP 5FZOB 2QQNA 2NM1A 1RGSA 1F15A 1ODNA 3OCPA 2AC1A 2VBPA 4YPJA 4CCLA 2W87A 2V5DA 3HNYM 3LA2A 4CDUB 4LHKA 1BBT2 1H6YA 1LENA 4L97A 3AJYA 3A44A 4OULA 5FY0A 2R32A 2IXCA 5GLWA 4EQVA 1T6BX 3NNFA 3H8UA 2ET1A 2XBO2 4QX8A 4RN5A 2GP5A 3ILNA 1UMZA 2W9XA 1WLWA 1WCQA 5A3OA 5HI0A 3LKJA 3NAPC 4G9SB 1Q5OA 2QJVA 3DKWA 2CAVA 2H6BA 4LXLA 1PZ8A 5D8AB 4LBJA 2K2DA 4FPJA 4AI9A 4I0WB 4YW1A 1JMUB 1FAYA 1QDOA 3IN9A 1LHVA 3AKSA 3H3ZA 3FFZA 4FTSA 2KR2A 4Q4X3 4Y26A 4FBFA 5FPBA 4Y1UA 1YIFA 2IFRA 2WFF3 1IKQA 3ZFEC
chains in the Genus database with same CATH topology
4L8QA 2XJSA 4UW3A 2A7AA 3WDVA 1KDKA 4XF4A 4AQ6A 4BCUA 3RSJA 4FPGA 3WP5A 4AF9A 2UURA 5I8YA 4B29A 1RMU3 4LEJA 4FPLA 3VBFB 3LSEA 4AI0A 1SCRA 5KHKA 1UPIA 2CAUA 2EAAA 4ORFA 1PZ9A 1V00A 4WVZA 4C1WA 2E9QA 2RS53 3B9CA 2XL7A 3IDEA 1MZEA 4D7SA 4RSUA 1Z78A 3PIP1 2DVFA 4KBBA 4LR4A 1ZZ6A 4BLJA 2TEPA 1LRHA 1QJY2 2D5FA 3WP3A 1I6XA 1C57A 1PGW2 2GN7A 2DYCA 1LKPA 4HZFA 4S2FA 1RUH1 4LTAA 1UIKA 4F8AA 1LJ7A 1H9PA 1PO22 1QQP2 4HPKB 1CD3G 4RR3A 2WA4A 1NXGA 1NCQA 3PHMA 3E5UA 2JD4A 4CDQC 2P2KA 8RXNA 1S2KA 1AX2A 2NYYA 5C9AC 3MW2A 4COUA 5DDJ1 3PJYA 7RXNA 1GNHA 1J1TA 3GZAA 4GB33 5BUVA 2YYOA 3U4XA 5A3MA 1PGL2 3V65A 1MQTA 1V9U3 5AVPA 4JGZB 1G9DA 2OVUA 1T9PA 3O14A 1O5LA 1N47A 4GXLA 2DVGA 3CEWA 3GZTB 5JMCA 5I8TA 3H3UA 2B7YA 1Z7S1 5JDBA 1V6JA 5CBLA 2LTNA 2PHRA 1FXZA 4JDOA 4JGYA 2N7GA 1PIV2 3KB5A 4RGGA 1BKZA 1Q3EA 1RUJ3 1QNYA 2NLRA 2O0OA 2B39A 3PKJA 3TN93 3WXPA 3VBOC 1RYQA 3WDTA 1AYM2 3J8F3 5T5PA 5AVAA 1H30A 1LHUA 2DU1A 3JQWA 3ZFFC 2BFUL 4H3WA 4RGAA 1VALA 5K9YA 2WS91 4E4ZA 4DXZA 4NWVA 3RZ6A 4XGHA 4BHPA 4Y20B 5CFDB 1N3QA 3BCWA 5EYXA 1JUIA 4E6YA 4Y1XA 1WW4A 4E4SA 3EO6A 1CPNA 1DGWA 3WW1A 3AFKA 5J96B 1J1LA 3WDUA 4N43A 5DZGA 4FPOB 3QH6A 3SNMA 3RI9A 1HQLA 4IV3A 4PIZA 2JG8A 5AI2A 2R042 3RMXA 1PZ7A 1YFYA 3SH4A 1SBEA 4XOGA 5CAZA 2OZ6A 5BPXA 3RJRA 4FQZA 1CJDA 2R062 3U11A 1RUE3 1DU3D 2XVLA 3O12A 3BB6A 4M3CB 4Q4X1 2WQZC 1BQPA 4XZPA 1VBE2 2D3RA 4AHYA 5FQ0B 5I0RA 3EJKA 3QD6A 1LTLA 3BOWA 4NOTA 1ZZCA 5FPZA 3D6EA 2O5JD 4WZCA 2ZHMA 3WW2A 1RMU1 1TMF2 4UXAA 3ZXGA 1R1A3 4WVVA 1UZZA 3PMSA 2VVDA 1JUHA 4KG8A 3AYAA 4HSJA 2PAMA 3KGLA 1NA1A 4TPUA 2VW1A 4AXOA 2XWBB 3KYUA 2A6WA 5C8WA 1ZM1A 1W6MA 2WNVA 1U12A 4AR4A 5FO8B 2X29A 4J1XA 2ZGMA 4Q4Y1 4YVWC 2PLV3 4N7IA 3MICA 1AUYA 2R072 3UKVA 1ZBA3 2XJRA 5F6KA 4AG4A 2PHUA 3H1YA 5JSOA 1RB8G 4EN6B 4HVRA 1VZIA 1W2UA 3ES1A 4MXVA 5L19A 2XH6A 1DYKA 2QE3A 2ZKNA 3E6BA 4X8PA 3N36A 3VDDB 2I45A 2D6LX 3QVDA 1GQHA 4Y1YA 3VZOA 5CIRA 5LEKA 3SCFA 1B09A 1SLLA 3JB4C 4GB31 2LCQA 5EV7A 4HFSA 1RUF2 1V9U1 5D1IA 1W6OB 2XKOA 3R4SA 4IV1C 3MYXA 4QX5A 1N1YA 4CTEA 5E89A 3WVJA 1HRV2 3SH5A 1A78A 4LLOA 4Q29A 2Y0IA 2LALA 3PTYA 1RUJ1 2VVFA 2HWF1 4AI1A 3TN91 2MNGA 5KC5A 2BTVC 1BYHA 4N9IA 3M3EA 4WBBA 1RUD2 3J8F1 4YG3A 4OHZA 3O0VA 5I0TA 4JCKA 4LLFA 4P9IA 4KWKA 1DF0A 4J1WA 2RS33 3WG2A 3B9IA 4HETA 5CNAA 5DG2A 4N53A 4I02A 2R16A 1AL23 1DGWX 4V196 1H8TC 2P3JA 2IXKA 2WZPP 1LKMA 1OLQA 1TE1B 3AXEA 4LBLA 3TB0A 3ZSLA 2ZACA 5AI3A 3MF6A 5ABJB 3ME2A 4NPRA 3RYRA 3RMYA 1I3HA 2D44A 4E4DX 1BBT3 1IPJA 2E6VA 3ZPYA 2NZ9A 4QU2A 2MHFA 2ZOEB 3VKMA 3OJBA 1EPZA 1Y43B 3ILRA 4IEUA 4WM7A 1F9KA 3WCSA 5JOXA 2HWD2 1RUE1 4Q0QA 1YYNA 2VPVA 4ATEA 2ZAHA 1VRH2 1O3TA 1YXWA 1QYBA 3RJ2X 2PFWA 3ZIWA 2HWE2 1A8DA 1NLSA 3JB8A 1D0GA 4HSLA 2VVEA 1W6NA 1LECA 1R1A1 3JUUA 2QUOA 2A6ZA 5DUXA 1VR3A 2BVVA 2AH2A 4AR5A 1NE4A 2RHPA 4AFDA 4WM8B 2V0EA 2VH9A 3AB0A 3AP7A 4IEVA 4MGYE 4M0NA 2PLV1 1ZBA1 3ELNA 2R30A 3H9AA 4JTOA 1YO8A 2UY9A 2ZGPA 2Q30A 4X6RB 3OYWA 5BNOA 5GZGA 1QJY3 3WWLA 1WUVA 1PK6B 2K9ZA 2IXLA 5GADc 1FHHA 3ZFGB 1OOPB 2EIGA 1SLIA 2GMPA 5FLIA 1G8WA 1PO23 1QQP3 5JIAA 4AFCA 4CZSA 4FOQA 2PSMC 1PO11 3FFQA 3TAYA 3VBUB 3P3PA 4F3JA 4YZ1A 2GC3A 1BQ9A 4CDXC 3ZN5A 5FO7B 5F9TA 4COZA 3B08B 5JZGA 2VOVA 1YFWA 3ZXEA 2YZ4A 2WSVA 4QGMA 2D6KA 2A5ZA 3GNEA 1PMIA 3NV2A 2NQYA 1C8M1 1BZWA 1AJKA 3DPRA 2UU8A 4QPGB 2UYBA 4XJUA 3USUB 4KG0A 3KT7A 1LODA 2D98A 1OQDA 1SLCA 2PAKA 1PIV3 2WFPA 5IK4A 3UL2A 1DHKB 1N3PA 4XMIA 2ZZJA 1ND3A 3BTAA 1RL3A 3VHPA 4HLTA 5F1RA 1R0IA 1FATA 2JI1A 2JKBA 3MZHA 1AYM3 2XHKA 1ZBE1 2RS31 1X36A 3VPBE 1CAUB 1JBCA 1T9OA 3LPEB 4HANA 4AFAA 2YUEA 5CU1A 5EJ3A 1ODHA 3T2TA 1GKBA 3ILFA 3ES4A 4XE9A 1VZGA 4B7KA 1IS3A 1AYN2 1ND2A 5A33A 1NCRA 3FE5A 1BBT1 5BNNA 5C33A 3ZXKA 2BBVA 2DCZA 1VLNA 1CN1A 1OWCA 2BGCA 4HK8A 3VBRB 2BEOA 2XBO1 3IPVB 4POFA 2GAUA 2R043 5FLJA 2JG9B 2JICA 3GBWA 4OFGA 1RUG2 1DQ5A 3KYVA 4G6BA 2R063 1UPSA 2RE9A 5K2ME 1CIWA 4UBGA 4AK3A 1VBE3 1VBD2 4PF5A 2IWGB 3GF6A 4LBQA 1D2QA 1PM7A 4AVBA 1VBC1 4KGGA 4LBOA 1H2NA 4HPKA 2WT0A 3MW4A 4O9EA 4XHBA 1AR72 1TMF3 3GALA 4CRQA 3E5XA 1HDKA 1T6GC 4ZKTB 1RTVA 3ZSKA 2IC1A 1QMJA 5J98B 1B35A 2AGSA 2UWBA 1CAXA 3AZWA 4GWNA 1ENRA 5A32A 4UBHA 2IXJA 1HQWA 4JGZA 1S2BA 4SBVA 5F5QA 4UW4A 1FX5A 1LOFA 4RR3C 1QJY1 2XGXA 2DVDA 2XWJB 1NCQC 4N7UA 1ZRFA 4HKLA 3M3QA 3JD72 3MSUA 1B13A 3R0RA 3TNPB 1QQP1 2CKAA 3GBFA 4DB5A 4PIYA 4XQWA 2SBAA 2XVGA 1QH7A 3VKNA 1SMWA 4BIFA 1HXS2 1DYPA 1POV0 1DX8A 4R9BA 2JXAA 1RVF1 1MQTC 3OY8B 2UY8A 4LO4B 5FMOS 2GH2A 4IEZA 1PGL1 1H2KA 3QACA 1RUF3 4K8FA 1EPWA 2W08A 1WD3A 1MS1A 2Q4SA 4XILA 5BY5A 4XFAA 4JGYC 4PBPA 1C09A 4ITCA 3AP5A 5CFDA 1JXNA 1FV3A 1HRV3 2M4VA 1MS8A 1YFUA 2WT1A 1ZA4A 3MGUA 4BMBA 3S7EA 1QXRA 3BPZA 1ULEA 1JYIA 1LHOA 1WW5A 3JZVA 5AC92 4RXNA 2YY1A 4PQ9A 5A3LA 4UW6A 1B2JA 2QZ2A 3AMPA 5I0UA 1QJU2 2VECA 3AXDA 1RUD3 1AYM1 4IEXA 5BYNA 3NV3A 5JLVA 2GALA 2VGDA 4CP0A 2FZ2A 5J48A 4QXKA 1BCXA 3AZVA 3HBZA 4QM8A 4M3CA 1XRUA 3FUOA 3NAPB 4BA6A 1BVP1 4INDA 5HBAA 1CQ9A 3FHIB 4LHNA 5GJ6A 2B42B 3CF6E 3NV4A 4RS5A 4CEYA 4N43C 2IFWA 1DQ0A 5GAEc 3WHTA 1PVC1 2A6XA 2HEYF 2JG8C 4IV3C 5GKAC 4LNVA 4XHXA 3RZTA 3GHNA 1GICA 1XE7A 2GNMA 3SS2A 3M3OA 4YGDA 3ZFEB 3PMEA 4TLFA 3KCXA 2C0ZA 1CX4A 2AUYA 2PYTA 2R041 1V6IA 3V64A 2AYJA 1WLDA 2R061 2HWD3 3USSA 2BVBA 4AHXA 1UX6A 2Q5TA 1R092 1OQ1A 5L73A 2RR11 3WD5A 3FC0A 1SDWA 1VRH3 1COV2 3CL1A 4BMEA 1A3KA 5I93A 3VBHB 4EN9B 4M0HA 4XFHA 1CAWB 5JI7A 2HWE3 2Z79A 1NA1C 2D93A 1TMF1 5MGNA 1EY2A 4QPIA 1BE7A 1XE8A 2WNVC 3N7MA 1QU0A 2I07B 1ENSA 5KHHA 2A71A 4P9YA 1CAVB 4XFCA 1DGRN 3PWFA 3ZG6A 3VL9A 3P3NA 1BJQA 4EROA 3GBGA 4MGKE 5JOWA 2PPTA 4CDQB 2FQPA 4I0BA 2PN5A 1MS5A 5H9RA 1LOBA 1OD5A 5JSRA 4AE2A 2R071 4XXBB 5IT6A 2PA7A 3OGGA 4XFIA 4OLLA 4COWA 4YYOA 4Z2WA 3T1LA 2BNNA 3KS7A 2OUJA 4FAHA 1HRI2 1YFXA 2WQ4A 3R4DB 2IXHA 3CU7A 3IBMA 2D6OX 1EYBA 2E7QA 1YI7A 1FPN2 4M01A 4IESA 4C90A 4FXGB 2XJPA 3MW3A 5B2GB 3ALQA 4B8EA 2RS11 1IS6A 1R0GA 3VBOB 1RUF1 4R8HA 5FTTC 1C5HA 3RYGA 5H9SA 4RHV2 5JR7B 3ZFFB 1ENQA 4XFFA 1HRV1 1APNA 1V6KA 3BALA 3MF9A 5I8SA 4QGNA 3V0AB 3ZVXA 1SBDA 4DZGA 2Z5WA 4PJYA 2PQQA 4WV8A 2DUOA 4PCRA 5CB7A 5JOYA 4Y4YA 2OPKA 2OUHA 1HKDA 1RUD1 4N53C 1YUDA 2ZGKA 3I59A 4YWMA 1Y9QA 1AJOA 4ZU7A 3VHNA 5JWPA 5I0SA 5E1RA 1XYOA 2VG9A 2RMU2 2OYZA 1AR61 1DZRA 3POSA 4YM2A 3MIFA 1AYN3 3RS6A 1C28A 1IROA 2BNMA 5H9PA 3GZUC 3MDPA 5GALA 4GS7D 3GHMA 4AHWA 4A7ZA 3N7JA 4Q0SA 3M4FA 3PJQA 4HN0A 1FMD2 2PTMA 4WM7C 2EVXA 2VOXA 1CJPA 1X8MA 4S2GA 3AMMA 4SLIA 3RYPA 2WL1A 5EFUA 2HWD1 2E53A 2E51A 2W52A 4AVVA 1YK5A 1GANA 1XXNA 3IIAA 3NO8A 1U5YA 4YM3A 4DOUA 3AYEA 2EXHA 4LA2A 1F5JA 1RUG3 4ZU5A 1R0FA 3AYCA 1VBD3 3ZXLA 2TUNA 4POGA 4YVWB 2HWE1 4KU7A 4FPEA 2D6MA 4JAGA 2VL6A 3B3QE 3B01A 1B2OA 5L7OA 2WJSA 2GNTA 5GLVA 4XF0A 3ROUA 1AR73 2PHTA 5JVH1 2ZBJA 2XJVA 1Y3TA 3QCWA 2FZ1A 3M8LA 3WHUA 3ZIXA 2D5HA 2HKXA 4FOYA 4L92A 5LEJA 1AR92 4RQPB 3U07A 5H1Sc 4AVSA 4MGZE 3N4MA 4GMP0 1KJLA 5BNOC 1QHDA 1RIRA 4P14A 4AEDA 1FI2A 1GR3A 1G86A 4CDWB 1NE6A 3NFPI 1MS3A 3AMHA 1S0IA 2ZMKA 3E97A 3LAGA 2XL9A 2D97A 4PLOA 2VUJA 5JI9A 3HMYA 4NHMA 4I30A 4W6XA 1YUXA 1QXPA 4PDWA 2MEV3 4HMZA 1GZ9A 1H2MA 3JD73 3VZKA 1NOVA 4HVOA 1IQAA 4QQHA 1FNYA 5JZGC 1B71A 2BQPA 1RB9A 1HXS3 2ZGOA 4RD7A 1VCXA 2WZR1 1WA4A 3A4UA 3DPRC 5DZFA 1TME2 1PNFA 2R0HA 1CAUA 2P3KA 4M3CE 5TSWA 5J09A 3UK9A 2E7AA 4UY81 2HWC2 2OA2A 2DFBA 4JAAA 1DQ6A 4K1ZA 3WP4A 3BODA 1N1SA 5FOJB 4XIOA 1ND3C 5BNQA 1F5FA 2VW0A 4K21A 3KGZA 3H50A 3RG0A 5GLTA 1VIWB 4QD2A 5AC93 5AFEA 3IWZA 2WFF1 1QJU3 3I2DA 4NVPA 5FREA 4YZ2A 1QCVA 1NY72 5T55A 1ND2C 1NCRC 3MPPG 5JCTA 3OTFA 5BNNC 1A8MA 1DDLA 3URFA 4F83A 4JC1A 1AYN1 3B0AB 1C1LA 4GH4A 1OHFA 4DQAA 2F4PA 4P9XA 4AWDA 1E57A 1ZRCA 2YPJA 1BFYA 2GN3A 2YROA 5FRAA 3JQXA 3MIHA 4B3NA 4N90A 2RS51 2D6NA 4XJ9A 1OWBA 1WGPA 4K20A 4U2AA 1QJX2 2PVXA 2C5DA 1ZRDA 2C6BA 5HXVA 1WCSA 4AR6A 5T52A 3WP6A 4DINB 4IERA 4S2HA 1J3QA 2V73A 4CEWA 2WWSA 3WG1A 1OSGA 3K48A 1RUG1 3WCRA 2YHJA 3OBRA 3AZZA 4WVMB 1R093 4TSVA 4ATFA 5K0UA 4AEJA 1VBD1 4GALA 1REEA 1UZYA 1COV3 3AP6A 4D69A 4FP2A 2WNUA 1AXZA 2M6PA 1UU6A 2ZMLA 4JTNA 5FMOL 3MEPA 1C3HA 1H1MA 1AR71 3AMQA 2CYFA 4Y22A 1B35C 1VB2A 3L2HA 3VBSA 1LCLA 1VJ2A 1IGOA 3MFCA 3ZXJA 1KQRA 1D2SA 1W6QB 1W6PB 1ZRRA 4YM1A 3KMHA 4JGZC 4BOWA 2RM22 2XJQA 1YJLA 2ETEA 1LOFC 3NV1A 3B7MA 4XIKA 4Q4W2 2ZIXA 4YM0A 4W6WA 4CDXB 2NN8A 5FPXA 1NXD1 1OA3A 5KWRA 1BMV2 4E2GA 3NKGA 4U36A 5EIOC 3LOIA 3N3HA 3AP9A 5E8AA 5CFCA 5ACA2 3AMNA 4LO7A 1LOGA 2Y38A 3CJIA 5T5OA 4Y24A 2HEVF 2CY6A 1VBB2 1GV9A 1M4WA 1WBFA 4AQTA 3M1HA 1U5IA 2FHRA 1MZFA 4RL7A 2VW2A 2EA7A 1HRI3 1ULDA 5KXBA 4Q0VA 3HN1A 2PHFA 1HXS1 4OUMA 2VOWA 2C6AA 5C4WB 2GC0A 1FPN3 5FLHA 5GZFA 3WQ1A 3WW3A 3UV9A 2NP0A 4P9WA 5MFZA 2JI2A 1YHFA 5CFDC 2MPFA 3PNAA 2V09A 3IKWA 5KHJA 4YVSB 4RHV3 4FPKA 1LHWA 2OIIA 4MXWA 1K5MA 4ME3A 1N1TA 3POWA 4LA3A 2RJKA 1SFYA 2J9UB 4QQOA 1SMMA 3QLQA 4LUKA 1S24A 1QJU1 2G9FA 3ZYRA 2DUQA 4XF1A 1S0FA 2R1BA 1EV12 3A0NA 5EYYA 4RS5C 2ZX2A 2IZWA 4QPYA 2CWSA 5EINC 4CEYC 3DL3A 3FLTA 5JSPA 2C1FA 4TYSA 2A73B 1D4M2 2I2SA 3ST7A 2YXSA 2HR5A 4MYEA 3SISA 2CGPA 2RMU3 4DY3A 2JJ6A 4FAGA 3VKOA 2QDNA 3VBHA 2DVAA 4MX3A 1ENXA 1CAWA 4S2DA 1MR5A 3ZYPA 5FO9B 1AXKA 3LGRA 3ZYGA 5SV8A 1U0AA 3HQXA 2ZTNA 3ZYIB 1NYWA 5GLUA 4FPHA 1FMD3 3QBQA 2VNOA 3S30A 3KT4A 4X6QB 3U10A 1FV2A 5H9QA 5FFOC 1J3RA 1G9FA 2D3PA 2G4IA 4R9DA 5T54A 3TNQA 1VBA2 3HWJA 5BNPB 1O91A 2LM3A 2VNRA 4YGCA 4Z8BA 1R091 3K51A 5F6LB 2OZJA 1C1FA 3V0BA 4XJZA 3AKQA 3E6DA 4FOWA 4QPIC 2Y26A 4YZ4A 1COV1 3DF0A 1JHNA 1UF2C 1GZWB 2SLIA 4LBNA 4BM8A 1XU1A 3VV1A 4I3GA 1Z7S2 5K7PA 2ZHNA 4YZ3A 4RR3B 2A6HD 1RINA 2K2SA 1NCQB 2WT2A 4IEWA 1OLRA 2JE9A 1SFNA 1VAKA 5FAXA 4PBOA 1Q8SA 1OPOA 1TEIA 1LKOA 2FMDA 4Q8LA 3ATGA 2Z42A 1AR93 1ASJ2 3ZN6A 5JVG1 1MZ5A 3RI8A 4CDUA 2Z2SB 1MQTB 3WOGA 1FOD2 3AZYA 2WINB 4B7EA 3S7IA 4R4XA 4HK9A 4FPFA 5JAXA 2B8MA 3VLBB 3AJZA 4JDNA 2QKDA 3M70A 4KQ7A 4XMAA 4AYUA 4U671 4K9SA 4ZN3B 1AR82 1YNAA 4A7YA 1HRI1 4JGYB 5MFPA 4AGRA 1O3SA 4JRLA 1R0JA 1LR5A 2D6PA 1KDMA 5D8AA 1LTEA 5BV6A 4LE3A 4A3XA 1AL21 2W68A 3PLQA 2DSXA 2H6CA 1S0CA 1KJRA 1XYPA 1YI9A 1S0JA 2BW8A 4L2NA 5FBZA 1XQNA 1TME3 1FNZA 3G6JB 3DN7A 4FO9A 3NL1A 5ABJC 4NO4A 1OA2A 5IUQA 4ASMB 1MS9A 4YW4A 2VY0A 3S6PA 4RHV1 2XUMA 2BPA2 2ZGNA 4G4FA 2HWC3 4IEPA 1RUNA 3D0SA 1Z0HA 3VBFA 2BFUS 3OD4A 2X5IB 2DV9A 3WT3A 4MGIE 1ZNPA 2PHLA 4EN8B 1AX1A 3TWIA 1FHMA 4IV3B 2JG8B 1MS4A 1ZZ7A 4K40A 3P8BA 1XNBA 5CG8A 1AL0G 1PVXA 3SITA 2PHXA 1SACA 1IPKA 1DFQA 2WKKA 4Q4Y2 1LGCA 4B4PA 4XFGA 1RHI2 4C0BA 2Q1MA 3TYJA 3VKLA 2NPIA 4W6YA 2XKPA 1YJKA 2ARBA 2ZHLA 2ZZQA 3CLPA 1KXGA 3MIEA 4KL1A 2ET7A 4DS0A 3IM0A 2CL2A 3RPQA 1GLHA 1FMD1 5KHIA 2BWAA 4KH9A 4HT1T 1QJX3 3M7AA 1GNZA 2XLAA 3B93A 4IXLA 1EP0A 2Z3RB 2EALA 1NA1B 2WNEA 4ZU4A 2EXIA 4RQPA 4AFMA 5C8CB 1PGW1 2WNVB 1W6MB 2MEV2 2VUAA 1WLCA 1DGLA 1PO21 1QOSA 3D5OA 4CDWA 2ERSA 4NHKA 1NG0A 5L7OC 3ENRA 4LT5A 3KYXA 2GH8A 4LBQD 3HT1A 3VZMA 2DU0A 1CR7A 4FXKB 2HWF2 1WW7A 3M3CA 1S1AA 4AEDC 1AR91 2JEMA 3FLRA 2RM23 4Y20A 3H0OA 4RA0A 3H1WA 4AQSA 1QGLA 2ZX0A 4Q4W3 5MF6A 3KM5A 4PDWC 5DXDA 1IZ3A 3ZMNA 4YW3A 3QQCE 1KS4A 1PIV1 3KCCA 2KN9A 1CONA 3WUCA 5ACA3 4MZUA 5J36A 3WX5A 4GQ7A 3VUOA 1VBB3 2XG3A 2B9UA 4YNIA 3LA7A 1WBLA 4CP1A 1CGPA 4PLMA 4EN0A 1F31A 4Z92B 1SQ4A 1LULA 3IU3I 1HV0A 3DGTA 1O4YA 1QY4A 4YSFA 5FQ0A 4FPCA 4JVAA 3KLSA 2QNKA 3E6CC 1S0BA 4H7LA 2TBVA 4AW7A 2ZX3A 2G9GA 2XVKA 4N53B 5JPNB 3E5QA 3MFAA 5J3UA 1ZRPA 5E16A 4J6GA 4TWTA 3WINE 3PKIA 1AXYA 4AGGA 3J7Y1 2GC1A 4COYA 3Q9OA 4AFBA 4K9FA 4Q0PA 1ZVFA 4AVTA 4XTPA