4AI0A

Flo5a showing a heptanuclear gadolinium cluster on its surface after 9 min of soaking
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
258
structure length
258
Chain Sequence
GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLOCCULATION PROTEIN FLO5
publication title Complex Gadolinium-Oxo Clusters Formed Along Concave Protein Surfaces.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell adhesion
total genus 56
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4ai0A02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ai0A01
4COZA 4AI0A 4CP2A 2XJRA 4AFAA 4AI3A 4AHZA 4D3WA 4LHKA 4AHWA 4LHLA 4COWA 4COVA 2XJQA 4ASLA 2XJTA 2XJPA 4AI1A 4AHXA 4CP0A 4AHYA 5A3LA 5A3MA 4A3XA 4CP1A 4AI2A 4AFCA 4AFBA 4COUA 4LHNA 2XJSA 2XJUA 2XJVA 4AF9A 4COYA 4GQ7A
chains in the Genus database with same CATH superfamily
4P9IA 1BE7A 4PDWB 1YCIA 2DVFA 1BBT2 4HVOA 1W3VA 4AI3A 4LK6A 5FZIA 3VBOB 3HQXA 2JKBA 4Y1ZA 3MPPG 1DVBA 2ZHLA 3ON7A 5FZMA 5FZDA 3ZDVA 5EXOA 4XUNA 3LA3A 3KZ4C 4FAGA 1QYBA 3GTLL 2VZ3A 2UYBA 2YGMA 4ET7A 3RZGA 3HOYL 5CA6A 3VKOA 3WP5A 2DF7A 4QHZA 3TAYA 2FZ1A 3W5NA 3T2OA 1QQP3 1EUUA 2VBDA 1W03A 1QQP1 4JAAA 3R4DB 3JXSA 2E6VA 1RINA 1UD1A 4GAZA 1STMA 4OHXA 5FZOA 5LBFA 1US2A 2BFUL 1AR93 3PUQA 2A69D 2CDOA 5FLML 1AR91 1B09A 2JIGA 3N9LA 1RUJ3 1RVF2 4R8HA 2QVSB 3SNMA 4YSFA 2XJUA 2V5DA 1YRZA 3GHMA 4A3DL 3WINE 4ZXEA 1NE4A 1UU6A 1W3XA 1UYPA 2WKKA 1DCSA 4CEYA 4MH0E 4NO4A 3CNAA 4JDOA 2Y38A 4Y22A 5DAVA 4R52A 4E2QA 4I02A 4XVHA 2PAMA 3R4SA 4A3EL 1C8M3 2AGSA 1C8M1 1DF0A 1DQ4A 1ZBE3 1LOFC 4AVTA 3FX3A 1US3A 3MW2A 2YB7A 4N53C 1ZBE1 4YZ5A 2AQCA 3ITQA 4FPGA 4DUXA 3WV6A 4ZN1B 4AEMA 5APAA 2M6PA 2XWJB 1OKQA 4BJ0A 1K45A 4MZUA 4QWNA 4Y22B 3T2PA 4OI2A 5IFPA 3O1UA 2N7GA 1FNYA 2VOXA 1B71A 3M3YL 2RMU3 3M2MA 5IVCA 4Y4YA 1W6PB 5DM61 5FPUA 2TEPA 1CD3G 4DY3A 1CGPA 4AK3A 5HI0A 2JDKA 1WBLA 4Y3OA 3IN9A 4BBSL 4UOJA 4CP2A 4E4HA 3SC7X 2D3RA 3VZKA 1DZQA 2KKDA 5EPAA 2PHUA 4AZZA 3BU0A 1JYIA 1BBT3 3K7AL 5JXIA 1BBT1 4XFGA 4WV8A 1PGSA 2E53A 4LTAA 1RB9A 5LCWL 1TG7A 3ABZA 3SLIA 2IXKA 1RWDA 1JZ4A 2ARXA 3LE0A 5FCCA 5EJZB 4XHBA 2A3YA 4BQWA 2B8MA 3PMSA 2BWCA 4C3HL 5KHHA 5D2AA 1COV2 1UF2C 4UW3A 3CQZL 3GTGL 2RE9A 1SFNA 1ULPA 1UMZA 3HD8B 2UY8A 4JRLA 4V2WA 2C9KA 3ZG6A 1RVF3 4E4DX 1S0JA 3J7Y1 1PFUA 1IS5A 1BHGA 1RVF1 2PELA 2PHXA 3OPWA 4IEQA 5K0UA 3U14A 4OHYA 1OPOA 3DYOA 4MGKE 2Z3QB 3VBFC 4EN8B 4K1YA 2UYAA 1YQCA 3ACFA 4L11A 4A45A 1DYKA 2ARCA 2JX9A 4UAPA 2RS12 1PMJX 4R9DA 2WAAA 4Z82A 4BISA 4IE6A 4F3JA 5K0UB 4A3XA 1GWKA 1U5XA 2YROA 5MF6A 4BMEA 4RFT0 1IZ3A 1LOAA 2YXSA 5FXWA 3AP6A 4BYYA 5C3QA 3HOXL 1DIWA 5IHRA 2RDVA 2A73B 2Q1MA 3MUZ1 3QCWA 1XOYA 4IV1C 4S2HA 1LU1A 4LHSA 4D0QA 3P1IA 4FTEA 3K51A 3RDIA 1H6XA 2WNVC 4XBLA 4N7UA 1S24A 1N3OA 3H3LA 3AP4A 3ZN4A 4ME3A 1IPSA 2HYXA 2VUAA 2H6CA 3OJBA 4I3PA 4YVWC 2W92A 3AL6A 3INAA 3N9MA 2GC1A 4Q4W2 3H8RA 5ACA3 4K20A 2A75A 3T0BA 5CVRA 2QDRA 5FZFA 2W9XA 3OGJA 3VHNA 2NN8A 1OUXA 4JAEA 4IE0A 3VL9A 3GZUC 3KV9A 4LUKA 3KYXA 3LCPA 1UOBA 3PVEA 3GTOL 3LDKA 2D6LX 1CAVB 1H7VA 1W8FA 1D2QA 1GMMA 1O91A 3KVAA 1CAWA 5F2SA 3ZVXA 2ZACA 4QKNA 2HWB2 3Q8BA 4XJAA 1IPKA 2UWBA 3D6EA 3CQOA 5ISLA 4CE8A 4HPKB 1AL0G 3WNMA 4LO7A 3C7FA 4CDQC 4XBQA 2RJ2A 2ID4A 3QH6A 2Y0IA 3T08A 1COV1 2DCZA 3D0SA 5GZGA 1W04A 5J3UA 2OUHA 2JENA 4EN7B 3U11A 3H42B 1PNFA 5FMOS 5C4WC 4UFLA 5J37A 1LOBA 2VNOA 1TEIA 3ZXDA 1VR3A 1VBB2 2G4IA 3I2KA 3OEAA 3A21A 5FZ6A 2RS13 4WVMA 2WFF3 4L9BA 4CEWC 2O5JD 2RS11 2VZUA 2HLEA 4WM7A 3WCSA 4N53A 5BNQA 4QKFA 5FO8B 3O14A 3WF4A 1VB4A 5HCBA 5E1RA 5FYZA 1I6XA 3T0AA 2B63L 1F15A 1VBA2 2XJSA 1OSGA 2CWMA 3AK0A 4WVMB 1I9RA 3CU7A 3SCGA 1BK1A 4XF4A 1KDMA 3RS6A 2D5HA 1ZA7A 4WM7B 3RJ2X 3POFA 3KYUA 1IQDC 4B8CD 1C5HA 4FPKA 2ZMLA 3SEPA 3A44A 3WT3A 3GTPL 1WMEA 5FP8A 2NP0A 4C90A 4CUAA 2DWRA 4LR4A 2QFEA 1O8SA 1BFYA 3ACHA 1IHMA 2DU0A 3B9IA 3C7OA 4CCJA 2RR12 1UOJA 1YNAA 2BDRA 4Q4W3 2ZGLA 3NNMA 4NIDA 4Y52L 3D5OA 1AX1A 2E26A 2ZGKA 2R7EB 2VO5A 4P5HA 1SFOL 2YV8A 4Q4W1 5A3MA 5LRSA 1O3TA 1H9PA 5DPNA 5ABJC 2Y64A 2ZX4A 3AM2A 2CR8A 3CJXA 3E6BA 5FDBA 4JHZA 1BCXA 5HCHA 1G9DA 2CWSA 1D0HA 1AX0A 4UI9L 5EYXA 5EZWA 2UWAA 1SLCA 2WINB 3AL5A 3U07A 2NPIA 2W91A 3VZJA 2BUKA 1YI9A 3WNKA 1H2LA 1KD7A 4U671 2HWB3 4PIZA 1WA6X 5IK5A 4Y5SA 4YM1A 3RZZA 1MS0A 3VBSC 2NM1A 3LOIA 1QKQA 1ST8A 2WC2A 3AP7A 2YHJA 4M3CE 1CIYA 3VBFA 3ZMNA 1LHWA 2CGOA 4IE5A 2OPWA 1ZBA1 1BEV2 3HJRA 3K35A 1S1AA 1QOOA 3I3QA 5IATA 2KM2A 5FXVA 3PL0A 1VBB3 3S1QL 2C0ZA 4LKSA 1VBB1 4A93L 3PUSA 3O12A 1Q5OA 1Q8SA 1SLTA 2F4LA 5FBZA 4LBJA 1WMFA 2QQKA 5A7PA 5GAGc 1HLCA 4I2OA 2D40A 1LGNA 4RA0A 4XABA 4K8RB 3F95A 2UURA 1Q56A 2SLIA 2VZSA 4IV1A 5LBEA 3VGIA 1VBA3 2E63A 2XVLA 4BIOA 4HZFA 1VBA1 4ZU7A 5LEKA 3KF5A 3PIP1 3B93A 3MPBA 2QJVA 1B35A 1ZZ6A 4YVWA 4BQ3A 2Q1ZB 1JYNA 3E97A 3AKQA 1T9QA 2E2JL 2XKOA 1TWAL 4W6YA 1EYBA 4U36A 3NAPB 4Y1UA 1ULDA 1UX7A 5AVPA 2DDUA 3EYPA 4NWWA 1Q8PA 1W6NA 3MBWA 4I0BA 4A6OA 2B45X 5C8WA 2VQUA 1B35B 2RR11 2ZGMA 3ASIA 4FT8A 3WDYA 5JUVA 4D7SA 4ZS3A 4LO8A 1UCXA 3ACGA 1CZSA 1U5ZA 2CTVA 1QY4A 3H8UA 3M3CA 4MGIE 1REFA 3VD3A 1WLTA 3WUCA 1W6NB 5A6ZA 4AGVA 2JG8B 3UKVA 3BKZA 4RR3A 4LA2A 2ZMNA 5GLUA 3ZYRA 3VBUC 4FP3A 2GAUA 1JS9A 4RS5A 1TMF2 4CDQA 1R0HA 1UXZA 1MR5A 2JJ6A 2J1AA 5EINC 4FPHA 4XF1A 5DUWA 4ZKTB 1OI6A 4KU8A 2GC2A 2GALA 1YFUA 4JGZA 2NVQL 1CN1A 1D2SA 4RR3B 2VMDA 4URTA 3NMBA 2HKXA 5C4WA 1HDKA 4AW7A 5FQ0A 5A80A 3KS7A 3S5QA 4RS5B 3IWZA 2ENRA 1O4YA 5DN2A 2I74A 1BEV3 4LK7A 5FZHA 5LEJA 3N4MA 3LF7A 1BEV1 1SPPA 1POV0 3K3NA 1WCUA 4QM9A 5F3EA 4JGZB 4CEWA 4XAAA 2XUEA 2E7TA 5FBJA 2BERA 2JDMA 1GU3A 4YWMA 3QBQA 2BWAA 3B08B 1W8WA 2D5FA 3LSEA 4XQ4A 3USSA 2DVDA 4WZCA 1SPPB 2VY0A 1VBD3 3I54A 3NRUA 1XE7A 4GZ9A 4LHKA 1W9FA 3H0GL 4Q8LA 4ZPIA 3GHNA 4QPIC 1NA1C 3GCXA 2Y34A 1YIFA 2E51A 5FY8A 4Q0QA 1SCSA 1M06G 3MW3A 1J83A 1BXHA 3LA2A 3J8F2 4YWAA 2MS3A 4FPCA 2WN3A 4D6QA 1XB9A 1GR3A 4ES8A 4PQQA 1LTLA 1F5JA 1RJ7A 1XNDA 1C09A 5ABJA 1ZA4A 5FLIA 5C5TA 3PIO1 1YI7A 2X5IB 3P8BA 3E1F1 4RN5A 3OGRA 4COYA 4GH4B 2YC0A 1LHOA 1JYBA 3WG1A 2P1BA 1NXGA 1WZXA 1GP6A 4DEQA 3D4KA 2O1QA 4IGOA 5CB7A 1R092 2GNTA 4LBLA 1UKGA 4MXWA 3ZXAC 5B2GB 4KBZA 3VBSA 4JDMA 1TMF3 1OA4A 2R16A 5DZEA 1TMF1 4GJYA 5GLVA 5JVG1 1FATA 1Z7S2 2VU9A 3DPRC 1SDWA 3RJRA 5I91A 2WSVA 3IPVB 3LB9A 3B94A 3I3EA 3NNJA 3MIEA 4Q1PA 3L2HA 4CPBA 5FYCA 1S30A 2NYYA 2Y6KA 5H1Sc 5C70A 3MIGA 3PLQA 4QMAA 3FHAA 1RITA 2R0FA 2A6YA 2XKPA 3CBNA 4IV3B 2B9VA 4LITA 1HQNA 4XW3A 4AQ6A 4ZXKA 5SV8A 4AVAA 1H2NA 4XFHA 2RHPA 5M3ML 3VLBB 2XLFA 4XFAA 5G05L 2GDFA 2Q4SA 4AHWA 2ZEZA 5GADc 3N7MA 3KHCA 3MHZA 2XMLA 2BOIA 4GS7D 5CFCC 1DGWA 1REEA 3HNYM 1OWCA 2YMZA 1GQHA 1QOSA 5KHKA 1SMVA 1ZYBA 4MADA 4NRQA 4GULA 3OF1A 5K8SA 3KD4A 2D3SA 2R1DA 3WQ7A 4EZ4A 3N7KA 4AAPA 2ZEXA 4A2UA 4BQYA 3OTFA 1DGRN 2G9GA 4DIQA 1GKBA 3BPSA 5MFPA 3J8F3 4OUEA 3J8F1 5JLVA 1EV12 2EIDA 4KQ7A 5B4NA 5I0DA 2VNGA 1JBCA 2D43A 5LASA 1V6OA 3VBRA 4AFDA 4CDWC 1K5MC 4CCLA 2HR5A 2ARAA 2QBXA 2JB4A 2QQPA 3Q8EA 2OS2A 1QJY2 2QCSB 3QACA 2P17A 2D98A 2DCKA 2WNEA 3GTJL 1HQLA 4A3JL 3ZFGC 3VBUA 5IK4A 4BQ1A 1WD3A 4XQWA 4YM0A 3VBRB 3WY6A 1R093 3N9PA 2K46A 3ZPYA 1RDVA 1TWHL 1R091 2Y0SP 2L9LA 1RYYA 3KMHA 3WQBA 4CA9A 4MGZE 1AJKA 1ND2A 3BPZA 4BOWA 1Z7S3 3QD6A 2MHFA 1CQ9A 2AZ5A 2Y26A 4C3JL 1V6JA 1Z7S1 5B4XA 3Q9OA 2VZOA 5GAHc 4MVTA 4QU2A 1W0OA 3VL8A 5KHGA 1VBE2 1IGOA 3MLKA 1I50L 1G9BA 3PMEA 5DM71 3IMMA 4B7KA 4WFN1 1ND2B 3OGVA 1N3QA 3BU7A 5L36A 5I0SA 4AR6A 5J36A 1BZWA 1WJVA 1O5LA 2Q30A 1JW6A 3I49A 1S0GA 4BHPA 3S1NL 1JYCA 5K2ME 3ZKUA 3ZIWA 3FBMA 2ZKNA 1HIXA 2ZGRA 3LIHA 1S4CA 4M3CA 4MSVA 1EPZA 1ULCA 2V3BB 1H2KA 3BCWA 1DP0A 2B5ID 4W6XA 1F2NA 2I2SA 3P5BA 5DZFA 3SKVA 5FYSA 1QH6A 1HB2A 2ES3A 3LAGA 2K2SA 2BW8A 2K9ZA 2VXRA 1NA1A 4QPIA 5GJ6A 2WFPA 5GLWA 3LDRA 5BUVA 2EXHA 2Z4FA 2A6ZA 3S6PA 2E7AA 4COUA 4L99A 4E8DA 2WAQP 5JCTA 2W46A 3D0JA 5C6CA 4DRVA 3WVJA 3V0AA 2B7YA 2BRTA 1YIPA 1EV13 4FFGA 4QPIB 1XNBA 1EV11 1K42A 4AE2A 1RDGA 1JOBA 1N1VA 4COWA 4A3ML 5AN9H 5I0UA 2PHTA 3HIFA 3RG0A 2GNBA 2VMGA 2RM21 2RS32 5FR3A 3RGBA 1QJY1 2WLQA 1QU0A 4QX7A 3ZYGA 3BIEA 4LO6B 1DQ5A 3C7EA 5L19A 3RYPA 4ASKA 2IXIA 4E2GA 1VMFA 1TQ5A 3DPRA 2VUJA 4QDRA 3HOZL 5IP7L 4CSWA 1KDKA 2WO3A 4WBBA 4FBFA 2CKAA 1UO9A 3NFPI 2C5DA 2B42B 2OYZA 5GZCA 4ZY9A 1GWLA 2WLPA 1VBE3 3PIGA 1BKZA 3TEYA 2KN9A 4C0HA 4E2SA 1VBE1 1OURA 2WZR2 5EV7A 2A68D 4AHZA 2GNDA 4UT5A 4BQXA 5CKQA 1IOAA 4M4PA 1I1EA 4A3FL 2HVYC 2WT1A 3ZOIA 2AC1A 1HB4A 2OA2A 1LGCA 1QXRA 2HYKA 1OA3A 2XHNA 3VDCA 4CVUA 5CFCA 5FXZA 3S15L 2ZAAA 2EXJA 3LDBA 4FOQA 5GZFA 5L7OA 4Y1YA 1RMU2 4FQZA 1ND3B 2QDNA 1OQDA 5A33B 4NPLA 1OD3A 5C71A 3AMQA 2ZPXA 3QH7A 5F5QA 3WW3A 3I4ML 4D6SA 1NNQA 2BBAA 3GTQL 1V6MA 3WQ1A 1XYOA 1P8JA 2VECA 1ZX5A 2W08A 1NYWA 1CJPA 1H1IA 4GMP3 3VDDC 5L7OB 3RZHA 4OI0A 1V6IA 4GMP1 5DUUA 5C8CC 5C9AB 5A7NA 2NVXL 2OXBA 3VD9A 1LR5A 2LW8A 3S57A 1IU6A 1K5MA 4QHOA 4QM8A 5MFZA 1SBFA 4Q4V2 4AI1A 5H9QA 1OH4A 2C26A 3J7HA 1VPHA 3MW4A 4QIWP 2VD7A 2YG0A 2RG4A 4RFRB 1IKPA 2ZGNA 1B13A 3O1SA 2RS33 5A3OA 2Q8OA 1KXGA 2XVKA 3KF3A 5L9VA 4IEVA 1K5MB 1RUNA 4JKLA 1DHKB 4FVVA 3G7DA 4AEDC 2B9UA 2PMZP 1MVQA 4OULA 3KHBA 2PN5A 4NWVA 3WF3A 4HFSA 1GICA 4Q4Y1 4XGHA 5FQ0B 4E6YA 1GZWA 3MDPA 1BK0A 4YZ2A 4P9JA 4SBVA 1TNRA 4QX3A 2FDKA 2ZX1A 3WSOA 4XXBB 3S30A 4NIAA 5IVBA 3NKGA 1QWRA 5K7PA 5FOBB 4XAEA 4LIUA 1UKRA 2JD4A 5CNAA 3PVOA 3R4UA 3UT0A 1GZWB 2WZR3 1JMUB 2VXJA 2I07B 4LBMA 4YLZA 5FZBA 3ZN5A 2WZR1 4OVEA 4META 5IW0A 3ZYFA 4ISQA 4I0AA 5FUPA 1PMIA 4QD2A 1F5FA 3GYDA 5JI7A 3K77A 4YZ1A 3I8TA 2BNMA 3M3EA 5BNPB 4MGTA 1VBC2 4P9XA 2EIBA 1OD5A 1XPWA 2JG9B 4R9CA 3VZNA 2DUOA 5GAEc 2YZ4A 4LBQD 2FDIA 3ETPA 4BPZA 2NMNA 2VZQA 3IKWA 3AB0A 1RMU3 2WNUB 1JZ7A 2P2KA 4QQ2A 1F31A 1RMU1 5JXJA 1BMV2 1XE0A 2WA4A 4G6BA 2B5HA 4GKXA 3VHRA 5BNOC 2IC1A 3VBHA 3QQCE 4B1MA 1LOCA 4GQ7A 3E5UA 3R0RA 1HB1A 4L0PA 2PXJA 2GMGA 4N43B 4CXWA 4K21A 4A7KA 4P14A 1MVEA 3NVCA 4ASLA 3RZJA 1OQ1A 3NQHA 3RNSA 4LBQA 3DN7A 3ZYBA 3O0WA 3VBHB 5C3SA 1OWBA 3NJYA 4GKYA 1B2OA 1Y4WA 4LUMA 4FO9A 4M01A 2QNKA 4BE3A 3I2OA 2VTXJ 4Q4V3 3WDVA 3L2YA 1SMWA 3HKZP 4Q4V1 3DXTA 3ZM8A 2R92L 1PK6C 2XL7A 3THCA 2J42A 4CCKA 4HVQA 3Q8CA 3EJKA 3UESA 3PTRB 4GD4A 4LBQB 1QMJA 3C8XA 3NO8A 2BE5D 2DYCA 4OMDA 4FFHA 1YUDA 2PHLA 3KLSA 4OLLA 3UYJA 3CJIA 5FKBA 2XOMA 3SISA 1AYN2 3WP6A 3ST7A 4A3BL 1ZM1A 5F5AA 3M3OA 5FLHA 3WUDA 4EYUA 2VOTA 2K0GA 2HWD2 3NL1A 2BGPA 4X6QB 4IUGA 3UL2A 4NIHA 2A1XA 3AYAA 5FOJB 3T09A 5LA2A 3ZLIA 2VMCA 3OOXA 3CJIB 1PO22 2VZ1A 3MI8A 2KA3A 5C3OA 3FN9A 3LZZA 1AF9A 2GZWA 2WABA 5CIRA 2OW4A 4OFGA 3PIJA 1F9KA 2IXJA 3R6SA 4FI9A 3UETA 3V0BA 1W99A 3AXEA 2WSUA 3E6CC 3AJYA 5DUXA 4HXCA 3NV2A 1VBC3 1Y3TA 4UWDA 3POSA 1QH7A 2HEYF 1VBC1 3HN3A 4NR1A 4PLNA 1IU5A 5C33A 4UFIA 5CISA 4LHNA 3HBKA 2EIGA 1JYXA 2PVXA 2H0VA 3V0BB 1W8OA 4HG6B 3S7IA 3VDDA 1J59A 1W39A 4S2DA 1BMV1 4HANA 2ZBJA 5C8CA 4FOWA 3GM8A 1KITA 3H1WA 3LWOB 2PQSA 2YBSA 1ZZCA 1LHVA 4FSJA 2ZEYA 4TYSA 2E2HL 4CU6A 5FO9B 3JBG2 4D7TA 2XBO1 1KS5A 2GMMA 3M7AA 1OLMA 2QQLA 3BTZA 3K4DA 4XHXA 5DDJ2 1C3HA 5FJKA 3U78A 1H0BA 1PO12 2BZDA 4N8MA 3AFKA 3VHOA 5FK7A 1QDCA 2CHHA 3NJXA 4C3IL 1R0GA 1YEWA 3EBRA 1OHFA 5F6KA 3M70A 4XUQA 1E57A 3MGUA 2QQWA 4IGPA 1JI6A 2Z2SB 1RTVA 5E89A 5FZOB 1M4WA 2VC9A 3KV4A 1ONAA 3DXUA 1AYN3 3RSJA 1O3SA 2P37A 4CU7A 4UW6A 1AYN1 1W0NA 2HWD3 4AYUA 2GMEA 5BPXA 2HWD1 2WJSA 4IDZA 2YY1A 5E8AA 1LHNA 1PO23 2HJIA 4RGKA 4BLJA 4TWTA 5CU1A 5GM0A 1PO21 4DXZA 4CEYB 2B39A 4JTOA 5IVEA 3GTML 3H1MA 4H55A 4KWJA 2VCCA 4R9AA 5IK8A 1O59A 2E32A 4CXYA 1XJAA 1UY4A 4P9LA 5GZDA 1Y9MA 1Y7BA 4OHVA 3FFZA 5JMCA 5C5UA 5BNOA 1SCRA 2JB8A 3CF6E 4IE7A 1RYTA 2QL0A 1C57A 4AFMA 5CKNA 2CGPA 4PBPA 2R1BA 4ATEA 5FZ3A 1UIKA 4PHZA 3S14L 1W2UA 1XYNA 4IEYA 4WM8C 5C3RA 4JAFA 1PGL2 1QHDA 2Q0AA 1IQAA 3FHQA 4BCUA 2VAUA 5IYYA 4CDUC 5C4JL 3BTXA 3O1TA 1KJLA 4B3NA 4QQLA 1YXWA 3J7LA 1L7QA 3JBG3 2GMPA 3ZR5A 3WNOA 1UYYA 3JBG1 5DDJ3 1PK6A 3TYJA 5F39A 5DDJ1 1LB2A 1PO13 3GGLA 2VUCA 2VGDA 1PO11 4YG0A 2DBNA 3OG2A 1O7FA 4LMFA 1UOGA 2FDJA 1GZTA 3CLPA 1G86A 3MZHA 2Y6FA 5A6YA 1C1LA 4OHZA 2W47A 4A3KL 1MS4A 3H3UA 1WCQA 1ODMA 2C9AA 2G9ZA 3JD72 3PU3A 4AHYA 2A3WA 1OPMA 3E5QA 5M0TA 3NNGA 2IVIB 3CZJA 2R071 3SHRA 4HN1A 4IEWA 1NCRC 2YU2A 3SXWA 1BRFA 1Y1VL 2CNAA 2VH9A 5A3WA 3UJQA 5I8TA 3V56A 1IRNA 5DMYA 3KYWA 1WD4A 5T55A 4A6SA 1QXJA 3AXDA 2NYDA 2VG9A 4O7XA 2LS6A 3O7OA 4FP2A 4RGAA 5E16A 3VKNA 5FP3A 3ZFFC 4HK9A 4Q26A 3PNAA 4AL9A 1F35A 4AQSA 2J1UA 1H9WA 3I2DA 2R042 3MIBA 5CADA 4M00A 1NCQC 2AENA 4I30A 4ZONA 1VIWB 2FMYA 1BVP1 2V73A 3Q8FA 2D6OX 1I5PA 1ZREA 4EWEA 4A3CL 2ZGPA 3T3YA 3S2DL 2XVGA 3LKJA 3LWQB 1ODNA 4BA6A 3VD4A 1PGL1 4ZN3B 2OIIA 4AYBP 3LPGA 4YG6A 3BTYA 4V1PA 1SFPA 3O5SA 4H3WA 4I0WB 1PVXA 4PIXA 3LEMA 1AJOA 1T6GC 1O4TA 1XC6A 2ZGSA 4NUBA 1GP5A 3AKSA 5JZGC 2BV4A 3MO4A 1VMJA 4XJUA 1ENXA 4HKOA 2D6PA 1COV3 1CAWB 5I8SA 4KG0A 2QZ2A 4X8NA 2FDHA 2ILMA 2EALA 3PL5A 2ERSA 1XYPA 3DECA 3FFQA 1ZBA2 4LULA 4NPMA 5DG2A 2A6WA 2V72A 2IVJA 1K83L 1R1A2 3LA7A 2WZEA 1SDDB 2BNNA 1RUI2 5CYYA 2A6HD 4QT6A 2CGNA 4MV2A 5A3NA 3JD73 5JOXA 1JU4A 1SQ4A 1LOFA 1KS4A 3JD71 3BVCA 3CL1A 3J4UH 5I0RA 3PJQA 1HN0A 2WAOA 1S0EA 3S17L 4XXPA 1POQA 1DLLA 1DGLA 2RDRA 2VULA 3CDZB 4RYDA 2ERJA 5FMDA 4Q8KA 2Y33A 1X8EA 3AKRA 3THDA 1JUIA 1S0DA 4N53B 2EXIA 3WDTA 3AVRA 2AH2A 3I4IA 3A0NA 1UIJA 2LALA 2IXCA 4XF9A 3ENRA 2DVGA 1YK5A 1E5SA 2R043 2YFZA 3PWFA 5FV3A 2EVXA 2R041 1CAUA 1GFF2 4BB3A 3C7HA 3BYWA 2VQ0A 3ES4A 5A32A 1RB8G 5M5YL 4NHLA 4XMAA 5H9RA 3IDEA 1YQ6A 1CIWA 4YRDA 1OKOA 4HONA 3KYYA 5A70A 2NZ9A 3OCPA 1PZ9A 2QUOA 3POJA 2VVFA 1A8DA 3D82A 3H7JA 3LIGA 4PIYA 5FP9A 5FY0A 5A32B 3POEA 1LGBA 2CYFA 4YG3A 1K5JA 4AI0A 1JXNA 5AC91 2Z42A 2XJRA 1UPIA 3WW4A 4A3LL 5AFBA 4RQPC 1OC1A 2PAEA 1V0AA 1OT5A 2WDBA 2A5ZA 3B7MA 5DUVA 4A42A 3H7YA 3TN92 1QGLA 3K4ZA 4XFFA 4Y20A 3GTKL 4FPLA 2FCTA 4CP9A 2R6QA 4R4XA 1H6YA 1ZBA3 2DBIA 1WW4A 1PIV2 4YW7A 2BQPA 5F5CA 2AREA 1R1A3 3IT8A 4QHBA 1PX3A 4IEUA 1FMD2 1OMIA 1R1A1 1RUI3 4TXWA 4AR5A 7RXNA 4Y20B 1RYQA 1CZVA 1RUI1 4AEJA 2ZJCA 1QJFA 4RXNA 1NCRA 3VBFB 4CP9B 3VKMA 1L3JA 1LECA 1LJ7A 3HT2A 2C24A 5F9TA 5BYNA 2EA7A 1UAIA 3JCIA 1RJ8A 2R30A 3HQUA 3GF6A 3I2JA 5D21A 1HW5A 1OBNA 3I3BA 2WNVA 3IDAA 4QB1A 4DRRA 5ERLA 3NNFA 4TZDA 4J1WA 3LWCA 4XIOA 4MUVA 1HKDA 2W1WA 5FPLA 4BZ4A 3RZTA 4CCCA 3AKPA 4C8DA 1NT0A 5M5XL 2ZGOA 2VNRA 4IV1B 3LD8A 3K48A 4YVSC 3T30A 3T4HB 5LA9A 2ZHKA 3FZ3A 4Y1XA 2Z5WA 2OT7A 1J3QA 1PFYA 1POV1 2WNVB 4JDNA 4C1XA 5J1XA 5E6HA 1UYXA 2RR13 5IAXA 4AGGA 3S1ML 4C91A 4YVWB 3QOPA 4QDSA 2J1SA 1SLBA 2UU8A 4DY5A 2BTVC 4RGGA 4DNYA 1JZ6A 1YLLA 2W1QA 1PHMA 5L73A 4CDXC 4E4SA 1OXCA 1W9YA 2RJLA 3LEKA 3H97A 1G6NA 1S0IA 1WCKA 3HAGA 4K1ZA 3WNNA 3MICA 1W06A 2V4VA 5JZGA 2P5BA 3WF0A 5EJ3A 5FMCA 3MFAA 1ZZBA 3H3ZA 5IFTA 3I4NL 1R0JA 2W39A 4XFCA 4D69A 4DO0A 1MS5A 1W9TA 1SG3A 4Q0VA 1J1TA 1WMDA 3S16L 1NZCA 4NRMA 4ES9A 3KCXA 3UV9A 2VTFA 4I01A 4DOUA 2JE7A 2JE8A 3EO6A 4XC9A 1CONA 2HWC2 3TN91 2DTWA 1JYTA 3FJSA 2VCBA 5M3FL 3ZX7A 5FK8A 4CDQB 5KHJA 3PURA 1HJGA 1PIV1 4HBNA 5JAXA 1UWWA 1ENSA 1FI2A 2W87A 1FMD3 3APBA 4P9YA 3NW4A 1FOD2 1FMD1 1XU1A 5C4WB 4Q0PA 2XJVA 1T6BX 3FC0A 5IWFA 2LCQA 3HN1A 2B4KA 3IBMA 3TEWA 3GCWA 3O1PA 3RZKA 4PLOA 4X6AL 1I5ZA 2ZCWA 2B46X 4XURA 1NLSA 4CEWB 1MACA 2QQJA 4LE4A 4LA3A 1VAMA 5G04L 5T3NA 5BNNC 3LFMA 1O3QA 4CCOA 1OUSA 1MEC1 1G9CA 1LESA 3KT7A 1S2EA 2JD9A 1GV9A 4AI8A 4TLGA 4LT5A 1WA4A 3JUUA 4XF0A 3K46A 3VB9A 5FPBA 3RZOL 5A7WA 2P3IA 1VB2A 3CO2A 4KI5M 1JYWA 1HV1A 4FXGB 3H3VM 2ZGQA 3NNLA 4YGCA 3S0MA 2H0BA 4HETA 5EYYA 1W9WA 4B8EA 4CRQA 1PZ7A 3S7EA 1DX8A 4NHKA 1YC61 4K6BA 4NAMA 1S2ZA 4B4RA 2J1TA 3H8XA 1NQDA 3RPQA 3MF6A 4JQTA 5FAXA 4HVRA 2QE3A 1X8MA 2JI1A 3A23A 2JA8L 4RQPA 5ABJB 4ZHNA 4K9SA 1H1MA 4XMIA 2NMOA 2WO1A 4QGNA 4XFBA 2W52A 1SBEA 3UGHA 3I97A 4FXKB 4CUBA 2IXHA 3ORJA 4QXKA 5FZKA 5HCFA 1FPN2 2A7AA 4QAWA 1WW7A 2V0EA 3MPSA 4N9IA 4XBNA 4Z92B 2GU9A 4YFWA 3M8LA 4RD7A 4WVZA 2EAKA 4LPLA 4NVPA 2HWC3 3AMNA 1X9TA 1FHHA 4MXWB 4X6RB 4PBOA 2HWC1 1PM4A 1W05A 4PQ9A 3VBSB 5DAXA 2VPVA 3VKLA 1LRHA 1NQJA 2C1FA 1S0FA 3EMRA 3AYCA 3TOJA 3K75B 4JADA 4QX1A 4RL7A 3VD7A 3BALA 4I09A 5FZ8A 1FOD3 4IEXA 2CDPA 1S0BA 1FOD1 4IQPA 4MYEA 5JR7B 4P08A 3BOPA 1UMIA 1HV0A 3I2IA 2W95A 3DEMA 4JTNA 2VBBA 1GQPA 5FZGA 3U10A 3ZO0B 5DXDA 1W2TA 2AEYA 4YNIA 3ILFA 1SMMA 2PLV2 3DYMA 3N9QA 3WNPA 3BOWA 5KXCA 3FHIB 3GBWA 2J9UB 2APOB 1CJDA 4QPYA 4YVSA 2VCMA 3M3QA 3I3MA 3WCRA 5D1IA 4BXSV 5KBFA 4NJ4A 1GBGA 2Y6HA 1Q8VA 4A3IL 2IUWA 4QQOA 2DCYA 2VZPA 4AEKA 4EQVA 3UGGA 4FTBA 2FDGA 5FYYA 5I93A 4RSUA 4QXBA 1JYVA 2RM22 4KMQA 4QX5A 4D7YA 1EY2A 2E33A 2R0HA 1S55A 2P6HA 4TLFA 1L7RA 4Y24A 3ZFEC 2YC4A 1HRI2 3PZAA 5DQ0A 1LKOA 1URXA 3S5AA 2HWF2 1BYHA 3WXPA 1WLDA 1FPN3 3AJZA 4LOSA 3GDBA 3VBUB 1SLLA 1FPN1 4OUMA 4L2NA 3T0DA 3FKIL 3ZXKA 4IESA 1ZRDA 4DMIA 2RDSA 2X53S 3I2HA 5FYHA 5MGNA 4Q27A 4FOVA 3G6JB 3TEZA 2G19A 3ZXFA 1AYM2 3UKNA 1V9U2 5IVFA 1QJX2 1OVSA 4KNCA 4POFA 4UBGA 3DKQA 1W2OA 2BBVA 1Q8OA 3AC0A 1LKPA 1EAH1 1PVC2 1RIRA 4IXLA 4R9BA 3UK9A 4GB32 4EV0A 2E7QA 3N3HA 5F3GA 4BXXL 4QXCA 4JGYC 4U2AA 4P9WA 2VM9A 2PSMC 1OOPC 5IAVA 2PLV3 3LWPB 3RZDL 1LKMA 2PLV1 3ILNA 4M3CB 5JWPA 2ET7A 3VDAA 1VE0A 4H14A 2RS52 4L92A 1DQ1A 5GLZA 1YQ5A 5LRRA 4A7ZA 2VOWA 1RHI2 3GBGA 4JQRA 1LOEA 3OEBA 1TE1B 2LTNA 3B69A 1NA1B 3O1VA 2Z79A 4G9SB 5FPXA 2Y60A 3FLRA 2X09A 4ZS2A 1VCXA 3J7MA 2HBUA 3ETQA 2RM23 1MS9A 4G4FA 2GNMA 1V70A 5LY1A 1QJY3 1QEXA 3KQ4B 1X33A 5FWEA 4Q29A 3V0AB 4YZ3A 2D97A 2PYTA 4W6WA 4XCBA 4QGMA 1HRI3 4Q4Y2 4BK5A 2PHRA 4YFZA 1HRI1 3USUA 1NXMA 4D6RA 1KQRA 5FYTA 1T9OA 2DTYA 4LNVA 1RGSA 2HWF3 2PHFA 4JVAA 1FNZA 2VQAA 2HWF1 5KWRA 2BEOA 1ENQA 2H6BA 1H8TC 1DBNA 1Z0HA 5LB6A 3UNPA 1HJFA 2W5FA 5A7QA 4B4QA 4LXLA 5FJ8L 4BY7L 3DPRB 2WB1P 3USUB 3W58A 2HEWF 1AYM3 1UZZA 4QX0A 1V9U3 1AYM1 1J3PA 2YPJA 4GALA 3V64A 1VAVA 1V9U1 1QJX1 2MNGA 2ATFA 3LGRA 4QQHA 2QQUA 5HXVA 3ECQA 5JDBA 1AXKA 1PVC3 4ARYA 1VP6A 4YPJA 1PVC1 3HWJA 4JC1A 4GB31 2BGOA 2QTWB 5CFDC 2NVTL 1LODA 1DZRA 4L97A 1JZ3A 1AR82 4LE3A 3U4XA 1P7PA 3OB8A 4XDPA 2BPA2 2DFCA 3URFA 1HQWA 2ZEWA 2DU1A 2PFWA 2VNVA 1UYZA 1W6QA 3PU8A 3S2HL 3TEXA 5A1LA 2YUEA 3T4VA 5FZ1A 1BLZA 5CFCB 1AUYA 2P6CA 3H50A 1G8WA 2H12A 1H4HA 3DV8A 1MQTC 4Y5Z0 3VZMA 4OHWA 1RHI3 2RS51 1W6QB 1PMHX 2E2IL 1PNGA 4M0NA 1RHI1 2FHRA 4CDWA 4EWDA 1UX6A 4Z07A 1LOGA 1UY3A 5K4LA 4JZRA 3ZXJA 4PDWC 4ZZ5A 2AYHA 1NX9A 2OPKA 3B9CA 3VBOC 3ZFGA 4H7LA 5I8YA 1JZ8A 3ZFEA 2ZOEB 2I45A 1XNTA 4CDWB 3JB4C 4M0HA 3LWRB 3HNMA 4OI4A 3OYWA 2ORZA 4BH9A 3PO3L 1G9FA 4Q4Y3 1JOJA 3C7GA 1VAKA 3ZFGB 5IVVA 1ULOA 4D94A 5JSPA 1EUTA 4XCAA 3KGZA 4DQAA 3UGFA 3EQEA 5CEHA 1XSQA 5KC6A 1WKYA 3OYWB 4AVVA 1GQGA 1NAEA 2JICA 1I3HA 3AMMA 3VHPA 2RJKA 3SH5A 4E27A 1F4LA 2JIJA 1CAXA 1CPNA 5IUQA 1NLRA 4UW4A 3ZMOA 4Q4X2 4NROA 4F7ZA 1JZ5A 5IVYA 2QQNA 4BY1L 4JGYA 1AZDA 4CXXA 1GZ9A 1Y43B 4NE9A 1OOPA 2G1MA 1S2KA 2XUMA 4NN0A 1AR83 3HMYA 4FPOB 2WQ8A 5HV4A 1AR81 1XQNA 3NKTA 5CKMA 1WLWA 2IZWA 2MPFA 5FPVA 1APNA 4AWDA 3AVSA 5FUIA 3S1RL 4BQ4A 1WLCA 3R05A 4GMP0 1CZTA 1KEXA 1SLIA 3IZOA 3W21A 3ZYJB 1XBFA 1DLCA 2W1UA 2JECA 4CUGA 3RYKA 3WNLA 1W8UA 1OF4A 2YC2A 3TB0A 2XBO2 2DUPA 3VZLA 1ZNPA 2FQPA 4FQ4A 2GN3A 3POBA 4YW1A 2VUDA 3MUY1 5DAQA 3LSDA 1GLHA 3SMHA 4YYOA 1R64A 4O61A 3RWKX 4OZOA 5A6XA 3WF1A 3MLJA 3X29B 3H0OA 3SITA 3U1XA 3LOBA 2QQOA 1WW6A 5F1RA 3ZN6A 1Z92B 5JXGA 4ARXA 1DQ0A 2KXLA 3BTAA 5FKCA 4UF0A 5T5PA 2VMFA 3PHMA 2WYFA 5CZKA 1L7LA 3A22A 1D0GA 5M5WL 4OQ9A 4QGLA 4D8MA 4Y5TA 1A34A 1TWGL 1CPMA 5T54A 3ZN6B 2AACA 4Q0SA 2ETEA 4LLOA 1DGWX 4UF0B 4CTEA 2HH9A 4K40A 5J09A 3MLLA 4MXVA 3OBRA 4G3YC 4Q4X3 2XLGA 1R081 4KWKA 4TN7A 2IFRA 1LEDA 3OSDA 4Q4X1 2D6NA 1OVPA 2BYVE 1EP0A 3N9OA 2KD7A 3TRSB 3RQ0A 4LLFA 3GJBA 2E9QA 3QLQA 5DG1A 5F6LB 2C6AA 5JIAA 5K0UC 1QXPA 2RFKB 4FPEA 4CCEA 3BODA 1PZ8A 3KT4A 3DKWA 2D3PA 2VMHA 3OD4A 2VVEA 4PT6A 5FFOC 4ZZ8A 1E5HA 2FCVA 1TWFL 3GNEA 1H2MA 1MQTA 3MIDA 3W5MA 5L9BA 1LAJA 5FZEA 1Q3EA 2DURA 2M4YA 1XNAA 2TBVA 4YGEA 4XEZA 1AL21 1ALYA 5FYUA 5HXMA 3WWLA 1AXYA 4Q1RA 4CU9A 2XBO3 3VDDB 4PDWA 1H8VA 1W2NA 4I3GA 1OFNA 1YK4A 3MSUA 1GSLA 5C8CB 3F2ZA 2WS92 4XPVA 4JCKA 4XACA 1U5IA 2JDZA 2PQQA 4LEJA 2IFWA 1YV1A 5A3UA 1IG3A 1IS4A 1VMHA 4AEDA 4EN6B 2JWPA 3AMHA 5A1FA 3PO2L 1WUVA 5EIYB 4COZA 2WT0A 4YW2A 1LHUA 1PGW2 4A4AA 2DVBA 4B7EA 4HLTA 1YJLA 1YQ8A 1SMUA 1J1LA 5AI3A 1J84A 2XWBB 3KGLA 4UXAA 2XJTA 2SBAA 3GZEA 4H7MA 4AEDB 4AOCA 4CYDA 4DB5A 2R072 3DL3A 1OLRA 4ZU4A 3PUIA 2VE1A 3RWNA 2VOVA 4XF3A 2WWSA 3I2FA 1C5IA 4Y4RA 2XL9A 2VMEA 5KXDA 3VDBA 2Q1FA 3OBZA 5IYCL 1OLQA 3C3VA 4EROA 1R9TL 3HOWL 1A3KA 1C8NA 2O14A 3OUIA 2FD8A 4O9GA 4Z2AA 2FZ2A 3M4OL 1I6HL 5CG8A 2GP3A 1RUJ1 1W8HA 2OKXA 5A3TA 3WOGA 4NIGA 2YGLA 1K3IA 4FPFA 4YGBA 2J22A 3PVBB 3IB3A 1ZRRA 3K3OA 4JKMA 4LKDA 4O9EA 2R32A 4A3GL 1J3RA 1ZZ9A 2XG3A 2IXLA 4YGDA 2XPJA 4BQ2A 1RUE2 5EIOC 3T1MA 3DUIA 2ZA9A 2JDYA 4WM7C 3GJAA 5SV5A 3WZ1A 5EP9A 1YFWA 1W6PA 3ACIA 3LFIA 1FX5A 4FFIA 3WW2A 2AEZA 4HKWA 4BQ5A 5BNOB 4CUCA 1GUIA 3HAXC 4ISRA 3P3PA 1S2BA 4GWNA 1SHWB 1X82A 3SS2A 4E9KA 2WYSA 3UJOA 5FUNA 5JVVA 5J96B 3HR9A 2RMU1 2WT2A 5T5OA 1YQ2A 5LA1A 2CY6A 1PZXA 2WS93 2RV9A 4W50A 3KYVA 2WS91 1JTZX 3ZR6A 2WQZC 3SCFA 1WMXA 4IEOA 2PYAA 5ACA2 3UKTA 3SH4A 2ADEA 2C6SA 3JQXA 4HK8A 4DS0A 4FFFA 2JDNA 1PK6B 4YW5A 3WQ0A 3FL7A 1PGW1 2Q8DA 2DCJA 3LPEB 1MZ5A 2F4PA 2WO2A 3TBDA 4YWLA 3HOBA 4HT1T 5A3LA 5FY7A 1A8MA 4FCAA 1UZYA 2R073 1W0PA 4PF5A 1IW7D 2JE9A 3FWEA 3NSTA 4QXHA 3VKFC 3FMGA 1AVBA 2P3JA 4L8QA 1UPSA 4W4ZA 5KHIA 3AMPA 2XQRA 1UY1A 5FYVA 4LJHA 1R0IA 3ZIXA 4MHRA 5T5JA 3D8CA 2WUHA 3ATGA 1FHMA 4XFIA 5T52A 2OQ7A 3GALA 4FTSA 2DVAA 3W59A 3DCQA 1OH3A 3LQCA 4D3WA 4ZU5A 1JHNA 2EICA 3FUQA 1J58A 3PUHA 4MGYE 5LY2A 2QKDA 2WFF2 8RXNA 3EHKA 4UYBA 2WRAA 5ANNA 3WWNB 4BK4A 2RVAA 1VLNA 2PTMA 2JDAA 4P5YA 1RUE3 5IP9L 3I59A 4UBHA 1ACCA 2V5YA 4XDQA 5IK7A 1VZGA 1RUE1 2D44A 4GWIA 3P6BA 3ZXGA 3O0VA 1YWKA 1FV3A 2EIEA 2XQXA 3MIFA 3TNQA 4UY81 1RXFA 5F7UA 2W3JA 3NAPC 5AC92 3I59B 3OPTA 3WDWA 3U37A 1B35C 2A70A 3FLPA 3MIHA 3PJYA 1E5IA 5DZGA 2X29A 1CAVA 3C2UA 1FXZA 4N7IA 2YPDA 4MLOA 4XTMA 4BDVB 4OQ8A 4J1XA 3D3AA 5KC5A 2ZIXA 5ACA1 5JPMB 4LIVA 5FY9A 2ZABA 1LNSA 2JG8C 2YBKA 3W20A 3HBZA 4QKDA 2VQTA 3PUAA 3MV01 4HPKA 4BBRL 1MZ6A 4HSJA 1ZZ8A 4UFHA 3GBFA 4URAA 2OUJA 2O0OA 4NIIA 2PMWB 2VW2A 1D4M2 2D7FA 4IGQA 3HT1A 3WLUA 2A6ED 5FY5A 2DUQA 2LRPA 4MX3A 4WVWA 5ANQA 4GWMA 2CAUA 4RR3C 5HBAA 5TSWA 5LA0A 5JSRA 2EY4E 4KGGA 3O1MA 4RS5C 5A7SA 3RMYA 2FCUA 3L9JT 3RZ6A 3MV11 3KQRA 3ZYHA 3KB5A 4JGZC 2VOKA 5FZ4A 1CWPA 2NQYA 1QF3A 2M4VA 3BB6A 4YARA 1XRUA 5JI9A 4CZSA 4AHXA 5C3EL 4XXAA 2CAVA 5A3PA 2D93A 1MS1A 4HSLA 4KG8A 3RRDA 4UFMA 4Y7NL 1UW8A 2QQIA 3KWVA 1VZIA 4V196 1TZOA 2WFF1 1BVVA 3N9NA 4KL1A 4WM8A 4XYXA 2WN2A 1DGRA 1QQTA 4XILA 4C2M1 3KT1A 1BJQA 3AX4A 2ZKLA 3T2TA 3HJWB 3OGGA 4CDUA 1DFQA 2XONA 3I7DA 1CAUB 1U0AA 2A6VA 4YM2A 1SLAA 5L9RA 1YFYA 3LEGA 4WM8B 5JMOA 1REDA 1OQEA 3IAQA 3WG4A 5AC93 3AYDA 1XE8A 2VZRA 3ZKYA 2CKCA 1JHJA 1ZRPA 3Q8AA 4CDUB 2JKXA 1VRH2 2XJQA 1LTEA 2X5IC 2NVYL 2R062 2XJPA 1QNYA 4TTGA 4GH4C 2QQMA 1DG6A 5H9SA 3ALQA 3ZSJA 2P34A 1R0FA 5MLC3 3DYPA 1B2JA 2XDVA 4GA9A 1X9PA 4LO4B 4LBOA 3NJVA 3WNXA 3U0ZA 5FYMA 4AFBA 1D4M3 1KFXL 1AXZA 2VZTA 1D4M1 3OPZA 3POGA 3HVDA 1NG0A 4WVVA 3WG3A 4AF9A 2UY9A 2HWB1 1H30A 2BOJA 2EXKA 3E6DA 4UFJA 1MEC2 5JOZA 2WZ8A 4NRPA 1ZRIA 4LORA 3THTA 1HXS2 4IV3C 3WHUA 1T2XA 1NCRB 1DYOA 3ZFFA 3CIHA 4FPJA 5DAWA 1PFWA 3IU3I 1TVGA 1A78A 1N3PA 2GSYA 4M4RA 2NLRA 1NCQA 3ZXLA 4K9FA 3AP5A 1RUOA 3BUCA 4IERA 3B0AB 1POV3 4MO3M 1W8TA 5BY5A 3HPNA 2YBPA 5LK5A 2JA7L 1HB3A 2FMDA 4S2FA 3HNBM 3ZFFB 3A7QA 4PJYA 3RZLA 1KRIA 4LKFA 3M1HA 2WBKA 1IKQA 3O0XA 3PDQA 3WD5A 5A6QA 1NCQB 4LKEA 1NZIA 3SCHA 1VBD2 4XJ9A 3W9AA 2JA5L 5IYDL 2Q8EA 3VV1A 2A3XA 3NAPA 4XUTA 1YHFA 3J9SA 2BVBA 4YM3A 1UZ0A 3NV1A 3ZYPA 4PCRA 2ZMKA 1JZ2A 5FYIA 2J1EA 2YU1A 4EN0A 4BXFA 1NLQA 5CBLA 1AX2A 3WR0A 2J1RA 3AKTA 4AXOA 2OZ6A 4TVMA 1FV2A 2ZAHA 2WQ4A 5FZAA 1VRH3 4XJ8A 2A6XA 2R063 1VRH1 3TN93 5JZGB 3WG2A 1Q8QA 2JG8A 2R061 4XUPA 4CP1A 2D6MA 3AFGA 4N90A 2GP5A 4N9HA 2XR4A 1GWMA 4YW6A 4OI1A 1PIV3 1LEMA 3VBRC 4BWOA 4DUWA 4IETA 3IM0A 2V0FA 3K2OA 4INDA 4ITCA 1ENRA 4DZGA 2JI2A 5T50A 1C1FA 1JH5A 1HN1A 2JEMA 3P2AA 1H4GA 1UNBA 5LW9A 1KJRA 5FZ9A 3WP4A 5IVJA 5KXBA 3JB8A 4OYUA 4A41A 3FUOA 1GANA 5D8AC 3VPBE 2R7ZL 2AR6A 4QDQA 4BMBA 1MEC3 1ND2C 5FIXA 4GIQA 5AVAA 4EWAA 1HXS3 1G9AA 4OZXA 2VUML 4QB2A 5JSOA 1HXS1 2R93L 2VZVA 2BP6A 5FZ0A 4ONUA 3TNPB 3FDJA 5BV6A 2BJSA 3PTYA 2GC3A 2HBTA 1PM7A 3J26N 2WA3A 1WCDJ 4FOYA 2W2IA 1AHSA 3B01A 4AVBA 2XB6C 2W1SA 4F83A 2ZX3A 1NXEA 4PI2A 5LBCA 4IL7A 4Z1VA 1W9SA 2WNOA 4K3UA 1QIQA 4DFSA 1GOGA 3FLTA 3GZTB 5A7WB 3U75A 4LBNA 1VBD1 3ME2A 2BVVA 3WX5A 2Y6LA 4JV4A 1IG0A 1UY2A 4ORFA 1QDOA 2R49A 2Y6GA 2YDEA 5HV0A 3B00A 3IDBB 5FMBA 1JOPA 1LULA 1Y9GA 3H9CA 1JU3A 3MEPA 2OQ6A 1AR62 2X5IA 2ZGUA 1I3QL 5KR7A 4AR4A 1MZFA 2ARBA 4GH4A 1NUKA 3RI8A 3KCYA 3CHXA 3H1YA 2BFUS 4RQPB 4IW3A 4POGA 4XIKA 1F4AA 4AVSA 2CL2A 5F32A 5J48A 1FT9A 1UZVA 1EPWA 4CPBD 1DZTA 4MGQA 2A71A 1IROA 4K8FA 3A0KA 1EAH2 3OUJA 3IPVA 2VBPA 5EWSA 2OX0A 2O8OA 4ATFA 4SLIA 4KBBA 1SEFA 4W8JA 2GC0A 5A1AA 1GNHA 1XSRA 1QJU2 4DPNA 3LPFA 1NE6A 4EZHA 3RZMA 2P4EA 1JN2P 1SACA 4IV3A 4E4ZA 3TWIA 2FDFA 2WL1A 5FPZA 2ZTNA 3ZSEA 1YJKA 3LEIA 2JDHA 1PX4A 2HEVF 3CKHA 3I3DA 4JRAA 1PFVA 5IJRA 1YUZA 1WCSA 3RFRA 5F2WA 1NOVA 3POWA 3DGTA 1DQ6A 3B02A 2M6OA 1AR72 4JX0A 3H8OA 4DUVA 2Q8CA 4HOOA 2L0ZA 2PHDA 4Q0UA 2DV9A 3LNLA 4JAGA 1VJ2A 5AFEA 1ASJ2 1ZRCA 2YFUA 1ND3C 2EF6A 5F3IA 2VCAA 4CCNA 1ULEA 3OD0A 4CDXA 4XDOA 3ZPOA 1YFXA 3FE5A 4YVSB 2UWCA 5JR2A 2VVDA 1XNKA 3HEIA 1W6OA 1QOTA 2VW0A 1ZRFA 1W2AX 4MHUA 5L7OC 3MQKB 2JA6L 1V00A 5DABA 4A44A 5F5IA 5C9AC 1NKGA 3MYXA 1GP4A 3H9BA 2W94A 2J7MA 3H9AA 3OGSA 1RUD2 4GJZA 4QPWA 4CDXB 1CESA 4NMIA 1TWCL 4KU7A 1A6CA 5FJHA 5JVH1 1E5RA 1E8JA 1OA2A 1AR63 3NV3A 5FZLA 4HKLA 1X7NA 3HJYB 1W6OB 2JDPA 1AR61 2WZPP 2X05A 1V6KA 4BLIA 2Y8KA 5IYBL 1OFSA 4C1WA 2OVUA 3KV5A 3JQWA 3K4AA 2G9FA 5FZ7A 4J6GA 4PI0A 4UW5A 5IT6A 1N1SA 2WWJA 1IS3A 2WR9A 1KFUL 2YYOA 1EAH3 3ROUA 5JIUA 2XH6A 3IMNA 2JXAA 2PAKA 3ZSLA 5CG9A 3AZZA 5BXXA 3J7Z1 3IIAA 1S0CA 5D8AA 3T2QA 3N7LA 5DAPA 1QJEA 5FY1A 4XTPA 1QJU3 4H2AA 5BNNA 1IPJA 3N35A 3THPA 1QJU1 1ULGA 1VRBA 3IIIA 4AQTA 5F3CA 1RUC2 2P3YA 4JHTA 4Y33A 1QJZA 3POYA 1MS3A 1WBFA 1JODA 1F8VA 2LM3A 5D8AB 1MS8A 4TPUA 5BNPC 3WDUA 5BNNB 2DSXA 1AR73 2JG9C 4AG4A 1CX4A 4AI9A 4AVCA 1DYPA 4CCMA 1AR71 5FLJA 3KVBA 1ASJ3 5CAZA 2WNUC 3N7JA 4LOTA 4PF1A 1W90A 1ASJ1 3HOVL 3AYEA 3EB7A 5F8PA 3SH3A 1VZHA 5IY0A 1CX1A 4XZUG 1BQPA 3WW1A 1LKNA 1X36A 1N47A 2DFBA 1U12A 4XJWA 1OLME 2WIIB 2AUYA 4N43C 3SQOA 4Y1VA 1N1YA 4XOGA 4A7YA 4MOAA 1RUD3 1DQ2A 4LQRA 4P00B 4Y26A 2OZJA 1RUD1 4AGRA 2BU9A 2BGCA 2F6BA 5FPAA 3PKJA 4J25A 3VBHC 3AZXA 3P3NA 5LZ6A 1BQ9A 3KSCA 2DCTA 1O8PA 3T1LA 4QX8A 2W68A 2Y0OA 4NPRA 2JI3A 3AZVA 2Z69A 1UQXA 2ZX2A 4GXLA 1UU5A 5RXNA 3ELNA 4DXRA 2ZGTA 4YZ4A 4LHLA 3RI9A 3SEEA 3HOUL 1RUG2 4S2GA 5FWJA 5FXXA 1QJX3 2VR4A 3IDCB 1HRV2 1HX6A 2ET1A 1XNCA 4QPGC 4LBKA 1Q43A 1GOFA 3AP9A 4GB33 5HCAA 2K2DA 1RUF2 2J1VA 4KWUA 3O1OA 2GH2A 3CJIC 5FYBA 5FZCA 3H99A 1MPXA 1RUC3 1IS6A 4Z2WA 1RUC1 2KR2A 5LWBA 3BGAA 4BU2A 4F8AA 3ZXEA 3WEZA 1MZEA 2E31A 1VALA 1Z78A 2PA7A 1BQ8A 3M4FA 4QQPA 1UZWA 2RS53 3A4UA 1ND3A 3KCCA 6RXNA 2X8KA 5J98B 5FP4A 5A33A 5FMOL 1TME2 4QB6A 1WGPA 4EE2A 1RXGA 2P3KA 2TNFA 1NY72 3DF0A 4M3CF 3SKJE 1G7YA 5JPNB 1Y1WL 5C9AA 2IWGB 1YYNA 2MEV2 5EJ1B 1FAYA 2BNOA 4NOTA 3M3IA 3GXUA 2ZS6B 3POIA 4RHV2 1RC6A 1UXXX 1D7PM 5A7OA 4GWJA 2O8QA 3GZAA 2ORXA 1XXNA 3ACLA 4IEPA 5HPOA 5FO7B 4E8CA 4MGSA 1C4RA 1O5UA 1WCML 2V09A 4XJZA 5EQUA 2VL4A 3ZFEB 4OUSA 2HWE2 3VZOA 4XETA 5GKAC 4XZPA 1DDLA 2WO7A 1R1ZA 3ZDSA 5C3PA 1ZZ7A 3OBAA 5JXHA 5GZEA 2GN7A 1K12A 3PVNA 4COVA 4DXTA 2TUNA 1W6MA 1V6NA 5LATA 3ES1A 3JZVA 4LO5B 4CCDA 4BIFA 4CP0A 1RUG3 5FRAA 4ASMB 4IEZA 4B1LA 2XLAA 4C0BA 1R082 1RUG1 3V65A 1U5YA 2RS31 1HRV3 2C4XA 5FREA 5E88A 1CAAA 1HRV1 3CEWA 3AZYA 4A3ZA 5K9YA 4EN9B 1LCLA 2PHWA 2WWUA 1W6MB 1RUH2 1D4VB 4HN0A 1O3RA 1RUF3 4JKKA 3I2GA 1CAXB 4KH9A 1RUF1 4MG2A 3N36A 5FP7A 4Z8BA 5T5LA 2CV6A 1W8NA 5C7GA 5F37A 1O6UA 4XE9A 4CEYC 1H1AA 4JGYB 1FYUA 1OF3A 3ZSMA 5BNPA 4AFAA 3AZWA 2AUSB 2JG9A 4NHMA 1CVNA 2F17A 5C4XL 3ILRA 1OOPB 2XGXA 5GALA 5FTTC 2PVEA 3FBYA 1AL22 5AI2A 2FBEA 2Q5TA 1JUHA 4OMCA 4NAOA 3RMXA 3ZYIB 3LWVB 1TNFA 2WNUA 1GNZA 2XXZA 5LBBA 3EXUA 4BM8A 4AR3A 1X50A 1ULFA 1TME3 3KV6A 5KXEA 1TME1 2ZZQA 4WZFA 1CADA 4AQ2A 1Y9QA 3QVDA 1NY71 3NWKA 4UFKA 2V4AA 4N43A 3RVHA 1QCVA 2QZ3A 3BIWE 2MEV3 2VL6A 3RYRA 2ADDA 2LUWA 3BN6A 2MEV1 2JDUA 2ERFA 3J7NA 4RHV3 5GLTA 4XUOA 3B3QE 4RHV1 2X10A 4QX2A 4DINB 2ZX0A 3MF9A 1CR7A 2YU9L 4Q2FA 1LU2A 1XU2A 3NJZA 4IE4A 3WHTA 4B29A 3RYGA 1SBDA 4K7JA 4KGQA 3PKIA 2VW1A 5H9PA 4QU1A 3VN4A 2GH8A 1H8TA 2Y6JA 4YW4A 3OBTA 3O1RA 2HWE3 3KM5A 4CU8A 2HWE1 5JOWA 2W0XA 1QQP2 3MFCA 1GZCA 3JR7A 5C44L 1UN1A 2LROA 4AR2A 2VMIA 3OY8A 1DU3D 1YUXA 1WW5A 5I0TA 2C6BA 1H8TB 1AR92 4HL0A 3HQRA 4NHXA 4QPGA 1R083 4DXSA 4PLMA 5J7MA 4X8PA 3WDXA 1V6LA 1RUJ2 2RDQA 4KWLA 1O4ZA 4AFCA 2ZZJA 3WF2A 5CFDA 4FAHA 5LK7B 2EAAA 1GNYA 2ZXQA 1RUH3 3OY8B 1F4HA 1RUH1 5JOYA 4QPGB 2AYJA 1W8ZA 1GOHA 3E5XA 3IAPA 5EHDA 1SFYA 4TSVA 1T9PA 5FY4A 3VUOA 4FPYA 5EFUA 1C8M2 4Q5OA 5CFDB 1NXD1 1UMHA 1ZBE2 4HMZA 3ZSKA 2CU5A 3U4SA 3BI3A 1N1TA 2VJXA 1W28A 1QNWA 1LENA 1ODHA 1ZVFA 1WWYA 4O65A 2PPTA 1AL23 2D6KA 3JU9A 4P02B 2CSGA 1UY0A 3B5LB 3CZUA 4DEVA 1RL3A 1UU4A 4OCTA 2RDNA 1C28A 3CMGA 4V2VA 4XQDA 2ZHNA 2RMU2 4AI2A 4R4ZA 1MQTB 4B4PA 4NHYA 4EJRA 4W65A 3VBOA 2Z3RB 1GYKA 1UOFA 3OUHA 2QQVA 3NV4A 3WP3A 1UL9A 4YW3A 4AAXA 4P9GA 2ZHMA 2XHKA 1KGYA 2VTXA 1YO8A 3VD5A 4QKBA 1SZBA
chains in the Genus database with same CATH topology
4P9IA 1BE7A 4PDWB 1YCIA 2DVFA 1BBT2 4HVOA 4AI3A 3VBOB 3HQXA 2JKBA 4Y1ZA 3MPPG 1DVBA 2ZHLA 5EXOA 3LA3A 3KZ4C 4FAGA 1QYBA 2UYBA 2YGMA 5CA6A 3VKOA 3WP5A 2DF7A 3TAYA 2FZ1A 1QQP3 1QQP1 4JAAA 3R4DB 4OHXA 2E6VA 1RINA 1UD1A 2BFUL 1AR93 2A69D 4A7ZA 1B09A 1AR91 1RUJ3 1RVF2 4R8HA 2QVSB 3SNMA 4YSFA 2XJUA 1YRZA 3GHMA 3WINE 1NE4A 1UU6A 2WKKA 4CEYA 4MH0E 4NO4A 3CNAA 4JDOA 2Y38A 4Y22A 4E2QA 4R52A 4I02A 2PAMA 3R4SA 1C8M3 2AGSA 1C8M1 1DF0A 1DQ4A 1ZBE3 1LOFC 4AVTA 3FX3A 3MW2A 4N53C 4YZ5A 1ZBE1 4FPGA 3WV6A 4ZN1B 2M6PA 2XWJB 1OKQA 4MZUA 4Y22B 4OI2A 2N7GA 1FNYA 2VOXA 1B71A 2RMU3 3M2MA 4Y4YA 1W6PB 5DM61 2TEPA 1CD3G 4DY3A 1CGPA 4AK3A 5HI0A 1WBLA 4CP2A 3IN9A 2D3RA 3VZKA 1DZQA 2KKDA 2PHUA 1JYIA 1BBT3 1BBT1 4XFGA 4WV8A 1PGSA 2E53A 4LTAA 1RB9A 3SLIA 2IXKA 1RWDA 2ARXA 5FCCA 4XHBA 2A3YA 2B8MA 3PMSA 2BWCA 5KHHA 1COV2 1UF2C 4UW3A 2RE9A 1SFNA 1UMZA 3HD8B 2UY8A 4JRLA 3ZG6A 1RVF3 4E4DX 1S0JA 3J7Y1 2PELA 1IS5A 2PHXA 1RVF1 5K0UA 4IEQA 4OHYA 1OPOA 4MGKE 4EN8B 2Z3QB 3VBFC 4K1YA 2UYAA 4L11A 1DYKA 2JX9A 2RS12 4R9DA 4Z82A 4F3JA 5K0UB 4A3XA 1U5XA 2YROA 5MF6A 4BMEA 4RFT0 1IZ3A 1LOAA 2YXSA 3AP6A 4BYYA 1DIWA 2RDVA 2A73B 2Q1MA 3QCWA 4IV1C 4S2HA 1LU1A 4FTEA 3K51A 3RDIA 2WNVC 4XBLA 4N7UA 1S24A 1N3OA 3AP4A 3ZN4A 4ME3A 3OJBA 4YVWC 2VUAA 2H6CA 4I3PA 3INAA 2GC1A 4Q4W2 5ACA3 4K20A 2A75A 5CVRA 2QDRA 3OGJA 3VHNA 3VL9A 2NN8A 4JAEA 3GZUC 4LUKA 3KYXA 3LCPA 3PVEA 2D6LX 1CAVB 1H7VA 3ZVXA 1D2QA 1O91A 1CAWA 2ZACA 2HWB2 4XJAA 1IPKA 2UWBA 3D6EA 4HPKB 1AL0G 4LO7A 4CDQC 4XBQA 3QH6A 2Y0IA 1COV1 2DCZA 3D0SA 5GZGA 5J3UA 2OUHA 2JENA 4EN7B 3U11A 1PNFA 5FMOS 5C4WC 5J37A 1LOBA 2VNOA 1TEIA 3ZXDA 1VR3A 1VBB2 2G4IA 2RS13 4WVMA 2WFF3 4L9BA 4CEWC 2O5JD 2RS11 3WCSA 4WM7A 4N53A 5BNQA 5FO8B 3O14A 1VB4A 5HCBA 5E1RA 1I6XA 1VBA2 3AK0A 2XJSA 1OSGA 2CWMA 4WVMB 1I9RA 3CU7A 3SCGA 1BK1A 4XF4A 1KDMA 3RS6A 2D5HA 4WM7B 3RJ2X 3KYUA 4B8CD 1C5HA 4FPKA 2ZMLA 3WT3A 3A44A 2NP0A 1WMEA 4C90A 2DWRA 4LR4A 2QFEA 1BFYA 1IHMA 2DU0A 3B9IA 2RR12 1YNAA 4Q4W3 2ZGLA 3D5OA 1AX1A 2ZGKA 4Q4W1 4P5HA 5A3MA 5LRSA 1O3TA 2YV8A 1H9PA 5ABJC 2ZX4A 3AM2A 2CR8A 3CJXA 3E6BA 5FDBA 1BCXA 1G9DA 2CWSA 1D0HA 1AX0A 5EYXA 5EZWA 2UWAA 1SLCA 2WINB 3U07A 2NPIA 3VZJA 2BUKA 1YI9A 1H2LA 1KD7A 4U671 2HWB3 4PIZA 5IK5A 4YM1A 3RZZA 1MS0A 3VBSC 2NM1A 3LOIA 1QKQA 2WC2A 3AP7A 2YHJA 4M3CE 3VBFA 3ZMNA 1LHWA 2CGOA 1ZBA1 1BEV2 3K35A 1S1AA 1QOOA 2KM2A 1VBB3 2C0ZA 1VBB1 3O12A 1Q5OA 1Q8SA 1SLTA 5FBZA 4LBJA 1WMFA 5GAGc 1HLCA 4I2OA 2D40A 1LGNA 4RA0A 4IV1A 2UURA 1Q56A 2SLIA 3VGIA 1VBA3 2E63A 2XVLA 4BIOA 4HZFA 1VBA1 4ZU7A 5LEKA 3PIP1 3B93A 3MPBA 2QJVA 1B35A 1ZZ6A 4YVWA 2Q1ZB 3E97A 3AKQA 1T9QA 2XKOA 4W6YA 1EYBA 4U36A 3NAPB 4Y1UA 1ULDA 5AVPA 4NWWA 1Q8PA 1W6NA 4I0BA 5C8WA 2B45X 1B35B 2RR11 2ZGMA 3ASIA 4FT8A 3WDYA 4D7SA 4LO8A 1UCXA 1U5ZA 2CTVA 1QY4A 3H8UA 3M3CA 4MGIE 1REFA 3WUCA 1WLTA 1W6NB 4AGVA 2JG8B 3UKVA 4RR3A 4LA2A 2ZMNA 5GLUA 3ZYRA 3VBUC 4FP3A 2GAUA 4RS5A 1TMF2 4CDQA 1R0HA 1MR5A 2JJ6A 4FPHA 5EINC 4XF1A 5DUWA 4ZKTB 1OI6A 4KU8A 2GC2A 2GALA 1YFUA 4JGZA 1CN1A 1D2SA 4RR3B 4URTA 4AW7A 2HKXA 5C4WA 1HDKA 3KS7A 4RS5B 3IWZA 2ENRA 1O4YA 3N4MA 2I74A 1BEV3 5LEJA 1BEV1 4CEWA 1POV0 4QM9A 4JGZB 2E7TA 4YWMA 3QBQA 2BWAA 3B08B 2D5FA 3LSEA 3USSA 2DVDA 4WZCA 2VY0A 1VBD3 3I54A 4LHKA 1XE7A 4Q8LA 3GHNA 4QPIC 1NA1C 1YIFA 2E51A 1M06G 4Q0QA 1SCSA 3MW3A 1BXHA 3LA2A 3J8F2 2MS3A 4FPCA 1GR3A 4ES8A 1LTLA 1F5JA 1RJ7A 1XNDA 1C09A 5ABJA 1ZA4A 5FLIA 3PIO1 1YI7A 2X5IB 3P8BA 4COYA 4GH4B 2YC0A 1LHOA 1JYBA 3WG1A 1NXGA 3D4KA 2O1QA 5CB7A 1R092 2GNTA 4LBLA 1UKGA 4MXWA 3ZXAC 5B2GB 3VBSA 4JDMA 1TMF3 1OA4A 2R16A 5DZEA 1TMF1 5GLVA 5JVG1 1FATA 1Z7S2 2VU9A 3DPRC 1SDWA 3RJRA 5I91A 2WSVA 3IPVB 3LB9A 3B94A 3MIEA 4Q1PA 3L2HA 1S30A 2NYYA 5H1Sc 3MIGA 3PLQA 4QMAA 1RITA 2R0FA 2A6YA 2XKPA 4IV3B 4XW3A 4AEMA 4AQ6A 1HQNA 4ZXKA 5SV8A 4AVAA 1H2NA 4XFHA 2RHPA 3VLBB 2XLFA 4XFAA 2GDFA 2Q4SA 4AHWA 5GADc 3N7MA 4GS7D 5CFCC 1DGWA 1REEA 1OWCA 2YMZA 1GQHA 1QOSA 5KHKA 1SMVA 1ZYBA 4GULA 3OF1A 5K8SA 3KD4A 2D3SA 2R1DA 3WQ7A 3N7KA 4A2UA 3OTFA 1DGRN 2G9GA 1GKBA 5MFPA 3J8F3 3J8F1 5JLVA 1EV12 4KQ7A 2VNGA 1JBCA 2D43A 1V6OA 3VBRA 4AFDA 4CDWC 1K5MC 2HR5A 2QQPA 1QJY2 2QCSB 3QACA 2P17A 2D98A 2DCKA 2WNEA 1HQLA 3ZFGC 3VBUA 5IK4A 4BQ1A 1WD3A 4XQWA 4YM0A 3VBRB 3WY6A 1R093 3ZPYA 1RDVA 1R091 3KMHA 4MGZE 1AJKA 1ND2A 3BPZA 4BOWA 1Z7S3 3QD6A 2MHFA 1CQ9A 2AZ5A 2Y26A 1V6JA 1Z7S1 3Q9OA 5GAHc 4MVTA 4QU2A 1W0OA 3VL8A 1VBE2 1IGOA 3MLKA 1G9BA 3PMEA 5DM71 4B7KA 4WFN1 1ND2B 1N3QA 3BU7A 5L36A 5I0SA 4AR6A 5J36A 1BZWA 1WJVA 1O5LA 2Q30A 1JW6A 1S0GA 4BHPA 1JYCA 5K2ME 3ZIWA 3FBMA 2ZKNA 1HIXA 2ZGRA 4M3CA 4MSVA 1EPZA 1ULCA 2V3BB 1H2KA 3BCWA 2B5ID 4W6XA 1F2NA 2I2SA 5DZFA 1QH6A 2ES3A 3LAGA 2K2SA 2BW8A 2K9ZA 2VXRA 1NA1A 4QPIA 5GJ6A 2WFPA 5GLWA 5BUVA 2EXHA 2A6ZA 3S6PA 2E7AA 4COUA 4L99A 5JCTA 5C6CA 3D0JA 4DRVA 3WVJA 3V0AA 2B7YA 1YIPA 1EV13 4QPIB 1XNBA 1EV11 4AE2A 1RDGA 1N1VA 4COWA 5AN9H 5I0UA 2PHTA 3HIFA 3RG0A 2GNBA 2VMGA 2RM21 2RS32 1QJY1 2WLQA 1QU0A 3ZYGA 4LO6B 1DQ5A 5L19A 3RYPA 2IXIA 4E2GA 1TQ5A 3DPRA 2VUJA 1KDKA 4WBBA 4FBFA 2CKAA 3NFPI 2C5DA 2B42B 2OYZA 2WLPA 1VBE3 1BKZA 2KN9A 4C0HA 4E2SA 1VBE1 5EV7A 2WZR2 2A68D 4AHZA 2GNDA 1IOAA 1I1EA 2WT1A 2OA2A 1LGCA 1QXRA 2HYKA 1OA3A 5CFCA 2ZAAA 2EXJA 5L7OA 4FOQA 5GZFA 4Y1YA 1RMU2 4FQZA 1ND3B 2QDNA 1OQDA 5A33B 3AMQA 2ZPXA 3QH7A 5F5QA 3WW3A 1NNQA 1V6MA 3WQ1A 1XYOA 2VECA 2W08A 1ZX5A 1NYWA 1CJPA 1H1IA 4GMP3 3VDDC 5L7OB 4OI0A 1V6IA 4GMP1 5DUUA 5C8CC 5C9AB 1LR5A 1IU6A 1K5MA 4QM8A 5MFZA 1SBFA 4Q4V2 4AI1A 5H9QA 3MW4A 5FQ0A 1IKPA 2ZGNA 1B13A 2RS33 2Q8OA 1KXGA 2XVKA 1RUNA 4IEVA 1K5MB 1DHKB 4FVVA 3G7DA 4AEDC 2B9UA 1MVQA 4OULA 4NWVA 2PN5A 4HFSA 1GICA 4Q4Y1 4XGHA 5FQ0B 4E6YA 1GZWA 3MDPA 4YZ2A 4P9JA 4SBVA 1TNRA 2ZX1A 4XXBB 3S30A 5K7PA 3NKGA 1QWRA 5FOBB 5CNAA 1UKRA 2JD4A 3PVOA 3R4UA 1GZWB 2WZR3 4LBMA 4AGGA 2I07B 3ZN5A 4YLZA 2WZR1 4OVEA 4META 4ISQA 4I0AA 1PMIA 4QD2A 1F5FA 3GYDA 5JI7A 4YZ1A 3I8TA 2BNMA 3M3EA 5BNPB 1VBC2 4P9XA 1OD5A 2JG9B 4R9CA 3VZNA 2DUOA 5GAEc 2YZ4A 4LBQD 4BPZA 2NMNA 3IKWA 3AB0A 1RMU3 2WNUB 2P2KA 4QQ2A 1F31A 1RMU1 1BMV2 2WA4A 4G6BA 2B5HA 4GKXA 3VHRA 5BNOC 2IC1A 3VBHA 3QQCE 1LOCA 4GQ7A 3E5UA 3R0RA 2GMGA 4N43B 4K21A 4A7KA 4P14A 1MVEA 3NVCA 4ASLA 1OQ1A 3RNSA 4LBQA 3DN7A 3O0WA 3VBHB 1OWBA 4LUMA 4GKYA 1B2OA 4BE3A 4FO9A 4M01A 2QNKA 4Q4V3 3WDVA 3L2YA 1SMWA 4Q4V1 2XL7A 1PK6C 4HVQA 3EJKA 4LBQB 1QMJA 3NO8A 2BE5D 2DYCA 1YUDA 2PHLA 3KLSA 4OLLA 3CJIA 3SISA 1AYN2 3WP6A 3ST7A 1ZM1A 5FLHA 3WUDA 3M3OA 2K0GA 2HWD2 3NL1A 4X6QB 3UL2A 3AYAA 5FOJB 3CJIB 1PO22 3MI8A 2KA3A 3LZZA 1AF9A 2GZWA 5CIRA 2OW4A 4OFGA 1F9KA 2IXJA 3R6SA 3V0BA 3AXEA 2WSUA 3E6CC 3AJYA 5DUXA 3NV2A 1VBC3 1Y3TA 3POSA 1QH7A 2HEYF 1VBC1 4NR1A 4PLNA 1IU5A 5C33A 4LHNA 2EIGA 2PVXA 2H0VA 3V0BB 3S7IA 3VDDA 1J59A 1W39A 4S2DA 1BMV1 4HANA 2ZBJA 5C8CA 4FOWA 1KITA 3H1WA 1ZZCA 1LHVA 4FSJA 4TYSA 3JBG2 4D7TA 2XBO1 1KS5A 2GMMA 3M7AA 4XHXA 5DDJ2 1C3HA 1H0BA 1PO12 3VHOA 3AFKA 1QDCA 3EBRA 1R0GA 5F6KA 1OHFA 3M70A 1E57A 3MGUA 5E89A 2Z2SB 1RTVA 1M4WA 1O3SA 1ONAA 3RSJA 1AYN3 2P37A 4UW6A 1AYN1 2HWD3 4AYUA 2GMEA 5BPXA 2HWD1 2WJSA 2YY1A 5E8AA 1LHNA 1PO23 2HJIA 4BLJA 4TWTA 5CU1A 5GM0A 1PO21 4DXZA 4CEYB 2B39A 4JTOA 3H1MA 4KWJA 4H55A 4R9AA 5IK8A 4P9LA 5GZDA 1Y7BA 4OHVA 3FFZA 5JMCA 5BNOA 1SCRA 3CF6E 2CGPA 1RYTA 2QL0A 1C57A 4AFMA 4PBPA 2R1BA 4ATEA 1UIKA 1W2UA 1XYNA 4IEYA 4WM8C 4JAFA 1PGL2 1QHDA 2Q0AA 1IQAA 4BCUA 4CDUC 1KJLA 4B3NA 4QQLA 1YXWA 3JBG3 2GMPA 3JBG1 5DDJ3 1PK6A 3TYJA 5DDJ1 1LB2A 1PO13 2VGDA 1PO11 4YG0A 1O7FA 3CLPA 1G86A 3MZHA 1C1LA 4OHZA 1MS4A 3H3UA 2C9AA 3JD72 4AHYA 2A3WA 1OPMA 3E5QA 2R071 3SHRA 4HN1A 4IEWA 1NCRC 3SXWA 1BRFA 2CNAA 2VH9A 3UJQA 5I8TA 3V56A 1IRNA 3KYWA 1WD4A 5T55A 1QXJA 3AXDA 2NYDA 2VG9A 4FP2A 3O7OA 4RGAA 5E16A 3VKNA 3ZFFC 4HK9A 4Q26A 3PNAA 4AQSA 3MIBA 1H9WA 3I2DA 2R042 5CADA 4M00A 1NCQC 2AENA 4I30A 1VIWB 2FMYA 1BVP1 2V73A 2D6OX 1ZREA 4EWEA 2ZGPA 2XVGA 3LKJA 4BA6A 1PGL1 4ZN3B 2OIIA 4YG6A 4V1PA 3O5SA 4H3WA 4I0WB 1PVXA 4PIXA 1AJOA 1T6GC 1O4TA 2ZGSA 5JZGC 3AKSA 4XJUA 1ENXA 4HKOA 2D6PA 1COV3 1CAWB 5I8SA 4KG0A 2QZ2A 4X8NA 2ILMA 2EALA 2ERSA 1XYPA 3FFQA 1ZBA2 4LULA 5DG2A 2A6WA 1R1A2 3LA7A 2BNNA 1RUI2 2A6HD 4QT6A 2CGNA 4MV2A 3JD73 5JOXA 1SQ4A 1LOFA 1KS4A 3JD71 3CL1A 3J4UH 5I0RA 3PJQA 1S0EA 4XXPA 1DLLA 1DGLA 2VULA 2ERJA 1X8EA 3AKRA 1JUIA 1S0DA 4N53B 2EXIA 3WDTA 2AH2A 3I4IA 3A0NA 1UIJA 2LALA 2IXCA 4XF9A 3ENRA 2DVGA 1YK5A 2R043 3PWFA 2EVXA 2R041 1CAUA 1GFF2 2VQ0A 3ES4A 5A32A 1RB8G 4NHLA 4XMAA 5H9RA 3IDEA 1CIWA 4YRDA 3KYYA 2NZ9A 3OCPA 1PZ9A 2QUOA 2VVFA 1A8DA 3D82A 3H7JA 4PIYA 5A32B 1LGBA 2CYFA 4YG3A 4AI0A 1JXNA 5AC91 2Z42A 2XJRA 1UPIA 3WW4A 5AFBA 4RQPC 2PAEA 3B7MA 5DUVA 2A5ZA 3H7YA 3TN92 1QGLA 4XFFA 4Y20A 4FPLA 2R6QA 4R4XA 1ZBA3 1WW4A 1PIV2 2BQPA 2AREA 1R1A3 3IT8A 4QHBA 4IEUA 1FMD2 1OMIA 1R1A1 1RUI3 4AR5A 7RXNA 4Y20B 1RYQA 1RUI1 4AEJA 2ZJCA 4RXNA 1NCRA 3VBFB 3VKMA 1L3JA 1LECA 1LJ7A 3HT2A 5F9TA 5BYNA 2EA7A 1UAIA 3JCIA 1RJ8A 2R30A 3GF6A 1HW5A 2WNVA 4DRRA 4TZDA 4J1WA 3LWCA 4XIOA 4MUVA 1HKDA 4BZ4A 3RZTA 3AKPA 2ZGOA 2VNRA 4IV1B 3K48A 4YVSC 2ZHKA 3FZ3A 4Y1XA 2Z5WA 4C1XA 1J3QA 1POV1 2WNVB 4JDNA 2RR13 4C91A 4YVWB 3QOPA 1SLBA 2UU8A 4DY5A 2BTVC 4RGGA 4DNYA 1YLLA 1PHMA 5L73A 4CDXC 4E4SA 2RJLA 1WCKA 1G6NA 1S0IA 3HAGA 4K1ZA 3MICA 5JZGA 5EJ3A 3MFAA 1ZZBA 3H3ZA 1R0JA 2W39A 4XFCA 4D69A 1MS5A 4Q0VA 1J1TA 1WMDA 1NZCA 4ES9A 3KCXA 3UV9A 4I01A 4DOUA 2JE7A 3EO6A 3TN91 2HWC2 1CONA 2DTWA 3FJSA 3ZX7A 4CDQB 5KHJA 1PIV1 4HBNA 5JAXA 1ENSA 1FI2A 1FMD3 3APBA 4P9YA 3NW4A 1FOD2 1FMD1 1XU1A 5C4WB 4Q0PA 2XJVA 3FC0A 2LCQA 3HN1A 3IBMA 4PLOA 1I5ZA 2ZCWA 2B46X 1NLSA 4CEWB 1MACA 4LE4A 4LA3A 1VAMA 5T3NA 5BNNC 1O3QA 1MEC1 1G9CA 1LESA 3KT7A 1GV9A 4AI8A 4LT5A 1WA4A 3JUUA 4XF0A 2P3IA 1VB2A 3CO2A 1HV1A 4FXGB 2ZGQA 4YGCA 3S0MA 2H0BA 4HETA 5EYYA 4B8EA 4CRQA 1PZ7A 3S7EA 1DX8A 4NHKA 4K6BA 1S2ZA 4B4RA 1NQDA 3RPQA 3MF6A 5FAXA 4HVRA 2QE3A 1X8MA 2JI1A 5ABJB 4RQPA 4K9SA 1H1MA 4XMIA 2NMOA 4QGNA 4XFBA 2W52A 1SBEA 4FXKB 2IXHA 4QXKA 5HCFA 1FPN2 2A7AA 1WW7A 2V0EA 3MPSA 4N9IA 4XBNA 4Z92B 2GU9A 4YFWA 3M8LA 4RD7A 4WVZA 2EAKA 4NVPA 2HWC3 3AMNA 4MXWB 1FHHA 4X6RB 4PBOA 2HWC1 4PQ9A 3VBSB 2VPVA 3VKLA 1LRHA 1NQJA 2C1FA 1S0FA 3AYCA 3TOJA 4JADA 4RL7A 3BALA 4I09A 1FOD3 4IEXA 1S0BA 1FOD1 4IQPA 4MYEA 5JR7B 3BOPA 1HV0A 4JTNA 3U10A 3ZO0B 5DXDA 4YNIA 3ILFA 1SMMA 2PLV2 3BOWA 5KXCA 3FHIB 3GBWA 2J9UB 1CJDA 4QPYA 4YVSA 3M3QA 3WCRA 5D1IA 5KBFA 1GBGA 1Q8VA 4QQOA 2DCYA 4AEKA 4FTBA 5I93A 4RSUA 2RM22 4QX5A 4D7YA 1EY2A 2R0HA 1S55A 4TLFA 4Y24A 3ZFEC 1HRI2 3PZAA 1LKOA 1URXA 2HWF2 1BYHA 3WXPA 1WLDA 1FPN3 3AJZA 3VBUB 1SLLA 1FPN1 4OUMA 4L2NA 3ZXKA 4IESA 1ZRDA 4DMIA 2X53S 5MGNA 4Q27A 4FOVA 3G6JB 3ZXFA 1AYM2 3UKNA 1V9U2 1QJX2 4KNCA 4POFA 4UBGA 2BBVA 1Q8OA 4R9BA 1LKPA 1EAH1 1PVC2 1RIRA 4IXLA 3UK9A 4EV0A 4GB32 2E7QA 3N3HA 4JGYC 4U2AA 4P9WA 2PSMC 1OOPC 2PLV3 1LKMA 2PLV1 3ILNA 4M3CB 5JWPA 2ET7A 4H14A 2RS52 4L92A 1DQ1A 5GLZA 5LRRA 2VOWA 1RHI2 3GBGA 4JQRA 1LOEA 1TE1B 2LTNA 3B69A 1NA1B 2Z79A 4G9SB 5FPXA 3FLRA 1VCXA 4G4FA 3ETQA 2RM23 1MS9A 2GNMA 1V70A 1QJY3 1X33A 4Q29A 3V0AB 4YZ3A 2D97A 2PYTA 4W6WA 4QGMA 1HRI3 4Q4Y2 4YFZA 2PHRA 1HRI1 3USUA 1NXMA 1KQRA 1T9OA 2DTYA 4LNVA 1RGSA 2HWF3 2PHFA 4JVAA 1FNZA 2VQAA 2HWF1 5KWRA 2BEOA 1ENQA 2H6BA 1H8TC 1DBNA 1Z0HA 4B4QA 3DPRB 3W58A 3USUB 2HEWF 1AYM3 1UZZA 1V9U3 1AYM1 1J3PA 2YPJA 4GALA 3V64A 1VAVA 1V9U1 1QJX1 2MNGA 2ATFA 3LGRA 4QQHA 5HXVA 3ECQA 5JDBA 1AXKA 1PVC3 1VP6A 1PVC1 3HWJA 4JC1A 4GB31 5CFDC 1LODA 1DZRA 4L97A 1AR82 4LE3A 3U4XA 2BPA2 2DFCA 3URFA 1HQWA