4AI0A

Flo5a showing a heptanuclear gadolinium cluster on its surface after 9 min of soaking
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
258
structure length
258
Chain Sequence
b'GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLOCCULATION PROTEIN FLO5
publication title Complex Gadolinium-Oxo Clusters Formed Along Concave Protein Surfaces.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell adhesion
total genus 56
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4ai0A02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ai0A01
4COWA 2XJVA 4CP0A 2XJRA 4AI0A 4AFCA 2XJQA 4AI1A 4CP1A 4AHZA 4AHXA 4GQ7A 4LHKA 4AFBA 4ASLA 4COUA 2XJTA 4AF9A 2XJSA 4COVA 4AFAA 4D3WA 4LHNA 4COZA 4AI2A 2XJPA 4COYA 5A3LA 4LHLA 4A3XA 5A3MA 2XJUA 4AHYA 4CP2A 4AI3A 4AHWA
chains in the Genus database with same CATH superfamily
3IU3I 2WAQP 1UL9A 1N1YA 3OBRA 1ZZ8A 4CU9A 4X6RB 3ZFEB 1I5ZA 3I54A 1KQRA 4AZZA 4M00A 2EALA 3KGLA 3SISA 4PDWB 5FUNA 2R0FA 4FXKB 1RUC2 2ZZQA 1VP6A 1YC61 4D3WA 1FATA 1QNWA 2YU9L 1AR72 3OYWA 2OPWA 5H9SA 4D8MA 3GTGL 1PX3A 4GAZA 4RR3C 2Y0IA 1RGSA 5FYIA 5A7PA 1VZGA 4E6YA 3UGGA 5EZWA 4CP2A 4AGRA 1W99A 3UESA 1ACCA 1NA1B 3TWIA 2DCYA 5FZIA 2E2JL 5KWRA 1QJU3 4P9WA 1EV11 1YQ5A 4MGZE 4QQ2A 3GTOL 1JUHA 1QDCA 4K20A 4R9BA 3RQ0A 1LKMA 4YGDA 3ZM8A 4FTSA 1N1TA 4CDWA 4IESA 2JDNA 1PO22 4M3CA 2WWUA 3CBNA 4G6BA 4HXCA 4RQPC 2V09A 4NPRA 4JAEA 4UFKA 5JZGA 5BNPC 2VCAA 5ABJB 4YM3A 4CEWC 1UY4A 2ZAHA 4Q4Y2 2Y8KA 5FPAA 2XJPA 1OLQA 4MVTA 2W08A 2QQUA 5FJ8L 3RI9A 1W2TA 3VBRB 3WP4A 1DQ6A 4JTOA 4JHZA 4UBHA 3SH5A 3VBHB 2PQQA 5LRRA 3VBSC 2DUPA 4BQ3A 3Q8EA 5JPMB 3TN93 5LA1A 5L9VA 1IZ3A 1VLNA 2QZ3A 5LY1A 4LXLA 1JOJA 2VQAA 3BU7A 1UKRA 1SBEA 3LPFA 4FP2A 1V9U2 4OHYA 5FY4A 4I09A 4YM2A 4COUA 5C3EL 2UURA 3GM8A 2IVIB 5FY9A 4A3KL 1I6HL 1GZTA 2JECA 4RL7A 2GC0A 2XWBB 1WWYA 2APOB 2VECA 4CUBA 4UT5A 1LENA 2EIGA 4XJZA 5F37A 4PLOA 4Y1XA 2P6CA 4GD4A 1GUIA 1OD3A 4EZ4A 3BCWA 3KHCA 2W9XA 4ZXEA 4XE9A 4YG0A 4A3JL 1RVF3 1Q5OA 4F8AA 2KA3A 1R0IA 1L7QA 3J9SA 3SCHA 1RUI3 2JI2A 2LALA 4A41A 4V196 3JD73 2WZR1 4K9FA 4L92A 4ZPIA 5JOZA 4OZXA 1OPOA 3BIWE 1OQ1A 2VBDA 4I01A 5E6HA 1W6OA 4C1WA 2CWMA 1DQ0A 2JKBA 3MF9A 4HPKA 4YG6A 5CEHA 3AYCA 4EJRA 2C5DA 5AC92 4NIGA 1ST8A 1YWKA 4B7EA 3ZDVA 4D7YA 3AX4A 5DG1A 1QH7A 4WVMA 5KXBA 1TME1 3H3ZA 5BNNA 1TWHL 2CNAA 1QJX3 1WLWA 2Y64A 1E5SA 3S17L 3LDBA 4UFHA 4Y20B 1WMXA 1T9QA 1BE7A 1HN1A 1TNRA 4GB33 1AR61 2WQ8A 2HKXA 3J8F3 3ZXDA 3WNMA 3BB6A 5DDJ3 4NHLA 2X8KA 5HPOA 2VQUA 1OF3A 5AN9H 1ZZBA 1HQNA 1CD3G 3O12A 2AREA 4J25A 4MGYE 4QDQA 3SCFA 5IVYA 2JA8L 1HRI2 1MS1A 1NE6A 1UCXA 2OA2A 4ISQA 4PIXA 2OKXA 4EN8B 2JDKA 3MDPA 2JIJA 3S5AA 1T2XA 1UN1A 4Q5OA 3OY8B 5LATA 5CFCC 5FPLA 2IUWA 5F39A 3B94A 3P6BA 4YGEA 5J98B 4FPCA 5I0RA 1NT0A 1NXMA 1D4M2 1T6GC 7RXNA 2VM9A 4FPHA 5FMDA 4TLFA 5FXXA 1AR92 2W1WA 4QXHA 2GNDA 5EIOC 5A1AA 3FHAA 2BVVA 1JHJA 1LHUA 3GHMA 4YW3A 2HWC1 2DVAA 3AP9A 3DYMA 4Y52L 5FZDA 3LAGA 4FPJA 1H7VA 4CCKA 4WM8B 1KXGA 2VU9A 4QQLA 2MEV2 5FYMA 4A3XA 4AGGA 1TWCL 2GP3A 3WG3A 3T1MA 3UT0A 4FPKA 1JYWA 4EWDA 3AVSA 3U37A 5LBCA 4BHPA 3B5LB 4R8HA 3WZ1A 3CJXA 2DTYA 2JG9B 2C6AA 2XJQA 2E32A 2WJSA 2JICA 1UIJA 2D40A 1B09A 2WSVA 4LO4B 4E2GA 2WQ4A 4OYUA 1KFXL 4KMQA 1OH4A 1AYM2 1UPSA 2JDHA 2WS93 2RS13 3I2KA 2PSMC 3IDEA 5CYYA 1CAXA 2Q1FA 4XOGA 3PVBB 5FPBA 3USUB 3M4FA 1E57A 1UIKA 4LK6A 2NMOA 1TMF1 4RFRB 4YZ5A 1WMDA 5FUPA 2HWB1 1DP0A 5A70A 3BVCA 1H8TA 1OKQA 1J1LA 2P6HA 2VBPA 3AYAA 2JEMA 5FYVA 3HEIA 2NVXL 4AW7A 4GMP1 4L0PA 5GLZA 2FCVA 4X6QB 5D8AB 3LGRA 4E9KA 4IEXA 2DU0A 4BOWA 3WWLA 2ZGRA 3MEPA 4OZOA 5BNOB 1NLSA 3ZFEC 5FZEA 1BFYA 4YVWB 3LE0A 1XNKA 5T3NA 3AZZA 1SPPA 4G3YC 5F3CA 3VDDC 4M0NA 4PDWC 1Q8SA 1W9TA 3AKRA 2EIEA 4NRQA 5CAZA 5J7MA 3JBG2 3S2HL 1GOGA 2A6WA 2HH9A 4OQ9A 2YFZA 1VZHA 3FLTA 2QCSB 4D7TA 3E6BA 2GC2A 2HWD2 1IQAA 1JOBA 1QWRA 4QB2A 4XIKA 4H7LA 1RUD1 2W95A 4XXBB 2FQPA 2QKDA 5A3TA 3KVAA 2QDNA 3MIHA 2E7QA 3RVHA 3J7Z1 3DV8A 2IFRA 4O9EA 5A6ZA 5C44L 2RS52 5FWEA 1NA1C 3C7EA 3UGFA 3PMSA 3KM5A 2D6KA 5EFUA 1IPJA 5B4XA 2BJSA 1CVNA 4QDRA 4FFHA 4AHZA 2BUKA 2NPIA 2YBSA 3VKLA 3N9QA 4ZZ8A 1RUF3 4Q4W3 1YO8A 5E1RA 3W59A 1YK5A 2V3BB 4KI5M 5ABJC 1YQ8A 1HKDA 3ZN4A 4QGMA 1UKGA 4LIUA 5A6QA 2E7AA 3HQUA 1ZBA1 3N7JA 1JU3A 5TSWA 3VBRC 1GKBA 4P9GA 5DAQA 4I0AA 4RN5A 4CDXB 1JZ5A 3CJIC 1S0BA 5FV3A 2O8OA 1DQ1A 2ZEZA 2V5DA 1PGW1 1C1LA 4URAA 1ZBE1 1SFOL 3GBWA 2W46A 3CIHA 5FK7A 4IEVA 2WZPP 4AVSA 5JPNB 4JRLA 1R1A1 4QMAA 1C3HA 5KC6A 2QNKA 1JH5A 4FI9A 4A45A 2R1BA 4LBMA 1NCQA 1X33A 1F5JA 1HV1A 1W9SA 2BZDA 2P3JA 2R042 4TLGA 3T1LA 3ZOIA 4Z8BA 1UX6A 4LITA 3MLLA 1BEV2 2DBIA 2DVDA 2Y34A 1TEIA 2YC2A 3H8UA 3Q9OA 5FJKA 3SEPA 3TNPB 3KSCA 4A6OA 4Q26A 2CY6A 2O0OA 1SMVA 5BXXA 4S2GA 1TE1B 2QQWA 5FCCA 4JDOA 2R93L 1ODMA 1R64A 4GWNA 4LE3A 1ZZ6A 1VJ2A 1ZRIA 5FKCA 1B71A 1PIV3 2A3WA 3E5XA 1QXPA 2BYVE 2GALA 4GWJA 3V65A 4WZFA 4AE2A 2VNGA 1SCSA 4QXCA 5KBFA 2VMHA 5A3PA 1RYTA 5FMCA 1DLLA 1O4ZA 5GZCA 2XKOA 1W04A 4QPIB 5FZ7A 4NHMA 1DGRN 2HVYC 4BQ2A 4OUSA 4Z07A 5JSPA 1F4HA 3TEWA 4U671 2D5HA 3DECA 4QWNA 3U10A 2WO7A 2OUHA 4HMZA 4IEWA 4PI0A 3FFQA 4R9DA 4KWKA 4A4AA 1GZ9A 3NSTA 4NAMA 3WG4A 1C8M1 1JBCA 1N3OA 2Q1ZB 1CAUB 1OQDA 1QJEA 4RGKA 3EQEA 1SHWB 5JCTA 1ZRFA 3GZUC 2RJ2A 5K0UA 1B35A 1DF0A 3LDRA 3K35A 1FX5A 5C5TA 3N9OA 2CTVA 3W9AA 4DNYA 1REDA 3HNYM 3PUHA 3GBGA 5E8AA 4P5YA 3S57A 3VZKA 4XMIA 4CP1A 1CAAA 3TYJA 1AX0A 1RITA 4M01A 3UKVA 5FTTC 4X8NA 3BPZA 3IDBB 4Y5SA 1AL22 3UL2A 2JDZA 1NLRA 4BISA 1HJGA 5C8CA 4TVMA 4Q4V2 5J96B 2FZ2A 4TXWA 4V1PA 3N7LA 4Y4RA 1AX1A 2XR4A 2AUSB 4AI2A 4XC9A 1BK0A 2GC1A 2XBO1 5LA9A 4D7SA 4XF3A 3ZDSA 1SCRA 1I1EA 1OD5A 5A3WA 3SKVA 3PUSA 4WM8C 1OH3A 4R4ZA 3LWRB 4RGAA 3ZIXA 5IK8A 5IWFA 1RUC3 1SBFA 1VBE1 3AKTA 5LRSA 1FOD2 1UAIA 2XH6A 4B7KA 4QPGA 3PTYA 1PGSA 4EQVA 1NXEA 3PU8A 1C28A 5JI7A 5ACA1 1ZVFA 1PK6A 5AI2A 1ULOA 1OWBA 3DPRA 4YVSA 4IXLA 1YV1A 1OMIA 3KYXA 3ENRA 2GH8A 3RPQA 3VBFB 1SG3A 2KXLA 4QGLA 1EUTA 2PHWA 1AVBA 2IVJA 3PUQA 1STMA 3RZZA 5F2SA 2RMU1 4CXXA 4CDUB 2JG8B 1RYQA 4XCAA 4CDWC 4D69A 3I4NL 4HG6B 3MIGA 3KGZA 1PO23 2DVBA 4KBBA 3ZSLA 2PPTA 3NFPI 5FYTA 2CAUA 1C09A 4V2VA 3RZTA 5D8AC 3HOXL 1VAVA 3DF0A 4Q4Y3 4RSUA 2K2SA 1IW7D 1SDWA 3POWA 3POIA 4XF1A 4Y1VA 2P2KA 2PYTA 2WO2A 2J1UA 2WUHA 5FY7A 4AVTA 4CP0A 2R16A 4YVWC 1US3A 3LWQB 2YXSA 5C9AA 2FDHA 4H14A 2ERSA 5KHJA 1WW5A 4Q0VA 5FMBA 3WUDA 3WW2A 1MQTA 2VZ1A 3C3VA 3R6SA 3VV1A 4CCLA 3VLBB 3TN92 5JLVA 4CPBA 3SEEA 3RYGA 4QPWA 3W5MA 3P1IA 2VQTA 1D2QA 1Z0HA 1W3VA 3P3PA 4XFFA 1REFA 2DWRA 2W5FA 3NKTA 1GZCA 4K40A 1NY72 1T9PA 4WM7A 2ZGKA 3BODA 3LWOB 1FI2A 1WZXA 3AP7A 4ZN1B 5C71A 3VHNA 2W91A 1UY0A 2RVAA 5IYDL 4POFA 5IUQA 1GBGA 1R082 3FHQA 1PO12 4KNCA 5LY2A 2IXJA 1J59A 4A42A 1YK4A 1XU1A 4FAGA 4FPYA 2Q0AA 2RR12 1S24A 2NYDA 3KD4A 5KXEA 1C8NA 4L8QA 4Q27A 5BYNA 5CVRA 2Q8DA 1EY2A 1WCUA 1WA6X 2R062 3KT7A 4KBZA 1K42A 4DXZA 1F4AA 4LLOA 1W8OA 3HJWB 1IS6A 1BJQA 1AYN1 4CDXC 2VZUA 3ZYHA 3LA2A 4YWAA 1W8HA 1ZRCA 4QHOA 4V2WA 3P5BA 4EV0A 2NMNA 5AC93 1J83A 2D97A 2LTNA 4LOTA 2PTMA 3TB0A 2XUEA 2E63A 1JUIA 1X8MA 2WAOA 3AXDA 3I4IA 1O3SA 2H0BA 2ZKLA 3SHRA 4RS5B 4Q0UA 5FBJA 1W2UA 4IGPA 4Z82A 1YFXA 2PN5A 3A0KA 5FYHA 1O7FA 1K5MA 1B2JA 1EAH1 1BVP1 4IE5A 4B29A 1TWGL 3S16L 4AFBA 4A7KA 2W2IA 2ZEXA 4LBOA 4OULA 5EJ3A 1S30A 2FCUA 3LSEA 3OJBA 1YFYA 1XNAA 4LKFA 2IXIA 5FPUA 3IWZA 4XF0A 5A32B 1D2SA 3WT3A 3D6EA 4B4RA 1JS9A 2D6PA 2W3JA 1HRI3 2VZ3A 3GDBA 5A80A 4K3UA 4DFSA 3CKHA 1MVQA 2OPKA 5KXCA 3HNMA 3K4ZA 1ODNA 2GSYA 2VMIA 1QJY3 4RHV2 3ZKUA 2HEVF 1N47A 1K5JA 4AI3A 3VKFC 4MGKE 4M4RA 1D4M3 3FKIL 1GQPA 4A3FL 1AR93 1LJ7A 3IBMA 4JX0A 4XPVA 3GZEA 3PVEA 3S7EA 3OD0A 4QPIC 4BK4A 3ES4A 4OI4A 2IZWA 4WV8A 1O59A 2DYCA 1EUUA 1MS3A 2WYFA 2ZHLA 4JKKA 3Q8AA 3ZXKA 1QJFA 1DFQA 4GULA 4QPYA 5DN2A 2MEV3 3ZKYA 4A3LL 1CJDA 1S0IA 4BJ0A 1O4TA 2W1UA 4HSJA 2EA7A 1N1VA 1KRIA 1I9RA 3CO2A 3ZSMA 3ALQA 2PVXA 4GS7D 3LWPB 4Y22B 5A33A 5IFTA 3B93A 1W06A 4QQHA 4ZU7A 3ZSEA 1LOFC 4XILA 5T50A 4UY81 3BN6A 1DQ4A 3AKQA 2TBVA 1AYM3 2DFBA 2VOKA 4LA2A 1CN1A 5C3SA 3RS6A 4GH4B 1POQA 4AI9A 2RS12 1CQ9A 4WZCA 4NRPA 2VTXJ 1F9KA 4FPGA 4AEKA 1H8TC 2V4AA 1MS0A 2XJRA 2Q5TA 5GALA 1YUXA 1CAVB 1H2NA 2UWAA 3E6CC 4ET7A 3AYEA 3HOUL 1COV1 1H4GA 4JV4A 5FREA 5SV5A 3RZOL 2SLIA 4MLOA 5A7QA 2G19A 1MS4A 4LUKA 1GV9A 4C0HA 2NM1A 2PLV3 2VZTA 2Y38A 4Y7NL 3NKGA 4W50A 4N53B 4NOTA 3GTLL 5BNPB 2VZRA 5HCFA 1HXS2 1LOCA 3ZO0B 5A3UA 1ZZCA 4O7XA 2J1SA 1GP4A 2VJXA 1OXCA 3NJYA 2LUWA 4BIOA 4L99A 2ZHMA 4Q8KA 4QKDA 3I3MA 1NAEA 1MQTB 2GU9A 2BNNA 3ZFGA 1GQHA 1D4VB 1CIWA 2AGSA 4NR1A 4ZU4A 5JSOA 1GP6A 1NXD1 1KJRA 1IS3A 5APAA 4HOOA 3NV4A 4N90A 1BZWA 3ILNA 3NV1A 3MLJA 5FPZA 4FFFA 1ZREA 1LU1A 3KT1A 3LD8A 4AFCA 1RVF1 3KV6A 3VL9A 4NPMA 3C7FA 1MPXA 2DVFA 1LGNA 4CEYA 1RUI1 4A3DL 4ZU5A 5T5OA 3JD71 3IMNA 5C70A 3RMXA 1OBNA 2RS53 4NPLA 3VBFC 4XAEA 3I3EA 1YXWA 2VUAA 5AFEA 4HLTA 5A7WB 5FZOA 1O8PA 1IKQA 2GC3A 2X05A 5FYYA 1S2ZA 2B39A 2JG8C 3I8TA 4MHUA 1UWWA 4BCUA 2WBKA 4YARA 1CONA 5F2WA 3T2QA 3UJOA 3ZFFB 1XNTA 1ULEA 4LO7A 3UGHA 5LA0A 1S2KA 4CCCA 2KD7A 4MUVA 1RUE1 2J1EA 1GFF2 3PNAA 3MIFA 4FBFA 3VZOA 5L7OA 3U0ZA 3H9AA 4Q4W2 3KV5A 4OUEA 1KEXA 1QJX1 2ERFA 2JX9A 5LASA 3VL8A 4CDQA 3JB4C 3KHBA 3NL1A 1QY4A 4GB31 1JYNA 3G7DA 3VBOB 1OVSA 2DVGA 3J8F1 1UPIA 1DG6A 5DDJ1 5GZFA 3V0AB 1OLME 3SH3A 2PAEA 4MSVA 3ZYFA 4HL0A 1WCDJ 4ME3A 4LO8A 4HN0A 3W21A 4SBVA 2WNUB 1DYPA 3TRSB 1HV0A 2JDYA 3HIFA 4XFAA 5FPXA 3JU9A 4Y24A 3D0SA 4OHVA 5FZKA 3GF6A 2R043 1QEXA 1YUZA 1UD1A 2Q8OA 1GR3A 1WD4A 4Q4X1 4HKLA 3PL5A 5IJRA 3ZXFA 4IDZA 1BEV3 2LM3A 2WNOA 1HRV2 4Y1UA 3NJXA 1RB9A 3I2HA 1JYXA 4KH9A 2EAAA 2VOTA 2JD9A 1KJLA 5D21A 5KXDA 2HBTA 3NNMA 1SFPA 2F4LA 2ZX1A 2ZPXA 1JXNA 2J22A 2FHRA 1G9BA 1WBLA 3WQ1A 4XQWA 4CUGA 2IXKA 1CAWA 5FRAA 4XDQA 2VBBA 3PU3A 1H1IA 3S7IA 4XMAA 2WS91 1G9FA 2MPFA 2ZAAA 2EXJA 4LBQB 4W65A 5BUVA 3O1MA 1IQDC 2YBPA 3GALA 4QX2A 4XUQA 1O5UA 3J26N 4LJHA 1HB2A 2CR8A 4XXPA 3LQCA 3DL3A 2X5IB 3DYOA 4AHWA 1OHFA 3W58A 4E27A 4RS5C 4AQTA 3RZ6A 1PFWA 2XJVA 1Y9GA 1LEMA 4OUMA 4CCOA 2XMLA 3FL7A 5KC5A 2VD7A 1VRH1 5K0UC 1B35C 4AWDA 4D6SA 1VCXA 2ZHNA 4Z2WA 1H2LA 3I2DA 2A3YA 2NZ9A 3HAXC 5T52A 1NNQA 4UFMA 2M6PA 4CSWA 4MH0E 1O6UA 2X53S 3WG1A 3B69A 4K6BA 2ZJCA 3D0JA 3ABZA 1AL23 1HQWA 5JXHA 5F5QA 1XPWA 1XRUA 3EJKA 2XVLA 3BGAA 4Q4V3 2VNOA 1Q43A 3CU7A 3WDWA 3QOPA 4GA9A 3WDXA 3WDTA 2O14A 1JOPA 3MZHA 2Y6LA 2PAKA 4B1LA 1RC6A 2OYZA 5FZ6A 3UKNA 4MGTA 2BOIA 4BQ4A 3KWVA 2MNGA 4LUMA 1VE0A 1Z7S2 2GN7A 1ND2A 4JGYB 4LHKA 4XQ4A 1G9AA 1YIPA 3VZNA 3THTA 3VDDB 4QPGC 1FOD3 2WABA 3N9NA 1B2OA 5CKNA 3KYVA 5RXNA 2E51A 3B3QE 4KU7A 3TOJA 3U4SA 3X29B 3BI3A 2P1BA 4XFIA 3POJA 4IUGA 4QKBA 5DAWA 4AK3A 4DINB 3DPRC 1TZOA 3LPGA 2BGPA 5FLJA 4FAHA 2E2HL 3VUOA 2LRPA 2Z69A 2G9FA 4GH4C 4W8JA 2PHDA 3TNQA 4XXAA 4CCNA 4AHYA 4COVA 1IRNA 4CRQA 1V70A 4NAOA 2WFF1 2ARXA 4M0HA 1LCLA 1Q3EA 4XHXA 2BPA2 3ZN6B 3F2ZA 1H30A 4CU6A 2A6XA 1W6NB 4IEPA 4RD7A 2JA6L 3VKMA 5L73A 2R071 3JR7A 2YBKA 4B4QA 4FOWA 4BMBA 2MHFA 5I8YA 4AEDB 4DY3A 4OFGA 1UMZA 1DLCA 1X82A 2P34A 2RDSA 3KCYA 4QKFA 3K2OA 3T09A 2HYXA 4N53C 2EF6A 1UU4A 3S1QL 4XF9A 4CYDA 2P3IA 3SXWA 1CADA 4LULA 1IOAA 5FZFA 5FBZA 3FDJA 3HNBM 2A6HD 1MQTC 5FAXA 3N4MA 4I02A 1I3HA 3S1NL 3WNLA 2RG4A 4AEMA 3CJIB 2HWF1 2ZGTA 2Y26A 4ARXA 4AR5A 5E16A 1R0FA 2VZQA 4AFAA 1RYYA 1V6MA 2XOMA 3H8OA 3B7MA 3BALA 3IIAA 1DZTA 4GKXA 1PIV1 1X7NA 1WUVA 4A3GL 3BTYA 3LOIA 1ENSA 4CCJA 1W6MB 2AUYA 4O65A 3W20A 4LK7A 3SKJE 1W39A 3LEIA 2GMMA 3NV2A 4LORA 5FZ9A 4RFT0 5KR7A 1GU3A 1NCRA 3AXEA 4BIFA 1UOBA 3QLQA 4JCKA 3RWNA 3TEXA 1PFVA 1ASJ3 1WA4A 3HOWL 1W9FA 2PFWA 2VOWA 2WT1A 3B9IA 3VDAA 1R083 2YZ4A 3A7QA 5LCWL 4NWVA 1PO13 2BOJA 4ZONA 1X9PA 4ZS2A 1KDKA 3ZFFC 4AQ2A 3M70A 1NQDA 1LHNA 3NNJA 3B00A 2RR13 1DQ5A 1AZDA 1Y43B 1NG0A 1CAWB 3NO8A 1K3IA 4A3CL 5H9QA 1A8MA 3C2UA 3C7GA 2R063 3OUIA 2K2DA 3ASIA 4XJWA 2H12A 1KS4A 1YQ2A 4UBGA 5CG9A 2NYYA 3VBOC 3FUQA 4BBRL 2AZ5A 4MGIE 4MZUA 4Z2AA 2QQPA 1OA4A 3OBTA 1LECA 5IW0A 1GANA 4KWLA 3BTZA 2Y6JA 2XLAA 1H9WA 4YFZA 1CWPA 3PIGA 4ZHNA 2ETEA 3L2YA 4CP9B 1RUH3 3BPSA 4TSVA 2WNUC 4SLIA 3RMYA 1ULCA 2TEPA 1KD7A 3FWEA 3GZAA 2AEYA 2B5HA 3HBKA 4FOQA 2Z2SB 1ND3B 4I0BA 4PT6A 2Y6HA 4YW1A 3O1VA 1ZRPA 3PDQA 2Y0OA 3KVBA 1ZM1A 3HR9A 5FPVA 5DUXA 4DXTA 4LQRA 1Q8VA 4IV1A 3U14A 2H0VA 4LNVA 5H9RA 3OEBA 3VHPA 1RUC1 2O5JD 1RJ8A 3N36A 4AI1A 4LR4A 5FP4A 2EIDA 5D2AA 2ZTNA 3RYRA 2QTWB 4EN9B 3AKSA 3HMYA 4RHV3 2BBAA 5FP7A 4MGQA 1AR71 1MZEA 4GQ7A 4XDOA 2C1FA 3IPVA 4LKEA 3OG2A 4QX3A 1QJY2 2HWE1 2SBAA 2VGDA 5EYYA 4D0QA 2A6VA 4IV3A 1DX8A 2DF7A 1GYKA 3WNOA 5HXMA 4HETA 3SQOA 1O3TA 1GWKA 1R0GA 3GTJL 4BQXA 4YZ1A 1WCML 2X5IC 3N3HA 4NHKA 3WNNA 3VZLA 5C4XL 1MS5A 4E4SA 1ZA4A 3M3CA 4ATFA 1PO21 3QQCE 2JDPA 4HZFA 2F6BA 1AR82 4AR3A 1REEA 4LO5B 3S30A 2VOXA 1S0FA 3NAPA 1PGW2 3OYWB 1Q8PA 3CLPA 2Z3QB 3R4DB 4Q4Y1 3ZYPA 1DGWA 1XE8A 3MPBA 3TEYA 3AVRA 2MS3A 2R49A 3D3AA 3K3OA 4N9HA 1S0DA 5FO7B 1WMEA 2XJSA 5DUUA 3LNLA 1UO9A 1NXGA 2A69D 5DABA 3VBUA 5C3PA 3PHMA 2DUOA 3TAYA 1MEC2 2DURA 3EMRA 1G8WA 2A1XA 3KYWA 4QM9A 3AK0A 1VB2A 4TTGA 2VUML 3LA7A 4AOCA 2A7AA 2XQRA 5IVBA 1NOVA 4CDWB 1JYIA 3OCPA 1FNYA 4K1YA 4M3CB 3CHXA 3POSA 4L97A 1V9U1 3PTRB 1XE7A 5JZGB 1H6YA 1DGRA 5HV0A 1IHMA 1HXS3 2PLV2 1Z92B 2AH2A 1BBT1 3C8XA 5FYSA 4YLZA 3MHZA 1GWMA 3FE5A 4JGYC 5C3QA 5F6LB 2I2SA 2B9VA 2J1AA 2A3XA 4XUTA 2J7MA 3AJZA 4QX5A 2GAUA 1PVXA 3AZVA 5T55A 2X10A 3Q8FA 2P3YA 1R092 5FUIA 1LKNA 3M3OA 4UF0A 4R4XA 3GYDA 4CEYC 2VL6A 3O1TA 1XOYA 2QQIA 4XFHA 2B9UA 5AVAA 3ACLA 3BUCA 3RZHA 1W03A 2JB8A 4MX3A 2B4KA 4A3BL 2I07B 3G6JB 3ZLIA 1LKOA 2WNVA 2WL1A 4FQ4A 5A1FA 4Y33A 2WN3A 4N43A 4HFSA 5C4WA 3WDUA 2C6BA 1R9TL 2DCJA 2RS31 2VNVA 3WW4A 5AC91 5BV6A 1QOSA 4XURA 2QQMA 3GTQL 2Y0SP 1E8JA 3M1HA 1BRFA 1WCKA 2FZ1A 4TYSA 4JKMA 3WOGA 5L7OC 2JDUA 4N9IA 2QQLA 3MI8A 3MLKA 4LTAA 1RMU1 2M4YA 1UZYA 4QIWP 2BEOA 1CPNA 2UYAA 1ALYA 2L9LA 1FPN1 3H7JA 1AL0G 1W6OB 2IXCA 3FHIB 1OVPA 2P5BA 5IVCA 5CNAA 1VBB2 1RJ7A 1W2AX 2JB4A 2YB7A 4HPKB 1RB8G 5F9TA 1HRI1 2YU1A 4JGZA 5DPNA 5KHKA 4Z92B 1MS8A 4TN7A 1LNSA 1ZZ7A 3O1OA 3MV01 4LIVA 3O0WA 3BIEA 2WB1P 1VBE2 3V0BA 4N7UA 4WVMB 3GHNA 1NX9A 3ILFA 5BNNB 1VRBA 2TNFA 4WBBA 4OHZA 2VW0A 4BLJA 1SQ4A 1AR91 5GLVA 3K46A 1HRV3 1OLMA 2TUNA 1UY2A 3OTFA 5C7GA 2EXKA 1AJKA 4ZS3A 4E4DX 4PLNA 4LHNA 1W0OA 5J1XA 3WDYA 4XABA 5C3RA 2MEV1 4KGGA 2V73A 3WF2A 2YMZA 1PX4A 4AYBP 3IDCB 1S2EA 1PMIA 1VBD2 3MW4A 4QM8A 3OPZA 5G05L 3WLUA 1HW5A 2GNMA 4RA0A 1JYVA 3ETQA 3JUUA 5LA2A 4JZRA 5LBBA 3EXUA 4AEDC 4A3EL 3WSOA 5FDBA 1RL3A 1OOPA 1S1AA 2DTWA 2XB6C 1AYM1 3U1XA 2Y6FA 4ASKA 2ZGUA 3NV3A 4XEZA 1LR5A 2YROA 4Y3OA 5FXZA 2IC1A 1PGL1 1ULGA 2AYJA 2YPJA 3NQHA 3HT1A 4RXNA 1VBC2 3D5OA 1LAJA 1F15A 1VAKA 3FBYA 3OPWA 1EPZA 4C90A 2BW8A 2BNOA 3P2AA 1ND3C 1V6NA 4QT6A 4BXFA 2YUEA 2V0EA 1RXGA 2WO1A 2HR5A 3HBZA 3DEMA 3IIIA 3KQRA 4PIZA 2PMWB 4DB5A 5LK7B 1CAXB 3HOBA 3WQBA 5EIYB 5MF6A 2ZXQA 3I49A 2IWGB 5A6YA 2AENA 2OS2A 4Q1PA 1TQ5A 3JXSA 5K4LA 3RZLA 2A68D 1BXHA 3JBG1 2M6OA 3AJYA 1QOTA 5DMYA 1H8TB 1MACA 3K4DA 4AEJA 2ZGLA 2E53A 1QHDA 5A7OA 5IVEA 4QU2A 2WWJA 1R1ZA 2HWD1 3CNAA 5FJHA 1CR7A 1JTZX 4OHWA 4QHZA 4AGVA 2ZZJA 3AFKA 1JZ8A 1E5IA 1W9WA 3MYXA 5FMOS 5LB6A 2BV4A 1OWCA 2BE5D 1G7YA 3QBQA 2FDIA 2Q30A 2RS51 2QJVA 4NHYA 1LGBA 2HJIA 5FOJB 1Z7S3 4XYXA 4K7JA 1SPPB 5AI3A 3GCWA 2EY4E 3POBA 1JYTA 4AR2A 1KGYA 1NYWA 1ENXA 1S0CA 2E31A 2HEWF 1Y3TA 2VG9A 3NJZA 3M4OL 1ZRRA 1PMHX 4XCBA 2A6ZA 3GCXA 3RZGA 4E8DA 2WFPA 4CZSA 3HOVL 1BMV2 5A3OA 1H1AA 3HN3A 3RZDL 2A70A 5LWBA 5GZEA 1NQJA 3MIEA 3ZXAC 5CISA 5FZ8A 2VMDA 4BY1L 5FY8A 4QX7A 4B4PA 1POV1 5JXJA 2D5FA 4KWJA 5GAGc 3S2DL 2RV9A 1GZWA 2JA7L 1EAH2 4HVRA 2JKXA 5DAXA 3D4KA 3KMHA 4NO4A 3WD5A 2AC1A 3EHKA 4NE9A 3BU0A 1W0PA 4COYA 1LOGA 3LFIA 1UZVA 4BQ5A 4H55A 3MPPG 3OGSA 1SZBA 2OQ6A 3PMEA 2W47A 3GJBA 4BQWA 5JZGC 5C4JL 1W3XA 5K7PA 1RUJ2 5DXDA 1UW8A 2C4XA 1UYYA 2XG3A 4X6AL 5I93A 2R0HA 1SLBA 4XACA 5F5AA 2P3KA 1WW6A 4JDMA 1GWLA 2ET1A 5LW9A 1UNBA 4NIHA 4QD2A 5GAEc 2GP5A 5IK7A 3OGGA 1FAYA 4OVEA 4FO9A 4RR3A 2ORZA 2CKCA 2WYSA 1ZZ9A 1PVC1 3PKJA 1DGWX 3KF3A 3T3YA 2KKDA 3O5SA 1W6QA 4CCMA 5LEKA 3RDIA 4DXSA 5FQ0A 2D43A 2EXIA 3THDA 1PZ7A 2D7FA 1QH6A 2QQVA 1NCQB 3OSDA 3GXUA 4H7MA 1QQP1 4B1MA 5L19A 1IPSA 1BHGA 1XQNA 3LOBA 2J1VA 3CEWA 2E6VA 4RQPA 5LK5A 3THCA 3DUIA 1A78A 1DQ2A 2VCCA 4HANA 5C3OA 3AZYA 4CEWA 1SLTA 2JIGA 1ASJ2 1NKGA 3KF5A 5CZKA 2JDMA 4I3GA 4S2HA 1W6PA 2XGXA 2XONA 3E5QA 4FQZA 2C0ZA 2QDRA 1TNFA 2R32A 5J36A 3VBSA 1RHI1 3I2GA 4QDSA 3EO6A 1SFNA 4OMCA 2J9UB 3UV9A 3ORJA 4CXWA 3ACFA 1YLLA 4UAPA 2NN8A 4ZN3B 2RM21 3UYJA 2PHTA 5GZGA 1W8UA 3LWCA 4BE3A 3AFGA 4LMFA 4GWMA 5DM61 2NQYA 3WR0A 1IU6A 1Y9QA 1SBDA 4E8CA 1I3QL 1RUH2 4AAPA 4TWTA 3A23A 1SLCA 4Q4V1 5BNNC 5M3ML 5IATA 5EYXA 2C9AA 1JZ4A 1ZNPA 3LZZA 5F7UA 4IV1C 4XBLA 1JZ2A 2FMDA 5K2ME 2CU5A 3FFZA 4UI9L 5K0UB 1B35B 4Q0PA 3BKZA 2H6BA 2BP6A 4S2FA 2YV8A 2BDRA 3HAGA 4YW2A 2VC9A 3KCCA 3PO3L 1B13A 4OI2A 4EWAA 2YFUA 1O3QA 3WVJA 4IQPA 1LHOA 2ILMA 1QQTA 4X8PA 3K7AL 2FDGA 4C2M1 4HKWA 2P17A 4O61A 1YI9A 4PQQA 5EXOA 3BYWA 4JQRA 1OPMA 2G4IA 5C8CB 3ST7A 4NIIA 1XE0A 4COWA 3S14L 2QZ2A 3WF1A 1RUE2 3IAQA 5L9BA 3AP4A 5B2GB 5KHGA 1UYZA 2W68A 1SFYA 1PNGA 3HN1A 3LSDA 3N35A 4JTNA 4Q1RA 5CU1A 5IVFA 4W6WA 2WT2A 1IS5A 1YHFA 3H99A 2VL4A 1R0JA 1OF4A 2HEYF 1HB3A 1QJU1 4K21A 3VD7A 3QVDA 4MHRA 1GOHA 1AR83 4Q2FA 4QPGB 3RJ2X 4XUOA 4YM1A 5C5UA 3POGA 5FIXA 1ZBE3 1U0AA 5GLTA 1N3PA 1PK6B 4JAAA 3ZPOA 3DPRB 2WZEA 3LIGA 1YFWA 4YVSB 2FD8A 2ARAA 3V64A 1DU3D 4EN0A 2ZGQA 3H9BA 3MV11 1MEC3 4B8CD 4IW3A 4EN6B 5CFCA 1WGPA 1XBFA 5FZCA 2QVSB 4EYUA 2UU8A 3WNXA 5J48A 4PJYA 1HQLA 3UKTA 4G4FA 4YZ2A 1HIXA 4R9AA 2DFCA 3MO4A 3TN91 5KHIA 3VGIA 4NWWA 3ZN5A 4TZDA 3O0VA 3HOYL 3EBRA 4UW4A 4LT5A 5J09A 3DCQA 3GJAA 3DXTA 2KM2A 3IN9A 3I2IA 2FDFA 1NY71 4FVVA 5FZLA 4MADA 2ZGMA 5GADc 4BZ4A 1BQPA 5T54A 5C9AB 1S55A 4DMIA 3RYKA 2VTFA 4L9BA 5FWJA 2ARBA 1R081 1PO11 1SMMA 3ZG6A 2D3RA 2BWCA 2WNEA 2ZBJA 1US2A 4KL1A 5JAXA 1QF3A 2A5ZA 2YDEA 1R093 1UY1A 1Q8QA 3FN9A 1IU5A 4BK5A 2JD4A 1FMD2 4FPOB 1S0GA 3LB9A 3M3IA 2C9KA 4G9SB 4MXWA 1TWFL 5F1RA 5T5JA 3T0AA 4WM7B 1XNCA 3MUY1 3PLQA 5L9RA 1C8M3 5CADA 3B01A 1VBA2 2VCBA 5C4WC 1H2MA 1SDDB 4P5HA 1U5IA 3ZSKA 1VRH2 4DRRA 3IM0A 4CTEA 4PF5A 5EINC 1YNAA 2JXAA 2OQ7A 3UK9A 4AVAA 2ZGPA 4XVHA 3ZFEA 5LZ6A 3ZXEA 1HN0A 4W6XA 4I3PA 5IYCL 5FK8A 5F3EA 4CU8A 2XPJA 4PDWA 1YRZA 1JODA 2ZGOA 4XETA 4XJAA 3DN7A 1UOJA 3ATGA 4UXAA 3JB8A 4E2QA 1RUG2 2V5YA 1WLDA 5FP3A 3N9PA 3E1F1 1C1FA 2C6SA 4GZ9A 4B8EA 1VBB3 4LBJA 1QDOA 1NE4A 1XXNA 3PWFA 1UOGA 3P8BA 1NA1A 3AMQA 2PXJA 3O0XA 4FCAA 4DY5A 3S6PA 1GLHA 1GQGA 1VBE3 3CZJA 4E4ZA 3PIJA 1UF2C 3KQ4B 2BFUS 1K5MB 1NCQC 2XKPA 4FPLA 1WW4A 3NWKA 4P9XA 3I4ML 5FP9A 2CAVA 4XFCA 4XZUG 1XSRA 5ABJA 1APNA 3NNFA 3WEZA 2PHFA 2YPDA 5FY5A 5JR7B 2WWSA 3APBA 3LFMA 1VBD3 2D44A 4HBNA 1LOBA 5HBAA 3H8RA 3VBRA 3ACGA 1OA3A 3KV4A 5C33A 1OOPC 3N9MA 1LTLA 1CIYA 3BOWA 3VBHA 4U36A 2R1DA 3BTXA 3DYPA 4XGHA 1U5XA 1EV12 3I3QA 1G9CA 4XZPA 5HCHA 2CGOA 2VNRA 4XUNA 4DUWA 2XVKA 2RS11 2CV6A 5EJ1B 4U2AA 5JSRA 4A3ML 2Y60A 3QCWA 3N7KA 2D3SA 1LKPA 2G9GA 3KYUA 2QFEA 1VBC3 2XL9A 3H3UA 2XJUA 2RDRA 4L2NA 3RFRA 1A8DA 3WW3A 1W8FA 1O8SA 3MGUA 1CJPA 5A33B 3T0BA 3WF3A 2RDVA 3I59A 2HWF2 2J1RA 2J1TA 3WCSA 3IT8A 5F6KA 4OI1A 4BLIA 1HXS1 4AHXA 3SS2A 3AL6A 3LF7A 3U4XA 4YWLA 1JYCA 3DKWA 3POFA 1K83L 4ITCA 5CBLA 4UW3A 4JADA 3H3VM 1XNDA 3K77A 3TBDA 4COZA 3VDBA 3H9CA 1SLLA 5DUVA 1BYHA 4OLLA 2NVTL 5J3UA 3VZMA 1OA2A 1OURA 4LEJA 3ZYGA 2WZ8A 3KB5A 4IE4A 3DKQA 1UQXA 1SMWA 1UXZA 5A6XA 5C8CC 4OI0A 2OVUA 3H7YA 2ES3A 3ON7A 2DUQA 3C7OA 2BRTA 3C7HA 4FPFA 5EPAA 4QQOA 5FY0A 3HWJA 4NROA 4Y20A 2ZMLA 1EPWA 3GBFA 4Y5TA 3ZFGB 3WX5A 2R7ZL 2WO3A 3L9JT 2ATFA 2PHRA 2WZR2 3KV9A 4ZZ5A 3GNEA 2RJLA 2WR9A 1WCQA 1RWDA 2JWPA 2VZOA 5DM71 1ENRA 4AAXA 5JMCA 1RUF1 4Q4W1 3J7LA 3HQXA 3O1SA 3ECQA 1PK6C 2ZEYA 1YFUA 3MW3A 4IE0A 4Y1YA 2JI3A 2X29A 4YVSC 4CEYB 1PZ9A 1F4LA 1OFNA 3JQXA 3ZIWA 1VB4A 2ENRA 2OIIA 2VMFA 3OY8A 4NHXA 5I8TA 1EAH3 1W90A 1AF9A 2CHHA 1TME2 5FZOB 1C4RA 3O1PA 1R0HA 2A73B 2OW4A 4HK8A 1G86A 1TG7A 4ARYA 4JRAA 5IK5A 5KHHA 1GP5A 3IZOA 3MIBA 1AR62 2JE9A 3H97A 1LEDA 2D6MA 4FXGB 3ZXLA 1PM7A 4C0BA 2WDBA 4PBPA 1AHSA 1XYOA 4WM8A 1CX4A 5M0TA 3N9LA 2D6NA 1RUJ3 5L7OB 4CDQB 2YG0A 3EYPA 4JKLA 2ORXA 1OUSA 5F8PA 1C5HA 5FZAA 1JHNA 4P9IA 2JG9A 2WT0A 3WWNB 1HRV1 3K48A 5C9AC 4META 4P02B 3H42B 5A3LA 2HWE2 4IEYA 5IAVA 1E5HA 1PMJX 6RXNA 3WQ0A 2ZKNA 2IXHA 1AXKA 1TWAL 2AYHA 3USUA 2NLRA 3PUIA 2DCTA 4AR6A 2GMGA 2WC2A 2HWC2 4PBOA 5DAVA 4A7ZA 5IHRA 1RTVA 1DGLA 2ZA9A 3I2JA 4YPJA 3IMMA 1LU2A 4LBKA 3L2HA 3PJQA 5EV7A 1J3QA 1QJZA 2OUJA 2XHNA 2XXZA 3H50A 2QQKA 2BU9A 2VQ0A 4HT1T 5CKQA 2V0FA 2ZGNA 4P9LA 3U78A 1OFSA 5D8AA 5G04L 4E4HA 4D94A 5FMOL 5MFZA 4P08A 2Q8CA 4D6RA 1J3PA 3I3DA 1OI6A 5BNOA 1IS4A 4CE8A 2XL7A 5IP7L 1X50A 4YVWA 3M3YL 4PHZA 3QD6A 1XC6A 2GDFA 5BPXA 1TMF2 2QQNA 4HONA 4QX1A 3OOXA 4UW5A 2CKAA 5A7SA 5BY5A 1UX7A 1COV3 1S0EA 2HWB2 3ME2A 5HXVA 4BYYA 3S15L 3OGRA 3J7MA 4WFN1 1NZCA 1LOAA 2A71A 4AQSA 1L3JA 3H0GL 2FDJA 1WKYA 5ANNA 1C57A 2YY1A 2PAMA 4H3WA 4XHBA 3MICA 4EWEA 1FYUA 1W8TA 2AR6A 4FSJA 3WF4A 1O4YA 2W1QA 2ARCA 4AYUA 2LCQA 5D1IA 1BBT2 1K45A 3MUZ1 2YC0A 3PVNA 1LHWA 4IGQA 4UFLA 3TEZA 1BKZA 2AQCA 1K12A 3KLSA 1IGOA 1LULA 1HDKA 1ZX5A 2Z42A 2KN9A 3I59B 1ULPA 4IL7A 2ZHKA 3HKZP 1J1TA 3FC0A 4YSFA 3ZR5A 1K5MC 2DCKA 3AL5A 2VXRA 3VKOA 4N7IA 2G1MA 2VVDA 5IYBL 4FOYA 3WW1A 2M4VA 1KDMA 3WP6A 4YWMA 3PJYA 4PIYA 3RZJA 3PZAA 1Z7S1 4YNIA 4PI2A 3T2PA 1RUD2 2R7EB 3OBZA 3HVDA 1S4CA 5FLIA 2ZX3A 3MFCA 3VZJA 2WA3A 3R4SA 3ZPYA 3SNMA 4LOSA 1NLQA 1H0BA 1KFUL 4XIOA 5F5IA 2JI1A 4CDXA 5CKMA 3VD5A 1WCSA 1O91A 1RUNA 3VPBE 2QE3A 4WVVA 1M06G 4ONUA 1ONAA 2RS32 5EWSA 2CSGA 4A2UA 1LOEA 2AEZA 2Z5WA 1RUE3 2UY8A 1PZXA 5F3GA 4URTA 1SEFA 2WINB 2RFKB 1CESA 4NMIA 1HB4A 1RMU2 1YJKA 3FUOA 3OGVA 3USSA 3ZMOA 3M2MA 4KQ7A 3NNGA 4XBQA 1ND2B 1P8JA 3AMMA 1VMHA 4P9YA 1QXRA 3NJVA 4DS0A 1WJVA 2VUDA 4JDNA 1ZBA2 1XSQA 5HV4A 1FPN2 5F5CA 1QNYA 3VB9A 1YJLA 3KCXA 1MZ6A 2VVFA 3OEAA 2Q1MA 3IKWA 5LEJA 1V6KA 4BXSV 1HX6A 1A3KA 1Y4WA 2E2IL 2ET7A 4GXLA 5DUWA 1DYKA 1VIWB 2AACA 3JCIA 4BY7L 1ZBE2 1UY3A 2XHKA 3WY6A 4WVZA 4EE2A 1R1A2 5EP9A 1JYBA 3SH4A 4LLFA 4YW6A 2DDUA 2K0GA 2PHUA 4Q4X3 5FYCA 4BMEA 4FFGA 1BK1A 1QOOA 3A0NA 4R52A 1RDGA 1IKPA 1VMFA 2FMYA 3AMPA 3BTAA 4RYDA 5FZ3A 2W1SA 1A6CA 4QPIA 2J42A 2VOVA 4BM8A 3QH6A 1U5YA 2Q8EA 4LBNA 3CL1A 1A34A 2VY0A 1HB1A 5ANQA 3THPA 3KS7A 1WLTA 2P4EA 2BGOA 2C24A 5CA6A 1LOFA 3T08A 1JN2P 3MSUA 3FBMA 4AFDA 4JAGA 2VE1A 5JIAA 2PELA 3ZFGC 1CAUA 1O3RA 1LRHA 2JE8A 3WXPA 3PUAA 1H2KA 4CCDA 3H0OA 2ZCWA 3MBWA 2GN3A 5I0SA 1O5LA 1ZYBA 3HOZL 2GZWA 2O8QA 1PGL2 3VD3A 1UZ0A 2B63L 3AZXA 2ZEWA 4XQDA 3LKJA 1FMD3 5E88A 4CUAA 3HJRA 2VVEA 1WD3A 2NP0A 2LS6A 5FOBB 3PIP1 1VBA3 2BTVC 4R9CA 1GICA 1NCRB 4Y5Z0 5FYUA 1VRH3 1C8M2 5GM0A 5MLC3 4I0WB 4QHBA 3IDAA 4YGCA 4AI0A 5I91A 3WHUA 2BNMA 3DGTA 3IB3A 2PQSA 2A6ED 2HBUA 5FZHA 4QKNA 3URFA 3T0DA 5JDBA 1BCXA 2XDVA 1V6IA 1CX1A 2Z3RB 5F32A 4CDQC 4XFBA 3I97A 4YZ3A 5FFOC 1RUG3 3WG2A 1FT9A 3MW2A 2GH2A 3I7DA 4IEUA 3RGBA 2WSUA 4Q0SA 1KITA 2PMZP 4FP3A 4I30A 3LEKA 1P7PA 5FO9B 1NUKA 2VR4A 1PHMA 3NRUA 3R0RA 4FFIA 4ISRA 4Y4YA 2XBO2 2E9QA 3VBFA 4CPBD 4CU7A 5CIRA 3LPEB 5GAHc 4EROA 3H1YA 1L7RA 5HCBA 1QJY1 2JG8A 4CDUA 4ATEA 4ES8A 2ERJA 2DU1A 2BQPA 1C5IA 4C3IL 4M3CF 1D4M1 1I6XA 4UFJA 1GSLA 3Q8CA 4NJ4A 4ZXKA 3T4VA 1MS9A 3AMHA 2GMEA 4IV1B 2YC4A 3NW4A 5ACA2 1LESA 1UZWA 3S0MA 2WQZC 2VMEA 3O1UA 4A3ZA 2R6QA 1CZVA 1J84A 1LB2A 2QUOA 5IT6A 2WFF3 5I0UA 1DIWA 2ZMNA 3VBHC 4CA9A 4TPUA 1AR81 3H1MA 2G9ZA 1D0HA 4DXRA 3R05A 1JI6A 1YUDA 3IPVB 3MIDA 2RMU2 1EV13 1W28A 2R073 1GNZA 4F83A 1AUYA 2B42B 4ES9A 2XQXA 4INDA 4IV3B 3WDVA 3ZYBA 5C8WA 5L36A 2RE9A 4QU1A 1PNFA 3SMHA 1MEC1 2D98A 1YI7A 3RSJA 2OXBA 4QB1A 4YFWA 5GLUA 1RIRA 1JU4A 2ID4A 1BQ9A 3EB7A 2W92A 4I2OA 2Q4SA 4FPEA 1V6OA 1URXA 1GOFA 2JJ6A 3WP5A 3OUHA 2HWF3 3AZWA 1OQEA 3NAPB 4XTPA 3E5UA 4QAWA 5I8SA 1EP0A 1FXZA 2VW1A 1PVC2 3WCRA 2B7YA 5BNQA 2PLV1 3RG0A 4BQYA 1FHMA 4MXVA 4XW3A 2DBNA 2ADEA 4K9SA 2NVQL 5T5PA 5DZEA 3AM2A 3VN4A 1H9PA 3VBUB 4UWDA 1OKOA 5MFPA 2RJKA 1QQP2 5FZMA 3UJQA 3WF0A 1X36A 5FKBA 4FT8A 4NVPA 5IVVA 3T2TA 2H6CA 1R091 4A3IL 3I2OA 4C1XA 2ZIXA 3H8XA 3M3EA 4XUPA 3HJYB 3FLPA 3DXUA 3M7AA 4LBQD 3IAPA 2HYKA 3K51A 4OCTA 1LHVA 1N1SA 4RS5A 3ETPA 1YIFA 3CMGA 3NVCA 4XJ8A 4NIDA 1RHI2 2BFUL 1V6LA 3RJRA 5FYZA 3E6DA 4Y26A 1ND2C 4Q0QA 2KR2A 3ZR6A 4BWOA 4DRVA 5M3FL 4DZGA 4BXXL 2ZX4A 2WZR3 3SCGA 4BA6A 5AFBA 3OPTA 1DZRA 1V0AA 2VZSA 4QXKA 1DZQA 1FNZA 1AYN2 2UWCA 3JQWA 2RM22 3K4AA 1WW7A 4Y1ZA 4CUCA 2Y6KA 5JR2A 4XJUA 2JA5L 5CFDA 4AVCA 5A32A 4ZKTB 1ULDA 3O7OA 4UF0B 4BU2A 2EVXA 1ODHA 5A3NA 2P37A 4YRDA 3WUCA 5I0DA 3ELNA 3AYDA 1FV2A 1TME3 4PF1A 2EXHA 3S5QA 2WNVB 3AP5A 4BQ1A 1H4HA 4IEQA 1VBB1 4N43B 1SACA 4WVWA 2BGCA 5A7NA 5C4WB 4QGNA 1FHHA 1AR63 1DYOA 1OLRA 1Y7BA 2UYBA 1S0JA 3AP6A 3F95A 4YW5A 4OQ8A 5T5LA 1F2NA 1WLCA 2YYOA 3CF6E 1PM4A 3R4UA 3FJSA 4KGQA 5A3MA 1MVEA 4JC1A 1AR73 2JG9C 3ZVXA 2ZACA 4Y22A 5F3IA 2R041 4MGSA 5IAXA 5AVPA 3LDKA 5JXIA 3O1RA 3LA3A 3J7HA 2HWE3 1BEV1 4M3CE 4HN1A 2EICA 5ERLA 4MOAA 4LHSA 2YGLA 1VBD1 4GH4A 2UWBA 3B9CA 2DCZA 3I2FA 4JGZB 5HCAA 3ZYIB 5GKAC 2HWC3 1MR5A 3U11A 5FYBA 4NIAA 2W0XA 3E97A 4IERA 2GNBA 2W87A 4HVQA 1CAVA 3V0BB 2F17A 2N7GA 1QJU2 5JVG1 5GLWA 2R92L 4DIQA 2DV9A 5DQ0A 4E2SA 4QB6A 1W05A 2FCTA 3ITQA 3RZKA 3ZYRA 1NCRC 3ZXJA 1XYPA 3PL0A 3QACA 3VKNA 2FDKA 4YGBA 3VHOA 5BNOC 4N53A 4WM7C 5BNPA 2CDOA 1VBC1 1VZIA 4DOUA 4LPLA 4KU8A 4DEVA 1JMUB 2ZOEB 1TMF3 1GNHA 3B0AB 4QQPA 4YW4A 1GNYA 2HWB3 3W5NA 3P3NA 3PURA 4K1ZA 4F7ZA 1PFUA 1OOPB 1XB9A 4MG2A 1SLAA 1COV2 3J7NA 4K8FA 1AX2A 1V9U3 2WRAA 4XJ9A 4DO0A 4GMP3 5CFDB 1BVVA 1QGLA 4MV2A 3B02A 3LIHA 1EYBA 1J3RA 2FBEA 2OT7A 4HSLA 1BBT3 2VCMA 4H2AA 2VPVA 5I0TA 2GMPA 2CL2A 3OGJA 5FY1A 3WV6A 2VXJA 4O9GA 1LGCA 4MYEA 5JOWA 4BBSL 2YU2A 4IGOA 3LWVB 1F5FA 5A7WA 4A6SA 5FXWA 1DDLA 1AL21 2CWSA 4QX8A 4DUVA 1E5RA 5M5XL 2B45X 2WAAA 4LE4A 3ZFFA 1F35A 5LBFA 2PHXA 5HI0A 2BVBA 5JI9A 1D7PM 3BOPA 4C8DA 1LTEA 1UYPA 3K75B 5A1LA 1Y9MA 2QL0A 1RVF2 1RUD3 2RDNA 1JZ7A 1Y1WL 3OBAA 1WBFA 1PZ8A 1OUXA 1RUI2 1Z78A 3CQZL 3JD72 3POEA 4YM0A 3VBOA 4FTBA 2Z79A 1XJAA 2VH9A 1FOD1 3WP3A 4LHLA 3V0AA 1Q56A 2RS33 1BMV1 1F31A 2K46A 3FLRA 1UXXX 1H1MA 1V6JA 5IP9L 2RDQA 2VMGA 2CDPA 1QYBA 3MF6A 4C91A 4IV3C 1W9YA 2ZABA 2YHJA 5JIUA 1VMJA 2WNUA 1RDVA 3WINE 1W8NA 2BBVA 1RMU3 1TVGA 1DBNA 1PFYA 1T6BX 4UW6A 4A44A 4GIQA 1QJX2 1XNBA 1G6NA 1T9OA 3AB0A 5C6CA 4A93L 1ZBA3 4IEZA 4AL9A 1JZ6A 1H6XA 5SV8A 4GB32 1FPN3 2Y33A 3HQRA 1N3QA 5JVH1 1DHKB 1MZFA 1OT5A 3J8F2 5M5YL 4N8MA 2RHPA 5DDJ2 5CB7A 5IK4A 3NAPC 2JE7A 4XFGA 4GMP0 1RUJ1 3CZUA 3D8CA 4YZ4A 3T30A 1DCSA 2EAKA 5K9YA 4BH9A 1YYNA 4OHXA 3ACIA 1R1A3 4KG0A 3OD4A 3B08B 3VBUC 4POGA 3U07A 1AJOA 1GZWB 4A7YA 1JW6A 1U5ZA 3OB8A 4XDPA 2F4PA 2WKKA 5DZFA 4CVUA 4AVBA 5IYYA 3D82A 4LBQA 4P14A 3VD9A 3PIO1 4QX0A 4Q4X2 3K3NA 2ZX0A 5FXVA 1ZRDA 2XUMA 1QKQA 1BQ8A 4Z1VA 2VMCA 2IXLA 2A6YA 5FZ4A 3RWKX 4IETA 2WIIB 2X5IA 1OC1A 3VDCA 2OX0A 5FLHA 3WHTA 3MQKB 4LKDA 2LW8A 5EHDA 3ZXGA 2VTXA 2WA4A 5H9PA 2ZGSA 3I3BA 2ZS6B 2A75A 3CDZB 2NVYL 3HT2A 3ROUA 3RNSA 4FTEA 2O1QA 1ASJ1 1KS5A 4IE6A 4M4PA 4UOJA 2WS92 3ILRA 4RR3B 3FZ3A 3A4UA 3AC0A 2W94A 3ZX7A 4CXYA 1DVBA 1MZ5A 1XYNA 1QIQA 2B8MA 1W6QB 1VAMA 2RR11 3ES1A 5JUVA 2UY9A 2XVGA 2W52A 4IEOA 5FQ0B 2B46X 3GTPL 1M4WA 1W2NA 2VULA 4Q8LA 2R061 3UNPA 2OZ6A 4AI8A 3SLIA 2DSXA 4HK9A 1RUOA 3Q8BA 5MGNA 4AF9A 5FLML 4AVVA 2WNVC 1QMJA 3J4UH 4RQPB 3SITA 4N43C 4XTMA 4YW7A 4CEWB 4B3NA 2JDAA 4XF4A 4BPZA 3NNLA 4BB3A 2E26A 2I45A 2WLPA 2VZPA 2L0ZA 4RGGA 1SLIA 1W6PB 1CPMA 3INAA 1RUH1 4ZY9A 3V56A 2JENA 4FOVA 2WN2A 3AKPA 2Y6GA 3HD8B 3JBG3 3GTML 4JGYA 3ZSJA 1ENQA 3VDDA 3UETA 3OUJA 3RRDA 3U75A 3VBSB 2D93A 2HWD3 5JOYA 2ZMKA 3A44A 4ASMB 1HJFA 3KYYA 3A22A 3KZ4C 1VR3A 1I5PA 5JMOA 1UOFA 1YEWA 1UYXA 1D0GA 1W8ZA 3KT4A 5DAPA 5JOXA 3CQOA 1RINA 2XJTA 1ZA7A 4JGZC 2XBO3 4CCEA 4EZHA 2E33A 4KWUA 2LROA 3SC7X 1BLZA 3MPSA 4J1WA 4JQTA 3ZMNA 4CDUC 2CGNA 4RHV1 3GTKL 4GKYA 2WLQA 2QQJA 4L11A 4PQ9A 3ZN6A 4UYBA 1W6NA 2HLEA 1WMFA 4NRMA 4P00B 4W4ZA 3MFAA 1U12A 4BDVB 2XWJB 3WNPA 4XAAA 3PKIA 1HLCA 2VUJA 1RUF2 4DUXA 5EJZB 5ACA3 3M3QA 2EIBA 3FMGA 1RXFA 5FZ0A 2B5ID 1POV3 1H8VA 1V00A 2PA7A 4GJZA 4AQ6A 5K8SA 5CG8A 4JVAA 3RI8A 1QXJA 2Z4FA 3JZVA 1S2BA 2WFF2 3H1WA 4ASLA 2RMU3 1W8WA 4J1XA 5LBEA 4C3HL 1UMHA 2K9ZA 3CJIA 4ORFA 3LEMA 4LKSA 5IY0A 3M8LA 2VW2A 1XU2A 4PCRA 3VHRA 2C26A 1CZTA 1YQCA 2I74A 8RXNA 2BERA 2R072 3RYPA 4YG3A 3NMBA 5JWPA 2OZJA 2CYFA 4D6QA 3HPNA 1IROA 3J7Y1 2V4VA 1Y1VL 1W6MA 3ZYJB 3RZMA 1UZZA 3H3LA 2VO5A 4LBLA 1FV3A 1W0NA 1IG0A 2PHLA 5J37A 4JAFA 3GZTB 2XLFA 2QQOA 2ZX2A 5DZGA 3T2OA 1Q8OA 4HKOA 4XBNA 4C3JL 5ISLA 5IFPA 3AMNA 5FR3A 5DG2A 5E89A 1NZIA 1VPHA 2X09A 4GJYA 2W39A 4AXOA 1PVC3 5FP8A 1UMIA 3LEGA 2E7TA 4NUBA 1IG3A 2VAUA 5JXGA 5IVJA 4AFMA 3PO2L 1QCVA 3QH7A 5GJ6A 1I50L 4AEDA 1PIV2 2PYAA 1X9TA 3N7MA 1LODA 3WNKA 5FZBA 4UFIA 3T4HB 1OSGA 5EQUA 3OF1A 4DQAA 5CFCB 4W6YA 1QQP3 3WQ7A 3VD4A 4EN7B 4YYOA 4GWIA 1F8VA 3GGLA 4KG8A 4PLMA 1X8EA 2PVEA 2VUCA 1J58A 1YCIA 2GNTA 4LO6B 4LA3A 5FZGA 3S1ML 2D6LX 3ACHA 5GZDA 4IE7A 4DPNA 4AR4A 4P9JA 4DEQA 1FMD1 4J6GA 4CP9A 1W2OA 1IPKA 2VZVA 1G9DA 5B4NA 1POV0 1UU6A 3PVOA 1VBA1 4K8RB 4S2DA 2R30A 1RHI3 2ADDA 2YGMA 1AXYA 3FX3A 4NN0A 5M5WL 2CGPA 5JVVA 1ND3A 1CZSA 4QXBA 1QU0A 5FZ1A 1AXZA 2V72A 4F3JA 1AYN3 4MO3M 4GALA 2RM23 3LCPA 5H1Sc 1ULFA 2IFWA 1UU5A 1YQ6A 3A21A 2QBXA 4JHTA 4Q29A 5CFDC 3S1RL 4HVOA 2D6OX 1VALA 2XLGA 4OMDA 3POYA 2BWAA 1SMUA 1GMMA 1L7LA 4AG4A 1RUG1 4MXWB 3O14A 1CGPA 5FO8B 1JZ3A 2D3PA
chains in the Genus database with same CATH topology
3IU3I 1UL9A 1N1YA 3OBRA 1ZZ8A 4X6RB 3ZFEB 1I5ZA 3I54A 1KQRA 4M00A 2EALA 3KGLA 3SISA 4PDWB 2R0FA 4FXKB 1RUC2 2ZZQA 1VP6A 4D3WA 1FATA 1QNWA 1AR72 3OYWA 5H9SA 4RR3C 2Y0IA 1RGSA 1VZGA 4E6YA 5EZWA 4CP2A 4AGRA 1NA1B 3TWIA 2DCYA 5KWRA 1QJU3 4P9WA 1EV11 4MGZE 4QQ2A 1JUHA 1QDCA 4K20A 4R9BA 3RQ0A 1LKMA 4YGDA 4FTSA 1N1TA 4CDWA 4IESA 1PO22 4M3CA 4G6BA 4RQPC 2V09A 4NPRA 4JAEA 5JZGA 5BNPC 5ABJB 4YM3A 4CEWC 4Q4Y2 2ZAHA 2XJPA 1OLQA 4MVTA 2W08A 3VBRB 3RI9A 3WP4A 1DQ6A 4JTOA 4UBHA 3SH5A 3VBHB 2PQQA 5LRRA 3VBSC 2DUPA 5JPMB 3TN93 1IZ3A 1VLNA 2QZ3A 1JOJA 2VQAA 3BU7A 1UKRA 1SBEA 4FP2A 1V9U2 4OHYA 4I09A 4YM2A 4COUA 2UURA 2JECA 4RL7A 2GC0A 2XWBB 2VECA 1LENA 2EIGA 4XJZA 4PLOA 4Y1XA 3BCWA 4XE9A 4YG0A 1RVF3 1Q5OA 4F8AA 2KA3A 1R0IA 3J9SA 3SCHA 1RUI3 2JI2A 2LALA 5JOZA 4V196 3JD73 2WZR1 4K9FA 4L92A 4OZXA 1OPOA 3BIWE 1OQ1A 4I01A 1W6OA 4C1WA 2CWMA 1DQ0A 2JKBA 3MF9A 4HPKA 4YG6A 3AYCA 4EJRA 2C5DA 5AC92 1YWKA 4B7EA 4D7YA 3AX4A 5DG1A 1QH7A 4WVMA 5KXBA 1TME1 3H3ZA 5BNNA 2CNAA 1QJX3 1WLWA 4Y20B 1T9QA 1BE7A 1TNRA 4GB33 1AR61 2HKXA 3J8F3 3ZXDA 3BB6A 5DDJ3 4NHLA 2X8KA 5AN9H 1ZZBA 1HQNA 1CD3G 3O12A 2AREA 4MGYE 3SCFA 1HRI2 1MS1A 1NE6A 2OA2A 1UCXA 4ISQA 4PIXA 4EN8B 3MDPA 1UN1A 3OY8B 5CFCC 3B94A 5J98B 4YGEA 4FPCA 5I0RA 1NXMA 1T6GC 1D4M2 4FPHA 7RXNA 3UKNA 4AEJA 4ZKTB 4TLFA 1AR92 2GNDA 5EIOC 2BVVA 1LHUA 3GHMA 4YW3A 2HWC1 2DVAA 3AP9A 3LAGA 4FPJA 1H7VA 4WM8B 1KXGA 2VU9A 4QQLA 2MEV2 4A3XA 4AGGA 3WG3A 3T1MA 4FPKA 4EWDA 4BHPA 3B5LB 4R8HA 3WZ1A 3CJXA 2DTYA 2JG9B 2C6AA 2XJQA 2WJSA 2JICA 1UIJA 2D40A 1B09A 2WSVA 4LO4B 4E2GA 2WQ4A 1KFXL 1UPSA 1AYM2 2WS93 2RS13 3IDEA 2PSMC 1CAXA 4XOGA 3PVBB 3USUB 3M4FA 1E57A 1UIKA 2NMOA 1TMF1 4YZ5A 1WMDA 2HWB1 1H8TA 1OKQA 1J1LA 3AYAA 2JEMA 4AW7A 4GMP1 5GLZA 4X6QB 5D8AB 3LGRA 4E9KA 4IEXA 2DU0A 4BOWA 3WWLA 2ZGRA 3MEPA 5BNOB 1NLSA 3ZFEC 1BFYA 4YVWB 1XNKA 5T3NA 3AZZA 4G3YC 3VDDC 4M0NA 4PDWC 1Q8SA 3AKRA 5CAZA 5J7MA 3JBG2 2A6WA 1VZHA 3FLTA 2QCSB 4D7TA 3E6BA 2GC2A 2HWD2 1IQAA 1QWRA 4XIKA 4H7LA 1RUD1 4XXBB 2FQPA 2QKDA 2QDNA 3MIHA 2E7QA 3J7Z1 3DV8A 2IFRA 4O9EA 2RS52 1NA1C 3PMSA 3KM5A 2D6KA 5EFUA 1IPJA 1CVNA 4AHZA 2BUKA 2NPIA 3VKLA 1RUF3 4Q4W3 1YO8A 5E1RA 3W59A 1YK5A 2V3BB 5ABJC 1HKDA 3ZN4A 4QGMA 1UKGA 2E7AA 1ZBA1 3N7JA 5TSWA 3VBRC 1GKBA 4P9GA 4CDXB 4I0AA 3CJIC 1S0BA 2O8OA 1DQ1A 1PGW1 1C1LA 1ZBE1 3GBWA 4IEVA 2WZPP 4AVSA 5JPNB 4JRLA 1R1A1 4QMAA 1C3HA 5KC6A 2QNKA 1JH5A 2R1BA 4LBMA 1NCQA 1X33A 1F5JA 1HV1A 2P3JA 2R042 3T1LA 4Z8BA 1UX6A 3MLLA 1BEV2 2DVDA 3H8UA 1TEIA 3TNPB 3Q9OA 3KSCA 4Q26A 2CY6A 2O0OA 1SMVA 5BXXA 4S2GA 1TE1B 5FCCA 4JDOA 4GWNA 4LE3A 1ZZ6A 1VJ2A 1B71A 1PIV3 2A3WA 3E5XA 1QXPA 2BYVE 2GALA 4AE2A 3V65A 4WZFA 2VNGA 1SCSA 5KBFA 2VMHA 1RYTA 1DLLA 1O4ZA 5GZCA 2XKOA 4QPIB 4NHMA 1DGRN 4OUSA 4Z07A 5JSPA 4U671 2D5HA 3U10A 2OUHA 4HMZA 4IEWA 4R9DA 3FFQA 4KWKA 1GZ9A 3NSTA 3WG4A 1C8M1 1JBCA 1N3OA 2Q1ZB 1CAUB 1OQDA 3EQEA 5JCTA 1ZRFA 3GZUC 5K0UA 1B35A 1DF0A 3K35A 1FX5A 2CTVA 3W9AA 4DNYA 1REDA 5E8AA 3GBGA 3VZKA 4XMIA 4CP1A 1CAAA 3TYJA 1AX0A 1RITA 4M01A 3UKVA 5FTTC 4X8NA 3BPZA 3IDBB 1AL22 3UL2A 2JDZA 1NLRA 5J96B 5C8CA 4TVMA 4Q4V2 2FZ2A 4V1PA 3N7LA 1AX1A 4AI2A 2XBO1 2GC1A 4D7SA 1I1EA 4XF3A 3ZDSA 1SCRA 1OD5A 4WM8C 4R4ZA 4RGAA 3ZIXA 5IK8A 1RUC3 1SBFA 1VBE1 3AKTA 5LRSA 1FOD2 1UAIA 2XH6A 4B7KA 4QPGA 3PTYA 1PGSA 1NXEA 1C28A 5JI7A 5ACA1 1ZVFA 1PK6A 5AI2A 1OWBA 3DPRA 4YVSA 4IXLA 1YV1A 1OMIA 3KYXA 3ENRA 2GH8A 3RPQA 3VBFB 2KXLA 4QGLA 2PHWA 1AVBA 3RZZA 2RMU1 4CDUB 2JG8B 1RYQA 4CDWC 4D69A 3MIGA 3KGZA 1PO23 2DVBA 4KBBA 3ZSLA 2PPTA 3NFPI 2CAUA 1C09A 5D8AC 3RZTA 1VAVA 3DF0A 4Q4Y3 4RSUA 2K2SA 1IW7D 1SDWA 3POWA 4Y1VA 4XF1A 2P2KA 2PYTA 4CP0A 4AVTA 2R16A 4YVWC 2YXSA 5C9AA 4H14A 2ERSA 5KHJA 1WW5A 4Q0VA 3WUDA 3WW2A 1MQTA 3C3VA 3R6SA 3VV1A 3VLBB 3TN92 5JLVA 3RYGA 1D2QA 1Z0HA 3P3PA 4XFFA 1REFA 2DWRA 3NKTA 1GZCA 4K40A 1NY72 1T9PA 4WM7A 2ZGKA 3BODA 1FI2A 3AP7A 4ZN1B 3VHNA 4POFA 5IUQA 1GBGA 1R082 1PO12 4KNCA 2IXJA 1J59A 1YK4A 1XU1A 4FAGA 4FPYA 2Q0AA 2RR12 1S24A 2NYDA 3KD4A 5KXEA 1C8NA 4L8QA 4Q27A 5BYNA 5CVRA 1EY2A 2R062 3KT7A 4DXZA 4LLOA 1IS6A 1BJQA 1AYN1 4CDXC 3LA2A 1ZRCA 5AC93 4EV0A 2NMNA 2D97A 2LTNA 2PTMA 3TB0A 2E63A 1JUIA 1X8MA 3AXDA 3I4IA 1O3SA 2H0BA 2ZKLA 3SHRA 4RS5B 4Q0UA 1W2UA 4Z82A 1YFXA 2PN5A 3A0KA 1O7FA 1K5MA 1B2JA 1EAH1 1BVP1 4B29A 4AFBA 4A7KA 4LBOA 4OULA 5EJ3A 1S30A 3LSEA 3OJBA 1YFYA 2IXIA 3IWZA 4XF0A 5A32B 1D2SA 3WT3A 3D6EA 4B4RA 2D6PA 5CFDB 1HRI3 4DFSA 4K3UA 1MVQA 2OPKA 5KXCA 2GSYA 2VMIA 1QJY3 4RHV2 2HEVF 1N47A 4AI3A 3VKFC 4MGKE 1D4M3 1AR93 1LJ7A 3IBMA 4XPVA 3PVEA 3S7EA 3OD0A 4QPIC 3ES4A 4OI4A 2IZWA 4WV8A 2DYCA 1MS3A 2ZHLA 3ZXKA 1DFQA 4GULA 4QPYA 2MEV3 1CJDA 1S0IA 1KRIA 1O4TA 4HSJA 2EA7A 1N1VA 1I9RA 3CO2A 3ZSMA 3ALQA 2PVXA 4GS7D 4Y22B 5A33A 3B93A 4QQHA 4ZU7A 3ZSEA 1LOFC 4XILA 5T50A 4UY81 1DQ4A 3AKQA 2TBVA 1AYM3 2DFBA 2VOKA 4LA2A 1CN1A 3RS6A 4GH4B 2RS12 1CQ9A 4WZCA 1F9KA 4FPGA 4AEKA 1H8TC 1MS0A 2XJRA 2Q5TA 5GALA 1YUXA 1CAVB 1H2NA 2UWAA 3E6CC 3AYEA 1COV1 1H4GA 4JV4A 5FREA 5SV5A 2SLIA 4MLOA 1MS4A 4LUKA 1GV9A 4C0HA 2NM1A 2PLV3 2Y38A 3NKGA 4N53B 4NOTA 5BNPB 5HCFA 1HXS2 1LOCA 3ZO0B 1ZZCA 4BIOA 2LUWA 4L99A 2ZHMA 4Q8KA 1MQTB 2GU9A 2BNNA 3ZFGA 1GQHA 1D4VB 1CIWA 2AGSA 4NR1A 4ZU4A 5JSOA 1NXD1 1KJRA 1IS3A 3NV4A 4N90A 1BZWA 3ILNA 3NV1A 3MLJA 5FPZA 1ZREA 1LU1A 3KT1A 4AFCA 1RVF1 3VL9A 2DVFA 1LGNA 4CEYA 1RUI1 4ZU5A 5T5OA 3JD71 3IMNA 3RMXA 2RS53 3VBFC 1YXWA 2VUAA 5AFEA 4HLTA 1IKQA 2GC3A 1S2ZA 2B39A 2JG8C 3I8TA 4BCUA 4YARA 1CONA 3UJOA 3ZFFB 1ULEA 4LO7A 1S2KA 4MUVA 1RUE1 1GFF2 3PNAA 3MIFA 4FBFA 3VZOA 5L7OA 3U0ZA 3H9AA 4Q4W2 3VL8A 1QJX1 2ERFA 2JX9A 4CDQA 3JB4C 3NL1A 1QY4A 4GB31 3G7DA 3VBOB 2DVGA 3J8F1 1UPIA 1DG6A 5DDJ1 5GZFA 3V0AB 3SH3A 2PAEA 4MSVA 4HL0A 1WCDJ 4ME3A 4LO8A 4HN0A 4SBVA 2WNUB 1DYPA 3TRSB 1HV0A 3HIFA 4XFAA 5FPXA 3JU9A 4Y24A 3D0SA 4OHVA 3GF6A 2R043 1YUZA 1UD1A 2Q8OA 1GR3A 1WD4A 4Q4X1 4HKLA 3ZXFA 1BEV3 2LM3A 1HRV2 4Y1UA 1RB9A 4KH9A 2EAAA 5KXDA 1KJLA 2ZX1A 2ZPXA 1JXNA 2FHRA 1G9BA 1WBLA 3WQ1A 4XQWA 2IXKA 1CAWA 5FRAA 4XDQA 1H1IA 3S7IA 4XMAA 2WS91 1G9FA 2MPFA 2ZAAA 2EXJA 4LBQB 4W65A 5BUVA 3GALA 1O5UA 3J26N 2CR8A 4XXPA 3DL3A 2X5IB 4AHWA 1OHFA 3W58A 4E27A 4RS5C 4AQTA 3RZ6A 2XJVA 1LEMA 4OUMA 5KC5A 1VRH1 5K0UC 1B35C 4AWDA 1VCXA 2ZHNA 4Z2WA 1H2LA 3I2DA 2A3YA 2NZ9A 5T52A 1NNQA 2M6PA 4MH0E 2X53S 3WG1A 3B69A 4K6BA 2ZJCA 3D0JA 1AL23 1HQWA 5F5QA 1XRUA 3EJKA 2XVLA 4Q4V3 2VNOA 1Q43A 3CU7A 3WDWA 3QOPA 4GA9A 3WDXA 3WDTA 3MZHA 2PAKA 1RC6A 2OYZA 2MNGA 4LUMA 1Z7S2 2GN7A 1ND2A 4JGYB 4LHKA 4XQ4A 1G9AA 1YIPA 3VZNA 3THTA 3VDDB 4QPGC 1FOD3 1B2OA 3KYVA 5RXNA 2E51A 3B3QE 4KU7A 3TOJA 3X29B 4XFIA 4AK3A 3DPRC 5FLJA 4FAHA 3VUOA 2Z69A 3TNQA 2G9FA 4GH4C 2PHDA 4XXAA 4AHYA 4COVA 1IRNA 4CRQA 1V70A 2WFF1 2ARXA 4M0HA 1LCLA 1Q3EA 4XHXA 2BPA2 3ZN6B 1H30A 2A6XA 1W6NB 4IEPA 4RD7A 3VKMA 5L73A 2R071 4B4QA 4BMBA 5I8YA 4FOWA 2MHFA 4DY3A 4OFGA 1UMZA 1X82A 3KCYA 2P34A 4N53C 2EF6A 1UU4A 4XF9A 4CYDA 2P3IA 3SXWA 1CADA 4LULA 1IOAA 5FBZA 2A6HD 1MQTC 5FAXA 3N4MA 4I02A 1I3HA 4AEMA 3CJIB 2HWF1 2ZGTA 2Y26A 4BLJA 4AR5A 5E16A 1R0FA 4AFAA 1V6MA 3B7MA 3BALA 3IIAA 1DZTA 4GKXA 1PIV1 1X7NA 1WUVA 3LOIA 1ENSA 1W6MB 2AUYA 1W39A 2GMMA 3NV2A 4RFT0 3AXEA 1NCRA 4BIFA 3QLQA 4JCKA 3RWNA 1ASJ3 1WA4A 2PFWA 2WT1A 2VOWA 3B9IA 1R083 2YZ4A 4NWVA 1PO13 3ZFFC 1KDKA 4AQ2A 3M70A 1NQDA 1LHNA 3B00A 2RR13 1DQ5A 1AZDA 1Y43B 1NG0A 1CAWB 3NO8A 4AEDB 5H9QA 1A8MA 3C2UA 2R063 2K2DA 3ASIA 4XJWA 2H12A 1KS4A 4UBGA 5CG9A 2NYYA 3VBOC 3FUQA 2AZ5A 4MGIE 4MZUA 2QQPA 1OA4A 3OBTA 1LECA 1GANA 4KWLA 2XLAA 1H9WA 4YFZA 2ETEA 3L2YA 1RUH3 4TSVA 2WNUC 4SLIA 3RMYA 1ULCA 2TEPA 1KD7A 3FWEA 3GZAA 2B5HA 4FOQA 2Z2SB 1ND3B 4I0BA 4YW1A 1ZRPA 2Y0OA 1ZM1A 3HR9A 5DUXA 1Q8VA 4IV1A 2H0VA 4LNVA 5H9RA 3VHPA 1RUC1 2O5JD 1RJ8A 3N36A 4AI1A 4LR4A 3RYRA 2ZTNA 4EN9B 3AKSA 3HMYA 4RHV3 1AR71 1MZEA 4GQ7A 2C1FA 3IPVA 1QJY2 2HWE1 2SBAA 2VGDA 5EYYA 2A6VA 4IV3A 1DX8A 2DF7A 1GYKA 4HETA 1O3TA 1R0GA 4YZ1A 2X5IC 3N3HA 4NHKA 3VZLA 1MS5A 4E4SA 1ZA4A 3M3CA 4ATFA 1PO21 3QQCE 4HZFA 2F6BA 1AR82 4AR3A 1REEA 4LO5B 3S30A 2VOXA 1S0FA 3NAPA 1PGW2 3OYWB 1Q8PA 3CLPA 2Z3QB 3R4DB 4Q4Y1 3ZYPA 1DGWA 1XE8A 3MPBA 2MS3A 2R49A 4N9HA 5FO7B 1S0DA 1WMEA 2XJSA 5DUUA 3LNLA 1NXGA 2A69D 3VBUA 3PHMA 2DUOA 3TAYA 1MEC2 2DURA 1G8WA 3KYWA 4QM9A 3AK0A 1VB2A 3LA7A 2A7AA 1NOVA 4CDWB 1JYIA 3OCPA 1FNYA 4K1YA 4M3CB 3POSA 4L97A 1V9U1 1XE7A 5JZGB 1DGRA 1IHMA 1HXS3 2PLV2 1Z92B 2AH2A 1BBT1 4YLZA 3FE5A 4JGYC 5F6LB 2I2SA 2A3XA 4QX5A 3AJZA 2GAUA 1PVXA 3AZVA 5T55A 1R092 1LKNA 3M3OA 4R4XA 3GYDA 4CEYC 2VL6A 4XFHA 2B9UA 5AVAA 3ACLA 4MX3A 2I07B 3G6JB 1LKOA 2WNVA 2WL1A 4FQ4A 3WDUA 4N43A 4HFSA 5C4WA 3WW4A 2C6BA 2DCJA 2RS31 5BV6A 5AC91 1QOSA 3M1HA 1E8JA 1BRFA 1WCKA 2FZ1A 4TYSA 3WOGA 5L7OC 4N9IA 3MI8A 3MLKA 4LTAA 1RMU1 2M4YA 1UZYA 2BEOA 1CPNA 2UYAA 1ALYA 1FPN1 3H7JA 1AL0G 1W6OB 2IXCA 3FHIB 5CNAA 1VBB2 1RJ7A 4HPKB 1RB8G 5F9TA 1HRI1 4JGZA 5KHKA 4Z92B 1MS8A 1ZZ7A 3O0WA 1VBE2 3V0BA 4N7UA 4WVMB 3GHNA 3ILFA 5BNNB 4OHZA 2TNFA 4WBBA 2VW0A 1SQ4A 1AR91 5GLVA 1HRV3 2TUNA 3OTFA 2EXKA 1AJKA 4E4DX 4PLNA 4LHNA 1W0OA 3WDYA 2MEV1 4KGGA 2V73A 2YMZA 3IDCB 3MW4A 1PMIA 1VBD2 4QM8A 3WLUA 3OPZA 1HW5A 2GNMA 4RA0A 3ETQA 3JUUA 3EXUA 4AEDC 5FDBA 1RL3A 1OOPA 1S1AA 2DTWA 2XB6C 1AYM1 2ZGUA 3NV3A 4XEZA 1LR5A 2YROA 2IC1A 1PGL1 1ULGA 2AYJA 2YPJA 3HT1A 4RXNA 1VBC2 3D5OA 1VAKA 3FBYA 1EPZA 4C90A 2BW8A 2BNOA 3P2AA 1ND3C 1V6NA 4QT6A 2YUEA 2V0EA 2HR5A 3HBZA 3KQRA 4PIZA 4DB5A 5LK7B 1CAXB 5MF6A 2IWGB 2AENA 4Q1PA 1TQ5A 2A68D 1BXHA 3JBG1 2M6OA 3AJYA 1QOTA 1H8TB 1MACA 2ZGLA 2E53A 1QHDA 4QU2A 1R1ZA 2HWD1 3CNAA 1CR7A 1JTZX 4OHWA 4AGVA 2ZZJA 3AFKA 3MYXA 5FMOS 3QBQA 1OWCA 2BE5D 1G7YA 2Q30A 2RS51 2QJVA 5FOJB 1LGBA 2HJIA 1Z7S3 4XYXA 4K7JA 5AI3A 2HEWF 1NYWA 1ENXA 1S0CA 2VG9A 1Y3TA 3NJZA 1ZRRA 2A6ZA 2WFPA 4CZSA 1BMV2 1H1AA 2A70A 5GZEA 1NQJA 3MIEA 3ZXAC 4B4PA 1POV1 2D5FA 4KWJA 5GAGc 1GZWA 1EAH2 4HVRA 3D4KA 3KMHA 4NO4A 3WD5A 3EHKA 1W0PA 4COYA 1LOGA 4H55A 3MPPG 3PMEA 5JZGC 5K7PA 1RUJ2 5DXDA 1UW8A 2XG3A 5I93A 2R0HA 1SLBA 2P3KA 1WW6A 4JDMA 2ET1A 4QD2A 5GAEc 5IK7A 3OGGA 1FAYA 4OVEA 4FO9A 4RR3A 2CKCA 1ZZ9A 1PVC1 3PKJA 1DGWX 2KKDA 3O5SA 1W6QA 5LEKA 3RDIA 5FQ0A 2D43A 2EXIA 1PZ7A 2D7FA 1QH6A 1NCQB 4H7MA 1QQP1 5L19A 3LOBA 1XQNA 3CEWA 2E6VA 4RQPA 5LK5A 3DUIA 1A78A 1DQ2A 4HANA 3AZYA 4CEWA 1SLTA 1ASJ2 4I3GA 4S2HA 1W6PA 2XGXA 3E5QA 4FQZA 2C0ZA 2QDRA 1TNFA 2R32A 5J36A 3VBSA 1RHI1 3EO6A 1SFNA 3UV9A 2J9UB 1YLLA 2NN8A 4ZN3B 2RM21 2PHTA 5GZGA 3LWCA 4BE3A 3AFGA 4GWMA 5DM61 2NQYA 3WR0A 1IU6A 1Y9QA 1SBDA 1RUH2 4TWTA 1SLCA 4Q4V1 5BNNC 5EYXA 2C9AA 1ZNPA 3LZZA 4IV1C 4XBLA 2FMDA 5K2ME 3FFZA 5K0UB 1B35B 4Q0PA 2H6BA 4S2FA 2YV8A 3HAGA 4YW2A 3KCCA 1B13A 4OI2A 4EWAA 1O3QA 3WVJA 4IQPA 1LHOA 2ILMA 4X8PA 4HKWA 2P17A 1YI9A 5EXOA 4JQRA 1OPMA 2G4IA 5C8CB 3ST7A 4COWA 2QZ2A 5B2GB 1RUE2 3AP4A 5KHGA 2W68A 1SFYA 1PNGA 3HN1A 3LSDA 3N35A 4JTNA 4Q1RA 5CU1A 4W6WA 2WT2A 1IS5A 1YHFA 1R0JA 2HEYF 1QJU1 4K21A 3QVDA 1AR83 4Q2FA 4QPGB 3RJ2X 4YM1A 1ZBE3 1U0AA 5GLTA 1N3PA 1PK6B 4JAAA 3DPRB 4YVSB 1YFWA 3V64A 1DU3D 4EN0A 2ZGQA 1MEC3 4B8CD 5CFCA 4EN6B 1WGPA 2QVSB 2UU8A 3WNXA 5J48A 4PJYA 1HQLA 3UKTA 4G4FA 4YZ2A 1HIXA 4R9AA 2DFCA 3TN91 5KHIA 3VGIA 4NWWA 3ZN5A 4TZDA 3O0VA 3EBRA 4UW4A 4LT5A 5J09A 3IN9A 2KM2A 1NY71 4FVVA 2ZGMA 5GADc 4BZ4A 1BQPA 5T54A 5C9AB 1S55A 4DMIA 3RYKA 4L9BA 2ARBA 1R081 1PO11 1SMMA 3ZG6A 2D3RA 2BWCA 2WNEA 2ZBJA 4KL1A 5JAXA 1QF3A 2A5ZA 2YDEA 1R093 1Q8QA 1IU5A 2JD4A 1FMD2 4FPOB 1S0GA 3LB9A 3M3IA 4G9SB 4MXWA 5F1RA 5T5JA 4WM7B 1XNCA 3PLQA 1C8M3 5CADA