4AHYA

Flo5a cocrystallized with 3 mm gdac3
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
258
structure length
258
Chain Sequence
GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLOCCULATION PROTEIN FLO5
publication title Complex Gadolinium-Oxo Clusters Formed Along Concave Protein Surfaces.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Sugar binding protein
total genus 60
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4ahyA02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ahyA01
4AI3A 5A3MA 4COZA 2XJUA 4AI2A 2XJPA 4COYA 2XJQA 4COUA 4AHWA 2XJVA 4D3WA 4LHNA 4AI0A 4COWA 4AHZA 4AFBA 5A3LA 4GQ7A 4LHKA 4AF9A 4CP0A 4AHXA 4LHLA 2XJRA 4COVA 2XJSA 4AI1A 4AHYA 4CP2A 4ASLA 4A3XA 4AFAA 2XJTA 4CP1A 4AFCA
chains in the Genus database with same CATH superfamily
2ORZA 4Y7NL 4CCJA 3CJXA 1UO9A 4RHV1 3MUZ1 4JDOA 1UY0A 5LA0A 3ZYFA 1UU6A 3KMHA 4AR6A 1CAXB 1S2ZA 3S2DL 1QU0A 4I02A 4FPHA 1KFUL 2J9UB 2WYSA 4NRQA 3VDAA 5IW0A 3U4XA 4P9JA 5JXGA 3PMSA 3U07A 5T52A 5JWPA 5KHIA 1TWAL 3SCHA 1V6NA 5JOZA 4PLMA 4AR4A 1UIKA 2VUAA 3GZAA 4ME3A 1QXPA 2VQ0A 2VBPA 4IEVA 1HQLA 4QQ2A 4Y22B 4HN0A 2Q8DA 5IJRA 4H7LA 3VUOA 3ACHA 4Z8BA 3WNMA 2RS32 1YHFA 3EB7A 3POBA 2RS51 3FFZA 3H0OA 2VL6A 4ATFA 1DQ2A 2OUHA 1GZ9A 3ELNA 3MW2A 1JS9A 5JPMB 4KWJA 4G6BA 1W6PA 4IGOA 5FP8A 5M5WL 4TTGA 4L9BA 1VBE1 2Y64A 1H6XA 2MEV1 2XJUA 3K4AA 3MFCA 4QGNA 5FXXA 2FHRA 3LA2A 3VBUA 2A6ZA 4PQ9A 2WZ8A 3MDPA 3OEAA 4GH4C 2ZGRA 2GP5A 4QQPA 3VDDA 2XKPA 1VBA3 1VLNA 5DQ0A 2JDHA 5T55A 3VDDC 4FTSA 4JKLA 4GB33 3WQ1A 2C24A 1QH6A 3HBKA 1XYOA 1UX7A 2HWD3 4LIVA 1W6QA 1V6KA 1I50L 5FYVA 3ZXGA 1AZDA 4CDXB 5L9VA 4BIFA 3RJ2X 4FBFA 3GHNA 3KHCA 5DZEA 2DVDA 3UYJA 1XXNA 3JCIA 3ZR6A 3BU7A 3DXTA 1J3QA 1FT9A 1CAUB 1RUJ1 1UOGA 1UZZA 2CGOA 1K5JA 5A6QA 3M3IA 4QDQA 5FOJB 5H9RA 2RR11 1UZWA 1H8TA 1ZM1A 3H50A 5FMOL 2LUWA 1RUG1 3WWLA 1OHFA 2XH6A 2YG0A 1WCSA 1EAH1 4GMP3 4WM7C 3H99A 5CKMA 4FXKB 1OOPA 5MFPA 1OQEA 4YVWB 4FXGB 3FL7A 2B8MA 1OOPC 3J26N 1O3RA 4HETA 3IDBB 5J1XA 2PHFA 4BJ0A 3RZLA 1J84A 3KT7A 5FPBA 1IU5A 3C2UA 5FZLA 1XJAA 2UU8A 4DPNA 4O9EA 3GF6A 1YQ8A 5I8TA 3ORJA 1PGL2 1S0JA 3TB0A 4BWOA 3DF0A 4QB2A 4SBVA 1ZZBA 3ACGA 1JI6A 2OA2A 3LB9A 5FZAA 1TQ5A 5DM71 2ZABA 4AGRA 4JQRA 3T2OA 3WINE 5DAWA 2QQMA 2RS52 4Q0SA 4LBLA 4Z1VA 2W1QA 4N53B 2VCAA 4FPEA 5JAXA 2KKDA 3ZPOA 1UMHA 3RWNA 2ZCWA 1LENA 1K42A 1XNKA 3USSA 1SFYA 4R9AA 5C7GA 1IU6A 3O14A 3B94A 3PWFA 1FPN2 3ZXFA 1T9OA 4PLOA 4WV8A 1ODHA 2AZ5A 1DX8A 4IV1C 4C90A 4FPFA 3V0AB 1ND2A 1OF4A 4PI0A 3FE5A 4A3IL 2Y38A 1W05A 1ND2C 1QF3A 4UFKA 1WCML 2EY4E 1GNZA 3IPVA 4YM0A 4P5YA 4JAAA 1H4HA 4UFJA 5K9YA 1QQP3 1OA4A 5EJ1B 1BZWA 3UGFA 4ARXA 4Z2WA 2WA4A 1ZBE3 1YFWA 3L2HA 4IEXA 3UK9A 3PL5A 1VAVA 2RR12 2VCCA 2VNOA 4MGSA 5C8CC 1HQNA 4XJZA 3WF0A 4HK8A 2DCYA 1EAH2 5I0DA 4LBMA 1PZ8A 4ISRA 2FMDA 5F5QA 1LGBA 3PDQA 3M2MA 4MZUA 3HQRA 2VMDA 2RMU1 2W91A 3WNPA 1J1TA 3AYDA 4WVVA 4XJ8A 3O1UA 2RVAA 4ITCA 1V6IA 2YXSA 4AOCA 4E8DA 2W9XA 3VBOB 2XJTA 1H9WA 1BJQA 2WFF1 1H2NA 5FAXA 4NIIA 1LU1A 4CP9A 4OVEA 3VBFA 4E4DX 1VCXA 2WNUB 5B2GB 3M1HA 1BCXA 3WF4A 3HNMA 2JKXA 4Q0QA 1LECA 1RIRA 1JYWA 4HLTA 1O3SA 5FR3A 4XTPA 2F4LA 2W39A 3O7OA 4HKLA 1YUZA 3CDZB 3E5QA 3SQOA 1BVP1 4P9GA 5FY1A 2G4IA 3CMGA 3KWVA 3I59B 3CZUA 4IV3B 1NZIA 3SH3A 4ZN1B 2VMCA 4NPMA 1G9DA 1YFXA 1YUXA 4ES9A 2BQPA 3WHTA 3HR9A 5AC93 4CCKA 5F1RA 2XKOA 1ENSA 2BTVC 2RE9A 2M6OA 2GNTA 1JYCA 2IFWA 2ZMLA 4OUEA 5A3PA 2VOVA 1NZCA 4XQWA 2EA7A 2O0OA 2K0GA 3ZOIA 5A1FA 1Y1VL 5GZDA 5IVBA 2GMGA 1V0AA 1ZBA3 2OPWA 5FLJA 4C2M1 2ZEYA 2JWPA 1DQ0A 2R32A 3LA3A 1PNGA 5A32B 1AJOA 1LAJA 1CESA 1DCSA 2XDVA 4L2NA 5BYNA 5IFPA 1KITA 2YBKA 3D4KA 3N9MA 4AFBA 1NOVA 2VZSA 1LTEA 1K5MA 4EYUA 4D7TA 4YWMA 3N9PA 3KYVA 2IZWA 2LW8A 1T9PA 1YRZA 3N36A 3R4UA 5K0UA 1DZQA 3RZDL 1S2EA 2IXIA 2OT7A 2AREA 5K0UC 1J3PA 1VBD2 1A8MA 3KCCA 3AKRA 4YRDA 3U4SA 2VOWA 2R7ZL 5E1RA 4XFBA 4QU2A 4DUXA 3J7Z1 1IHMA 4P9IA 2VBBA 3B3QE 5GZGA 1XU1A 1C8M1 4XF4A 5C4WA 3KCXA 3ACFA 4CA9A 4UW4A 2JG8A 2KD7A 2NN8A 3WCSA 3FJSA 4GJYA 4NN0A 3A7QA 5D1IA 1XNCA 2JG8C 4A3FL 1PO13 1QJEA 1PFUA 3FHIB 2C9KA 4AVVA 3WEZA 2CL2A 3KV9A 1RUF1 2CY6A 2WABA 4PBPA 3O0XA 4ZPIA 1CX4A 5K7PA 3HJRA 2WR9A 2Q30A 3GTGL 1D0GA 2WKKA 1J1LA 3UKTA 2BVVA 1N1TA 3ZLIA 4BY7L 1AXYA 5A6XA 3EBRA 3POGA 2C4XA 1YFUA 2OPKA 4C0HA 3GCWA 4DQAA 1OSGA 3ZN6A 1BQ9A 3GTPL 4A45A 4FPJA 1E8JA 5C6CA 1ZZ6A 5EQUA 2XJQA 1YC61 2VVFA 2VMEA 5EP9A 3IIIA 4K9FA 5IUQA 2ZX1A 4LKFA 3ZYPA 5JSPA 2JDPA 5FZGA 1PIV1 4YZ4A 5J96B 4C3IL 3AYAA 3GYDA 2YGMA 3VBUB 3W21A 3VLBB 4A93L 4WVMA 1MZEA 4UFLA 1RUC2 3EHKA 1NXGA 5LY2A 3PIGA 3V65A 1QKQA 2PELA 2ZX4A 3H8XA 1FMD2 3R0RA 1Z7S3 3IM0A 2A6XA 1VBA1 1XSQA 2R043 3RYKA 5BNNA 4QHBA 2CWSA 4GB31 4RD7A 1SBEA 5BNNC 4XFAA 3WD5A 5L19A 1CWPA 4JVAA 1U5YA 2QNKA 3LZZA 1LESA 3H8RA 1SZBA 2PQQA 2HWD1 3GZTB 5DDJ1 3KQ4B 2TBVA 1BK0A 3ES1A 5FY7A 3ZFGB 1NQDA 4YG0A 4CCOA 4DB5A 3ETQA 3H3UA 1V70A 2EIBA 1MQTC 2A6VA 2OIIA 4N43A 1FXZA 1SLIA 2B63L 1AX1A 1QY4A 2HYXA 2IWGB 2PHDA 3Q9OA 4N43C 3I3EA 4V1PA 3AMPA 2BOJA 4N9HA 4GMP1 4JHTA 3T2QA 1QJU3 3DECA 3SC7X 1HRV1 3BCWA 1VR3A 4WZFA 3RZHA 4IE7A 4LO6B 3RZTA 3PU3A 2A6WA 4P5HA 5GLUA 2BV4A 1PVXA 3CO2A 3A0NA 3I2KA 2IXKA 2BEOA 1W8TA 4XYXA 3FUQA 3TEXA 1FNYA 1R64A 5CG9A 2C5DA 5C4XL 2GH2A 1TME1 3WCRA 5HXMA 2ETEA 5JR7B 4LJHA 4BK4A 3EQEA 5LWBA 2LROA 4CU8A 1QOTA 4XUQA 1RXFA 4NRPA 4BIOA 5AVAA 2O1QA 4AEDA 3OGJA 5IK7A 5A1AA 1W6OA 2EAAA 4ZU4A 5CA6A 1UZVA 4AEDC 1FAYA 1LKOA 2D3PA 3H3VM 3KF5A 1W90A 3OYWA 4JGZB 3MW4A 1F4LA 3HIFA 4Y1VA 3VHRA 2CGNA 5HI0A 2WNVA 4URAA 3BPZA 2IC1A 4K3UA 1GQHA 4GWIA 4FPKA 2EXIA 3ECQA 1BQ8A 2AENA 5C70A 2CTVA 3UL2A 4B4PA 2V5YA 1VBA2 1YWKA 4PI2A 1ULFA 2DVGA 4GB32 4QPGB 2XJPA 1GYKA 3HOZL 3H9BA 2RFKB 3AX4A 3B01A 4Q4W1 4NIAA 3QLQA 5FZ3A 2BP6A 5JOXA 3ZG6A 1Y7BA 3PHMA 5DG1A 2JD9A 2QQIA 4JV4A 3WQ7A 2VMFA 1AYN3 2FCTA 1QXJA 4YFWA 4JGYB 2E51A 4YGCA 1QJZA 3NKTA 4CYDA 2A3YA 5ABJC 1WW7A 2JE7A 2BYVE 5HCAA 1W28A 5MF6A 4BOWA 1ULDA 4HMZA 4A3XA 2BW8A 3E97A 3E6DA 3ZXKA 1OFSA 4FFIA 1KQRA 1OLQA 1JZ5A 2HWF1 3M70A 5G05L 4A2UA 4COYA 3HPNA 2WT2A 4EZHA 3POYA 2ZGLA 1E57A 3PIJA 1UYXA 1V9U3 1Q5OA 3LWPB 1YI7A 1P7PA 3O1SA 2C6AA 2OUJA 4QXKA 4QU1A 1PMHX 1AUYA 1FOD3 5JZGB 4QKFA 1KEXA 5LEJA 5MLC3 1OF3A 3H7JA 4NAMA 2YROA 2DFCA 1O5LA 1UAIA 4LUMA 5FYIA 2A6YA 4JTOA 5KC6A 2Q5TA 1DIWA 3FBMA 2CU5A 4G3YC 4OZXA 3TAYA 5C3PA 2RJKA 2YPDA 3FN9A 1L7LA 2BUKA 4CPBA 1UYYA 5DABA 3LPEB 5FXZA 1X82A 5FUNA 5AC91 4YLZA 5FPXA 4CE8A 1AR82 1QDOA 4GKXA 4XJUA 4ZS2A 2R49A 3RVHA 2YZ4A 4AEJA 1I1EA 4E6YA 3RZ6A 5ERLA 1GWMA 4GS7D 1NNQA 2Q0AA 3B9IA 4KWUA 2VECA 1V6LA 3PUAA 2AGSA 1D4M3 1ZBA1 1OA3A 4AF9A 5AFBA 1E5HA 3PKIA 4JADA 4GALA 2C1FA 1W8ZA 2W94A 4I30A 1IPJA 1EPZA 1VRH2 5LK7B 1QQP2 1J3RA 2RM21 3T1MA 3T0BA 2QQVA 5T5PA 3IZOA 4EN9B 1ZBE2 3RI8A 3PZAA 3ETPA 3NNJA 3H42B 1RB9A 2WS91 5FO8B 1CAXA 1UOFA 2JD4A 2YGLA 1BVVA 2VQTA 4IGPA 4QX1A 5K8SA 1UU5A 3GTLL 5LA1A 5IY0A 1NA1B 3OF1A 2D98A 1KFXL 3MIFA 3JZVA 5CEHA 4MH0E 4LE4A 1XRUA 4QQLA 3I2GA 4OUMA 1RUI1 4FPOB 3V56A 4IEOA 4Y22A 1WCUA 2WWUA 1ULCA 1SEFA 2VJXA 4XUPA 3WW2A 4A3ML 5IVVA 1GR3A 5IWFA 4MADA 2VZTA 3FLPA 1W99A 4BXXL 3B08B 3B7MA 1DLLA 2RHPA 3I2FA 4FO9A 4LEJA 2CV6A 5LB6A 5C4WC 4NJ4A 1VBE3 2QTWB 3TNQA 3AMNA 1DGWX 4N8MA 1PO11 2PXJA 3ZSKA 3J7HA 4V2WA 5F3IA 2VTXA 2GN3A 3F95A 1VBB3 3J4UH 3F2ZA 4GJZA 1TWFL 4AEKA 5M0TA 2BERA 3B0AB 1PFWA 2ZGPA 4P00B 3PUSA 4MGQA 3RMYA 4QMAA 2DU1A 3KYWA 4KBZA 1PGW1 3RI9A 1F15A 2ET7A 3JD73 4XUTA 5FZ9A 4X8NA 3I7DA 2UWAA 4CDXA 3QH6A 5BUVA 1CIYA 1CR7A 2D40A 3ZXEA 4QT6A 2GU9A 5DUXA 1IS4A 2ZKNA 2B9UA 3WNKA 4MG2A 3CKHA 5GJ6A 3K7AL 1CAUA 3NL1A 3BIEA 1T2XA 1W6NB 2VUCA 4GWMA 4CVUA 3BUCA 2E32A 1RUG3 1GP4A 1V00A 4RGAA 5E16A 1ZBA2 3GBGA 4LK7A 4C3JL 1VAMA 4XURA 3TWIA 3WOGA 4B1LA 1EV13 3FLRA 3VZNA 4CTEA 5FIXA 1UKGA 4BCUA 4YVWA 1Z7S1 3O1RA 5LBBA 4AK3A 2PYTA 2VU9A 3NNFA 4YVWC 2PN5A 3WNNA 3UKNA 1IQDC 5CZKA 5IYCL 4XJWA 1ZRFA 1POQA 2G19A 4FFGA 4I2OA 1RHI3 3H97A 2VMGA 3J7MA 5A1LA 4LHSA 5HBAA 1YJLA 4FQ4A 4JAGA 4BPZA 2IXHA 1O91A 4FP3A 4E9KA 4F83A 3L2YA 2K2DA 4L11A 2FZ2A 5JSRA 4BM8A 5LA2A 5T54A 5A6YA 2JG9B 2KN9A 4DEVA 1MZFA 4A3EL 1LOCA 5FZCA 4YARA 4N53A 5LRSA 2OZ6A 2R062 2PFWA 1RUOA 1ASJ3 3OUIA 4YW1A 4BLJA 5IYYA 1SQ4A 2JI2A 2DUQA 4N53C 4NE9A 1IZ3A 4E4SA 1QOOA 1W2NA 4JDMA 4NIHA 2JDZA 5M5YL 4PQQA 3ZMNA 4H55A 2V09A 4J25A 1KS5A 5JDBA 2ZA9A 4CCNA 1F2NA 1BK1A 3V0AA 1PK6C 4NUBA 4IE4A 2GALA 1ENQA 1D7PM 2ORXA 4Z2AA 2YB7A 3DYOA 3OYWB 4XJAA 3LEIA 3HKZP 1HN0A 4EWEA 3MIHA 5A6ZA 1DP0A 4IEYA 1N3OA 1WMDA 3U75A 1RJ8A 1RDGA 1KDMA 1C5IA 4JKMA 1IRNA 1RVF1 1VPHA 1YJKA 4XACA 4LBOA 4AQ2A 3TEWA 1SFOL 1L7RA 1PMJX 3I3BA 4K40A 4Q8LA 1WWYA 1DG6A 1Z7S2 1W9FA 2R042 2A68D 1UXZA 3AYEA 3EO6A 2D44A 2Y33A 3KVAA 1YUDA 2GZWA 1UKRA 2ZGOA 2WFF3 2ZOEB 3MUY1 3VBOA 3DUIA 1ALYA 4JCKA 4NWVA 1W8OA 3VBOC 4QX7A 1SLLA 4LBQB 4AHYA 1AYN1 4XAEA 2WZEA 2ZTNA 3SXWA 4R8HA 1UOJA 1U5ZA 1ZZ9A 2HWB3 5D8AB 5EYXA 3THCA 3A21A 2WNUC 2YBPA 1JHNA 1G9BA 2BU9A 3HOUL 4Q29A 2R16A 2L0ZA 1N1VA 4CSWA 1SBFA 3O5SA 2PVXA 4HONA 1QJU2 3I59A 4IV3A 3PVNA 1PHMA 2XWJB 1H2MA 3K77A 1NLQA 3NJVA 4IV3C 2QJVA 1NXD1 3BIWE 4TWTA 5EYYA 4KMQA 1CPMA 2R073 4CCDA 3KT1A 1OFNA 4Y52L 1IKQA 2P17A 5KHKA 3VD9A 1LR5A 4RR3C 4HKOA 2WUHA 2YU2A 4RS5B 3WR0A 3BTYA 3O1TA 1MS3A 4QKDA 1FOD1 1HXS3 3D8CA 5EIOC 1XPWA 1CD3G 5C5TA 1V6OA 3ZXDA 5FZKA 2F17A 1RTVA 1DGRA 1ZVFA 1U12A 2ATFA 4OHWA 3SKJE 5A32A 4F7ZA 3H8UA 3ZXLA 3NQHA 3PURA 1BXHA 3A44A 1D0HA 3P5BA 2ZHNA 2Q4SA 3RDIA 3V64A 4EN8B 1RGSA 1Z0HA 3K4DA 1DDLA 1CAVB 1HRI2 2ZBJA 2VXJA 4Q8KA 5C3SA 1H1AA 2PTMA 2QL0A 8RXNA 2VO5A 4BQ2A 5DMYA 3H9CA 4FPLA 4Y1UA 1JYVA 3T0DA 2XVLA 4XDOA 3O0WA 4XMIA 2P3JA 3I49A 2YC2A 3CL1A 1Q56A 1PX4A 2VNGA 2VGDA 2VC9A 3ILFA 2FDIA 3DPRB 1A6CA 2E6VA 3LFIA 4PLNA 5FMOS 4COVA 3QVDA 1REFA 1VB2A 4DRRA 5DAVA 1C8M3 4YWLA 3LQCA 4BQ5A 1FV3A 5IK5A 1C09A 3P8BA 3TYJA 4A7ZA 4I0AA 1GP5A 5FZBA 3ZFFB 3O1MA 1CQ9A 1S4CA 2V3BB 4COZA 1PZ7A 3ROUA 1MS8A 1AYN2 4YZ5A 1W2OA 1ZZ8A 2OX0A 5ACA2 1RUF3 2VOXA 2W1SA 4ZXEA 1D2QA 3GJAA 3U37A 3W59A 4DY5A 3AXEA 1GZWB 1ULOA 5C9AB 4DXRA 2J1SA 1OWCA 4A3GL 2XVGA 1W3VA 4YM2A 3ACIA 1VIWB 5EWSA 3URFA 4X6QB 2YDEA 3U1XA 3VBRB 1K12A 5ISLA 5JVG1 1SDWA 3HN3A 2M4YA 4XOGA 3ZYRA 4BXFA 1LB2A 2EALA 3ILRA 5FYBA 1GKBA 3PUIA 1CADA 2ARXA 3AZZA 4QAWA 4FSJA 2UWCA 1UN1A 1V9U2 3KCYA 3PVOA 1W2UA 3S7IA 1WLTA 5L7OA 4PBOA 1PIV3 1IQAA 1FOD2 4D69A 3RZJA 3FLTA 1HJGA 1MVEA 1RUD1 3IDCB 1AYM2 5G04L 2ZGMA 3WP4A 1O3QA 3VBUC 1R9TL 1G7YA 1JUIA 1VBB1 1W8WA 4HG6B 2E2HL 4RQPB 4XFCA 3TN91 3ZO0B 1V6MA 3BI3A 1JUHA 3T0AA 1JYXA 4JAEA 3GTOL 5FZDA 1QNYA 4UFIA 4CDWB 1KJRA 3OTFA 2B39A 2WRAA 3S30A 4XBLA 3Q8AA 2WFPA 1YLLA 2RS13 5DDJ3 3JD71 4Q1PA 3NWKA 5EHDA 1ENRA 2Z5WA 3R4DB 4KH9A 4ZU7A 4LR4A 1BE7A 1ACCA 1KD7A 4MVTA 4OMCA 1BKZA 4CZSA 5C33A 3ZFGA 4TLGA 4IUGA 5CNAA 5FKBA 3ZMOA 2W52A 3ZFGC 4DEQA 4EQVA 5FUIA 4DXZA 1DBNA 4COUA 1D4M2 2DSXA 1CPNA 1H8TC 4INDA 2VZQA 2Y6HA 1N47A 1HRV3 1ZRRA 2B46X 4OMDA 1POV0 1SLCA 2UWBA 2QDRA 3JXSA 3M3CA 1EV11 2JA8L 4I0WB 4RHV2 5DAPA 1MEC1 2XPJA 3ILNA 4WFN1 5FYCA 2WWSA 3FHAA 1FATA 3KB5A 5DUVA 4DOUA 3AP4A 4OCTA 5FQ0B 3U14A 3LOIA 4I09A 4IEPA 1OH4A 1NT0A 2MHFA 1TME3 4NHLA 4A3KL 3A0KA 1HKDA 3I4ML 1BFYA 1RHI1 1W0OA 2DFBA 1CJPA 2E26A 3AMHA 3DCQA 3E1F1 4LBKA 5A7SA 5F3CA 1OQDA 1GANA 1AXZA 4GD4A 1ULGA 2Y60A 2BGOA 3D0SA 1I9RA 3VV1A 3VDCA 1UIJA 3FDJA 2ZAHA 4LKEA 1AR61 2E33A 4V2VA 1PFYA 1OD3A 2EXJA 5FO9B 1VBE2 4JGZA 5GZFA 2CHHA 1CN1A 1ASJ1 1DZTA 2MEV2 2VZUA 3E6CC 3VDBA 3WHUA 1S0BA 4JGZC 1SLBA 1X33A 3SEPA 2G9ZA 1XNDA 1JN2P 2IXJA 4HL0A 2APOB 3NKGA 2V0EA 2R0FA 3V0BB 2Y8KA 1STMA 2HJIA 5I0SA 4Q4W3 1AXKA 1W2TA 4DZGA 4JHZA 4QPGA 2ZGKA 4K8RB 4XQ4A 3KT4A 3NV2A 3NV4A 4ASLA 4PJYA 4B4RA 5BV6A 4L97A 2V4VA 4YGBA 1K3IA 2JI3A 2HLEA 4MGTA 3JD72 1TNFA 2XGXA 4A7KA 3BGAA 3ZVXA 4AR2A 2JDMA 4NIGA 2FQPA 2WN3A 5IVYA 5CBLA 4LHNA 2VD7A 1TWCL 1RUJ2 3MSUA 4Y1XA 1YQCA 4L92A 2DCTA 1JU3A 3PO3L 4JGYA 1RUG2 2CNAA 4B7EA 1DU3D 4JGYC 1RUH3 1FI2A 1SDDB 1UPIA 4TXWA 4UYBA 3BKZA 3AFKA 1QGLA 3T08A 5IAXA 1HW5A 1EV12 2X09A 2F6BA 3NMBA 2HWF3 4I3GA 1VZHA 2IVIB 3M4FA 4IQPA 4K6BA 2QQKA 3Q8FA 4XDQA 3JUUA 4XXPA 3HOWL 5KXDA 4ZZ5A 1BYHA 4C1WA 3MFAA 4M4PA 4IEWA 2W0XA 1M06G 1GU3A 2ARCA 2J1AA 4R52A 4AAPA 2UYBA 5FV3A 1RHI2 3CQZL 2R7EB 3ITQA 4UWDA 4A6SA 5FOBB 5FMBA 5JZGA 5KXBA 2P1BA 2V4AA 3VBFC 1IS6A 3BTZA 2VZVA 2HWB1 5JZGC 3W5NA 4CDQA 3SH4A 1QQTA 5DZGA 5FZ4A 4BMBA 4GQ7A 1RMU1 4TZDA 2DF7A 2NYYA 2VG9A 1SLTA 2QQUA 5H9QA 1R0JA 4Z07A 1REDA 4OYUA 1APNA 1YXWA 1JOJA 5A3NA 1NG0A 2UY8A 2P37A 4AFMA 3WZ1A 5J48A 1VMHA 2AEZA 2A3XA 4XFHA 2Q1ZB 1MS9A 3WV6A 5IT6A 1G9CA 2R071 1MS4A 5FYTA 2WJSA 5A80A 5AN9H 1ZNPA 1AL21 1LGCA 1HV0A 5A7OA 1PM7A 2DU0A 2KXLA 5A3TA 1RITA 1HXS1 3GALA 4UW3A 1C4RA 3AZVA 2X05A 3RFRA 4E2QA 1F5JA 1S1AA 4P9WA 4QPWA 1O4YA 2RM23 2VTFA 3KF3A 5L9RA 1CJDA 1NCRB 4TPUA 1QOSA 4GA9A 4XVHA 5F5IA 2C26A 2FMYA 4OI1A 1OA2A 4CP0A 1WGPA 2WS93 4EJRA 1O59A 4NIDA 1K5MC 1AL0G 2YU1A 2ZHMA 1W04A 3JR7A 3E6BA 5DAXA 5T5LA 3S57A 1RDVA 4BQWA 4MXVA 4PDWB 5T5JA 4W4ZA 1JH5A 5LBEA 2CKCA 1R1A3 1JZ4A 3NSTA 1TNRA 2Y6LA 1DGLA 1NA1A 5H9PA 4CCMA 1RUI3 5JUVA 2RMU2 3RNSA 1NA1C 2JIJA 3ZSJA 4V196 2JDNA 3OBRA 2LS6A 4QHOA 3IU3I 4XGHA 4Y20B 5A33B 3AZYA 2I2SA 2WFF2 3K51A 3KYXA 2IVJA 1LHVA 3CJIB 4HANA 4FOVA 4LA2A 3K4ZA 3USUB 4A44A 1MS5A 1Y43B 4EN7B 4HVQA 2AH2A 3E5UA 4GWNA 3LCPA 1QJY3 2J22A 1ODMA 2BWCA 4ATEA 3LGRA 3VKNA 1LHWA 1VB4A 4Y5SA 2YV8A 3MW3A 2YY1A 5L73A 2JB8A 3LDBA 4LK6A 5EPAA 3WW4A 3ABZA 3HWJA 2J1RA 4OHYA 3D3AA 1SG3A 4XIKA 1H1MA 4OI4A 2XQXA 3CBNA 2X53S 2X10A 3NAPB 5FREA 3T1LA 3HJWB 2VY0A 2D43A 3WNXA 4A42A 1CAWA 2D97A 3I2JA 5L7OB 3UJQA 1E5IA 5GLWA 3SLIA 4COWA 3ZN4A 5AI3A 3O1VA 2PSMC 4HPKB 3JBG3 3FWEA 1NE4A 3GBWA 2P3IA 2GC2A 1W6NA 4Q4V3 2BFUL 2NMOA 4WZCA 2P2KA 4Q0VA 2A70A 3PLQA 4ISQA 4E2SA 3U0ZA 3GCXA 4AHXA 4LNVA 4QPYA 1X50A 1PZXA 3HOVL 1NXMA 1XNBA 2J1UA 2GP3A 5I0TA 3ZXAC 1LCLA 3MPSA 3RYGA 1LJ7A 3J9SA 4LORA 2CWMA 3OUJA 1LULA 2VTXJ 1AVBA 1EP0A 2QCSB 5CG8A 5IVCA 3H1YA 5C3RA 4HK9A 2Y26A 4IL7A 2RS11 1VBC3 1X9PA 3ZIWA 1QJX1 4OHZA 3H3ZA 4U2AA 1JOPA 1F35A 4QD2A 1PVC3 2XHNA 2GC3A 4A3JL 4GH4B 2EXKA 2FCUA 4D6RA 2PMZP 2I74A 3Q8EA 1C8M2 3S1QL 1KXGA 1UZYA 2QFEA 5F3GA 5BY5A 3I4IA 3PL0A 2JE9A 5CFDB 4FP2A 2JG9A 4CUGA 5FP4A 2B9VA 4BXSV 4XEZA 1JBCA 1TVGA 3CNAA 3M3OA 1BBT3 2A71A 3HD8B 2HEYF 1RUF2 3MBWA 5FMCA 1MZ5A 1OVSA 2B5HA 3P2AA 3KLSA 2A5ZA 1GV9A 4S2HA 2EICA 2XJVA 4WM7B 1CZVA 1HLCA 3IMNA 1JZ2A 2XUEA 2BGCA 1JZ3A 2JXAA 1UCXA 4NMIA 4QGMA 5KC5A 1DQ5A 3FZ3A 1W6MB 3OPZA 4RA0A 1H30A 1ZYBA 3KV5A 3NNGA 1OLRA 5FY9A 5A7WB 2ZS6B 5LRRA 3WG4A 4CUAA 4LHKA 4XZPA 4AR5A 1BEV3 1ZRIA 4AG4A 4BA6A 1H9PA 4LA3A 2XONA 3KD4A 2QQOA 1US2A 2ERSA 3OB8A 3ALQA 1RWDA 2Z42A 1PIV2 3RSJA 1PX3A 1JW6A 5LATA 2WNVC 1PNFA 1RVF3 3DV8A 3PMEA 1LOEA 3LEMA 2PLV1 1GSLA 2CYFA 4Q4X1 1T9QA 1RUNA 1SCSA 2VOKA 4YZ1A 3WXPA 4QWNA 3PVEA 4BQXA 3I2IA 1GMMA 3BOWA 2FCVA 1LOGA 1NAEA 1X9TA 2DBIA 5EINC 1C57A 1OD5A 4C1XA 4GZ9A 3PIP1 2D5HA 3J8F1 2HWD2 5DDJ2 2WINB 3MIDA 5K4LA 4JRAA 4O65A 2AUSB 4RN5A 3P3PA 3SEEA 3ZKUA 1MACA 1U0AA 3J7NA 3FC0A 2AEYA 5A3WA 4LBQA 4EROA 1T6GC 2Q8CA 3KYYA 2JA7L 2VAUA 1YCIA 4KI5M 4IV1B 5EXOA 5J09A 5D8AA 1LHNA 1O8PA 2ZGSA 3OEBA 3WDUA 3S1RL 3HT2A 1OXCA 1OPMA 4XF1A 4ZHNA 5D8AC 3LOBA 1RUH1 1R0FA 2W92A 1HRV2 4OI0A 1DFQA 3AFGA 4JC1A 4C91A 1O7FA 3GZEA 1S55A 1Q8PA 3KZ4C 3POSA 4XZUG 4E4HA 2BGPA 2BNNA 5KHGA 1SMWA 3GJBA 4YM3A 4Y1YA 3SH5A 3MQKB 4UBGA 3WG3A 4BQ3A 1JZ6A 3INAA 1VMJA 4FTEA 2XWBB 2DVBA 1G8WA 2Q1MA 2Y6FA 5LBCA 5C8CB 1TME2 2VZ3A 1Y4WA 2A1XA 2VCBA 1F4AA 2OYZA 2EIDA 2WWJA 3ZDVA 4ET7A 5F7UA 2O5JD 3PTRB 1GWKA 4RS5A 4BYYA 3MIEA 4MHUA 2WL1A 3OPWA 4JRLA 4POGA 4RS5C 3C7EA 4CDQB 1KJLA 2D3SA 4OHXA 1HX6A 3UGGA 2BE5D 4A4AA 4AQSA 2JA5L 5A3OA 2AYHA 4FAHA 5F37A 2BBVA 3MLJA 5JPNB 1IROA 3NJYA 3U11A 5IP9L 1LKNA 2BNOA 2DTWA 4HXCA 4Q26A 1WBLA 1CAVA 2NYDA 2VZ1A 3O0VA 2NMNA 2R93L 2ARAA 1CIWA 2JECA 5APAA 3UESA 3QQCE 1SMUA 1FYUA 5JIAA 1N3PA 3AP9A 5FYUA 1X7NA 3K2OA 3WUDA 3ZSEA 4OFGA 5FLHA 3DPRA 2NVXL 4Q4W2 3HJYB 1UU4A 1CX1A 4LULA 1MS1A 2GMMA 2Z79A 4PHZA 4A3ZA 4CXXA 5BNOB 2RJLA 5GALA 3IAPA 1LODA 3GTKL 3HQUA 3ZFFA 4BQ1A 4R9BA 4EN6B 4B8CD 5GAEc 1SMMA 3T2TA 3KGZA 3ZFFC 4AI8A 1NY71 3VPBE 1TMF1 4FFFA 4QX2A 5CVRA 5IAVA 4CRQA 1C5HA 1WW6A 4XAAA 3WDTA 3AKPA 4QDSA 1GLHA 5DUWA 1GZWA 5M3ML 1RUH2 1VAKA 1R1A1 3N4MA 1XSRA 1B13A 4R9CA 3ZM8A 5CIRA 3WF3A 3VBHA 2L9LA 2VUDA 4M4RA 4QXBA 2HWF2 3PNAA 3VBRA 2ZGQA 5C44L 1W3XA 5GZCA 4LO7A 2WYFA 2Y0IA 3WP3A 3VBRC 5I91A 2J1VA 1H2LA 3WG1A 2JJ6A 2N7GA 3UT0A 1O4TA 1LGNA 2ERJA 2PAMA 1A8DA 2PQSA 1RUD3 4RSUA 2VQUA 3HVDA 2UURA 2WLPA 2ARBA 1SMVA 4YVSB 1QJY1 4TVMA 4TN7A 3M3YL 3S17L 3JB8A 2FDJA 1F4HA 4W50A 4NR1A 3TN93 5MGNA 5J36A 4AQ6A 4U671 3A4UA 1UZ0A 4RQPA 3VHPA 3HNBM 5A7QA 4OHVA 4RQPC 4C8DA 1DQ1A 4CDWA 1XC6A 1RUE3 1Z78A 1QJFA 3K3OA 4KWKA 5LZ6A 2RDQA 4CDWC 1UMIA 1PFVA 2ZEWA 3D0JA 5AC92 1CAWB 2GC1A 3C3VA 3KHBA 2LALA 4TSVA 4AE2A 3FFQA 4CDXC 2VW0A 3C7HA 4MYEA 2WDBA 2EXHA 4N7UA 3VB9A 4YSFA 3IAQA 1W03A 2RG4A 3CF6E 4LLOA 5CYYA 3RWKX 2FDGA 2O8OA 1FPN3 3JBG1 4Q4V1 4HKWA 1R093 4FOQA 4XXBB 5IFTA 5C3EL 4AYBP 4KG0A 4P14A 3AMMA 3EMRA 2RM22 3WDVA 4IEZA 1MEC3 3LWVB 3P6BA 3QD6A 5KHJA 1O6UA 5JVH1 3MV11 4MO3M 1L7QA 4K21A 2WS92 3ZFEB 4UOJA 1N1YA 4Y4YA 5FKCA 1REEA 4D7SA 4DRVA 4KU7A 4YW7A 3S16L 2LM3A 3TEYA 4FPYA 1UY4A 2R30A 5FQ0A 4URTA 4JAFA 1R1A2 1VBC1 1WUVA 3VBSB 4EWAA 1OI6A 2XBO3 3MLKA 1IW7D 1B35B 1DQ6A 4HT1T 4JKKA 1RUI2 3GTJL 1ST8A 4NO4A 2E63A 3AJZA 1PVC1 3MGUA 1U5IA 2FDFA 3DKWA 3W20A 5KXCA 4QX0A 2YFZA 3ZXJA 4B7KA 3VKLA 1AR63 4FPGA 4OUSA 2J1TA 4FOYA 1MR5A 5DM61 3QCWA 5H9SA 5D2AA 4MGIE 4CDUB 1PO12 5LEKA 1WD4A 3E5XA 1MZ6A 1KDKA 3NJZA 1AR71 4ZS3A 4CEYB 1BBT1 3GXUA 2A6ED 3FBYA 4R4XA 5GZEA 2DVAA 3V0BA 5FY4A 5SV5A 5FYSA 1LEDA 3B93A 2PVEA 2HWE1 4EWDA 1AJKA 2B42B 1PGW2 1G6NA 3C8XA 3KSCA 1LKMA 1LHUA 1W39A 2D6LX 4NWWA 2W47A 4Y26A 5FZOB 3HAXC 1A78A 1AR93 1WW4A 5DG2A 2PPTA 1CGPA 4XCBA 1XYNA 4GULA 3PUHA 3IT8A 5FLIA 1SPPB 1GWLA 1WLWA 3I4NL 2Y34A 2WO1A 4UXAA 1BEV1 5SV8A 3VGIA 3WY6A 2WNOA 1VMFA 3VD5A 4BBRL 1DZRA 5CISA 1J59A 2VE1A 4AVBA 3T2PA 1GFF2 4RL7A 5FY8A 5FZ8A 1O3TA 1WA6X 2PHXA 3CLPA 5BNPB 1R0IA 5CKQA 2X5IB 4FQZA 3GHMA 4M3CF 1ULPA 3GTML 5GAGc 1X36A 3PJQA 3SCFA 1A34A 1SHWB 5FZ7A 1SFPA 1UY1A 5JSOA 4OI2A 1IKPA 3LPFA 1Q8OA 4M3CB 4BDVB 4GMP0 3LDRA 5GAHc 3PUQA 2DWRA 3MIBA 4NOTA 3FMGA 4KQ7A 2HWC1 3MLLA 1VBC2 2M4VA 2GMPA 3IMMA 1S0CA 4NPRA 5I93A 4AEMA 4M0NA 3O12A 4LBJA 4F3JA 5DZFA 3MIGA 1E5SA 4CUBA 4ES8A 2W87A 4GWJA 5LASA 2PAKA 3OUHA 3SISA 3WDXA 2CSGA 3IKWA 4N7IA 4A41A 3I8TA 5L9BA 3WSOA 4NAOA 1RMU3 4P08A 3OD4A 4ZONA 4LO8A 3RZZA 5KXEA 4AI0A 5FJKA 1RYQA 1C3HA 1YO8A 4L99A 3BU0A 5D21A 5HV0A 1V6JA 2WC2A 2GSYA 4Y5Z0 2XB6C 3OGSA 3N9NA 2BPA2 3R05A 4D0QA 2DDUA 4J6GA 2ERFA 4A3LL 2VVEA 4FOWA 3LNLA 3B5LB 5IVEA 2AC1A 5JMCA 2D6OX 3ZYJB 1S24A 2J7MA 5DN2A 4CEWA 4DS0A 3OGRA 3KV4A 3CEWA 1NLRA 4QX3A 2WA3A 4NPLA 3POFA 4AL9A 2VMIA 3M4OL 4LT5A 1AL23 5ABJB 2E7TA 5F3EA 2FD8A 3HMYA 5I0RA 4AXOA 3C7GA 2QUOA 3CZJA 4PF5A 1YNAA 2WNEA 4AVCA 3WP5A 5JXJA 1NCQB 5IVJA 1KS4A 4X8PA 2YC0A 1C1FA 3ZYHA 2DCZA 2P3KA 2ZKLA 4M00A 4Y1ZA 4E2GA 3KM5A 5FZ0A 1NCRA 3MEPA 1BEV2 4IE0A 2NVTL 3I2DA 5GM0A 2YU9L 4BQ4A 3EXUA 1S2KA 2K9ZA 2Y6KA 4GKYA 1HJFA 4Z82A 5A33A 3MHZA 1ODNA 3AJYA 5HXVA 4AVAA 3TEZA 1VALA 3VZMA 2RS31 4XFIA 2WO3A 4PDWA 2BDRA 1RVF2 4CU9A 3AC0A 3DGTA 3H7YA 4D6SA 1I3QL 3S5QA 2H6BA 1TG7A 2LRPA 1JTZX 4D6QA 4RGGA 5JOWA 2QQNA 2C9AA 2V72A 3WDWA 5T50A 3ZDSA 1OLME 1XNAA 2R0HA 3MF6A 3WF2A 2X29A 4FI9A 2CR8A 4Y20A 2OS2A 4AI3A 4RGKA 4I01A 2CDPA 2ZGUA 5GLTA 4FT8A 2VOTA 1VRBA 3CJIA 1EYBA 3H9AA 3JU9A 4NHXA 3USUA 1ZRDA 1ZREA 3S1NL 1FHMA 2AQCA 3CJIC 3IDAA 1URXA 3KQRA 1ONAA 2E53A 4ZY9A 5FZFA 4G9SB 4KNCA 4SLIA 3Q8CA 2JDYA 4C0BA 3MO4A 3D5OA 1OWBA 5KBFA 5HCHA 4FVVA 3WG2A 5C4JL 1OLMA 2E2IL 2RDSA 2Y6JA 4YG3A 3GZUC 2R1BA 3VBHB 3LEGA 4S2DA 4ONUA 1H1IA 3NAPA 4W6WA 2VPVA 1AX2A 2WT0A 1LKPA 4FPCA 3W9AA 3MICA 3NAPC 1N3QA 2HYKA 3SCGA 1IS5A 5FXVA 4IXLA 3MPPG 1GOFA 4MGKE 5F8PA 5B4XA 2I07B 4QB6A 5L7OC 4HPKA 3GGLA 3TRSB 2JENA 4P9LA 5LBFA 5KWRA 4D7YA 5FXWA 2CGPA 2ZZJA 1GZCA 4MX3A 4J1WA 1GQPA 1GOGA 5AFEA 5I8YA 3KYUA 3N9QA 1BMV1 3KS7A 3NVCA 4Q1RA 1PGL1 4UAPA 1W8FA 5FYHA 5J3UA 2QZ3A 1XNTA 3QH7A 4XCAA 4C3HL 2YHJA 2EF6A 4Q27A 1F8VA 2PHLA 4A3BL 2H12A 3SNMA 1QCVA 1WW5A 3G7DA 3LPGA 5F6KA 4GIQA 1RUE1 4CXYA 4IEQA 4U36A 1NUKA 1QJX3 4DUWA 3T3YA 5GADc 3NW4A 2JDKA 1WBFA 3T4HB 2Z4FA 4DXTA 2ILMA 3UGHA 4DUVA 2TNFA 4D8MA 3ZKYA 1FHHA 4GH4A 1JZ8A 2OVUA 5FZIA 4JZRA 1FPN1 2NVYL 4WM8B 2SBAA 3HNYM 1S30A 1WCQA 1R091 1WZXA 3GTQL 2P6HA 1EPWA 3IWZA 5CFDA 3VL8A 1B2JA 3HOXL 4CU7A 4HBNA 4BBSL 4XILA 2XL7A 2ZMKA 2VZPA 4LTAA 5CFDC 3TOJA 1US3A 5IATA 2XOMA 1F9KA 2C0ZA 1R1ZA 5BXXA 1JXNA 3RS6A 5RXNA 4E8CA 5GLZA 2RDRA 4P02B 4LO5B 1G9AA 2P6CA 1QMJA 3T09A 3UJOA 1RYTA 3S14L 2WSVA 2Q8OA 1RINA 4XQDA 3VZKA 4K7JA 1Q8QA 4N9IA 4EV0A 2XBO1 4LUKA 3LWCA 1GNHA 1Y1WL 4WM7A 4GXLA 5LCWL 2OXBA 1ZX5A 3FHQA 3P3NA 2CKAA 4A6OA 1IPKA 1GBGA 4XW3A 1W6MA 2EAKA 5FUPA 5JVVA 1QDCA 5JOYA 5T5OA 1DYOA 1I5ZA 2VL4A 1S2BA 5A7WA 5FPLA 1ZZ7A 3LKJA 2ZEXA 4MXWB 1WLCA 2BVBA 1EUUA 3B00A 2ZPXA 5IYBL 2ZX0A 3AVRA 1ND3B 2RDNA 3FKIL 4XUNA 4YYOA 1RUD2 3K75B 4KU8A 3WP6A 2PLV3 4YGDA 3N7LA 4Q4X3 5IVFA 3THTA 2ZX2A 2A7AA 1BMV2 1VBB2 3TN92 2WIIB 3PO2L 3LSDA 1W8NA 4XC9A 5DXDA 5EZWA 3B02A 2ID4A 2J42A 3M3QA 5HCBA 1DQ4A 2GN7A 1PO23 3J8F3 3RGBA 2QKDA 4YM1A 2GNMA 1RUE2 1F5FA 3HAGA 3ME2A 4QPGC 2WAQP 1RL3A 1TZOA 1BQPA 2DV9A 2WZR3 1AR91 2XHKA 2DTYA 1IOAA 3BN6A 1WKYA 2JB4A 2D5FA 2HEVF 2VW1A 2XLAA 2IUWA 2JA6L 4K1YA 2WLQA 1Y3TA 1AR83 4QPIB 3KGLA 4IV1A 5FDBA 1Y9QA 3VZOA 1XE0A 1YEWA 4XXAA 4LLFA 1PK6B 1R092 3O1PA 1KRIA 4QKNA 2QDNA 4K8FA 5LK5A 1UL9A 1W8UA 4G4FA 4Y5TA 4MUVA 4QM9A 5FYZA 3AZWA 4KWLA 1GUIA 2YC4A 2PHUA 3UKVA 1MEC2 4B1MA 3VKFC 4XIOA 4RYDA 2QZ2A 3CIHA 4LQRA 1NQJA 3BTXA 2VVDA 1VRH3 2VH9A 1RYYA 1IG0A 1AX0A 4QKBA 1W9TA 2CAUA 1GICA 5I8SA 1HIXA 5A3MA 3BALA 3J7LA 4FFHA 1WD3A 1H6YA 1HB2A 1W8HA 5C8CA 3S0MA 3UNPA 3OY8B 1R083 2VXRA 2XBO2 4IETA 4YZ2A 2Z2SB 1IGOA 2GC0A 4MLOA 1MPXA 1XQNA 2YPJA 1VBD1 3DYPA 4CU6A 3RZOL 1S0GA 1G9FA 4Q4Y3 5E8AA 4CDQC 1AR62 5FBJA 4DIQA 3LF7A 4DO0A 4POFA 4LBQD 1DYPA 4M01A 4LKDA 3RJRA 4Q0UA 1ASJ2 2NQYA 5FWJA 1J58A 3THPA 2NLRA 3AKSA 3AYCA 1COV3 1UF2C 2WO7A 4HVOA 3WDYA 5CFCB 1OC1A 4CEWB 2V73A 5CB7A 3GNEA 2H6CA 4FAGA 3ATGA 5IP7L 5EIYB 4HZFA 3WF1A 2BFUS 3H1MA 3ON7A 3ZX7A 2WB1P 5FP3A 2V5DA 1W0PA 4K20A 4QXHA 4PT6A 1HV1A 1LEMA 5BNOA 1SACA 5AI2A 5FYMA 3QBQA 4PCRA 2X8KA 1AR92 3AM2A 4NRMA 4YPJA 5BNOC 2XVKA 1OKQA 4MHRA 1TMF3 2F4PA 2XLFA 4KGQA 1WJVA 5FP7A 2WQZC 2QBXA 4EE2A 2ZHKA 3RZKA 2NZ9A 4UY81 2B7YA 2W5FA 4RR3B 4BMEA 4P9YA 2Y6GA 1OT5A 4OQ9A 4Y24A 4BK5A 2E7QA 4CP1A 2W1WA 4DNYA 5FPUA 3LWOB 1XBFA 2VW2A 3POEA 4CPBD 4EZ4A 4R4ZA 5C8WA 3D6EA 4UBHA 1NXEA 3NFPI 2W3JA 4H7MA 5FFOC 2ES3A 4LO4B 5HV4A 4MGZE 2BOIA 2NM1A 2D7FA 4LBNA 3ZR5A 4HSLA 1RUC1 4IW3A 2J1EA 5F6LB 2YYOA 2AR6A 1FMD1 4Y33A 1VZIA 3N9OA 5FPZA 1XYPA 1JMUB 3LE0A 5J98B 4XHXA 2OW4A 2WAAA 2DCKA 3U78A 4L8QA 1DLCA 2HWB2 5F5CA 3EYPA 4YVSA 4RXNA 1JHJA 3GBFA 1RMU2 4K1ZA 4UFMA 1UOBA 4YVSC 2JX9A 4HFSA 1POV3 5LW9A 1UMZA 3OG2A 2WN2A 3NNMA 5CAZA 2XR4A 1DF0A 4MOAA 5FZMA 4AHWA 4UF0B 5T3NA 2MPFA 1SFNA 3S7EA 3ZYGA 4AI9A 2JEMA 2R063 4NVPA 5IK4A 2R072 3OCPA 4AHZA 1J83A 3HN1A 4KG8A 5A3LA 4ASKA 4JQTA 4IDZA 3PTYA 1AL22 5F9TA 4QQOA 3FX3A 1SLAA 2BWAA 4W6XA 1HXS2 4KL1A 2DURA 3RYRA 4LMFA 1B09A 4AI1A 2VZOA 4JX0A 1OUSA 1NX9A 1IPSA 2Z3RB 1L3JA 3JB4C 4UT5A 1ZRCA 3PIO1 4E4ZA 2G9GA 4YFZA 3QACA 3VKOA 1Q8SA 1P8JA 4O7XA 1I3HA 2BRTA 5AVPA 3ZFEA 1ZA4A 1S0FA 1PM4A 5FTTC 5FWEA 3RMXA 3RG0A 3ZFEC 3W5MA 1WLDA 3WW3A 4BZ4A 1W6PB 2G1MA 3VBSA 5FPAA 1YIFA 2VM9A 2VR4A 3HOYL 2XUMA 3NV1A 4HOOA 1B35A 4XF9A 5FZHA 2EVXA 2YFUA 3VBSC 1C28A 2ZEZA 5H1Sc 1B35C 1NYWA 4ZKTB 1O4ZA 4YW4A 3VDDB 1Q8VA 5FK8A 3SHRA 2A69D 2QQWA 4H2AA 1GQGA 4XTMA 2OQ7A 5J37A 3VD3A 1LOFA 4PIZA 2VULA 3IDEA 2JG9C 3LSEA 4CDUA 1LOFC 1W6QB 1AR73 4BHPA 1UQXA 4Y3OA 4F8AA 2W46A 3BB6A 3AVSA 4CDUC 3KVBA 3OBAA 3S2HL 4IEUA 4CEYA 2P4EA 4XUOA 1JZ7A 1W9YA 2RJ2A 4LXLA 4BY1L 2VNRA 1QIQA 4CEYC 3MZHA 1MQTA 1BRFA 1RJ7A 2TUNA 2ZAAA 4D94A 1K83L 1ENXA 1HB1A 2HWE3 3CQOA 4MSVA 2JDAA 5FZ1A 1H8TB 3OGGA 2OKXA 2QE3A 4S2FA 2ADDA 5LA9A 3AP5A 3EJKA 4L0PA 1TWHL 3LEKA 1VP6A 3JQWA 5EV7A 6RXNA 3LWQB 1U5XA 2O14A 4IERA 5FZOA 3SMHA 3VHOA 1YK4A 1OOPB 3AK0A 3AZXA 5GKAC 2P5BA 2VCMA 3GM8A 1HN1A 3DN7A 1QH7A 1SPPA 5CU1A 3PJYA 5F39A 3DEMA 4M3CE 3W58A 2EIEA 3WNLA 1R0HA 1WCDJ 2WQ4A 3SITA 3O1OA 2IXCA 4NHYA 2A3WA 3K35A 3HOBA 2AYJA 1LOBA 4NROA 2FZ1A 4HN1A 4NHKA 1Y9GA 1UYPA 5BNPA 3OBZA 4ZXKA 1ZRPA 2X5IA 1Y9MA 2QVSB 1FNZA 4ASMB 5BNPC 5JMOA 2X5IC 4J1XA 3A22A 1WCKA 3RZMA 2VUJA 4YW6A 1Q43A 4B8EA 1OH3A 4M3CA 1PO21 1OUXA 3AB0A 2HWC3 1WMEA 2RS12 4QGLA 4S2GA 4IE6A 1QJX2 2C6SA 4HVRA 5FMDA 3R6SA 4NHMA 5DAQA 5C5UA 2WZR1 3OBTA 2HBUA 1W9SA 3MI8A 1HRI3 3ZPYA 3NO8A 3VKMA 3OOXA 4W6YA 1JU4A 5EJZB 4Y4RA 1CZTA 4O9GA 1CAAA 1UYZA 3K46A 2WT1A 3RQ0A 5JXHA 4BQYA 1AR81 4AWDA 4W65A 1JYTA 1ZA7A 3N7MA 4AFAA 2A75A 2DUOA 1ND2B 5L36A 2PHWA 3J7Y1 3DYMA 4AQTA 2JI1A 1LTLA 1W2AX 2ZGNA 1TEIA 3IPVB 4AGGA 4XBQA 2HH9A 5F5AA 4Q0PA 3KV6A 3POIA 2HKXA 1VRH1 1UD1A 1QQP1 4QX5A 3NV3A 1OVPA 3OPTA 5FK7A 2QQLA 5JI9A 3M8LA 3N7JA 5K2ME 1ZBE1 5FP9A 2D3RA 5ACA3 3B69A 5ABJA 1OPOA 3S6PA 3S15L 1R081 1UWWA 2R1DA 3P1IA 5C3QA 5JR2A 2E2JL 4XHBA 3S1ML 1NCQA 2PAEA 4O61A 2B4KA 2GH8A 5A7PA 1O5UA 1GOHA 4OULA 1FX5A 1NCQC 4B4QA 2RDVA 1W9WA 3IN9A 4A3DL 4Q4Y1 5JIUA 2JKBA 4BH9A 3ZSLA 2RS33 3OD0A 4AW7A 5IYDL 2GNBA 5HCFA 3VD7A 1COV1 4EN0A 5FZEA 1RXGA 2PLV2 1AF9A 4Q4X2 2DYCA 3AL6A 4CP9B 3VBFB 4IGQA 4CCEA 2ZZQA 2ET1A 1DVBA 2VQAA 2BJSA 1AYM3 4LOSA 2VNVA 2M6PA 1H0BA 1YIPA 4CUCA 1PO22 3HQXA 3AMQA 3DPRC 3J8F2 4YNIA 4BLIA 2ZJCA 2XJSA 1SBDA 3C7FA 5BPXA 2WZR2 2E31A 5C9AA 4TYSA 1LOAA 4GAZA 1C1LA 1LRHA 4OZOA 5JI7A 5C9AC 5MFZA 1F31A 3ASIA 5ANQA 4PIXA 3ENRA 2CAVA 4LPLA 3HBZA 4AI2A 1XU2A 3H3LA 4XFFA 4BISA 5EJ3A 2NVQL 3VD4A 3N7KA 2YUEA 1ZZCA 2CDOA 4YZ3A 2BNMA 4H3WA 3WW1A 4OQ8A 3GDBA 3IIAA 1UY2A 2AACA 2WQ8A 2XLGA 3VBHC 5J7MA 4BU2A 2SLIA 1B71A 1S0EA 4YWAA 2XJRA 1K5MB 2TEPA 3DKQA 4RHV3 4LE3A 2OZJA 1XE7A 5A7NA 3MYXA 2Y0SP 2FDHA 5FPVA 3S5AA 3AP7A 3MPBA 2JICA 5K0UB 3T30A 4MGYE 1R082 5ANNA 3ZYIB 1W06A 1I6HL 3ZSMA 1R0GA 1H7VA 1S0DA 2ZGTA 4K9SA 2NP0A 3WLUA 2VZRA 4YW5A 2D6NA 2H0BA 4ZU5A 1UXXX 3ZIXA 1YFYA 3WT3A 1LNSA 4QB1A 4Q4Y2 1BLZA 1XOYA 4ARYA 5B4NA 5HPOA 1POV1 1DHKB 1S0IA 3PKJA 2QQPA 4META 3I2OA 2O8QA 2RS53 3AKQA 4X6AL 1CZSA 5KHHA 5C4WB 1COV2 2JG8B 3BYWA 3RYPA 1JODA 4LKSA 1O8SA 2YBSA 2WZPP 1TE1B 3CHXA 3U10A 2R061 4XETA 2MEV3 4A7YA 5DPNA 1Z92B 2WBKA 3I3DA 3MV01 4IE5A 1UW8A 4UW5A 4IESA 4RFT0 1LU2A 4BE3A 3LD8A 1EUTA 3POWA 4WM8A 4E27A 1JYBA 4M0HA 3APBA 3FUOA 4WM8C 1MS0A 3AKTA 1PMIA 5FZ6A 2MS3A 1D4VB 2B45X 1NY72 1TMF2 2DUPA 5FRAA 3ZN6B 4AAXA 1B2OA 2VBDA 5FLML 3WVJA 2YMZA 1CVNA 3D82A 2K46A 4P9XA 2FBEA 2Y0OA 5KR7A 5C71A 2XQRA 5M5XL 4RFRB 2HBTA 5FY5A 1H2KA 3WQ0A 1RUJ3 2PHRA 2ENRA 5E89A 1AHSA 1OURA 2GAUA 1QYBA 5GLVA 3SS2A 3THDA 3WX5A 4AR3A 2RR13 4LHLA 2JE8A 1RC6A 2W95A 2HR5A 1HDKA 3G6JB 4N90A 3LA7A 3UV9A 3DL3A 2BBAA 2C6BA 2LTNA 3I3QA 1EAH3 3M7AA 1WMXA 3NJXA 4ORFA 4WVMB 4XDPA 5IHRA 1VZGA 4CXWA 1M4WA 2HVYC 2LCQA 3T4VA 1UY3A 5FJHA 5BNNB 1JYIA 4AVSA 3AL5A 3ES4A 1OKOA 2D6MA 2E9QA 4MXWA 3VHNA 2EIGA 2R041 4QXCA 3UETA 2NPIA 3ACLA 2W08A 1K45A 4WVWA 4ZN3B 3WNOA 1ND3A 1YQ5A 2HEWF 2JIGA 1QJY2 3POJA 4I0BA 1MVQA 2P34A 1WMFA 1ND3C 3N3HA 4FCAA 1YYNA 5C3OA 2G9FA 1MQTB 4XPVA 5E6HA 1QHDA 5F2SA 4DMIA 2Q8EA 5JLVA 3WUCA 2RV9A 2IFRA 3LFMA 3I3MA 4N43B 1DGRN 4A3CL 2DBNA 3I2HA 5M3FL 3RPQA 1W0NA 1YK5A 2WAOA 2ZIXA 1SCRA 1OQ1A 1PZ9A 4UFHA 1IG3A 1NLSA 7RXNA 1TWGL 2Z3QB 2OQ6A 4X6RB 4CCLA 4XE9A 4TLFA 3ST7A 1D2SA 4B29A 1QJU1 1WA4A 4QDRA 3BOPA 2R6QA 4XMAA 4QM8A 3I54A 5FO7B 2IXLA 4AVTA 5LY1A 1DYKA 2E7AA 1YQ2A 2XL9A 4XABA 4LITA 1XB9A 3OSDA 3JBG2 4Q2FA 4Q4V2 2W68A 2ZACA 4QPIA 4WVZA 5DUUA 1QXRA 5FCCA 1KGYA 1PK6A 1OMIA 4QPIC 3WQBA 2BZDA 3DXUA 1PGSA 3AP6A 4BB3A 2ZMNA 2VUML 2GNDA 4AEDB 4KGGA 4UW6A 3LWRB 4YGEA 2H0VA 1W6OB 3X29B 2MNGA 3H0GL 4UI9L 2WO2A 5I0UA 1IS3A 4DFSA 5E88A 4Q5OA 1A3KA 2WNVB 3ZN5A 4CP2A 5A70A 1UPSA 3BVCA 4LIUA 4MV2A 3OY8A 4QQHA 1HRI1 5FBZA 1QNWA 3NNLA 1PVC2 3VL9A 4B3NA 2JDUA 1VBD3 2A73B 1VE0A 4W8JA 3QOPA 2V0FA 1H4GA 1VJ2A 4LOTA 3TBDA 4XF0A 4PIYA 5F2WA 2RMU3 1CONA 1NE6A 1JOBA 3H1WA 1LHOA 5F32A 1E5RA 2KA3A 4QX8A 3RZGA 4FTBA 1T6BX 2XG3A 3I97A 2R92L 3HEIA 3LDKA 4QHZA 4R9DA 2P3YA 2UYAA 3TNPB 3OJBA 3N35A 4YW2A 5JCTA 3VZLA 1AR72 1DGWA 5CFCA 1BBT2 2XXZA 4ZZ8A 4AYUA 3WWNB 2W2IA 2GMEA 3LIHA 5A3UA 1RB8G 2GDFA 5CFCC 4XJ9A 3VN4A 4CEWC 3K3NA 2WNUA 2HWE2 5ACA1 1X8MA 2PA7A 3A23A 3L9JT 3SKVA 1XE8A 1ULEA 2VMHA 4JDNA 3AXDA 2FDKA 4D3WA 4WBBA 2WSUA 4XF3A 3R4SA 4YW3A 1C8NA 2D6KA 1BHGA 3VZJA 5FYYA 1NKGA 1YV1A 1NCRC 1HB3A 2ZHLA 2UY9A 1YQ6A 3ZYBA 5TSWA 3BPSA 4DXSA 4RR3A 1N1SA 3H8OA 4YG6A 4PF1A 3Q8BA 4OLLA 2PYAA 3B9CA 1V9U1 1Q3EA 3LIGA 4PDWC 3BODA 4Z92B 2D93A 1OBNA 1GNYA 2I45A 3M3EA 1HQWA 2A6HD 1AYM1 2PHTA 1I5PA 1RUC3 2KR2A 2B5ID 2ZX3A 5CADA 2XMLA 1QWRA 1FMD3 2HWC2 1GP6A 3HT1A 3BTAA 1UX6A 1YI9A 2ZXQA 3PU8A 2K2SA 1H8VA 2W1UA 4JTNA 3N9LA 4HSJA 4XFGA 5JXIA 1I6XA 3JQXA 5IK8A 2KM2A 3IB3A 5EFUA 3OGVA 3IBMA 4KBBA 3LAGA 3C7OA 2DCJA 1GZTA 2Q1FA 3NRUA 4QIWP 4XBNA 2AUYA 1X8EA 4AZZA 5CKNA 3RRDA 4I3PA 5FJ8L 4DY3A 1HB4A 1FV2A 1G86A 1UNBA 2DVFA 4H14A 3K48A 2PMWB 1QEXA 3CU7A 1D4M1 2Z69A 3PVBB 4AGVA 4DINB 2ADEA 5FY0A 4CCCA 1EY2A 3MF9A 4UF0A 5BNQA 1JYNA 4AFDA 2D6PA 4AFCA 2QQJA
chains in the Genus database with same CATH topology
3CJXA 4RHV1 4JDOA 1UU6A 3KMHA 4AR6A 1CAXB 1S2ZA 1QU0A 4I02A 4FPHA 1KFUL 2J9UB 3U4XA 4P9JA 5KHIA 3PMSA 3U07A 5T52A 5JWPA 3SCHA 1V6NA 5JOZA 4PLMA 4AR4A 1UIKA 2VUAA 3GZAA 4ME3A 1QXPA 2VQ0A 4IEVA 4QQ2A 1HQLA 4Y22B 4HN0A 4H7LA 3VUOA 4Z8BA 2RS32 1YHFA 2RS51 3FFZA 3H0OA 2VL6A 4ATFA 1DQ2A 2OUHA 1GZ9A 3ELNA 3MW2A 5JPMB 4KWJA 4G6BA 1W6PA 4L9BA 1VBE1 2MEV1 2XJUA 3MFCA 4QGNA 3VBUA 2FHRA 3LA2A 2A6ZA 4PQ9A 3MDPA 4GH4C 2ZGRA 3VDDA 4QQPA 2XKPA 1VBA3 1VLNA 4FTSA 5T55A 3VDDC 4GB33 3WQ1A 1QH6A 1XYOA 2HWD3 1W6QA 1V6KA 3ZXGA 4CDXB 1AZDA 4BIFA 3RJ2X 4FBFA 3GHNA 5DZEA 2DVDA 1XXNA 3JCIA 3BU7A 1J3QA 1FT9A 1CAUB 1RUJ1 1UZZA 2CGOA 5FOJB 3M3IA 5H9RA 2RR11 1H8TA 1ZM1A 3H50A 5FMOL 2LUWA 1RUG1 3WWLA 1OHFA 2XH6A 1WCSA 1EAH1 4GMP3 4WM7C 4FXKB 1OOPA 5MFPA 1OQEA 4YVWB 4FXGB 2B8MA 1OOPC 3J26N 1O3RA 4HETA 3IDBB 2PHFA 3KT7A 1IU5A 3C2UA 2UU8A 4DPNA 4O9EA 3GF6A 5I8TA 1PGL2 1S0JA 3TB0A 4BWOA 3DF0A 4SBVA 1ZZBA 2OA2A 3LB9A 1TQ5A 5DM71 2ZABA 4AGRA 4JQRA 3WINE 2RS52 4Q0SA 4LBLA 4Z1VA 4N53B 4FPEA 5JAXA 2KKDA 3RWNA 2ZCWA 1LENA 1XNKA 3USSA 1SFYA 4R9AA 1IU6A 3O14A 3B94A 3PWFA 1FPN2 3ZXFA 1T9OA 4PLOA 4WV8A 1ODHA 2AZ5A 1DX8A 4IV1C 4C90A 4FPFA 3V0AB 1ND2A 3FE5A 2Y38A 1ND2C 1QF3A 1GNZA 3IPVA 4YM0A 4JAAA 1H4HA 5K9YA 1QQP3 1OA4A 4Z2WA 1BZWA 2WA4A 1ZBE3 1YFWA 3L2HA 4IEXA 3UK9A 1VAVA 2RR12 2VNOA 5C8CC 1HQNA 4XJZA 4HK8A 2DCYA 1EAH2 4LBMA 1PZ8A 4ISRA 2FMDA 5F5QA 1LGBA 4MZUA 3M2MA 2RMU1 1J1TA 3AYDA 4WVVA 4XJ8A 4ITCA 1V6IA 2YXSA 3VBOB 2XJTA 1H9WA 1BJQA 2WFF1 1H2NA 5FAXA 1LU1A 4OVEA 3VBFA 4E4DX 1VCXA 2WNUB 5B2GB 3M1HA 1BCXA 4Q0QA 1LECA 1RIRA 1O3SA 4HLTA 4XTPA 2W39A 3O7OA 4HKLA 1YUZA 3E5QA 1BVP1 4P9GA 2G4IA 3I59B 4IV3B 1G9DA 3SH3A 4ZN1B 1YFXA 1YUXA 4ES9A 2BQPA 3WHTA 3HR9A 5AC93 5F1RA 2XKOA 1ENSA 2BTVC 2RE9A 2M6OA 2IFWA 1JYCA 2GNTA 2ZMLA 2VOVA 1NZCA 4XQWA 2EA7A 2O0OA 2K0GA 5GZDA 2GMGA 1ZBA3 5FLJA 1DQ0A 2R32A 3LA3A 1PNGA 5A32B 1AJOA 1CESA 4L2NA 5BYNA 1KITA 3D4KA 4AFBA 1NOVA 1LTEA 1K5MA 4D7TA 4YWMA 3KYVA 2IZWA 1T9PA 1YRZA 3N36A 3R4UA 5K0UA 1DZQA 2IXIA 2AREA 5K0UC 1J3PA 1VBD2 1A8MA 3KCCA 3AKRA 4YRDA 2VOWA 5E1RA 4XFBA 4QU2A 3J7Z1 1IHMA 4P9IA 3B3QE 5GZGA 1XU1A 1C8M1 4XF4A 5C4WA 3KCXA 4UW4A 2JG8A 2NN8A 3WCSA 3FJSA 4NN0A 5D1IA 1XNCA 2JG8C 1PO13 3FHIB 4AVVA 2CL2A 1RUF1 2CY6A 4PBPA 3O0XA 5K7PA 1CX4A 2Q30A 1D0GA 2WKKA 1J1LA 3UKTA 2BVVA 1N1TA 1AXYA 3EBRA 4C0HA 1YFUA 2OPKA 4DQAA 1OSGA 3ZN6A 1BQ9A 4FPJA 1E8JA 5C6CA 1ZZ6A 2XJQA 2VVFA 4K9FA 5IUQA 2ZX1A 3ZYPA 5JSPA 1PIV1 4YZ4A 5J96B 3AYAA 3GYDA 2YGMA 3VBUB 3VLBB 4WVMA 1MZEA 1RUC2 3EHKA 1NXGA 3V65A 1QKQA 2PELA 2ZX4A 1FMD2 3R0RA 1Z7S3 3IM0A 2A6XA 1VBA1 2R043 3RYKA 5BNNA 4QHBA 2CWSA 4GB31 4RD7A 1SBEA 5BNNC 4XFAA 3WD5A 5L19A 4JVAA 1U5YA 2QNKA 3LZZA 1LESA 2PQQA 2HWD1 3GZTB 5DDJ1 2TBVA 3ES1A 3ZFGB 1NQDA 4YG0A 4DB5A 3ETQA 3H3UA 1V70A 1MQTC 2A6VA 2OIIA 4N43A 1FXZA 1SLIA 1AX1A 1QY4A 2IWGB 2PHDA 3Q9OA 4N43C 4V1PA 3AMPA 4N9HA 4GMP1 1QJU3 1HRV1 3BCWA 1VR3A 4WZFA 4LO6B 3RZTA 2A6WA 4P5HA 5GLUA 3CO2A 1PVXA 3A0NA 2IXKA 2BEOA 4XYXA 3FUQA 1FNYA 5CG9A 2C5DA 2GH2A 1TME1 3WCRA 2ETEA 5JR7B 3EQEA 1QOTA 4BIOA 5AVAA 2O1QA 4AEDA 3OGJA 5IK7A 1W6OA 2EAAA 4ZU4A 5CA6A 4AEDC 1FAYA 1LKOA 2D3PA 3OYWA 4Y1VA 4JGZB 3MW4A 3VHRA 3HIFA 5HI0A 2CGNA 2WNVA 3BPZA 2IC1A 4K3UA 1GQHA 4FPKA 2EXIA 3ECQA 1BQ8A 2AENA 2CTVA 3UL2A 4B4PA 2V5YA 1VBA2 1YWKA 1ULFA 2DVGA 4GB32 4QPGB 2XJPA 1GYKA 3AX4A 3B01A 4Q4W1 3QLQA 5JOXA 3ZG6A 1Y7BA 3PHMA 5DG1A 4JV4A 3WQ7A 1AYN3 4YFWA 1QXJA 4JGYB 2E51A 4YGCA 1QJZA 3NKTA 4CYDA 2A3YA 5ABJC 1WW7A 2JE7A 2BYVE 5HCAA 5MF6A 4BOWA 1ULDA 4HMZA 4A3XA 2BW8A 3E97A 3E6DA 3ZXKA 1OFSA 1KQRA 1OLQA 2HWF1 3M70A 4A2UA 4COYA 2WT2A 3POYA 2ZGLA 1E57A 1Q5OA 1V9U3 1YI7A 2C6AA 2OUJA 4QXKA 1AUYA 1FOD3 5JZGB 5LEJA 5MLC3 3H7JA 2YROA 2DFCA 1O5LA 1UAIA 4LUMA 2A6YA 4JTOA 5KC6A 2Q5TA 1DIWA 3FBMA 4G3YC 3TAYA 4OZXA 2RJKA 2BUKA 3LPEB 1X82A 5AC91 4YLZA 5FPXA 1AR82 1QDOA 4GKXA 4XJUA 4AEJA 2R49A 2YZ4A 1I1EA 4E6YA 3RZ6A 4GS7D 1NNQA 2Q0AA 3B9IA 2VECA 1V6LA 2AGSA 1D4M3 1ZBA1 1OA3A 4AF9A 5AFBA 3PKIA 4JADA 4GALA 2C1FA 4I30A 5LK7B 1IPJA 1EPZA 1VRH2 1QQP2 1J3RA 2RM21 3T1MA 5T5PA 4EN9B 1ZBE2 3RI8A 3PZAA 1RB9A 2WS91 5FO8B 1CAXA 2JD4A 2YGLA 1BVVA 5K8SA 1UU5A 5IY0A 1NA1B 3OF1A 2D98A 1KFXL 3MIFA 3JZVA 4MH0E 4LE4A 1XRUA 4QQLA 4OUMA 1RUI1 4FPOB 3V56A 4IEOA 4Y22A 1ULCA 1SEFA 3WW2A 1GR3A 3FLPA 3B08B 3B7MA 1DLLA 2RHPA 4FO9A 4LEJA 2CV6A 1VBE3 3TNQA 3AMNA 1DGWX 1PO11 2GN3A 1VBB3 3J4UH 4AEKA 3B0AB 2ZGPA 3RMYA 4QMAA 2DU1A 3KYWA 1PGW1 3RI9A 2ET7A 3JD73 4X8NA 3I7DA 2UWAA 4CDXA 3QH6A 5BUVA 1CR7A 2D40A 3ZXEA 4QT6A 2GU9A 5DUXA 1IS4A 2ZKNA 2B9UA 5GJ6A 1CAUA 3NL1A 1W6NB 4GWMA 1RUG3 1V00A 4RGAA 5E16A 1ZBA2 3GBGA 3TWIA 1VAMA 3WOGA 1EV13 3FLRA 3VZNA 4CTEA 1UKGA 4BCUA 4YVWA 1Z7S1 4AK3A 2PYTA 2VU9A 4YVWC 2PN5A 3UKNA 4XJWA 1ZRFA 4I2OA 1RHI3 2VMGA 5HBAA 1YJLA 4FQ4A 4JAGA 4BPZA 2IXHA 1O91A 4FP3A 4E9KA 4F83A 3L2YA 2K2DA 4L11A 2FZ2A 5JSRA 4BM8A 5T54A 2JG9B 2KN9A 1MZFA 1LOCA 5LRSA 4YARA 4N53A 2OZ6A 2R062 2PFWA 1RUOA 1ASJ3 4BLJA 4YW1A 1SQ4A 2JI2A 2DUQA 4N53C 1IZ3A 4E4SA 1QOOA 4JDMA 2JDZA 3ZMNA 4H55A 2V09A 1KS5A 5JDBA 2ZA9A 1F2NA 1BK1A 3V0AA 1PK6C 2GALA 1ENQA 3OYWB 4XJAA 4EWEA 3MIHA 4IEYA 1N3OA 1WMDA 1RJ8A 1RDGA 1KDMA 1C5IA 1IRNA 1RVF1 1YJKA 4LBOA 4AQ2A 4K40A 4Q8LA 1DG6A 1Z7S2 2R042 2A68D 3AYEA 3EO6A 2D44A 1YUDA 2GZWA 1UKRA 2ZGOA 2WFF3 2ZOEB 3VBOA 3DUIA 1ALYA 4JCKA 4NWVA 3VBOC 1SLLA 4LBQB 4AHYA 1AYN1 2ZTNA 3SXWA 4R8HA 2HWB3 1U5ZA 1ZZ9A 5D8AB 5EYXA 2WNUC 1JHNA 1G9BA 4Q29A 2R16A 2L0ZA 1N1VA 1SBFA 3O5SA 2PVXA 1QJU2 3I59A 4IV3A 3PVNA 1PHMA 2XWJB 1H2MA 4IV3C 2QJVA 1NXD1 3BIWE 4TWTA 5EYYA 1CPMA 2R073 3KT1A 1OFNA 5KHKA 1IKQA 2P17A 1LR5A 4RR3C 4HKOA 3WR0A 4RS5B 1MS3A 1FOD1 1HXS3 3D8CA 5EIOC 1CD3G 1V6OA 3ZXDA 1RTVA 1DGRA 1ZVFA 1U12A 2ATFA 4OHWA 5A32A 4F7ZA 3H8UA 3ZXLA 1BXHA 3A44A 1D0HA 2ZHNA 2Q4SA 3RDIA 3V64A 4EN8B 1RGSA 1Z0HA 1DDLA 1CAVB 1HRI2 2ZBJA 4Q8KA 1H1AA 2PTMA 2QL0A 8RXNA 4FPLA 4Y1UA 2XVLA 3O0WA 4XMIA 2P3JA 3CL1A 1Q56A 2VNGA 2VGDA 3ILFA 3DPRB 1A6CA 2E6VA 4PLNA 5FMOS 4COVA 3QVDA 1REFA 1VB2A 4DRRA 1C8M3 4YWLA 1FV3A 5IK5A 1C09A 3P8BA 3TYJA 4A7ZA 4I0AA 3ZFFB 1CQ9A 2V3BB 4COZA 1PZ7A 3ROUA 1MS8A 1AYN2 4YZ5A 1ZZ8A 5ACA2 1RUF3 2VOXA 3W59A 1D2QA 3AXEA 1GZWB 1OWCA 2XVGA 4YM2A 1VIWB 5EWSA 3URFA 4X6QB 2YDEA 3VBRB 5JVG1 1SDWA 2M4YA 4XOGA 3ZYRA 1LB2A 2EALA 3ILRA 1GKBA 1CADA 2ARXA 3AZZA 4FSJA 2UWCA 1UN1A 1V9U2 3KCYA 3PVOA 1W2UA 3S7IA 1WLTA 5L7OA 4PBOA 1PIV3 1IQAA 1FOD2 4D69A 3FLTA 1MVEA 1RUD1 3IDCB 1AYM2 2ZGMA 3WP4A 1O3QA 3VBUC 1G7YA 1JUIA 1VBB1 4RQPB 3TN91 3ZO0B 4XFCA 1V6MA 1JUHA 4JAEA 1QNYA 4CDWB 1KJRA 3OTFA 2B39A 3S30A 4XBLA 2WFPA 1YLLA 2RS13 5DDJ3 3JD71 4Q1PA 3NWKA 1ENRA 2Z5WA 3R4DB 4KH9A 4ZU7A 4LR4A 1BE7A 1KD7A 4MVTA 1BKZA 4CZSA 5C33A 3ZFGA 5CNAA 3ZMOA 2W52A 3ZFGC 4DXZA 1DBNA 4COUA 1D4M2 2DSXA 1CPNA 1H8TC 4INDA 1N47A 1HRV3 1ZRRA 2B46X 1POV0 1SLCA 2UWBA 2QDRA 3M3CA 1EV11 4I0WB 4RHV2 1MEC1 2XPJA 3ILNA 4WFN1 2WWSA 1FATA 3KB5A 5DUVA 4DOUA 3AP4A 5FQ0B 3LOIA 4I09A 4IEPA 2MHFA 1TME3 4NHLA 3A0KA 1HKDA 1RHI1 1BFYA 2DFBA 1W0OA 1CJPA 3AMHA 4LBKA 1OQDA 1GANA 1AXZA 1ULGA 3D0SA 3VV1A 1I9RA 1UIJA 2ZAHA 1AR61 2EXJA 5FO9B 1VBE2 4JGZA 5GZFA 3E6CC 1CN1A 1ASJ1 1DZTA 2MEV2 3WHUA 1S0BA 4JGZC 1SLBA 1X33A 1XNDA 1JN2P 2IXJA 4HL0A 3NKGA 2V0EA 2R0FA 3V0BB 2HJIA 5I0SA 4Q4W3 1AXKA 4DZGA 4QPGA 2ZGKA 4XQ4A 4ASLA 3KT4A 3NV2A 3NV4A 4B4RA 4PJYA 5BV6A 4L97A 4YGBA 2JI3A 3JD72 1TNFA 2XGXA 4A7KA 3ZVXA 2FQPA 5CBLA 4LHNA 1RUJ2 3MSUA 4Y1XA 4L92A 2DCTA 4JGYA 1RUG2 2CNAA 4B7EA 1DU3D 4JGYC 1RUH3 1FI2A 1UPIA 3AFKA 1QGLA 1HW5A 1EV12 2F6BA 2HWF3 4I3GA 1VZHA 3M4FA 4IQPA 4K6BA 4XDQA 3JUUA 4XXPA 5KXDA 1BYHA 4C1WA 3MFAA 4IEWA 2W0XA 1M06G 4R52A 2UYBA 1RHI2 5FOBB 5JZGA 5KXBA 3VBFC 1IS6A 2HWB1 5JZGC 4CDQA 3SH4A 5DZGA 4BMBA 4GQ7A 1RMU1 4TZDA 2DF7A 2NYYA 2VG9A 1SLTA 5H9QA 1R0JA 4Z07A 1REDA 1APNA 1YXWA 1JOJA 1NG0A 2UY8A 2P37A 4AFMA 3WZ1A 5J48A 5IT6A 2A3XA 4XFHA 2Q1ZB 1MS9A 1G9CA 2R071 1MS4A 2WJSA 5AN9H 1ZNPA 1AL21 1LGCA 1HV0A 1PM7A 2DU0A 2KXLA 1RITA 1HXS1 3GALA 4UW3A 1C4RA 3AZVA 4E2QA 1F5JA 1S1AA 4P9WA 1O4YA 2RM23 1CJDA 1NCRB 4TPUA 1QOSA 4GA9A 2FMYA 4OI1A 1OA2A 4CP0A 1WGPA 2WS93 4EJRA 1K5MC 1AL0G 2ZHMA 3E6BA 5T5LA 1RDVA 4MXVA 4PDWB 5T5JA 1JH5A 2CKCA 1R1A3 3NSTA 1TNRA 1DGLA 1NA1A 5H9PA 1RUI3 2RMU2 3RNSA 1NA1C 3ZSJA 4V196 3OBRA 3IU3I 4XGHA 4Y20B 5A33B 3AZYA 2I2SA 2WFF2 3K51A 3KYXA 3CJIB 1LHVA 4HANA 3USUB 4FOVA 4LA2A 5C4WC 1MS5A 1Y43B 4EN7B 4HVQA 2AH2A 3E5UA 4GWNA 3LCPA 1QJY3 2BWCA 4ATEA 3LGRA 3VKNA 1LHWA 1VB4A 2YV8A 3MW3A 2YY1A 5L73A 3WW4A 3HWJA 4OHYA 4XIKA 1H1MA 4OI4A 3T1LA 3NAPB 2X53S 5FREA 2VY0A 2D43A 3WNXA 1CAWA 2D97A 5L7OB 3UJQA 5GLWA 4COWA 3SLIA 3ZN4A 5AI3A 2PSMC 4HPKB 3JBG3 3FWEA 1NE4A 3GBWA 2P3IA 2GC2A 1W6NA 4Q4V3 2BFUL 2NMOA 4WZCA 2P2KA 4Q0VA 2A70A 3PLQA 4ISQA 4E2SA 3U0ZA 4AHXA 4LNVA 4QPYA 1X50A 1NXMA 1XNBA 5I0TA 3ZXAC 1LCLA 3MPSA 3RYGA 1LJ7A 3J9SA 2CWMA 1LULA 1AVBA 1EP0A 2QCSB 5CG8A 3H1YA 4HK9A 2Y26A 4IL7A 2RS11 1VBC3 3ZIWA 1QJX1 4OHZA 3H3ZA 4U2AA 4QD2A 1PVC3 2GC3A 4GH4B 2EXKA 2I74A 1C8M2 1KXGA 1UZYA 2QFEA 5BY5A 3I4IA 2JE9A 5CFDB 4FP2A 2JG9A 4XEZA 1JBCA 3CNAA 3M3OA 1BBT3 2A71A 3HD8B 2HEYF 1RUF2 1MZ5A 2B5HA 3P2AA 3KLSA 2A5ZA 1GV9A 4S2HA 2XJVA 4WM7B 1HLCA 3IMNA 2BGCA 2JXAA 1UCXA 5KC5A 4QGMA 1DQ5A 3FZ3A 1W6MB 3OPZA 4RA0A 1H30A 1ZYBA 1OLRA 3WG4A 2ZS6B 5LRRA 4LHKA 4XZPA 4AR5A 1BEV3 4AG4A 4BA6A 1H9PA 4LA3A 3KD4A 2ERSA 3ALQA 1RWDA 2Z42A 1PIV2 3RSJA 1JW6A 2WNVC 1PNFA 1RVF3 3DV8A 3PMEA 1LOEA 2PLV1 1GSLA 2CYFA 4Q4X1 1T9QA 1RUNA 1SCSA 2VOKA 4YZ1A 3WXPA 3PVEA 3BOWA 1LOGA 5EINC 1C57A 1OD5A 4C1XA 3PIP1 2D5HA 3J8F1 2HWD2 5DDJ2 2WINB 3MIDA 4JRAA 3P3PA 1MACA 1U0AA 3FC0A 4EROA 4LBQA 1T6GC 3KYYA 1YCIA 4IV1B 5EXOA 5J09A 5D8AA 1LHNA 2ZGSA 3WDUA 3HT2A 1OPMA 4XF1A 5D8AC 3LOBA 1RUH1 1R0FA 1HRV2 4OI0A 1DFQA 3AFGA 4JC1A 4C91A 1O7FA 3KZ4C 1S55A 1Q8PA 3POSA 5KHGA 2BNNA 1SMWA 4YM3A 4Y1YA 3SH5A 4UBGA 3WG3A 3INAA 4FTEA 2XWBB 2DVBA 1G8WA 2Q1MA 5C8CB 1TME2 2OYZA 2O5JD 4RS5A 4BYYA 3MIEA 2WL1A 4JRLA 4POGA 4RS5C 4CDQB 1KJLA 2D3SA 4OHXA 1HX6A 2BE5D 4AQSA 4FAHA 2AYHA 2BBVA 3MLJA 5JPNB 1IROA 3U11A 2BNOA 1LKNA 4Q26A 2DTWA 1WBLA 1CAVA 2NYDA 3O0VA 2NMNA 2JECA 1CIWA 3QQCE 1SMUA 1FYUA 5JIAA 1N3PA 3AP9A 3WUDA 1X7NA 3ZSEA 4OFGA 5FLHA 3DPRA 4Q4W2 1UU4A 4LULA 1MS1A 2GMMA 2Z79A 5BNOB 2RJLA 5GALA 1LODA 3ZFFA 4BQ1A 4R9BA 4EN6B 4B8CD 5GAEc 1SMMA 3T2TA 3KGZA 3ZFFC 4AI8A 1NY71 3VPBE 1TMF1 5CVRA 4DY5A 4CRQA 1C5HA 1WW6A 3WDTA 3AKPA 1GLHA 5DUWA 1GZWA 1VAKA 1RUH2 3N4MA 1R1A1 1B13A 4R9CA 5CIRA 3VBHA 2HWF2 3PNAA 3VBRA 2ZGQA 5GZCA 4LO7A 2Y0IA 3WP3A 3VBRC 5I91A 1H2LA 3WG1A 2JJ6A 2N7GA 1O4TA 1LGNA 2ERJA 2PAMA 1A8DA 1RUD3 4RSUA 2UURA 2WLPA 2ARBA 1SMVA 4YVSB 1QJY1 4TVMA 3ZSKA 3JB8A 4NR1A 3TN93 5MGNA 5J36A 4AQ6A 4U671 3A4UA 4RQPA 3VHPA 4OHVA 4RQPC 1DQ1A 4CDWA 1RUE3 1Z78A 4KWKA 4CDWC 3D0JA 5AC92 1CAWB 2GC1A 3C3VA 2LALA 4TSVA 4AE2A 3FFQA 4CDXC 2VW0A 4MYEA 4N7UA 2EXHA 4YSFA 3CF6E 4LLOA 2O8OA 1FPN3 3JBG1 4Q4V1 4HKWA 1R093 4FOQA 4XXBB 4KG0A 4P14A 3AMMA 2RM22 3WDVA 4IEZA 1MEC3 5KHJA 3QD6A 5JVH1 4K21A 2WS92 3ZFEB 4D7SA 1N1YA 4Y4YA 1REEA 4DRVA 4KU7A 2LM3A 4FPYA 2R30A 5FQ0A 4URTA 4JAFA 1R1A2 1VBC1 1WUVA 3VBSB 4EWAA 1OI6A 2XBO3 3MLKA 1IW7D 1B35B 1DQ6A 4HT1T 1RUI2 4NO4A 2E63A 3AJZA 1PVC1 3MGUA 1U5IA 3DKWA 5KXCA 3ZXJA 4B7KA 3VKLA 1AR63 4FPGA 4OUSA 4FOYA 1MR5A 5DM61 3QCWA 5H9SA 4MGIE 4CDUB 1PO12 5LEKA 1WD4A 3E5XA 1MZ6A 1KDKA 3NJZA 1AR71 4CEYB 1BBT1 2A6ED 3FBYA 4R4XA 5GZEA 2DVAA 3V0BA 5SV5A 1LEDA 3B93A 2PVEA 2HWE1 4EWDA 1AJKA 2B42B 1PGW2 1G6NA 3KSCA 1LKMA 1LHUA 1W39A