4AI0A

Flo5a showing a heptanuclear gadolinium cluster on its surface after 9 min of soaking
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
258
structure length
258
Chain Sequence
GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLOCCULATION PROTEIN FLO5
publication title Complex Gadolinium-Oxo Clusters Formed Along Concave Protein Surfaces.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell adhesion
total genus 56
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4ai0A02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ai0A01
5A3MA 4AHZA 4AFCA 4AF9A 4AHXA 4LHNA 4ASLA 4AHWA 4AI1A 2XJUA 4AHYA 4GQ7A 2XJQA 4AFBA 4COYA 2XJSA 4A3XA 4CP0A 4COZA 4COVA 4AI3A 2XJPA 2XJTA 4COUA 5A3LA 4D3WA 4CP1A 2XJRA 2XJVA 4COWA 4LHKA 4AFAA 4CP2A 4AI0A 4LHLA 4AI2A
chains in the Genus database with same CATH superfamily
3PNAA 2VUML 2VAUA 2O0OA 3K77A 4JQTA 4LO8A 2GNMA 2WINB 3LCPA 4V2VA 5IHRA 3LWOB 5TSWA 1GOHA 3VBHB 5FPAA 4YW6A 4GWIA 3ZYIB 1OF3A 1XJAA 3B08B 4AVBA 5FBZA 1HXS2 1JI6A 3M70A 1WMXA 4JHTA 3VDDB 1DQ6A 2C5DA 4QPYA 2RFKB 1X9PA 5GZEA 3WW4A 2YYOA 2GZWA 4HLTA 1OSGA 3RMYA 3ZFEC 1JZ6A 1JH5A 1ASJ3 3MIGA 5A7WB 4NAMA 4GAZA 2WQZC 4BQ4A 1MS8A 1J1LA 2W3JA 3IDEA 4A3EL 5L9VA 3OGSA 5JVG1 2W52A 3I59B 5H9RA 4EN9B 5JPMB 1S0FA 2D40A 3ZFFB 3F2ZA 2VNGA 3ZMOA 1Q8VA 1PX3A 2WL1A 1I50L 2GP3A 2L0ZA 3DCQA 3GGLA 4N7UA 4AHXA 4Y1XA 4CEWA 5C8CC 4MGQA 5C3PA 1Q8OA 1ASJ1 2W94A 4MXWB 1SPPA 4GMP3 3WNPA 5JDBA 2VZPA 2E33A 3CKHA 1TMF2 4NHLA 1S0IA 2ENRA 4XMIA 2WT2A 4D69A 1MVEA 1PK6B 1RMU2 1WCML 1JYNA 1RYYA 2CV6A 2JI1A 5D21A 4Z2WA 2R1BA 4JGZA 4LPLA 3VGIA 2QTWB 3RGBA 3CJIB 4P14A 3VHRA 1TME2 2JIGA 4YWAA 3USSA 1RXFA 4QKDA 3WSOA 3IMNA 2VD7A 4QQOA 1HRV3 1BQ9A 3ZPOA 2BE5D 4CDXB 5JLVA 4N9IA 3C3VA 3EQEA 4HVQA 2YY1A 3ZDVA 3VKOA 3KHBA 5F32A 2EAAA 3IPVA 4YG3A 1O3TA 3AC0A 3NJYA 5A7OA 1UU6A 2FDJA 1QU0A 1D2QA 2BJSA 5AVPA 4ZXKA 1G8WA 3VBSB 2M6OA 5FUIA 5EFUA 5J37A 2ZACA 4FBFA 4QU1A 2I2SA 3LA7A 3THPA 2ERJA 3MF6A 1HRV1 2CAUA 2IFRA 1H2NA 1ULOA 1G6NA 1GWLA 1W39A 3GF6A 3N7LA 3UETA 5KC6A 3EBRA 3WP3A 1VPHA 4LHLA 2HWB3 4XDQA 4LKSA 5DUVA 1C5HA 3LDKA 2XDVA 4AXOA 1UOGA 1GP4A 2VTXJ 3I3BA 2EXHA 1LOFC 1R0JA 1CPMA 2BBVA 1YYNA 2HH9A 3O14A 2J1SA 4M01A 5IAVA 4CDWB 4AFBA 4UT5A 3RZ6A 1VAVA 2YXSA 3ACFA 1VIWB 1NCQB 1O91A 3KM5A 3OY8A 1JYIA 1Q8QA 1FOD2 2E7TA 5AN9H 3FL7A 1XNKA 2HWB1 3FJSA 4K21A 3MI8A 2E2IL 3PLQA 4HSJA 4Q0SA 1NUKA 1SLLA 4PLMA 4QPIC 1PVXA 5A33A 3USUB 4BK5A 5F37A 3C7GA 5J3UA 5JR2A 2W1QA 2WSVA 1YCIA 3DPRA 3AFGA 2VH9A 3A23A 1ND3C 4LHKA 2CYFA 4D6QA 4BQ1A 5GZGA 2LCQA 2ORZA 3GYDA 4EWAA 3MW2A 3LWCA 5FO9B 1W8ZA 1U0AA 2WQ4A 4R9CA 2HWF1 3Q8BA 3JU9A 1UZWA 1UYPA 3TOJA 1PGW2 2NMOA 2Y38A 3CNAA 3RNSA 1VBE2 5FWJA 3THCA 3DXUA 4EN8B 1QXJA 2XJUA 1R0FA 2PQQA 1YK4A 5FZ1A 1RINA 1XYOA 2YBKA 4H3WA 5DAVA 1LB2A 1S4CA 4Z92B 4Q27A 3B9IA 3SH4A 3ZR6A 4MSVA 4DY3A 1DDLA 2VMIA 3WD5A 3O1TA 5HCFA 1ENRA 5BNOA 3HWJA 4KG8A 1JHNA 3POFA 3WHUA 2W0XA 5FTTC 1JU3A 4EV0A 1HIXA 1ALYA 1BVVA 3AP6A 5CISA 2PYAA 4E2QA 3ZN5A 8RXNA 3J7MA 2XUMA 4H7MA 1RDVA 2ES3A 4HSLA 4RQPB 4WM8B 2B9UA 3AKRA 4BA6A 3LF7A 1O4ZA 1RUD3 3SEEA 4A7ZA 5B2GB 1G86A 2F4PA 4QPGA 7RXNA 3OYWB 1CZTA 2JB8A 4JADA 1SQ4A 2OIIA 2QQVA 3MLLA 3N7KA 5C8WA 2HYKA 1QEXA 1AYM3 2Z69A 3P5BA 4CU6A 2IWGB 3M3IA 1LAJA 2QQOA 1IHMA 1NXD1 1Y4WA 5JCTA 5LBFA 3NAPB 1RYTA 2IXCA 2JDUA 3BGAA 3N7MA 4IETA 4KL1A 5FZCA 4FVVA 4YM0A 4BQXA 3FFQA 3LOBA 3NKGA 2AC1A 3SCGA 1JZ5A 4MG2A 5JAXA 1YFUA 4OI4A 4Q2FA 4D7SA 1SMVA 4X6QB 1JYTA 2ZEYA 1W8TA 1AYM1 2ATFA 5K4LA 1VBA2 3EO6A 4BCUA 2WZ8A 4CZSA 4QX2A 5I0UA 4CCNA 4JCKA 3QACA 4L92A 2FDHA 1LCLA 2YBSA 5LEJA 4P9WA 3FKIL 2G4IA 5D2AA 2Y0IA 4R9AA 1FPN3 2JICA 4Q4V3 2AH2A 4WVMB 4B3NA 3X29B 4WVWA 3B00A 5BNNB 4B4QA 4XOGA 3D0SA 3KV5A 4FPYA 4DUWA 1ENQA 2RR12 2ZEZA 3NJVA 5FZKA 5L7OC 2B5ID 4A41A 4RHV2 4RR3C 4K6BA 4I0AA 4KNCA 4D3WA 1MZ5A 4S2HA 4RGKA 1UY4A 1APNA 4V196 1AR63 1AR82 3OBTA 3U14A 1VZGA 1FPN1 4EN6B 4Q4V1 3MHZA 1VBD2 4FPKA 3SH3A 1QH7A 1PVC3 2JECA 5FPXA 4Q1PA 1RVF3 5JIAA 5KHHA 4CDQC 2NP0A 1RUI3 4LHNA 4ES8A 1N3OA 5A7PA 3BUCA 1ENSA 1Y7BA 1VBC2 3ROUA 4Q5OA 2BTVC 1LHOA 4RFT0 2W92A 1XE8A 2Q1MA 4XUPA 3WXPA 2CHHA 5GALA 3S17L 2YU1A 4UY81 3HJWB 2HYXA 3N35A 4Q4Y3 1HJFA 5IK5A 1RUG3 1SLCA 1F5FA 3T08A 3RZKA 5A3LA 1QXRA 1W8HA 1CAUB 1PVC1 4KH9A 3WX5A 4AWDA 4CP1A 1RVF1 4JKMA 1VZHA 1RUI1 3JD72 1JOJA 2XQRA 2R7ZL 1S2EA 1ND2B 3H1YA 1CAXA 1XNCA 1ZVFA 4CU9A 2PHLA 4SLIA 4POFA 2P3YA 4Q4Y1 5JZGB 4HG6B 1XRUA 3B7MA 3WEZA 4K40A 4FSJA 2OW4A 3KB5A 2WS93 1LEMA 4P9YA 1M4WA 3A4UA 2PHXA 1AYN3 2EIDA 2YC0A 4SBVA 5FREA 2IXIA 5T5LA 1O3RA 1W6MB 3T3YA 4Z8BA 5JXHA 3FLPA 2DVGA 1AR92 3WW1A 1OFNA 2V5DA 4YVSA 5FUNA 4LBLA 3KYUA 3LE0A 2R7EB 5ABJA 2DVBA 2J1TA 1CR7A 5MFPA 1D0HA 3KWVA 1WCQA 1PNGA 3L9JT 4FCAA 5D8AB 4CU8A 1W9YA 2WS91 5A3NA 4FXKB 2QJVA 1RHI3 5A7QA 4GA9A 4XURA 2VMFA 2R32A 3WF3A 4YW3A 1AYN1 3RYRA 2PQSA 2P34A 4IV3A 4Q0UA 3VZMA 2BGPA 3OPWA 3B02A 1FHMA 1A6CA 3FBMA 2QQWA 4O61A 3VBUA 3WNOA 3PIO1 2WZR2 2QKDA 1R0HA 1SEFA 4N43B 4R8HA 4ZU7A 1QJY2 1W2NA 5AFEA 4DOUA 1WJVA 4DFSA 4FFHA 5GAGc 3VBFA 3R6SA 1O8SA 4FPJA 4PIYA 1YO8A 1O7FA 1FV2A 3QOPA 5A6YA 5FZOA 4CEWC 3CL1A 3POIA 2QQJA 3ZKUA 3P3NA 1W6OA 2JI2A 4CUAA 3PTYA 2D3PA 4ES9A 5C9AA 1JYCA 3F95A 4YLZA 1UPIA 5IJRA 4LMFA 3VBOC 4UFJA 4XUQA 3ZOIA 1LULA 4XC9A 5BXXA 3ZSKA 4BLIA 2D6NA 2BDRA 4Y22B 4M0NA 1BYHA 1VE0A 1JZ8A 1C8M2 1H7VA 3VN4A 2VNRA 5K9YA 2JD9A 5I0TA 1SMUA 2GDFA 1SACA 2VMDA 3CZJA 3WNNA 5JIUA 4Z82A 4Y1ZA 1ULFA 3M3CA 1GP6A 4AEJA 1G9BA 3AB0A 5CKNA 1LENA 5ACA2 1G9AA 4FTSA 4CEYB 4AYUA 3O1PA 4M3CB 4NHMA 2JDZA 1LGBA 5C33A 4LKDA 3AL6A 4A6SA 3NQHA 4UW6A 3IDBB 3R4DB 4TXWA 1AXZA 4E6YA 2GSYA 5DZGA 3J8F1 3P1IA 2XJQA 3HNMA 5LA0A 2VMEA 3JB4C 2JDMA 2Y6HA 1VLNA 1ZRPA 5JXJA 4AVSA 4E27A 1N1YA 2HWE2 1LU2A 1H2MA 1H6YA 1ZRIA 4NHKA 1QNWA 4N53C 3MLJA 3IU3I 4DUXA 2BWCA 1W3XA 4KWLA 1CX1A 3LA2A 2A3WA 1K3IA 4CSWA 3S2HL 2QQIA 3A21A 3IDAA 3A44A 1BBT2 2JG8B 1JYVA 3NV4A 2OS2A 3LEGA 3HQXA 4KMQA 4QDQA 2VQ0A 5FIXA 3QVDA 1GQPA 1S2ZA 4ISQA 5FJKA 3WP5A 2RDSA 1B71A 1AL23 3AL5A 3LDRA 1P7PA 4BY7L 4K8FA 1ZZ6A 1QDOA 3PO2L 4CYDA 4QIWP 3SLIA 4AGRA 2IVJA 1NG0A 4H2AA 2AUSB 2XWBB 3PDQA 1NCRB 3T1LA 4LJHA 4FTBA 3DPRC 4A3JL 1JN2P 4BDVB 5I93A 3BTZA 3N9PA 4FOQA 1B13A 4YZ3A 1AL21 4YGCA 4MZUA 2NVQL 1IS6A 4WVZA 1DU3D 3D6EA 2QDRA 4CXWA 1PFWA 2RS32 3O1VA 5LY1A 5HXVA 4BXXL 2W1SA 1JYBA 1H2LA 2CKCA 1V6OA 3JR7A 1CJDA 4D7TA 5C5TA 3AMHA 1PIV3 1EP0A 1UAIA 3WG1A 2I45A 4CEYA 1B35C 4KBZA 2Y6LA 2JA5L 5IUQA 3UL2A 3M3QA 3ZFGB 2HWD3 3FWEA 1V9U2 3I2OA 2F4LA 1XU1A 4NE9A 4YZ2A 5L36A 1VRBA 3MIHA 1DLCA 3NNFA 1W6PA 3RZHA 4BMEA 2BV4A 3POYA 2NYYA 1HDKA 5M5XL 2Q5TA 3IT8A 4LO6B 4NHYA 4U36A 4L11A 1PIV1 3I3DA 3FBYA 1GLHA 3WF2A 5BV6A 1WBFA 1WMFA 3DV8A 4AQ2A 2BFUS 2ZHKA 2DTWA 1PO12 4Q4W3 3VZKA 3O1OA 1BMV1 3HOZL 2HWD1 4AAXA 1QWRA 1SFNA 1XE0A 4YW2A 1CIWA 3C7EA 3I7DA 4PQ9A 4K20A 3VDDA 2CR8A 5FO8B 3ZXFA 4CCJA 2RS51 1AL0G 1QIQA 4EJRA 3OEAA 5FFOC 3KYVA 2CKAA 5A7WA 4OZXA 1UIJA 5GZCA 3K3OA 4Q4W1 1RUE1 1O5UA 4ME3A 5DAQA 2ZX4A 5FOJB 4DNYA 3T30A 4XFGA 4Y20A 5K8SA 2K0GA 1V6KA 4XZUG 5JVVA 4CCLA 5BYNA 2P4EA 2TBVA 5IVJA 1B2JA 4XMAA 5BPXA 5AC91 2VMCA 2PVEA 4L97A 1HQNA 1COV3 2PYTA 3E6DA 3VKFC 3ME2A 1CQ9A 1YQ5A 2YU2A 4OHWA 5LBCA 3POWA 4MXWA 2H6BA 3WG3A 1QQTA 1B2OA 1WA4A 3CU7A 2ZXQA 3B69A 1FHHA 2WSUA 4CXXA 2PSMC 3UJOA 1PK6A 3B5LB 3BPZA 2WDBA 4C1XA 3V65A 2YROA 4AVAA 1EAH3 4QQPA 1SG3A 2R30A 1R64A 4QB6A 5FLIA 1JTZX 2PLV3 2FMYA 3ILFA 4LKEA 5M0TA 3CJIA 1COV1 2XBO2 4I30A 5F3EA 5GLTA 1YUXA 3MIFA 1OA2A 1XNTA 2RMU2 5LA1A 3SKVA 1QQP3 3M1HA 1CWPA 2JD4A 4CDXA 4H7LA 2A68D 1OQEA 1W8UA 1EAH1 1URXA 4CCDA 4DS0A 4E2GA 1OVPA 3PMSA 4C3IL 3ZXLA 3MV01 4YYOA 2VZOA 4QPIA 2PLV1 1PNFA 3VBSA 4DQAA 5FZ7A 1G9DA 1MS1A 4FPHA 2VUJA 2WFPA 1ND3A 4HKOA 1JUIA 3LWRB 3GTML 4LBQD 3U07A 1LNSA 4A42A 4D6SA 5JOYA 3IAQA 5EJZB 5FZ9A 1W6QB 3W5MA 4UOJA 3RS6A 4N7IA 3KVBA 2BU9A 3ZYPA 4CCCA 1O6UA 5JMCA 5MLC3 4GH4B 5MGNA 2WNUC 1ACCA 1LKOA 4JDMA 5EIYB 1W9SA 3HJYB 2E32A 2FZ1A 2ARAA 2ZCWA 4JTNA 5JI9A 2LTNA 4JKKA 2WFF2 4Y4RA 5FYTA 4FFFA 1E5HA 2Y6KA 2Q8EA 2KKDA 1R9TL 1RUOA 1CAWB 4OZOA 4CDWA 1VMHA 2VPVA 1PFYA 2OA2A 1W90A 3DKWA 4AR3A 2R043 3GM8A 5A3MA 1A8MA 2BYVE 4KU8A 3UK9A 5DAXA 1LODA 4IXLA 1Y9GA 3PZAA 4LA2A 1TNRA 1DZRA 1HX6A 1UMIA 2VC9A 4IL7A 3USUA 1VP6A 4QX7A 3L2YA 5CFCC 3RZLA 3AX4A 4YVSC 5H9PA 1OH4A 2JG9B 1R083 1AF9A 1ZRFA 4NR1A 3O1SA 4FTEA 5FQ0B 5ABJC 4PQQA 3ZO0B 5I0SA 2ZX3A 2J1VA 3FHIB 2M6PA 4UBHA 1W04A 3HQUA 2D97A 3H0OA 1IG3A 3SKJE 1UOJA 1AXYA 4M3CE 2G9FA 4IV3C 1W9WA 1FT9A 4EN7B 1QXPA 4GB32 4AI0A 4QX1A 4XBLA 1MS0A 1NNQA 1HRI3 2VCBA 5LK5A 1A78A 4A45A 4CUBA 3H8XA 1ULEA 2BGOA 2NLRA 4QMAA 2DUPA 2F6BA 1VJ2A 3AMNA 5FYHA 2GALA 3AZZA 3OGGA 4MHUA 1MVQA 2M4VA 3J9SA 2MEV3 3VBFC 4YPJA 3EB7A 2YPJA 4LTAA 4XTMA 5JOZA 1UW8A 1S2BA 1LTEA 2QQMA 4GIQA 3U78A 3HOYL 2P37A 3LIGA 3LZZA 4FOYA 4HK9A 5IYCL 2Y6GA 4COZA 1VBB2 2GU9A 4RQPA 2CGPA 1HRI1 3N9MA 4WM8A 4XFHA 5FXZA 4RGGA 2H0VA 2JKXA 3GTLL 1NX9A 2HEWF 2JDPA 2W46A 4J25A 5FYZA 5FZ8A 2DURA 2R0HA 5C9AC 2XQXA 1E5IA 1U5YA 3OYWA 4JZRA 1WLDA 3B0AB 2WNVB 3J26N 5F6LB 3M3YL 3ZXKA 4CA9A 4IESA 3WDUA 4IV1B 2MEV1 4TWTA 4U2AA 3BOPA 1FX5A 4ASMB 3SQOA 1MPXA 1KGYA 4BE3A 1UX7A 2OZJA 3ZXJA 4NROA 3ZXAC 1NKGA 1Y43B 2CTVA 3AP9A 3JB8A 2BPA2 3VPBE 2O8OA 4OHXA 4BH9A 1GV9A 3MDPA 3C2UA 5J1XA 2VE1A 4DRVA 4ATEA 4HVRA 2W2IA 3LOIA 5F2WA 4CDQA 1GBGA 2K2SA 3M7AA 2P2KA 2J9UB 2ZGLA 1W28A 2ZEWA 4AG4A 2OUJA 1C5IA 3H8OA 3I49A 2NM1A 5L9RA 1ZRCA 5ISLA 1LRHA 3ASIA 1RUH2 1ST8A 1H2KA 3TAYA 3BIWE 3OTFA 3ZXEA 4BISA 2WAQP 3B01A 3NRUA 4WVMA 1G9CA 2YC2A 4BBRL 1HXS3 5CKMA 1I6XA 2DVAA 4Q0PA 2XONA 1OFSA 5F3CA 2Z3RB 5GLUA 1VZIA 1K5MC 1PFUA 3WNXA 4H55A 3GHNA 3T1MA 5C3EL 1JYXA 1BE7A 2AUYA 2E63A 2P6CA 2YU9L 2BWAA 4B7KA 5L9BA 4F3JA 4UYBA 5T5OA 4AEKA 3GTGL 3D8CA 2FCUA 3I2JA 5A1AA 3VLBB 1POV0 3NV3A 1ENXA 1L3JA 4PI2A 3CMGA 3OD0A 2E9QA 2WNEA 5DQ0A 5FZ3A 3VBRB 4QWNA 4LKFA 1ZA7A 1HXS1 1W2TA 4OMCA 5IP9L 3PKJA 1DQ5A 1HB1A 1S0BA 4A3DL 3DEMA 4AAPA 3OUHA 4LOTA 4LBMA 4L8QA 2IXHA 2AENA 4IUGA 3HOWL 4JGYC 2ERFA 2B7YA 3VB9A 1XYPA 2WQ8A 2CNAA 1H6XA 1DIWA 1TMF3 1OLMA 1GNHA 1W03A 2XUEA 4Y5SA 5IAXA 5KC5A 5RXNA 4LLOA 1NA1B 4LBJA 1OF4A 5DDJ2 1JZ3A 5FBJA 1GOFA 5G05L 3HNBM 3V0BB 4B4PA 5J36A 2VVDA 1KQRA 2BZDA 3NJZA 4BLJA 1MS9A 2QNKA 3TEWA 2OPWA 3ETQA 3MYXA 1NE6A 1XC6A 4K1ZA 4EYUA 2WB1P 5MF6A 1QOOA 1O8PA 2ZEXA 1VB2A 3FZ3A 4RSUA 1XYNA 5FPUA 1WCSA 5JZGA 1TMF1 1YNAA 3TB0A 5KBFA 3IBMA 2WA4A 1BEV2 4P00B 2BNMA 4AQTA 1LESA 2WT1A 1AJOA 4DXTA 1OLQA 4E8DA 3MFAA 3J7Z1 1K5JA 2V0FA 1D4M2 4ET7A 3DGTA 2Q1ZB 1OWBA 2P5BA 4JV4A 5FXXA 1W6MA 4BU2A 3AMQA 4BIFA 3PIP1 1D0GA 4NIAA 2Y60A 2ZGMA 4ASLA 3LIHA 5KHIA 1I9RA 4JHZA 5A7SA 2GC2A 1REDA 4LIUA 4DEQA 1IOAA 4RL7A 3B94A 1IRNA 1HB4A 5FZIA 4IEVA 3OD4A 5FZEA 1VR3A 3VBOA 1GQGA 3ZM8A 3VL8A 3MZHA 2NMNA 4X6AL 5DZEA 2VW0A 1C09A 4Y1UA 3DXTA 1YI9A 4AOCA 2O14A 3I8TA 5JPNB 1K83L 2F17A 1T2XA 3VDDC 1S2KA 2R6QA 2ZHMA 4XEZA 3H1MA 1CADA 4CP2A 2X29A 4LO5B 5FP7A 2GN7A 4LULA 2XLFA 2XR4A 1DF0A 3QCWA 1XNAA 3DF0A 4XJZA 4AFCA 3K3NA 4NMIA 2Z4FA 3U0ZA 2DTYA 4KG0A 1FOD3 1G7YA 4IEQA 4KGGA 4A44A 4BZ4A 3ZFFC 1CZVA 1WMEA 3SISA 1U5ZA 2O5JD 1QJU2 5I91A 2QZ3A 3RZDL 4R9BA 2D93A 2VZUA 2ADEA 3O1RA 1QY4A 1YC61 2RG4A 2QDNA 1ZBE2 1ZRRA 4CTEA 4E4SA 1WCUA 2EICA 2P3JA 3I2HA 4GWMA 4YFWA 3V0AB 1FOD1 1PK6C 4CCKA 4C0BA 4N53A 2WLQA 2XVLA 4OHVA 1ASJ2 4Y4YA 5LB6A 4BBSL 3DYOA 4BYYA 4AHZA 1O5LA 1EUUA 1O59A 4M0HA 5A6QA 2X09A 3CJIC 5EXOA 1GU3A 3FMGA 2DV9A 1R1A3 3CZUA 1E5RA 1XSQA 4XZPA 1RJ8A 3GHMA 2GP5A 5F5IA 4Z2AA 3K48A 1JW6A 1PZ8A 2KN9A 2BUKA 4YZ4A 2B39A 1VMFA 2HWF3 1PGW1 1UCXA 4IDZA 4CDXC 1V6NA 1OOPB 3KZ4C 5CADA 2GAUA 2ARCA 1DBNA 1JMUB 4NRPA 3WUCA 4HPKB 4YGDA 3IM0A 2FHRA 4KQ7A 3OBAA 4HN0A 3VBSC 1HW5A 3Q8CA 1R1A1 1ZZCA 4LUMA 5FZBA 3RWNA 4WZCA 2J1AA 4QHOA 3CBNA 4C0HA 5F8PA 1UZYA 1SLIA 1PZXA 3I4ML 3B93A 2PN5A 4YGEA 3PIJA 2XVGA 3K46A 3M4FA 5CAZA 3CHXA 3VV1A 2DFBA 5LASA 4CRQA 2NN8A 2Y8KA 1NQJA 1RITA 1YQCA 2A73B 2JG8A 4AVTA 5L7OA 4CXYA 1OA4A 2ZJCA 2PPTA 1V0AA 4FI9A 4HN1A 4URAA 2PXJA 3QH7A 1B35A 2EIEA 2BNOA 4CDWC 5CB7A 3JBG3 3MUY1 2DF7A 1WD3A 1CN1A 3SMHA 2I07B 1NCQC 1SLBA 1YJLA 1VBA3 4ARXA 2K2DA 2ZOEB 2ZAAA 4LO4B 2AZ5A 1BQPA 4KWKA 4F7ZA 5EINC 1AR72 1NLRA 4DZGA 2A69D 2WA3A 3MLKA 4IEWA 4ZHNA 5FYYA 3T0DA 4JQRA 4UAPA 5A3TA 3KHCA 2QUOA 3AYAA 3NKTA 2OQ7A 2YBPA 1K42A 3DUIA 3N7JA 1VB4A 5HCAA 1LGNA 2QQKA 4MGIE 3PIGA 4QXKA 4CUCA 2UWCA 1PZ7A 2XVKA 1DGLA 1S0DA 1B09A 2RR13 3JBG1 2EALA 3LSEA 4HBNA 4XJWA 5GAEc 2ZGTA 1VBA1 3Q9OA 4K7JA 4RHV3 2V4VA 2GNTA 3WQ1A 3N36A 4COYA 4RYDA 2FCTA 2NYDA 3VKNA 1Z78A 3ZYJB 4A3XA 3OJBA 4CCMA 2BOJA 3HBZA 4JKLA 4PBOA 4B1LA 2VU9A 5FZHA 1BJQA 1VBD3 2CSGA 2D44A 2VVFA 5FMDA 2XWJB 2HEYF 2PAEA 4TVMA 3ZFGA 3WP6A 4ZY9A 4CDUB 3SXWA 2RR11 1XU2A 3POSA 1VBC3 1X82A 2D3SA 1DQ2A 4RFRB 4RHV1 1MACA 2JDAA 2P1BA 4Q26A 1DZTA 1WLWA 4XVHA 1CAAA 2Y0SP 4JRAA 4BPZA 1UY2A 1IQAA 1AR81 1BK1A 2C6BA 1C3HA 4RQPC 4J1XA 3ELNA 1VBD1 4WM8C 1WD4A 2W95A 2UU8A 3HT2A 4CVUA 1GZWA 3LPFA 3U37A 1BFYA 5CG8A 2W08A 2P6HA 1NY71 3SCHA 2ZBJA 2E31A 2EA7A 3GNEA 4MGTA 5FJ8L 4BOWA 2WBKA 2D6PA 1VBC1 1IS4A 4W4ZA 3OOXA 2LRPA 2JI3A 2HJIA 4F8AA 4QD2A 4Z1VA 2YV8A 3AM2A 2ZX1A 1ZBA2 2R92L 1C1FA 2GH2A 3NAPC 2WT0A 2WO3A 1LR5A 5K0UB 5C3SA 3MPSA 1A34A 2FBEA 1UZVA 4B1MA 3MQKB 1C1LA 1WUVA 2TNFA 4QPWA 1JZ4A 4WVVA 1F2NA 3VL9A 3WQBA 3JZVA 4Y33A 4XUNA 5KXDA 1K12A 1GP5A 1ULPA 4Q0VA 4HONA 1AR93 2DCYA 2ZTNA 1RUD2 3VZLA 4TPUA 1QNYA 4OYUA 4I09A 4YW5A 2XPJA 1F15A 4ORFA 1PX4A 1BHGA 4IGQA 1AYM2 1UN1A 2O1QA 4P9XA 3BPSA 1J84A 2OUHA 4UFMA 5F3GA 5G04L 5BNNC 5FP8A 3AYDA 4C2M1 2A1XA 2PVXA 3S1QL 1DGRN 1OVSA 4RS5B 5JSOA 4FPFA 3OGJA 5K2ME 1AR91 3GZUC 2WNUA 1QJX2 1ZM1A 2WZEA 4HZFA 1N3PA 4UBGA 3RWKX 4ZN1B 3J7NA 2WZR3 1U5XA 2JJ6A 4XUTA 2DSXA 3LPEB 1I3HA 2D6OX 3ES1A 3OPTA 4AFDA 3KT4A 2WAAA 5DAWA 3W21A 2WIIB 2WRAA 1EYBA 3LA3A 2JA8L 3TEYA 2CGOA 2QCSB 2JX9A 2J42A 1OUSA 3FDJA 4TLGA 5AVAA 3I3QA 1DHKB 3FLTA 3E6CC 2XL7A 1DQ0A 2ZS6B 3O12A 3OSDA 1FPN2 3U1XA 3W9AA 1F5JA 1SCRA 4DUVA 4XW3A 5IK7A 1ULGA 2LUWA 4A93L 5CFCA 2WZR1 2QBXA 2V73A 1IW7D 5IVCA 4S2GA 3JCIA 3ZYBA 1J3QA 2G9ZA 4IEZA 3PO3L 4A3LL 1YFXA 1W6QA 2BOIA 5IWFA 2DYCA 5BUVA 4LBOA 1WZXA 4GJYA 4CP9A 2J22A 4IEXA 4CPBD 3CDZB 4YGBA 1AR62 3RZZA 2WN3A 4OLLA 5FY9A 4GH4A 2VQAA 4XBNA 3I54A 5T50A 1ND2C 1Q3EA 2QE3A 2K9ZA 3E5QA 4G3YC 5J96B 4A3KL 4LORA 1Q8PA 3BALA 4UW4A 1RUI2 3APBA 1CAWA 5JZGC 3KCCA 1V6JA 3LEIA 4CUGA 4D8MA 4L0PA 5IY0A 4JAEA 2GH8A 5ACA3 1CJPA 1RUC3 2JE9A 3HVDA 2G1MA 3I2KA 2R072 1W0NA 4P08A 1F4AA 4MLOA 3K4AA 3FX3A 3KS7A 1PMIA 2W39A 1RUG2 2C9AA 4PF5A 4AEMA 4BXSV 2HWC2 4OHYA 2HEVF 5CNAA 1X50A 2VZSA 1YIPA 4UI9L 4XQDA 3VD9A 4INDA 5FQ0A 3A0KA 5D8AC 1O3SA 5IYYA 3T2PA 2VM9A 3FN9A 4JGZB 5F3IA 2VCCA 2VUDA 1F9KA 3MUZ1 3GBFA 2BRTA 5LBBA 5ACA1 3ST7A 1RUC1 2LM3A 3UGHA 1WWYA 5IFTA 3GTKL 1H4GA 3AMMA 4Q4X3 2YZ4A 5CIRA 1PGL1 2VNOA 4QKFA 3DYPA 5IATA 5JOXA 4AVVA 5DUUA 2YGMA 3AVSA 5A32A 3FE5A 4RN5A 1GOGA 1EV13 3AKTA 4FPGA 5KXBA 1AYN2 4N43C 3IPVB 3J8F3 3JQWA 2AQCA 5FWEA 5I0DA 1F8VA 4ZPIA 1H0BA 1F31A 2IFWA 2ZZJA 1H8TB 1IKQA 1LOCA 4CPBA 3TWIA 2VQTA 1GZ9A 1AXKA 2Y33A 2LROA 3ATGA 3RSJA 4Q4X1 3TNPB 5DMYA 1XOYA 5EPAA 3RMXA 5FYCA 4C3HL 4EWEA 4AR4A 5C4JL 3LEMA 1RHI2 4R52A 2VUAA 1EV11 2EIBA 2CDOA 1H9WA 4NRQA 3QQCE 1LHNA 2E7AA 2Q30A 3VZJA 2ZGOA 3ZSLA 4P9IA 2WNVA 3ACGA 4CU7A 5CVRA 2GC3A 4I01A 3FHQA 5JSPA 1PHMA 1K5MA 2IXLA 2IZWA 2P3KA 4GD4A 4D6RA 1WKYA 2BNNA 1CX4A 3M3EA 2FDGA 3MEPA 3I4NL 1IU6A 2WC2A 2ETEA 1R092 2D6KA 4NWVA 5J98B 3IN9A 1QMJA 3J7HA 1UMHA 2GC0A 4PCRA 1UY3A 4QDSA 4QXCA 5HV4A 1I6HL 1FXZA 1IU5A 2RHPA 1V9U3 2JDKA 3WT3A 5A33B 4Y24A 2EY4E 3NNMA 4W50A 2V0EA 2RS31 4CEYC 5C4WB 4OUSA 3MICA 2R0FA 1KDKA 4AQ6A 4JGYA 1KD7A 3NNJA 1YK5A 3OBRA 1ODHA 1POV3 2AYHA 2A5ZA 1PO13 1UF2C 2GNBA 1QJFA 3GBWA 4NOTA 3UGFA 3V64A 1W8NA 1JZ7A 1LKPA 5FDBA 3E6BA 1V9U1 4Y5TA 3H3VM 2NPIA 2UURA 3H8RA 2A6VA 4MXVA 4HVOA 4XJ9A 3KYYA 2WO7A 3UKTA 2X05A 3HD8B 5FZMA 5IK4A 1RUF2 3BKZA 1DYKA 5BNOB 2OPKA 3WR0A 2QZ2A 4BK4A 1RUJ3 3LB9A 1ULDA 4LK6A 4AE2A 2JG8C 4Y26A 3WHTA 1POV1 2CAVA 2A6ZA 1DLLA 1PO11 1SHWB 4I3GA 5EIOC 1O4YA 4S2DA 2VR4A 3CEWA 5CFDB 2W1UA 2RDQA 2PHFA 3ORJA 1DGWX 2YMZA 3N9QA 5FJHA 5FXVA 4YG0A 3AJYA 1C8NA 1DYOA 1ZZ7A 2W5FA 3AZXA 3KF5A 4XHBA 4I0BA 4AQSA 3ZIXA 4FXGB 4XJAA 3H9AA 4CP0A 4MGSA 4QPGB 4LXLA 2UWAA 1RUJ1 2E53A 2RS53 1NCRC 3H42B 3RZMA 3ZR5A 4Q8LA 2UYBA 3ZVXA 1F4HA 2FMDA 4GJZA 5F1RA 1NA1A 2WLPA 3VBHA 1S0CA 3WG2A 4EN0A 5JOWA 1SBFA 1RUE3 2XLAA 4FOWA 2VZVA 3EHKA 5GKAC 4NJ4A 1W2AX 4ZZ8A 2KD7A 5FP9A 2VW2A 2X5IB 1HB2A 2LS6A 4ZKTB 3H99A 5AC93 3CQZL 1TQ5A 4IE6A 4PDWB 3ZX7A 1ZA4A 2E51A 1FMD2 2RMU3 3ACLA 4QQ2A 3MIDA 5BNPB 3AYEA 1AL22 4AHYA 1GMMA 4DRRA 3EXUA 5IVYA 3UKNA 2RM22 2PAKA 3KVAA 1V00A 3GZTB 3B9CA 3R05A 4MO3M 4B8CD 5AI2A 3I59A 2RS13 3IIAA 4JRLA 5FLHA 3ZFGC 4BQYA 3HN1A 3ZFFA 1VRH2 1BCXA 5J48A 3LWQB 1GSLA 2B45X 3LPGA 5FYIA 1V6IA 5A70A 2XBO1 4PBPA 3O0XA 5LRRA 1ZZBA 3FUOA 5KR7A 2A6XA 2C4XA 3R0RA 5DN2A 2RMU1 4QKBA 1QKQA 2DCTA 3INAA 1BRFA 1UQXA 3M8LA 4HETA 4XETA 4B4RA 3GDBA 5C70A 1QYBA 4MGZE 5F2SA 2V3BB 4AR6A 4XYXA 3U10A 3I2FA 3O0WA 4NRMA 4PLOA 2RS11 3NV2A 2DVFA 5LEKA 1SDWA 1PIV2 1W9FA 1HQWA 2DVDA 4GULA 5DZFA 4YFZA 1GQHA 3NJXA 2OQ6A 4K9SA 1BMV2 3EJKA 3D0JA 2HWD2 4COVA 2FQPA 3ZYRA 3MGUA 1MQTB 2A75A 1WA6X 2WNOA 4DO0A 2VECA 2YG0A 4HMZA 1POQA 1JU4A 4LEJA 3BU7A 1AHSA 5C6CA 4MH0E 3UESA 3PVEA 5FV3A 4AW7A 4ITCA 4C8DA 2RJKA 5E1RA 4ZS3A 5LBEA 1OWCA 1IG0A 4Q4W2 2OKXA 3ZKYA 1US3A 2WFF1 5H9SA 1N1VA 1RXGA 2ZA9A 5FY1A 2WYFA 3EYPA 2E2HL 1BLZA 4Q1RA 3GCXA 4P02B 4R4ZA 5KXCA 2J1UA 5JUVA 1Y1VL 2YFUA 4XE9A 2W47A 2PHRA 1UU4A 4UF0B 2W1WA 4XCBA 2KA3A 3J7LA 2XJSA 4MHRA 1OHFA 3ZMNA 3ZXGA 3VKMA 3BCWA 1NT0A 2FDKA 5FZ6A 1TEIA 4JDOA 3VD5A 2C1FA 1AUYA 1BK0A 5FK7A 3OUJA 1W99A 1EY2A 2AR6A 1GWKA 2AACA 2VULA 2VQUA 5ANNA 2O8QA 5I8SA 1IROA 3UJQA 2R93L 1TG7A 4I2OA 1YI7A 2ARBA 2ZGUA 5FUPA 3T2QA 4A3GL 2ZGSA 3I97A 1TZOA 1BVP1 4Y1VA 1NCQA 1OOPA 1DQ1A 4MUVA 2VG9A 2A6YA 5ABJB 2JA7L 4HPKA 1AVBA 1H1MA 3I4IA 5I0RA 1WW5A 4XF0A 5JXIA 3WUDA 5KHGA 3VHNA 1LHWA 4P9JA 2IXJA 1JS9A 3PKIA 2ZMLA 5SV5A 3WLUA 1IZ3A 1HKDA 2E6VA 3C7OA 4AEDB 5DUXA 1OI6A 5GAHc 5M5WL 3SEPA 2PLV2 2NVXL 5K7PA 2JDHA 1E8JA 4ARYA 3VBUB 4ZN3B 5IYBL 2Z2SB 3QBQA 1WMDA 2WR9A 2HKXA 1GUIA 1WBLA 1OUXA 3OPZA 3KLSA 2WO1A 4OULA 1UNBA 4GH4C 4XFIA 5CZKA 2V5YA 1QQP2 1OKOA 2WABA 2XLGA 5FZGA 3T09A 4WM7B 5LZ6A 3L2HA 4C3JL 1E5SA 1Z0HA 2QVSB 3MIEA 3K75B 4CCEA 5GJ6A 4CCOA 1FV3A 4ZU5A 2XH6A 2I74A 3JXSA 1C28A 4IW3A 5FZOB 5FYVA 3VDCA 4BB3A 1H9PA 3KV9A 2ZKLA 5JWPA 1W6OB 3RVHA 5EZWA 2UYAA 1LOGA 1LEDA 1MEC2 1Q8SA 1PO23 1NE4A 4XFBA 3TEZA 4NIDA 3BOWA 3LNLA 4COUA 1E57A 1YFWA 1ZYBA 3FUQA 3N9LA 3OB8A 4NUBA 2JG9C 3LDBA 3IZOA 1T9OA 4L2NA 2SLIA 4A2UA 4IEOA 5FOBB 3ITQA 4FPEA 4MGKE 2R062 2EAKA 4OMDA 4UW3A 3T0AA 3PL0A 2WUHA 4XXAA 3WOGA 3WWLA 1JYWA 1UXZA 1PO21 3WNKA 4BJ0A 3K7AL 5E8AA 2CL2A 1RUH1 5I8YA 4LA3A 3HMYA 2Z42A 3NAPA 2PHUA 2GMPA 2M4YA 2R042 3LFMA 2ZGRA 2WWJA 2XOMA 2ZABA 3LSDA 4FT8A 3UNPA 2C6SA 2VBBA 4PJYA 4M4PA 4U671 4O65A 5HCHA 4PI0A 3GTJL 2CU5A 4LBNA 2XG3A 2N7GA 3TN92 1BKZA 1JOPA 1R082 2RJLA 4JC1A 4E4DX 2YHJA 1YIFA 1AX2A 1IQDC 1ZZ9A 4KWJA 1CAVB 2ZGPA 4IGPA 5FKCA 1V70A 5FP3A 1EUTA 3W20A 4QXHA 3VKLA 2BFUL 1I5ZA 2JDNA 2WNVC 5BNNA 3AXDA 5IVBA 3MBWA 2YPDA 1HRI2 4E2SA 3AP5A 4IV1C 1RDGA 3HBKA 3MIBA 2FZ2A 4AI8A 1NLSA 4YVWB 5GM0A 4EROA 4NPLA 2HBUA 1DVBA 3U75A 2D7FA 4MV2A 2QQUA 5F5AA 2JWPA 5K0UA 1BEV3 2DBIA 1KXGA 4AFMA 5LY2A 2MEV2 1YUZA 4A3FL 4YARA 2Q4SA 4K1YA 3K4DA 5E89A 5FLJA 3H9CA 1RB9A 2XJVA 1LU1A 5HV0A 2JEMA 4F83A 3BI3A 2MS3A 3BIEA 4DINB 3WQ7A 3E5UA 2BW8A 1DZQA 1V6LA 3CIHA 2ILMA 3D82A 5EWSA 1XXNA 3RQ0A 1QGLA 5E16A 5F9TA 2IC1A 3PURA 1X8EA 4V1PA 2LALA 2GC1A 3GXUA 2Z79A 5C5UA 4NVPA 5ANQA 4BM8A 3WNLA 1BEV1 5A7NA 3RZGA 5FZFA 4E4HA 3FFZA 3IKWA 1CAUA 4GQ7A 3Q8EA 1QJEA 1D4M1 4IGOA 5DG2A 1RMU3 1YXWA 4RS5A 2ADDA 3QH6A 4O9GA 3ZFEB 4AL9A 4B29A 5A3PA 2VUCA 4FFIA 4LE4A 1NZIA 1N3QA 1QCVA 3VDAA 1ND2A 4IE5A 5CKQA 1SFYA 1CZSA 1TME3 3K35A 1XSRA 5BY5A 1BQ8A 5EJ3A 3RDIA 1O3QA 1W8WA 5H1Sc 4JDNA 3RZOL 4OI0A 1SMMA 1W6PB 3HOVL 5DAPA 3VBRC 3S0MA 3WV6A 1S24A 3A0NA 5JMOA 5FYMA 1RMU1 5C8CB 3KCYA 4KU7A 1QJU3 1S0JA 2E26A 1D4VB 4DEVA 3G7DA 5CU1A 3P6BA 3PUSA 2NVYL 5CYYA 1OC1A 5DG1A 4ZS2A 3RZJA 3ACIA 1TME1 3OG2A 1U5IA 3BVCA 4WZFA 2A7AA 1ZBE3 1Z7S2 5D8AA 1X33A 3TBDA 4JX0A 1TE1B 2VNVA 1NA1C 4MOAA 4G6BA 1MS5A 3VBHC 3RFRA 1UOBA 3VD4A 2E2JL 4QX5A 2QL0A 4G4FA 4A7KA 1OPOA 4YW1A 4AGGA 1QJU1 2UWBA 1RB8G 2XXZA 1OMIA 5D1IA 1UZZA 2A70A 1HJGA 1LGCA 1Q5OA 4AI2A 2A71A 1W6NB 3AP7A 4Y20B 3AFKA 2CGNA 4N43A 3HAGA 3LEKA 1ZBE1 2JDYA 5A3WA 3O5SA 3HT1A 3KYWA 4O7XA 1RC6A 1ONAA 1PMJX 4LO7A 3RPQA 2CWSA 2D6MA 1YLLA 2PHTA 4YZ5A 2LW8A 5FYUA 5JXGA 3BTYA 4XPVA 2YDEA 5I8TA 3AXEA 5FP4A 1FATA 4A6OA 1UMZA 5LA9A 2D3RA 1HN0A 1Q56A 4L99A 5JVH1 3RYKA 3KCXA 1RUNA 5C3OA 4COWA 4E4ZA 4LITA 1SDDB 1SBDA 2SBAA 4NWWA 4QDRA 4IQPA 1VBE3 1G9FA 4GMP1 2BVBA 3ILRA 5KXEA 2VBPA 4OI2A 1UPSA 4Y22A 3AKPA 3U4SA 4RXNA 3RYGA 1UKRA 5J09A 2HBTA 3WDVA 1CGPA 3HJRA 3T2OA 5B4NA 1JODA 1ODMA 4XDOA 2JE8A 1YFYA 1NYWA 2DDUA 3KT1A 3ZSJA 4QPIB 4PIZA 1H8TA 4BXFA 3HKZP 4ZU4A 3SITA 2R49A 3ZXDA 3M3OA 3BN6A 3TRSB 5GLZA 5F6KA 3P2AA 2VZ3A 4A3BL 1AR73 4XFFA 1ND3B 1VBE1 5JI7A 1BZWA 1YEWA 1XNBA 1FI2A 2RDNA 4M3CA 4UW5A 1GICA 4BQ2A 4ZZ5A 2OX0A 4Y5Z0 4FFGA 3T4VA 4NIHA 2WAOA 3NVCA 4QKNA 4XF1A 2B42B 4W8JA 1AX0A 4FQZA 6RXNA 4ONUA 4PHZA 1UX6A 3KQ4B 3WDXA 3CLPA 4QGMA 1HN1A 5DPNA 2DUOA 2D98A 1DP0A 4AYBP 1QH6A 1U12A 4HOOA 1FYUA 2VCAA 4XDPA 4DIQA 1LECA 4BQWA 4EZHA 1AR71 1OBNA 1REEA 1HQLA 5DM71 2VZTA 3HR9A 3RRDA 3WCSA 4YZ1A 4XIKA 1J59A 3DYMA 3S30A 2ZMNA 3ZDSA 1HRV2 3LKJA 1STMA 1LOBA 4JAAA 4AGVA 3G6JB 1NXGA 3FC0A 4A4AA 1PGSA 3POBA 3N9NA 1AJKA 1D2SA 3CQOA 2XJPA 1QF3A 1TVGA 3BB6A 1XB9A 4LBKA 2PMWB 2EXIA 4H14A 1YQ2A 5FYBA 1YV1A 4BIOA 5J7MA 3W59A 3UV9A 4FAHA 1GNYA 3ON7A 3W58A 5C4WA 1OOPC 1YRZA 2UY9A 2VMGA 2YGLA 2ZKNA 1OH3A 1V6MA 1RL3A 3PUAA 5T5PA 5IYDL 1UY0A 3NO8A 4XAEA 3S7IA 5JSRA 3VDBA 5M3FL 1NCRA 4P9LA 4J6GA 4TTGA 2NZ9A 3VZNA 3ETPA 4EZ4A 1QOSA 1W0PA 2HWB2 2ZX2A 2PHDA 3ECQA 4NIGA 1TWCL 1QHDA 3PVBB 1LTLA 1RTVA 4LBQB 4YRDA 3N4MA 3H0GL 2WYSA 1R1A2 2ZGKA 4QGLA 3WG4A 1ZBA3 2VL6A 1LKNA 4K9FA 4UFHA 4YM2A 3GTQL 1UXXX 1SFOL 1UZ0A 1WCKA 4AI3A 1J83A 2VMHA 4NIIA 1LKMA 2XJTA 1AR83 2JB4A 3LQCA 4I3PA 5FZ0A 2HWF2 5EYXA 2Y0OA 4KGQA 1R0IA 2BP6A 5CFDA 1W8FA 2W68A 4WV8A 1MR5A 4QAWA 3ZN6B 4D0QA 4DMIA 3AVRA 1XE7A 4AFAA 2W87A 1S0GA 4QGNA 5LK7B 4HXCA 2EIGA 1GYKA 4MADA 5T54A 5GLWA 3RYPA 2R16A 2XL9A 1UYXA 2JE7A 1ZBA1 1OPMA 4Y1YA 5FYSA 2ZAHA 4LOSA 2ARXA 2WJSA 2GNDA 3P8BA 3M2MA 4FP3A 1WW4A 5FAXA 5FZLA 4Q29A 2WWUA 2A6ED 3K51A 5L7OB 5FPBA 1EPWA 4GALA 1VAKA 4RR3B 4UWDA 3PTRB 2C0ZA 1N1TA 3H3ZA 3ABZA 4GXLA 5ERLA 3AJZA 5B4XA 1GZCA 1WCDJ 3IIIA 3JD73 3POGA 3H8UA 3NNLA 4O9EA 1QJX3 1RUD1 2X5IA 1MZ6A 1J3PA 2VVEA 4NO4A 4PDWA 3K2OA 5BNPA 3JBG2 4CDQB 4XILA 4QX0A 3WVJA 2V09A 3LWVB 1OKQA 3LD8A 5AFBA 3RJRA 2DWRA 4Y52L 5FMOS 5A32B 3ZSEA 2H12A 4CDUC 4DY5A 4UFLA 3JD71 1BXHA 1DFQA 2MHFA 2VZ1A 3S1RL 2CDPA 4N9HA 1QJX1 4C91A 2ZGQA 1DX8A 1OXCA 1CD3G 1SBEA 3KD4A 3U4XA 5GADc 1CESA 2Y6FA 2YUEA 3AZVA 4I0WB 1XNDA 2R1DA 3HPNA 3NV1A 3WDTA 1CPNA 2HVYC 1NQDA 1SMWA 3PVNA 4NN0A 5F5CA 2B9VA 3V56A 5IVFA 4YWMA 3D3AA 3I2IA 5HXMA 2ID4A 3S1ML 2XMLA 3Q8FA 2B63L 3NW4A 2J1EA 2CY6A 3MW4A 2VZQA 3R4UA 4XFAA 3VD3A 3NSTA 4E9KA 3WZ1A 1S0EA 1NY72 5T55A 1O4TA 3WNMA 4BWOA 2VL4A 3LAGA 4W6XA 3O1UA 5FLML 1MQTA 1OLRA 4IEUA 5K0UC 4Y3OA 1QJY3 4ISRA 4UFKA 2GMGA 3GALA 4YW7A 4TSVA 4JAFA 3J7Y1 1RIRA 5HBAA 2R073 1DCSA 5A3UA 3HNYM 4L9BA 4NHXA 1AR61 2VTFA 4IERA 4EE2A 1FNYA 1UD1A 1KJRA 3C8XA 1Y9QA 4XFCA 5C4XL 2IVIB 2QQNA 3S7EA 3N9OA 1KITA 4Q4V2 2HWC3 1K45A 3VUOA 3W5NA 4HFSA 1ULCA 4OFGA 4LQRA 3SC7X 3IAPA 2AEZA 1HB3A 3H50A 1QJY1 3ZLIA 5F5QA 4UF0A 2FD8A 1UKGA 4NPRA 4XXPA 2R071 2RDVA 5EHDA 5LW9A 1PM4A 1UY1A 4RS5C 4OCTA 2J1RA 1RUG1 4UFIA 1Z92B 1GWMA 2APOB 3DN7A 4OQ9A 1VAMA 2HWC1 4POGA 1C8M3 2A3YA 2Y64A 3AK0A 2DU0A 1PVC2 5C3RA 1EPZA 1NOVA 4V2WA 4XF3A 1RVF2 5FZAA 1HV1A 1C57A 1H8VA 4PT6A 2BEOA 3WDWA 4YG6A 3H97A 3OCPA 5HCBA 5A6ZA 1R1ZA 3O1MA 4CEWB 2VBDA 1ZX5A 1ZREA 1F35A 1XQNA 4MGYE 5FXWA 4LLFA 1KS5A 3HIFA 3HOXL 3S15L 1OQDA 2DUQA 2JA6L 2VY0A 2WO2A 4GZ9A 1SPPB 1W05A 4Q4Y2 1UU5A 4XUOA 1PZ9A 4EQVA 1N1SA 1C8M1 1UYYA 4M00A 1QDCA 3VBOB 3ENRA 1S30A 4DPNA 2GN3A 4OUEA 5LRSA 5A6XA 4AEDA 1IPJA 2JG9A 2VOXA 3VD7A 1L7RA 4XGHA 1SLTA 2HWE3 4PF1A 4AI1A 1RGSA 1CVNA 3LWPB 2Q1FA 2JKBA 4BQ5A 1KEXA 4FPCA 4GMP0 1R093 4MYEA 3VZOA 2D5HA 1T6GC 5CA6A 1M06G 4WM7A 1F4LA 3MSUA 1BBT3 2AREA 3BYWA 1RHI1 3PU3A 5IT6A 2WS92 3DECA 4AVCA 1J58A 1OT5A 2C26A 2EVXA 4HKWA 2D43A 2HWE1 2KR2A 3KT7A 3Q8AA 2Q0AA 4OVEA 3T4HB 1Q43A 4KI5M 2BVVA 3AYCA 3D4KA 4OHZA 3OGRA 4XJUA 1R091 4MVTA 1X8MA 3S6PA 3MPPG 1ODNA 3WWNB 1BBT1 5M3ML 3PUQA 2Y26A 1YUDA 1CIYA 2BGCA 2RVAA 3KSCA 4XACA 4TLFA 5FKBA 4ZONA 4N53B 4XF4A 5FY7A 4AI9A 4WFN1 5A80A 3WW3A 3WY6A 2Y6JA 4QB1A 3RG0A 4JGZC 3FHAA 3M4OL 1TWGL 1KFXL 3B3QE 5FPZA 3DL3A 3GZAA 2X10A 3NMBA 4IV1A 5LA2A 4IE0A 2RS33 1RUF3 3SNMA 3WF0A 4HT1T 1T9PA 1AZDA 1X7NA 3GZEA 3O7OA 2HR5A 2XJRA 2GMMA 2EXKA 2JXAA 1WGPA 2XGXA 2RDRA 1RUC2 3OY8B 3R4SA 1DGRA 1PM7A 1PFVA 3PUIA 4KBBA 1A3KA 1WLCA 1VMJA 2AGSA 3WCRA 1SFPA 5IVVA 1PGL2 2VOKA 1H8TC 2CWMA 3S16L 3H1WA 4FO9A 4NAOA 2EXJA 3C7FA 5L73A 1UO9A 1P8JA 1OURA 3DPRB 1RUF1 4D94A 3I2GA 1GR3A 4LR4A 1HLCA 1H30A 1GNZA 1CAVA 3UYJA 5FRAA 2G9GA 2VOWA 2XHKA 2D5FA 4Q4X2 4ATFA 1SZBA 2OZ6A 3KGLA 3PU8A 4GKYA 2B46X 1NAEA 4W6WA 2DCJA 4W65A 4AZZA 1MS4A 3A7QA 4XTPA 3ZYFA 3WW2A 1EV12 1IKPA 1B35B 4YVWA 2EF6A 1FMD3 3J8F2 5LCWL 2B8MA 3MV11 4BHPA 2OXBA 2RM23 3AZWA 1GANA 1FAYA 1UYZA 2E7QA 3EMRA 2L9LA 1GZTA 5IVEA 1IPSA 3LFIA 5C44L 3GBGA 3OEBA 3VBRA 4XABA 4XIOA 1KS4A 3ZN4A 1GFF2 5JR7B 3GTOL 3E97A 4B7EA 1VRH3 5FMOL 4FP2A 5C4WC 3AMPA 3GJBA 3LGRA 4QQHA 1FMD1 1L7LA 2DCZA 2ZX0A 3HN3A 5FY0A 4BY1L 2RM21 1LJ7A 1W8OA 4YWLA 4YNIA 4Y7NL 5CG9A 4FPLA 2K46A 2ZGNA 3URFA 3NL1A 1S1AA 3UGGA 2ZZQA 4IEYA 3ZFEA 3V0BA 5SV8A 1VRH1 1REFA 2MNGA 4TN7A 4BMBA 4AR5A 4UXAA 2Z5WA 3P3PA 5FPLA 5LWBA 5A1LA 3BTXA 2XBO3 4GS7D 3PVOA 2ERSA 4FAGA 5BNOC 4A7YA 4CE8A 1JZ2A 2VCMA 4RA0A 2IXKA 2C6AA 1OQ1A 3RI8A 4XHXA 2Q8CA 2VW1A 4XQ4A 5FY8A 5CFDC 1DYPA 4LUKA 3ZPYA 3WDYA 5C8CA 4TZDA 2C9KA 5IFPA 1YQ6A 5FZDA 1DQ4A 3S2DL 1CONA 4PLNA 4D7YA 3ALQA 3KV4A 1GZWB 1GKBA 3PUHA 4QPGC 3AKQA 5LATA 4A3ZA 1LHVA 1OD3A 2YFZA 3ZIWA 3THTA 2ZMKA 3RZTA 4N8MA 4BQ3A 3IWZA 3ACHA 2W91A 3ILNA 2TUNA 3VHPA 1R0GA 1TWAL 5L19A 2DFCA 3PHMA 5FO7B 3HOUL 3WP4A 2OYZA 1VALA 3H7JA 1RUJ2 2QQPA 3MPBA 1OD5A 2V4AA 4A3ML 2XKPA 4LHSA 4TYSA 4LIVA 3S5QA 1OLME 4ASKA 3PL5A 1PMHX 5EQUA 2X5IC 1T6BX 1Y9MA 2Q8OA 4PDWC 1I1EA 2Q8DA 3TNQA 3KYXA 1W6NA 2PMZP 2WFF3 4I02A 3H3LA 2BERA 1YJKA 3POJA 4NPMA 4OUMA 5BNPC 3IB3A 3PMEA 2FCVA 2P17A 2BBAA 1W2UA 3DKQA 4QM8A 5C71A 4IE4A 2TEPA 1I5PA 2G19A 3MW3A 2VO5A 3S5AA 2RS52 5IP7L 4YSFA 3AKSA 2XKOA 1SCSA 3T0BA 4GKXA 2RV9A 4FOVA 4DB5A 5F39A 2VTXA 5FCCA 1TNFA 4YW4A 5A1FA 3KGZA 1RUE2 4JAGA 3HEIA 5DUWA 1UOFA 2HLEA 5C7GA 1LOEA 2D6LX 3BODA 2ZPXA 1UIKA 2JIJA 4WBBA 4YM1A 1W2OA 5A3OA 2WNUB 5T5JA 2WZPP 5KHJA 4G9SB 1JHJA 1HV0A 5EP9A 5T52A 4HANA 1H1IA 4RD7A 3ZYHA 2NVTL 1CAXB 3NNGA 5AC92 3V0AA 1LOFA 3GTPL 4AR2A 3RI9A 3JQXA 3I3MA 4A3IL 5FY5A 2J7MA 2RE9A 4GB33 4XF9A 4C90A 2FDIA 3MF9A 1QJZA 3KQRA 2UY8A 1X36A 2NQYA 1ZZ8A 2ORXA 4QHZA 2BQPA 2RS12 4QU2A 3E5XA 1RYQA 2ZIXA 1MQTC 1OA3A 5E88A 1Y3TA 3HQRA 3J4UH 1D7PM 2AYJA 5CFCB 3WINE 3AZYA 4YVSB 1COV2 3THDA 2JENA 1L7QA 1MEC3 2A3XA 4XJ8A 2Y34A 5KWRA 1QQP1 4AHWA 4PIXA 1KFUL 4GB31 3H9BA 3POEA 1VBB3 3RJ2X 5F7UA 5HI0A 5FPVA 4CP9B 5EYYA 1N47A 1EAH2 4QX3A 1H1AA 4IV3B 2R063 4M4RA 2QQLA 3N3HA 2OT7A 4XXBB 2GMEA 4A3CL 1IS3A 1YWKA 4AK3A 1MEC1 4E8CA 3S14L 5GZFA 4QT6A 3MFCA 5M5YL 4XBQA 3K4ZA 1VBB1 3OF1A 4K3UA 4HK8A 4OQ8A 2VXRA 3VBFB 2WN2A 2H0BA 1QOTA 3H7YA 3IDCB 4S2FA 5H9QA 1AX1A 4P9GA 2R061 1W0OA 4J1WA 1YHFA 1JOBA 3BU0A 3S57A 3TN93 1SLAA 4KWUA 1TWFL 4QXBA 4LE3A 4X6RB 4QM9A 1J1TA 2KXLA 5GZDA 5C9AB 2A6HD 3VHOA 1DGWA 4RGAA 2R041 3FLRA 1RUH3 4XQWA 4GWJA 4Q0QA 3BTAA 4DXSA 3O0VA 5HPOA 2QFEA 2W9XA 2WKKA 1W06A 4AEDC 4LT5A 2DCKA 1JXNA 1KRIA 2B4KA 3OUIA 4LBQA 4QHBA 3TYJA 3HAXC 3VBUC 2XHNA 1DG6A 1VCXA 3TN91 4C1WA 1R081 1KJLA 2VJXA 2YC4A 4OI1A 2VOTA 1IS5A 1XPWA 4AF9A 1W3VA 4QB2A 5CBLA 5DM61 4URTA 4WM7C 2ET7A 3SS2A 1X9TA 1MS3A 3H3UA 4FPOB 5EV7A 5FY4A 4XCAA 3ZYGA 2PELA 3ZN6A 5CEHA 1UL9A 5DABA 4HL0A 4HKLA 4GWNA 1IGOA 2V72A 4CDUA 2VGDA 3A22A 2YB7A 4P5HA 4B8EA 2Z3QB 2X53S 3ZSMA 5IK8A 1US2A 3PWFA 2RJ2A 2PA7A 4QX8A 4R4XA 4Q8KA 4FQ4A 4K8RB 3U11A 2IUWA 4X8NA 4IEPA 2AEYA 1K5MB 3MO4A 4P5YA 4RR3A 1RWDA 3OGVA 3CO2A 5DDJ3 1WW7A 2A6WA 5GLVA 1RJ7A 1NXEA 3NWKA 1LOAA 3SCFA 1WW6A 4Z07A 2B5HA 4QQLA 3C7HA 4LNVA 4R9DA 5DXDA 4XAAA 4JVAA 4LK7A 1NZCA 3T2TA 3UKVA 1A8DA 3AP4A 2MPFA 1H4HA 4MX3A 3IMMA 4EWDA 3QD6A 2DBNA 3SH5A 5KHKA 3HOBA 4JTOA 5DDJ1 2H6CA 1JBCA 1NXMA 2WWSA 3I3EA 3OBZA 1PO22 2VXJA 3S1NL 1MZEA 1D4M3 3KV6A 4IE7A 4JGYB 2XB6C 4META 4W6YA 5BNQA 1Y1WL 2PTMA 5APAA 3TEXA 3WF1A 2DU1A 4DXZA 1W9TA 4DXRA 1TWHL 3PJQA 3WQ0A 1JUHA 1T9QA 3ZG6A 3CF6E 3SHRA 4YM3A 5MFZA 3UT0A 1J3RA 1FNZA 1MZFA 4M3CF 2PHWA 3JUUA 3CJXA 1Z7S3 1NLQA 1UWWA 1ZRDA 3NFPI 2VZRA 4ZXEA 1LHUA 1ZNPA 3KF3A 1WLTA 4X8PA 3QLQA 2FDFA 3KMHA 2PAMA 5FMBA 2VOVA 3PJYA 1C4RA 5EJ1B 5FK8A 2PFWA 2X8KA 2ZHNA 3E1F1 2OVUA 5IW0A 5E6HA 2KM2A 2C24A 4YVWC 3D5OA 5FR3A 5FZ4A 3ES4A 5T3NA 3WF4A 1S55A 1Z7S1 1I3QL 3GJAA 1YQ8A 2ZHLA 3I2DA 5FMCA 5AI3A 3GCWA 4N90A 5C3QA 1KDMA 2ET1A 1XBFA 1IPKA 2P3IA
chains in the Genus database with same CATH topology
3PNAA 2O0OA 4LO8A 2GNMA 2WINB 3LCPA 5TSWA 3VBHB 3ZYIB 4AVBA 3B08B 5FBZA 1HXS2 3M70A 3VDDB 1DQ6A 2C5DA 4QPYA 3WW4A 5GZEA 2YYOA 2GZWA 4HLTA 1OSGA 3RMYA 3ZFEC 1JH5A 1ASJ3 3MIGA 2WQZC 1MS8A 1J1LA 3IDEA 5JVG1 2W52A 3I59B 5H9RA 4EN9B 5JPMB 1S0FA 2D40A 3ZFFB 2VNGA 3ZMOA 1Q8VA 2WL1A 4CEWA 2L0ZA 4N7UA 4Y1XA 4AHXA 5C8CC 1Q8OA 1ASJ1 5JDBA 4MXWB 4GMP3 4NHLA 1TMF2 1S0IA 2ENRA 4XMIA 2WT2A 4D69A 1MVEA 1PK6B 1RMU2 2CV6A 2JI1A 4Z2WA 2R1BA 4JGZA 3VGIA 3CJIB 4P14A 3VHRA 1TME2 3USSA 3IMNA 4QQOA 1HRV3 1BQ9A 2BE5D 4CDXB 5JLVA 4N9IA 3C3VA 3EQEA 4HVQA 2YY1A 3VKOA 1O3TA 2EAAA 3IPVA 4YG3A 1UU6A 5AVPA 1QU0A 1D2QA 4ZXKA 3VBSB 1G8WA 2M6OA 5EFUA 5J37A 2ZACA 4FBFA 2I2SA 3LA7A 3THPA 2ERJA 3MF6A 1HRV1 2CAUA 2IFRA 1H2NA 1G6NA 1W39A 3GF6A 3N7LA 5KC6A 3EBRA 3WP3A 4LHLA 2HWB3 4XDQA 5DUVA 1C5HA 4AXOA 2EXHA 1LOFC 1R0JA 1CPMA 2BBVA 1YYNA 3O14A 4M01A 4CDWB 4AFBA 3RZ6A 1VAVA 2YXSA 3KM5A 1VIWB 1NCQB 1O91A 3OY8A 1JYIA 1Q8QA 1FOD2 2E7TA 5AN9H 1XNKA 2HWB1 3FJSA 4K21A 3MI8A 4HSJA 3PLQA 4Q0SA 1SLLA 4QPIC 4PLMA 5A33A 1PVXA 3USUB 5J3UA 2WSVA 1YCIA 3DPRA 3AFGA 2VH9A 4LHKA 1ND3C 2CYFA 4BQ1A 5GZGA 2LCQA 3GYDA 4EWAA 3MW2A 3LWCA 5FO9B 1U0AA 2WQ4A 4R9CA 2HWF1 3JU9A 3TOJA 1PGW2 2NMOA 2Y38A 3CNAA 3RNSA 1VBE2 4EN8B 1QXJA 2XJUA 1R0FA 2PQQA 1YK4A 1RINA 1XYOA 4H3WA 1LB2A 4Z92B 4Q27A 3B9IA 4MSVA 1DDLA 2VMIA 3WD5A 5HCFA 1ENRA 5BNOA 3HWJA 4KG8A 1JHNA 3WHUA 2W0XA 5FTTC 4EV0A 1HIXA 1ALYA 1BVVA 3AP6A 2PYAA 4E2QA 3ZN5A 8RXNA 2XUMA 4H7MA 1RDVA 2ES3A 4HSLA 4RQPB 4WM8B 2B9UA 3AKRA 4BA6A 1O4ZA 1RUD3 4A7ZA 1G86A 2F4PA 4QPGA 7RXNA 3OYWB 4JADA 1SQ4A 2OIIA 3MLLA 3N7KA 5C8WA 2HYKA 2Z69A 1AYM3 2IWGB 3M3IA 1IHMA 1NXD1 5JCTA 3NAPB 1RYTA 2IXCA 4IETA 3N7MA 4KL1A 4FVVA 4YM0A 3FFQA 3LOBA 3NKGA 3SCGA 5JAXA 1YFUA 4OI4A 4Q2FA 4D7SA 1SMVA 4X6QB 2ATFA 1AYM1 4CZSA 1VBA2 3EO6A 4BCUA 5I0UA 4JCKA 3QACA 4L92A 1LCLA 5LEJA 4P9WA 2G4IA 2Y0IA 4R9AA 1FPN3 2JICA 4Q4V3 2AH2A 4WVMB 4B3NA 3X29B 4WVWA 3B00A 5BNNB 4B4QA 4XOGA 3D0SA 4FPYA 1ENQA 2RR12 5L7OC 2B5ID 4RHV2 4RR3C 4K6BA 4I0AA 4KNCA 4D3WA 1MZ5A 4S2HA 1APNA 4V196 1AR63 1AR82 3OBTA 1VZGA 1FPN1 4EN6B 4Q4V1 1VBD2 4FPKA 3SH3A 1QH7A 1PVC3 2JECA 4Q1PA 1RVF3 5JIAA 5KHHA 4CDQC 2NP0A 1RUI3 4LHNA 4ES8A 1N3OA 1ENSA 1Y7BA 1VBC2 3ROUA 2BTVC 1LHOA 4RFT0 3WXPA 1XE8A 2Q1MA 5GALA 3N35A 4UY81 5IK5A 4Q4Y3 1RUG3 1SLCA 1F5FA 5A3LA 1QXRA 3WX5A 1CAUB 1PVC1 4KH9A 4AWDA 4CP1A 1RVF1 1VZHA 1RUI1 3JD72 1JOJA 1ND2B 3H1YA 1CAXA 1XNCA 1ZVFA 2PHLA 4SLIA 4POFA 4Q4Y1 5JZGB 1XRUA 3B7MA 4K40A 4FSJA 2OW4A 3KB5A 2WS93 1LEMA 4P9YA 1M4WA 3A4UA 2PHXA 1AYN3 2YC0A 4SBVA 5FREA 5T5LA 2IXIA 1O3RA 1W6MB 4Z8BA 3FLPA 2DVGA 1AR92 3WW1A 1OFNA 4YVSA 4LBLA 3KYUA 5ABJA 2DVBA 1CR7A 5MFPA 1D0HA 3L9JT 4FCAA 1PNGA 5D8AB 2WS91 4FXKB 2QJVA 1RHI3 4GA9A 2R32A 4YW3A 1AYN1 3RYRA 2P34A 4IV3A 4Q0UA 3VZMA 3B02A 1FHMA 1A6CA 3FBMA 3VBUA 3PIO1 2WZR2 2QKDA 1R0HA 1SEFA 4N43B 4R8HA 4ZU7A 1QJY2 5AFEA 4DOUA 1WJVA 4DFSA 5GAGc 3VBFA 3R6SA 4FPJA 4PIYA 1YO8A 1O7FA 1FV2A 3QOPA 4CEWC 3CL1A 3P3NA 1W6OA 2JI2A 3PTYA 2D3PA 4ES9A 5C9AA 1JYCA 4YLZA 1UPIA 3VBOC 1LULA 5BXXA 3ZSKA 4BLIA 2D6NA 4Y22B 4M0NA 1BYHA 1C8M2 1H7VA 3VN4A 2VNRA 5K9YA 5I0TA 1SMUA 2GDFA 1SACA 5JIUA 4Z82A 4Y1ZA 1ULFA 3M3CA 4AEJA 1G9BA 3AB0A 1LENA 5ACA2 1G9AA 4FTSA 4CEYB 4AYUA 4M3CB 4NHMA 2JDZA 1LGBA 5C33A 4UW6A 3IDBB 3R4DB 1AXZA 4E6YA 2GSYA 5DZGA 3J8F1 2XJQA 3JB4C 1VLNA 1ZRPA 4AVSA 4E27A 1N1YA 2HWE2 1LU2A 1H2MA 4NHKA 1QNWA 4N53C 3MLJA 3IU3I 2BWCA 4KWLA 3LA2A 2A3WA 3A44A 1BBT2 2JG8B 3NV4A 3HQXA 2VQ0A 3QVDA 1S2ZA 4ISQA 3WP5A 1B71A 1AL23 4K8FA 1ZZ6A 1QDOA 4CYDA 3SLIA 4AGRA 1NG0A 2XWBB 1NCRB 3T1LA 4FTBA 3DPRC 1JN2P 5I93A 4FOQA 1B13A 4YZ3A 1AL21 4YGCA 4MZUA 1IS6A 4WVZA 1DU3D 3D6EA 2QDRA 2RS32 5HXVA 1JYBA 1H2LA 2CKCA 1V6OA 1CJDA 4D7TA 3AMHA 1PIV3 1EP0A 1UAIA 3WG1A 2I45A 1B35C 5IUQA 3UL2A 3M3QA 3ZFGB 2HWD3 3FWEA 1V9U2 1XU1A 4YZ2A 5L36A 3MIHA 1W6PA 4BMEA 3POYA 2NYYA 1HDKA 3IT8A 2Q5TA 4LO6B 4U36A 4L11A 1PIV1 5BV6A 3FBYA 1GLHA 1WBFA 1WMFA 3DV8A 4AQ2A 2BFUS 2ZHKA 2DTWA 1PO12 4Q4W3 3VZKA 1BMV1 2HWD1 1QWRA 1SFNA 4YW2A 1CIWA 3I7DA 4PQ9A 3VDDA 4K20A 2CR8A 5FO8B 3ZXFA 2RS51 1AL0G 4EJRA 5FFOC 3KYVA 2CKAA 4OZXA 1UIJA 5GZCA 4Q4W1 1RUE1 1O5UA 4ME3A 5FOJB 2ZX4A 4XFGA 4Y20A 5K8SA 2K0GA 1V6KA 5JVVA 5BYNA 2TBVA 1B2JA 4XMAA 5BPXA 5AC91 2PVEA 4L97A 1HQNA 1COV3 2PYTA 3E6DA 3VKFC 3ME2A 1CQ9A 4OHWA 3POWA 4MXWA 2H6BA 3WG3A 1B2OA 1WA4A 3CU7A 3B69A 1FHHA 2WSUA 2PSMC 3UJOA 1PK6A 3B5LB 3BPZA 4C1XA 3V65A 2YROA 4AVAA 1EAH3 4QQPA 2R30A 5FLIA 1JTZX 2PLV3 2FMYA 3ILFA 3CJIA 1COV1 2XBO2 4I30A 5GLTA 1YUXA 3MIFA 1OA2A 2RMU2 1QQP3 3M1HA 2JD4A 4CDXA 4H7LA 2A68D 1OQEA 1EAH1 1URXA 4DS0A 4E2GA 3ZXLA 3PMSA 4YYOA 4QPIA 2PLV1 1PNFA 3VBSA 4DQAA 1G9DA 1MS1A 4FPHA 2VUJA 2WFPA 1ND3A 4HKOA 1JUIA 3U07A 4LBQD 5JOYA 1W6QB 3RS6A 4N7IA 3ZYPA 5JMCA 5MLC3 4GH4B 5MGNA 2WNUC 4JDMA 1LKOA 2FZ1A 2ZCWA 4JTNA 5JI9A 2LTNA 2WFF2 1RUOA 2KKDA 1CAWB 4CDWA 2VPVA 2OA2A 3DKWA 4AR3A 2R043 5A3MA 1A8MA 2BYVE 4KU8A 3UK9A 1LODA 4IXLA 3PZAA 4LA2A 1TNRA 1DZRA 1HX6A 4IL7A 3USUA 1VP6A 5CFCC 3L2YA 3AX4A 4YVSC 2JG9B 1R083 1AF9A 1ZRFA 4NR1A 4FTEA 5FQ0B 5ABJC 3ZO0B 5I0SA 2ZX3A 3FHIB 2M6PA 4UBHA 2D97A 3H0OA 1AXYA 4M3CE 2G9FA 4IV3C 1FT9A 4EN7B 1QXPA 4GB32 4AI0A 4XBLA 1MS0A 1NNQA 1HRI3 5LK5A 1A78A 1ULEA 2NLRA 4QMAA 2DUPA 2F6BA 1VJ2A 3AMNA 2GALA 3AZZA 3OGGA 1MVQA 2M4VA 3J9SA 2MEV3 3VBFC 5JOZA 4XTMA 2YPJA 4LTAA 1UW8A 1S2BA 1LTEA 4GIQA 4DNYA 2P37A 3LZZA 4FOYA 4HK9A 4COZA 2CGPA 1VBB2 2GU9A 4RQPA 1HRI1 4XFHA 4WM8A 4RGGA 2H0VA 2HEWF 5C9AC 2DURA 2R0HA 3OYWA 1U5YA 1WLDA 3B0AB 2WNVB 3J26N 5F6LB 3ZXKA 4IESA 3WDUA 4IV1B 2MEV1 4TWTA 4U2AA 3BOPA 1FX5A 4ASMB 5L7OA 4BE3A 2OZJA 3ZXJA 3ZXAC 1Y43B 2CTVA 3AP9A 3JB8A 2BPA2 3VPBE 2O8OA 4OHXA 4BH9A 1GV9A 3MDPA 3C2UA 4DRVA 4ATEA 4HVRA 3LOIA 4CDQA 1GBGA 2K2SA 3M7AA 2P2KA 2J9UB 2ZGLA 4AG4A 2OUJA 1C5IA 2NM1A 1ZRCA 1LRHA 3ASIA 1RUH2 1H2KA 3TAYA 3BIWE 3OTFA 3ZXEA 3B01A 4WVMA 1G9CA 1HXS3 1I6XA 2DVAA 4Q0PA 1OFSA 2Z3RB 5GLUA 1VZIA 1K5MC 3WNXA 4H55A 3GHNA 3T1MA 1BE7A 2AUYA 2E63A 2BWAA 4B7KA 4F3JA 5T5OA 4AEKA 3D8CA 3VLBB 1POV0 3NV3A 1ENXA 1L3JA 3OD0A 2E9QA 2WNEA 3VBRB 1HXS1 3PKJA 1DQ5A 1S0BA 4LBMA 4L8QA 2IXHA 2AENA 4JGYC 2ERFA 2B7YA 1XYPA 2CNAA 1DIWA 1TMF3 1GNHA 5KC5A 5RXNA 4LLOA 1NA1B 4LBJA 5DDJ2 3V0BB 4B4PA 5J36A 2VVDA 1KQRA 3NJZA 4BLJA 1MS9A 2QNKA 3ETQA 3MYXA 1NE6A 4K1ZA 5MF6A 1QOOA 3FZ3A 1VB2A 4RSUA 5JZGA 1XYNA 5KBFA 1WCSA 1TMF1 1YNAA 3TB0A 3IBMA 2WA4A 1BEV2 4AQTA 2BNMA 1LESA 2WT1A 1AJOA 1OLQA 3MFAA 3J7Z1 2V0FA 1D4M2 3DGTA 2Q1ZB 1OWBA 4JV4A 1W6MA 3AMQA 4BIFA 3PIP1 1D0GA 2ZGMA 4ASLA 5KHIA 1I9RA 2GC2A 1REDA 1IOAA 4RL7A 3B94A 1IRNA 4IEVA 3OD4A 1VR3A 3VBOA 1GQGA 3VL8A 3MZHA 2NMNA 5DZEA 2VW0A 1C09A 4Y1UA 1YI9A 3I8TA 5JPNB 3VDDC 1S2KA 2R6QA 2ZHMA 4XEZA 3H1MA 1CADA 4CP2A 2X29A 4LO5B 2GN7A 4LULA 2XLFA 1DF0A 3QCWA 3DF0A 4XJZA 4AFCA 3U0ZA 2DTYA 4KG0A 1FOD3 1G7YA 4IEQA 4KGGA 4BZ4A 3ZFFC 1WMEA 3SISA 1U5ZA 2O5JD 1QJU2 5I91A 2QZ3A 4R9BA 2D93A 1QY4A 2QDNA 1ZBE2 1ZRRA 4CTEA 4E4SA 4GWMA 2P3JA 4YFWA 3V0AB 1FOD1 1PK6C 4C0BA 4N53A 2WLQA 2XVLA 4OHVA 1ASJ2 4Y4YA 4BYYA 4AHZA 1O5LA 4M0HA 3CJIC 5EXOA 3FMGA 4XZPA 2DV9A 1R1A3 1RJ8A 3GHMA 3K48A 1JW6A 1PZ8A 2KN9A 2BUKA 4YZ4A 2B39A 2HWF3 1PGW1 1UCXA 4CDXC 1V6NA 1OOPB 3KZ4C 5CADA 2GAUA 1DBNA 3WUCA 4HPKB 4YGDA 3IM0A 2FHRA 4KQ7A 4HN0A 3VBSC 1HW5A 4LUMA 1R1A1 1ZZCA 3RWNA 4WZCA 4C0HA 1UZYA 1SLIA 3B93A 2PN5A 4YGEA 2XVGA 3M4FA 5CAZA 3VV1A 2DFBA 4CRQA 2NN8A 1NQJA 1RITA 2A73B 2JG8A 4AVTA 1OA4A 2ZJCA 2PPTA 4HN1A 3QH7A 1B35A 2BNOA 4CDWC 5CB7A 3JBG3 2DF7A 1WD3A 1CN1A 3SMHA 2I07B 1NCQC 1SLBA 1YJLA 1VBA3 2K2DA 2ZOEB 2ZAAA 4LO4B 2AZ5A 1BQPA 4KWKA 4F7ZA 5EINC 1AR72 1NLRA 4DZGA 2A69D 2WA3A 3MLKA 4IEWA 4JQRA 2QUOA 3AYAA 3NKTA 3DUIA 3N7JA 1VB4A 5HCAA 1LGNA 4MGIE 4QXKA 2UWCA 1PZ7A 2XVKA 1DGLA 1S0DA 1B09A 2RR13 3JBG1 2EALA 3LSEA 4HBNA 4XJWA 5GAEc 2ZGTA 1VBA1 3Q9OA 4K7JA 4RHV3 2GNTA 3WQ1A 3N36A 4COYA 2NYDA 3VKNA 1Z78A 3ZYJB 4A3XA 3OJBA 3HBZA 4PBOA 2VU9A 1BJQA 1VBD3 2D44A 2VVFA 2XWJB 2HEYF 2PAEA 4TVMA 3ZFGA 3WP6A 4CDUB 3SXWA 2RR11 1XU2A 3POSA 1VBC3 1X82A 2D3SA 1DQ2A 4RHV1 1MACA 4Q26A 1DZTA 1WLWA 1CAAA 4BPZA 4JRAA 1IQAA 1AR81 1BK1A 2C6BA 1C3HA 4RQPC 4J1XA 3ELNA 1VBD1 4WM8C 1WD4A 2UU8A 3HT2A 1GZWA 1BFYA 5CG8A 2W08A 3SCHA 1NY71 2ZBJA 2EA7A 3GNEA 4BOWA 2D6PA 1VBC1 1IS4A 4F8AA 2JI3A 2HJIA 4QD2A 4Z1VA 2YV8A 3AM2A 2ZX1A 1ZBA2 1C1FA 2GH2A 3NAPC 2WT0A 1LR5A 5K0UB 3MPSA 2FBEA 1C1LA 1WUVA 2TNFA 4WVVA 1F2NA 3VL9A 3JZVA 5KXDA 4Q0VA 1AR93 2DCYA 2ZTNA 1RUD2 3VZLA 4TPUA 1QNYA 4I09A 4YW5A 2XPJA 4ORFA 1AYM2 1UN1A 2O1QA 4P9XA 2OUHA 5BNNC 3AYDA 2PVXA 1DGRN 4RS5B 5JSOA 4FPFA 3OGJA 5K2ME 1AR91 3GZUC 2WNUA 1QJX2 1ZM1A 4HZFA 4UBGA 1N3PA 4ZN1B 2WZR3 1U5XA 2JJ6A 2DSXA 3LPEB 1I3HA 2D6OX 3ES1A 4AFDA 3KT4A 2WIIB 1EYBA 3LA3A 2CGOA 2QCSB 2JX9A 5AVAA 1DHKB 3FLTA 3E6CC 2XL7A 1DQ0A 2ZS6B 3O12A 1FPN2 3W9AA 1F5JA 1SCRA 4XW3A 5IK7A 1ULGA 2LUWA 5CFCA 2WZR1 2V73A 1IW7D 4S2GA 3JCIA 1J3QA 4IEZA 1YFXA 1W6QA 2DYCA 5BUVA 4LBOA 4IEXA 4YGBA 1AR62 3RZZA 4OLLA 4GH4A 2VQAA 4XBNA 3I54A 5T50A 1ND2C 1Q3EA 2QE3A 2K9ZA 3E5QA 4G3YC 5J96B 4UW4A 1Q8PA 3BALA 1RUI2 3APBA 1CAWA 5JZGC 3KCCA 1V6JA 5IY0A 4JAEA 2GH8A 5ACA3 1CJPA 1RUC3 2JE9A 2R072 4MLOA 3FX3A 3KS7A 1PMIA 2W39A 1RUG2 2C9AA 4PF5A 4AEMA 2HWC2 4OHYA 2HEVF 5CNAA 1X50A 4XQDA 1YIPA 4INDA 5FQ0A 3A0KA 5D8AC 1O3SA 4JGZB 1F9KA 3GBFA 5ACA1 3ST7A 1RUC1 2LM3A 1H4GA 3AMMA 4Q4X3 2YZ4A 5CIRA 1PGL1 2VNOA 5JOXA 4AVVA 5DUUA 2YGMA 3FE5A 1EV13 3AKTA 4FPGA 5KXBA 1AYN2 4N43C 3IPVB 3J8F3 3JQWA 1F8VA 1H0BA 1F31A 2IFWA 2ZZJA 1H8TB 1IKQA 1LOCA 3TWIA 1GZ9A 1AXKA 3RSJA 3ATGA 4Q4X1 3TNPB 3RMXA 4EWEA 4AR4A 1RHI2 4R52A 2VUAA 1EV11 1H9WA 3VZJA 3QQCE 1LHNA 2E7AA 2Q30A 3ZSLA 2ZGOA 4P9IA 2WNVA 5CVRA 2GC3A 4I01A 5JSPA 1PHMA 1K5MA 2IXLA 2IZWA 2P3KA 2BNNA 1CX4A 3M3EA 3MEPA 2WC2A 1IU6A 2ETEA 1R092 2D6KA 4NWVA 5J98B 3IN9A 1QMJA 2GC0A 4PCRA 1FXZA 1IU5A 2RHPA 1V9U3 3WT3A 5A33B 4Y24A 2V0EA 2RS31 4CEYC 5C4WB 4OUSA 3MICA 2R0FA 1KDKA 4AQ6A 4JGYA 1KD7A 1YK5A 3OBRA 1ODHA 1POV3 2AYHA 2A5ZA 1PO13 1UF2C 2GNBA 3GBWA 3V64A 4NOTA 1LKPA 5FDBA 3E6BA 1V9U1 2NPIA 2UURA 2A6VA 4MXVA 4HVOA 4XJ9A 3KYYA 3UKTA 3HD8B 5IK4A 1RUF2 1DYKA 5BNOB 2OPKA 3WR0A 2QZ2A 1RUJ3 3LB9A 1ULDA 4AE2A 2JG8C 4Y26A 3WHTA 1POV1 2CAVA 2A6ZA 1DLLA 1PO11 4I3GA 4S2DA 5EIOC 1O4YA 5E89A 3CEWA 5CFDB 2PHFA 1DGWX 2YMZA 4YG0A 3AJYA 1C8NA 1ZZ7A 3AZXA 4XHBA 4I0BA 4AQSA 3ZIXA 4FXGB 4XJAA 3H9AA 4CP0A 4QPGB 2UWAA 1RUJ1 2E53A 2RS53 1NCRC 4Q8LA 2UYBA 3ZVXA 2FMDA 5F1RA 1NA1A 2WLPA 3VBHA 1S0CA 3WG2A 4EN0A 5JOWA 1SBFA 1RUE3 2XLAA 4FOWA 3EHKA 5GKAC 2VW2A 2X5IB 4ZKTB 5AC93 1TQ5A 4PDWB 3ZX7A 1ZA4A 2E51A 1FMD2 2RMU3 3ACLA 4QQ2A 3MIDA 5BNPB 3AYEA 1AL22 4AHYA 4DRRA 3EXUA 3UKNA 2RM22 2PAKA 1V00A 3GZTB 3B9CA 3R05A 4B8CD 5AI2A 3I59A 2RS13 3IIAA 4JRLA 5FLHA 3ZFGC 3HN1A 3ZFFA 1VRH2 1BCXA 5J48A 1GSLA 2B45X 1V6IA 2XBO1 4PBPA 3O0XA 5LRRA 1ZZBA 3FUOA 2A6XA 3R0RA 2RMU1 1QKQA 2DCTA 3INAA 1BRFA 3M8LA 4HETA 4XETA 4B4RA 1QYBA 4MGZE 2V3BB 4AR6A 4XYXA 3U10A 3O0WA 4PLOA 2RS11 3NV2A 2DVFA 5LEKA 1SDWA 1PIV2 5DZFA 1HQWA 2DVDA 4GULA 4YFZA 1GQHA 4K9SA 1BMV2 3EJKA 3D0JA 2HWD2 4COVA 2FQPA 3ZYRA 3MGUA 1MQTB 2A75A 2VECA 4HMZA 4LEJA 3BU7A 1AHSA 5C6CA 4MH0E 3PVEA 4AW7A 4ITCA 2RJKA 5E1RA 1OWCA 4Q4W2 2WFF1 5H9SA 1N1VA 2ZA9A 4Q1RA 4R4ZA 5KXCA 4XE9A 2PHRA 1UU4A 2KA3A 2XJSA 1OHFA 3ZMNA 3ZXGA 3VKMA 3BCWA 1TEIA 4JDOA 2C1FA 1AUYA 1EY2A 2AR6A 2VULA 2O8QA 5I8SA 1IROA 3UJQA 4I2OA 1YI7A 2ARBA 2ZGUA 2ZGSA 1BVP1 4Y1VA 1NCQA 1OOPA 1DQ1A 4MUVA 2VG9A 2A6YA 5ABJB 4HPKA 1AVBA 1H1MA 3I4IA 5I0RA