4AI1A

Flo5a showing a heptanuclear gadolinium cluster on its surface after 19 min of soaking
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
258
structure length
258
Chain Sequence
GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complex Gadolinium-Oxo Clusters Formed Along Concave Protein Surfaces.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell adhesion
molecule keywords FLOCCULATION PROTEIN FLO5
total genus 56
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4ai1A02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ai1A01
2XJVA 2XJRA 4AHZA 4A3XA 4CP0A 4AFCA 2XJQA 4COUA 4AI2A 4D3WA 4AHWA 4CP1A 4AFAA 2XJSA 4COYA 4ASLA 4AI3A 5A3LA 4LHKA 4COVA 4LHLA 4AFBA 4COZA 4GQ7A 4COWA 4AF9A 4AI1A 4LHNA 2XJPA 2XJUA 4AHXA 4AI0A 5A3MA 2XJTA 4CP2A 4AHYA
chains in the Genus database with same CATH superfamily
4NWVA 3D82A 1VBE2 1G9DA 1O3RA 3C7OA 1QXPA 1AZDA 1XNAA 3AFKA 4BIFA 1S0JA 5F2SA 4BK5A 1QQTA 5FMOS 4R4ZA 4EE2A 1V6MA 3CMGA 4GXLA 2XONA 1JOBA 3LDRA 3MDPA 2VXJA 1S0DA 4D3WA 1MZEA 1NQJA 2ZZQA 4MXVA 1SBEA 2Q8OA 3MIFA 3H3LA 3NNGA 1ZBE2 1YCIA 2DVAA 2O14A 1AYM3 2DFBA 5F39A 2RMU1 3MPBA 1ND2B 3OG2A 1XOYA 1CAAA 3ENRA 4HSLA 1JU4A 1QXRA 5FRAA 2QQNA 1EPWA 1YFYA 4LR4A 3MICA 2MHFA 1UXXX 4AQ6A 4B1MA 4E2SA 5CADA 5FY4A 3AX4A 3IDBB 4FVVA 5DAQA 3I2DA 4D6QA 4JZRA 5JVH1 1QNYA 4GD4A 4QD2A 4Y5TA 1FI2A 3POJA 4AQSA 1H2KA 2D7FA 3WD5A 5A3PA 1YQ2A 3GBWA 2J1VA 5HCAA 3MLJA 1AR72 2IXJA 2UWAA 4CEYC 5CKNA 3NV2A 5AVPA 2UURA 1LOFC 1YJLA 2IFRA 4N7IA 3O14A 6RXNA 2OA2A 3TRSB 2NVQL 2GMGA 4HL0A 4Y5Z0 4XQWA 4YW5A 2W39A 1HB3A 1YYNA 2DFCA 2QBXA 4HOOA 3IIAA 1KDKA 1RUD1 4Q5OA 5IATA 1R0JA 2WFF2 3VBRA 2JDYA 1J3RA 1BFYA 1F4AA 2UYBA 2ZTNA 1OLQA 4GWNA 1UOGA 2DVBA 4IETA 4A3IL 4A3JL 4KGQA 1ZRCA 3T0AA 3KGZA 5JSRA 1IKPA 1O6UA 3GHMA 3GBGA 2Z3RB 1HW5A 3NJXA 4KBZA 3LAGA 4Q0PA 4Q4V1 1AR82 1CVNA 3I8TA 3M7AA 5A33A 1A6CA 3MF9A 4Y20A 4WM8A 1K5JA 4D69A 4J25A 1MS8A 3RYGA 2Y6GA 1FXZA 3ES4A 5F3CA 3S1ML 4QB1A 4PBPA 4ET7A 4YG6A 2Y0IA 4NPMA 3J7LA 3T09A 3WG3A 4B4RA 2PLV2 1S2EA 3TEWA 2ARAA 1AHSA 4Q8LA 4V2VA 3BU7A 4R9DA 4LKDA 4EZ4A 1UIKA 3DKQA 3J8F3 1KJRA 3VHOA 1YEWA 3DPRA 3IMNA 3VZOA 2BNOA 5I0SA 5K0UC 5IWFA 4LTAA 4CSWA 1W8NA 3WF4A 4RQPB 1IQDC 2Z2SB 3PVNA 2YBSA 3HOYL 2PLV1 5FZHA 5A7SA 2FMYA 2QJVA 2HWE2 3AJYA 4KWLA 3PURA 5KXEA 3TB0A 1QHDA 1ULPA 3UYJA 2DCJA 1R1ZA 4BCUA 1PMJX 4NO4A 4QXHA 4NPLA 4XPVA 2Q4SA 3THPA 1WCQA 3T2OA 4IV1B 4O61A 4TTGA 4ATEA 2XLGA 5K9YA 2P2KA 5JR2A 4MGIE 4JAAA 2WKKA 5DDJ3 1AYM2 3C7FA 3ZDSA 4FTBA 5JZGA 1X7NA 4NMIA 4XFHA 3USUB 4BE3A 1UD1A 1V0AA 2WINB 4MHRA 5FP8A 5L9BA 1UIJA 2CHHA 2EVXA 4CVUA 2AUSB 4YM3A 5L7OB 1ASJ1 3VBOC 2J1RA 1BMV2 1QYBA 1I5ZA 1F2NA 4LORA 2P1BA 1RB8G 1GZWB 1OOPA 2PHWA 2BOIA 5F5AA 5FXWA 1DQ5A 1EPZA 5IP7L 5GAEc 4HN0A 1W8ZA 1GNZA 4DUVA 1ZYBA 5A32B 4Y1UA 1SLIA 1FHMA 1RL3A 2Q8DA 4BLIA 1UWWA 3B00A 1RUE1 1Y1VL 2GP3A 5FP7A 1Q43A 2RJKA 4G4FA 5C70A 3B69A 1GOFA 2JENA 3JQXA 4XUTA 2A69D 1YFUA 1JZ6A 5GKAC 3L9JT 4NPRA 1AVBA 3ZFEA 5F3GA 2J22A 2WYSA 1G8WA 2R16A 3A0NA 2KN9A 2EA7A 2M4YA 1AR91 5L7OC 1OA4A 4IEQA 4EWEA 2ZGRA 1HQLA 1U12A 2P6HA 5L7OA 1NA1A 4NHMA 5H9RA 3SXWA 2EIEA 3MF6A 4YW3A 4A41A 1CAVA 3IU3I 2XMLA 1O3QA 5DUXA 2VZ3A 2IXIA 3WNXA 1R0IA 5FY0A 2A3XA 3WR0A 1HQNA 3KCXA 2W92A 2ZGUA 2XOMA 4XW3A 4JHZA 5EWSA 1YJKA 3PNAA 5FPVA 2O8OA 3H1MA 5FJ8L 3ETPA 1QQP1 3GYDA 3POGA 4JDNA 3LCPA 3O0WA 3PUHA 1S0FA 3LWPB 1NA1C 1QEXA 1UY4A 3AZXA 4XHBA 5CFDA 5A32A 5J96B 1S24A 3K4AA 4WM7B 2OQ6A 3ZFFC 2RJLA 3U37A 1ULEA 2WJSA 3AMNA 5EIOC 3DYOA 3M3QA 4QAWA 1W6OB 1N1YA 2VOXA 2WS93 5M0TA 5ACA1 3QOPA 1UMHA 4RXNA 2DUOA 2VCCA 2Y6JA 4UT5A 3ZFEB 3TEYA 2DYCA 2OUHA 5JIUA 2PLV3 2JJ6A 1S0CA 2HKXA 2WC2A 3WW2A 4AGGA 2KM2A 1SDWA 4MXWB 4BM8A 1IS5A 5AI3A 2B45X 1V6OA 2JDZA 3TN92 3NQHA 2R0FA 2ADDA 2VO5A 2BVBA 5FXVA 3H0OA 3S15L 4QQLA 2PHUA 4Y26A 3NKTA 2HEWF 5MLC3 4A3ML 3CZUA 1F5FA 1QQP3 1CIYA 2B5ID 3JBG3 3FHAA 3FHQA 2XPJA 3HN1A 4M3CA 4PIZA 3KYVA 3OYWA 2YFZA 3AYDA 3RI9A 4AXOA 4C0BA 3I2JA 4Z92B 1P7PA 1N3OA 3PKJA 2VMGA 3OB8A 2V09A 1UKGA 3ZSJA 3W58A 2ZKNA 3HJRA 3VZJA 1CZTA 2R6QA 2WZR3 4KMQA 3G7DA 5M3FL 1VP6A 4GIQA 1A3KA 5T50A 2YZ4A 2WB1P 1IKQA 4QPGB 5A7WA 1BYHA 4CU8A 2P4EA 1NY72 3ON7A 4XACA 5C4WB 2VCAA 1LB2A 5IVEA 5FMCA 4AE2A 2W94A 5FO8B 2GN3A 1HRV3 2WO3A 3T3YA 2A6XA 1TWGL 2D6KA 3V65A 2ZAHA 5JSOA 2YHJA 4QT6A 3WCRA 2ZEZA 4CP1A 5FYCA 5FDBA 1OUSA 4S2DA 1H4GA 1KRIA 3I3DA 3JBG1 1JI6A 3FWEA 2W08A 3LGRA 4P9LA 1DGWX 2CTVA 3OGRA 3ZFGA 1O4TA 5LK5A 5FYSA 2BFUS 3ZFFB 2RDQA 1WLTA 3WNMA 2NP0A 1V70A 2JEMA 1HLCA 1HRV2 5EV7A 2DVGA 4RFRB 2ZABA 1C57A 1MS1A 5AC91 3R6SA 2JE9A 1W3VA 2WAAA 3O1OA 1N1VA 1MS5A 1J83A 2WFF1 4QPGA 1DF0A 1ODNA 1RINA 2CL2A 2R063 2HJIA 4JGYB 1F31A 1DP0A 3QLQA 4L97A 3AC0A 3LWQB 5IVYA 4AI9A 1HRV1 4JVAA 1XNCA 1TMF2 2TBVA 5FZMA 3H3VM 1APNA 3GF6A 1G7YA 2G19A 4YM1A 2XQRA 3ZMNA 3WW4A 1BVP1 4DXRA 2RMU2 3GHNA 2KKDA 1X33A 3U10A 5F6KA 2BERA 4ISRA 3DPRC 2CDPA 4XF1A 3CLPA 4DIQA 4HT1T 2EF6A 1RUOA 4IEWA 1UAIA 4HLTA 1PVC3 1RUJ2 2XJPA 3TN93 2VGDA 4AHXA 3THDA 3NRUA 4M0HA 4ONUA 1ZRDA 4A4AA 2R0HA 5J98B 1OBNA 3GBFA 4EV0A 4QX3A 1ENSA 3ZYIB 1MQTB 1ND3C 1QJY2 1W06A 3MFCA 3A7QA 3K2OA 4FOVA 4KNCA 4YGCA 4TXWA 5BNNA 1RDGA 1VZHA 5DN2A 3H8OA 2BVVA 1TME2 2YU2A 1TEIA 4QDQA 5HCFA 2QDRA 4AQ2A 2ZX1A 3OD0A 5IHRA 4XTPA 1QOSA 3BOPA 4IGPA 2XL7A 3OF1A 1I9RA 1UL9A 4XE9A 3FC0A 3P2AA 2WWSA 4XXBB 4X6QB 3JBG2 4WZCA 4BOWA 1GNYA 2VOVA 3AZWA 1Y4WA 1I50L 2BOJA 2JE8A 1T9OA 1OKOA 1W6QA 1H8TA 1IPSA 1C8NA 3K3OA 3LEGA 5BNOB 2PAEA 1T6GC 3Q9OA 3WWNB 1QDOA 5FPLA 3VBHC 2QQPA 4KU7A 3ACHA 5FJHA 3KS7A 2PTMA 2Y0OA 3I59A 3AVRA 2RS33 3B94A 4BQ1A 5IFPA 1NQDA 1UZYA 3OY8B 2RS53 2JI1A 1FV3A 2EXIA 2OT7A 1QJZA 1C1LA 2VUCA 3UKTA 3LB9A 3POEA 1I6XA 1O91A 4FO9A 4P5YA 4Z82A 1ODMA 2HWD3 1UF2C 4OHVA 5JVVA 2XKPA 4UI9L 1JZ8A 5I0TA 3T08A 4Q4V3 3B08B 4AW7A 5JIAA 1EUUA 1RUG1 1YV1A 1H9PA 1I3HA 1KITA 1OHFA 4IUGA 1L7QA 2AENA 4LXLA 1RUF2 1VALA 5CKQA 1PMIA 3HQUA 3WWLA 4GMP0 4DUXA 5FOJB 2B4KA 1WA6X 2FCTA 2P3IA 1TMF3 4CDWB 3FFQA 2CWSA 4M3CB 3JB4C 1ZBA1 2HWB3 1RUD3 5LEKA 3W21A 4YFZA 4RQPC 1HRI1 4PF5A 5FY7A 5LBFA 3SKVA 5CA6A 1CN1A 3EXUA 1D4VB 5RXNA 1RMU3 4GWJA 1EY2A 4UXAA 3N36A 4DINB 2OS2A 5BYNA 2Y6KA 2KD7A 3GTLL 1UOBA 4JKKA 1AR93 3B9IA 1FNZA 5D1IA 1QJX3 2JG8A 4OQ8A 2VVEA 3MQKB 3NL1A 5AFEA 3VD9A 2HBUA 2JDPA 1RUC3 2W3JA 3HT1A 4P08A 1R0HA 4CDUA 2HWB2 3PO2L 3ALQA 1CESA 4FP3A 5FKCA 2XBO1 3ZXAC 2VMDA 1EUTA 3C7EA 4ME3A 1T6BX 3JCIA 2F17A 3N35A 5ABJA 1PK6C 4META 5LWBA 4HVQA 4JRAA 3B0AB 2AH2A 1OA2A 4ATFA 1YQ8A 3B7MA 4B3NA 2JA8L 3HN3A 1IOAA 3HQXA 1QU0A 1US3A 4I0BA 2ZCWA 3WDTA 3WXPA 4CCJA 5MF6A 4YVSB 4GMP3 1FOD3 4QB2A 3M2MA 1W2UA 5GZFA 2AEYA 1POV1 1RIRA 4WZFA 1QJEA 1RMU1 5FIXA 5EJZB 1ZX5A 1SLLA 3LEMA 4E4SA 1JYVA 2IXCA 1NE6A 2HBTA 5DZGA 5FZOB 4DXTA 5A7PA 1QNWA 3WNNA 3MI8A 4MUVA 2JG8B 4P9XA 1RUH1 2A70A 3WW1A 5I93A 2CYFA 3M70A 2DU0A 5A3WA 4TLFA 4JAGA 4Y22A 1CX4A 3AL6A 3MW4A 4AVBA 5C3PA 1YI9A 4OVEA 3R4SA 2NPIA 4RS5A 2YU1A 2G1MA 3IDAA 3PU8A 2WNUC 4MGQA 5A6XA 3HT2A 1GQGA 5FBZA 1NXMA 3ZFGC 3VZLA 3ZYJB 2GNMA 4QX2A 3VDAA 4HKOA 5JVG1 5IYCL 1UYYA 3A44A 4YVSA 3RZTA 3OGSA 5AVAA 1QJX2 4PDWB 4DPNA 1O4ZA 4CEYA 1HX6A 5L36A 1RUF3 1XPWA 4AZZA 3J7HA 4YZ1A 5CIRA 1AYN3 4LIUA 5DG1A 1I6HL 2XDVA 3WSOA 5GM0A 1SFPA 1PZ9A 2F4LA 4KL1A 5E8AA 4E2GA 4A3FL 5FMDA 3VBHB 1GZ9A 1LESA 2RR13 1S2BA 3MO4A 1NT0A 1E5SA 2GU9A 3MYXA 2QFEA 4AVCA 4MVTA 3K3NA 4NHYA 4CDUC 1Q8VA 1RUD2 5FZ0A 4XCAA 1S1AA 4ITCA 2C0ZA 4OLLA 3O0XA 1QJU1 4KBBA 2C1FA 5FP3A 2JA7L 1LKPA 4Q4X3 1KFUL 4QKDA 2FBEA 3S2DL 5FYZA 4QKNA 3WDYA 1AF9A 2RR12 1R1A2 3OUHA 1XNBA 3LNLA 4A3KL 3KYYA 1REEA 4PI2A 4LBNA 4XJ9A 3SH3A 2HWF1 1LTLA 2A6YA 3PTRB 3WX5A 4XBNA 4U671 1W6QB 5FY5A 1QH6A 3OD4A 4FPCA 1WUVA 2XJUA 2RDNA 4OI2A 4TYSA 5K0UA 3ZDVA 1C4RA 1NLQA 1DGLA 1OXCA 1RYTA 5IK7A 1RMU2 5GLWA 5HV0A 5LEJA 2VULA 4QPYA 5IJRA 3RVHA 3ZSLA 2FDHA 2DBIA 1GYKA 1JYTA 3TNPB 2QZ2A 3BCWA 3P5BA 4O65A 1VRH3 5FYUA 4XDPA 2VR4A 4WVWA 1EP0A 4EN9B 2XJSA 3ZXLA 4Q4W2 5A3LA 1NXGA 3BB6A 4Y7NL 5C8CA 2VZVA 3O12A 4IE5A 1WA4A 4N43C 1N3PA 4C91A 1NAEA 1RHI2 3LFMA 3WQ7A 3MLKA 4CPBD 1LECA 1FPN1 1QIQA 3UESA 3T2PA 3TWIA 1OF3A 2YMZA 4MSVA 5CG9A 1MR5A 3H50A 4Q4Y2 2AYJA 1BXHA 1LKMA 2A5ZA 2BGOA 2VQUA 4K6BA 1LHWA 1UX7A 4PI0A 5GLUA 1V6IA 1PMHX 3WP3A 3QH6A 1OPOA 2NLRA 1X8EA 3I4ML 4IEZA 4HPKA 1LOFA 2R041 5F6LB 4PBOA 4CCKA 3LDKA 2ARCA 3N9QA 2X8KA 1O59A 2PHLA 2VPVA 3N7MA 3MV11 4Q4X2 2VNOA 5DPNA 4DO0A 4MGKE 4XGHA 4UW3A 2OPKA 1GWLA 5KC5A 2ILMA 3IB3A 1ULOA 4QHZA 4E9KA 1JYWA 1FX5A 4DEVA 2FDKA 3IPVA 1R093 3JD72 2Q1FA 5BV6A 3AL5A 3GZUC 1CJDA 2IUWA 2O0OA 3FX3A 4RD7A 2WABA 4WM8B 2DV9A 4AYUA 4EZHA 1DX8A 5LATA 3WUDA 3BPSA 2JKXA 3SH5A 4N7UA 5EIYB 1SFYA 5T5LA 2AR6A 1C8M3 3WQ0A 1XC6A 3FE5A 2GMPA 3UL2A 5DM61 1TWCL 2FZ1A 4IEXA 2JG9B 1SLTA 4QHBA 1J3PA 1RUE3 3AP4A 3K48A 3AKQA 4K8FA 4Q4W3 3K4ZA 5FV3A 2AEZA 3WG4A 3G6JB 4RR3C 3KMHA 2D6LX 5A1FA 5GLTA 2HYXA 2YBPA 2DF7A 4RQPA 5A3NA 2J9UB 4Y24A 3DKWA 3WDVA 4YWLA 1ZA7A 1ACCA 2E2HL 2ZX3A 5DQ0A 1NXEA 2JX9A 4GB31 1D7PM 2ZEXA 1GR3A 5M3ML 3BODA 4FPOB 4NR1A 5A3MA 3KV6A 5GAHc 3CO2A 2DUQA 2ENRA 3E1F1 2GSYA 5C4JL 4E4HA 4XTMA 4RS5B 2V4VA 1F15A 4OI1A 1R0GA 1XRUA 2JDMA 1C1FA 4LBLA 5ABJC 1JXNA 4IE7A 4R9AA 2EXJA 1NCQC 3SEEA 4EJRA 3VL8A 3MUZ1 2ORZA 4LOSA 2A71A 2D43A 3RYKA 1S0IA 1GZWA 2JDUA 2VQAA 5LA0A 3WLUA 1PHMA 3C7GA 4QQ2A 2WS91 1VCXA 4OMCA 4DMIA 3RI8A 5J1XA 5GAGc 4JTNA 4MV2A 4Y1XA 5LBBA 1G86A 4P14A 1JZ5A 1PFWA 2PVXA 2OXBA 1LU1A 3CU7A 1OLMA 3KHBA 3PLQA 2VNVA 2BQPA 1RDVA 2BP6A 3GCXA 1YIPA 4SLIA 3WW3A 2RS12 1D0HA 4CDXA 2GH8A 1MACA 3NVCA 1VBD3 3O1TA 4ES9A 4GAZA 2QQJA 3GJAA 5CAZA 3AZVA 3B9CA 4JGZC 2X05A 1NX9A 2YC4A 5DUWA 2RS32 1LHVA 1WKYA 4A6SA 1H2LA 5JPNB 3H1YA 2AC1A 2H6CA 5FJKA 1U0AA 4Q0UA 5FK7A 4D6RA 3HOWL 2LUWA 2R072 4YW4A 3RZMA 4BBRL 3POWA 4IGOA 4YG3A 2Z42A 4URTA 3LPEB 1HKDA 4YVSC 2VG9A 1QWRA 3SCFA 4TVMA 1IPKA 2E7QA 5DAXA 5F3IA 5FLIA 5FLML 1CAWB 1Q8PA 2M6PA 2AGSA 2D5HA 3M3IA 1SHWB 3Q8BA 2VTFA 4QDRA 5FLHA 4DFSA 3ASIA 5J48A 1QXJA 1J1LA 1OKQA 1VMHA 1NCRB 4O9EA 4WM8C 5BNNB 1DU3D 1AL0G 2E26A 1VBD1 5F5CA 4M4PA 1K5MC 4CXYA 4XJAA 3O1MA 3S16L 4LHKA 1COV3 4PQ9A 1PFVA 3LEIA 3K75B 4R9BA 4BWOA 5BNQA 3IZOA 1RVF1 5F1RA 4XC9A 2WT1A 1HQWA 1SLAA 4EQVA 1BQ8A 1AX1A 1ZVFA 4FPJA 2ERJA 5BXXA 3FUQA 2WT2A 4ZU7A 2XBO3 5JSPA 1AR92 2WS92 3QBQA 4PIXA 1X82A 4MX3A 4C3IL 1OI6A 2RR11 5FZCA 2VMCA 4JV4A 4AHZA 1VBC3 1RUG2 1ND3A 3KQ4B 2ZGPA 2VQ0A 4GULA 1YK4A 4C0HA 3ACLA 1GP5A 4CCEA 4Z8BA 2LS6A 2YPDA 5FMOL 4U36A 3SKJE 1PM7A 1F4LA 3B93A 5FPUA 4NE9A 5CVRA 2ZEWA 2N7GA 4JTOA 5DMYA 2B7YA 5BNNC 1S30A 1AR63 3KV4A 1LENA 3ACIA 4I3PA 5A7WB 1ZZBA 3VHNA 3WT3A 5JLVA 4LHNA 1E57A 1LODA 2CY6A 2VM9A 5FZBA 1KDMA 3HQRA 1D4M3 1PO13 1CWPA 2PVEA 1IS4A 5LASA 1W9TA 3MIEA 2DWRA 5FYIA 5F8PA 3UV9A 5JZGC 1DDLA 4LBJA 4QKFA 2P3JA 1BZWA 5FLJA 5A80A 1EAH3 2VZQA 2XGXA 2PHTA 2AUYA 2NZ9A 5JI7A 4COUA 4F7ZA 1PFUA 1CZSA 2VBPA 4AR3A 2PSMC 4GMP1 1V9U3 5C7GA 3BU0A 4G6BA 4YZ4A 1LAJA 2RMU3 4OI4A 4AI8A 5HPOA 2J1UA 2ID4A 1XNKA 2DDUA 3TNQA 3LQCA 3CJIB 5KHKA 4AR2A 4AG4A 2J1EA 2RDSA 3AKPA 4XHXA 4Z2WA 1RUJ3 1CX1A 1W2NA 1GV9A 4NHLA 4M01A 1ASJ3 2PN5A 4XUPA 5C6CA 5T5OA 5IVBA 3H1WA 3RPQA 1RVF2 2XB6C 1Y43B 3BTAA 1NE4A 2A6VA 5A7NA 1G9CA 4YVWB 3OBRA 5K4LA 4CDUB 2JB4A 1BHGA 3ROUA 3CF6E 4LEJA 3SCGA 4BQXA 1SACA 4QHOA 5CFCA 3O1VA 1CGPA 5FZ6A 1AXKA 4GKXA 3GZEA 8RXNA 1E5IA 2V3BB 4F3JA 1PZ8A 4UFMA 4XUOA 4BZ4A 4AL9A 1UZVA 4XJ8A 4IQPA 2XVGA 5LA9A 3RZOL 4KWUA 4I09A 3M1HA 4HK9A 4XEZA 4I2OA 1NCQB 4COZA 2FDGA 1JH5A 1A78A 1GP6A 2D93A 4QQOA 5I8TA 3SHRA 4Q4Y1 5B2GB 4QM9A 1XNDA 5EJ1B 4NUBA 2Z69A 1DG6A 4QGMA 1KQRA 1UPIA 4AHYA 1BCXA 3AFGA 4QPIC 3E5QA 1RUG3 3VZKA 1ZRPA 4E4ZA 4YLZA 2E9QA 1RHI1 4JGYC 3RZ6A 4QX0A 2VUAA 4PT6A 5IFTA 2W91A 3NW4A 1X9TA 2UY8A 2OYZA 1A8DA 4AVAA 4ZU5A 2K2SA 1BEV3 3N9MA 4K7JA 3USUA 4CDQB 4DZGA 4UF0A 4OYUA 4XJWA 1YUXA 3VV1A 1IGOA 3EMRA 2A75A 4L99A 5HI0A 4NIHA 3MLLA 5D8AB 2ATFA 1VAKA 4MHUA 1LU2A 3ZYFA 1YIFA 1D4M2 1PO12 3BIEA 1UYPA 1JZ4A 4BMEA 5JOYA 4HONA 4Q8KA 3VD4A 3ZFGB 1WD3A 1AR61 2VXRA 4OUMA 4H7MA 1NCQA 2WN2A 2BWCA 3POBA 4NIAA 2DVDA 5FK8A 1UY1A 5IYBL 4J1XA 4FOQA 4BBSL 2C26A 3PVOA 1OD3A 4LO6B 4DOUA 3C8XA 1BKZA 5DAWA 3RWNA 4FOWA 5AN9H 3DXUA 2VZTA 4YZ5A 3IKWA 3VBSC 3MIDA 3WP5A 1GQHA 4L2NA 4UFLA 5C8WA 1SQ4A 4IE6A 2IC1A 2WFPA 3J7MA 2HH9A 1RTVA 1DQ2A 3GTML 3HNMA 3NWKA 1R9TL 2EICA 3RZZA 4A45A 1E5HA 1WW5A 2E7AA 3J7Y1 2FDJA 3D4KA 5JXGA 3HIFA 1GWKA 1BE7A 4JAFA 1H2NA 2XHKA 3OTFA 5LB6A 2YYOA 5K8SA 1S0EA 4XYXA 3MW3A 3U1XA 1IG0A 3TEZA 2H6BA 5ACA3 4RR3B 4CP9B 5CNAA 3AMHA 4NRQA 5H9QA 1WMDA 1N1TA 2Q8CA 3VD3A 2ZIXA 3WHUA 4HVOA 1XYPA 4ISQA 3THTA 1W99A 5FREA 1NG0A 2VMEA 4Q1PA 5CFDB 3AZYA 4MLOA 1LOEA 5E89A 5IY0A 1WMEA 3AKRA 4A3XA 1LOGA 4OHZA 2RS51 2GZWA 5J09A 2D3PA 2BGCA 1H30A 1XXNA 5JOWA 2XXZA 2GC2A 3H9CA 3MSUA 2VU9A 1HV1A 1W3XA 2F6BA 2QE3A 2CDOA 3IN9A 4XILA 3NNFA 1H7VA 5EFUA 3RSJA 4AFBA 4C8DA 4BXXL 1YQ6A 2KXLA 3MIGA 4GQ7A 4QGLA 1Q8QA 3INAA 3J4UH 1BQ9A 4Q0QA 4KQ7A 3H7YA 1GOHA 4Z07A 4CRQA 2FDIA 2KR2A 3TEXA 3ILFA 2VCMA 3MPPG 3K51A 2PFWA 3VB9A 3LWRB 4FTSA 4X6RB 4HMZA 2A6ZA 1WLWA 2ZEYA 1GSLA 2OUJA 4LUKA 5EQUA 1IZ3A 3VKOA 3X29B 5T5PA 4POFA 4CDWC 2PMWB 5C5TA 1HJGA 1SFOL 1R1A3 2CKAA 5BNOC 3K4DA 2A7AA 3E5XA 3NFPI 2CGNA 1HXS3 2DURA 2J1TA 2ZGSA 4XFCA 4XXAA 3HOBA 2SBAA 3NAPB 1QJU3 1R64A 1H1MA 5C33A 5EJ3A 2VD7A 3ZLIA 1K5MB 3KV5A 5GZEA 3ZX7A 3AP9A 3KYXA 1FNYA 1R081 2NN8A 4A3DL 3RZHA 1SMMA 4XUQA 5E16A 1LOCA 4BPZA 4BQ5A 2E6VA 4A3LL 4D94A 5JXIA 3S17L 4Y1YA 1PVXA 4ES8A 2A6ED 2D6PA 2VMHA 1RUH3 4MYEA 4YVWA 4CXXA 4R8HA 4XABA 1IQAA 1POV0 5I0RA 5HXMA 1O5LA 1Q56A 2B5HA 5FQ0A 4BDVB 5LW9A 4IE4A 5C71A 2WDBA 3RJRA 3JUUA 3RRDA 1BQPA 1HRI2 2ZHMA 4D6SA 4URAA 2X09A 5C3RA 3MIHA 1BLZA 1J3QA 2QQVA 1WCKA 4AVTA 4G3YC 1OWBA 5J3UA 4Q2FA 2VUDA 5HCHA 1Q5OA 1ZZCA 2BNNA 2YDEA 2OVUA 4LBKA 1ZRIA 3AKSA 4ZZ8A 1DZQA 1MS0A 4O9GA 5I0UA 5FYYA 3ZSKA 4ASMB 3JD71 2MEV1 2YGMA 3ZXJA 3H8UA 2ERFA 1YQCA 2JICA 1Q3EA 1CPMA 4R4XA 4KG8A 4KWJA 5FPXA 5IYDL 1QH7A 3WQBA 1RUE2 2Y38A 3TAYA 1NLSA 2J42A 3LEKA 4UWDA 2RE9A 4EROA 1W8HA 3EJKA 1DZTA 1O8SA 4FPYA 4LA2A 5FQ0B 3RJ2X 3UKVA 2R043 2YU9L 4J1WA 1QJU2 1O4YA 4EWAA 2MS3A 4GWMA 1IW7D 2VW1A 4FOYA 4WVMA 5CB7A 3UGFA 4PDWC 3A22A 3W5NA 1A8MA 1VBB3 2HWF3 3OGGA 4JX0A 4RN5A 3ZYPA 3AMMA 5MGNA 5K0UB 1JZ3A 5H9PA 1Y7BA 2HEYF 2EIGA 1DQ6A 3LWOB 1RJ7A 1O5UA 2NVYL 2G9GA 2XG3A 5CKMA 3WCSA 2WYFA 1ZRFA 2RS11 5FZAA 4IEUA 3AYEA 1TNFA 3KB5A 4LA3A 1PIV2 2VZUA 1W6MB 3AM2A 4FQ4A 4NAMA 2Q8EA 1VBB2 4IEOA 2JG8C 2C4XA 2YPJA 3C2UA 1RGSA 2R49A 4B1LA 1E5RA 2EXHA 1YHFA 4YW6A 4RHV2 5ERLA 3WOGA 2AACA 4HXCA 4W6YA 4CU7A 2WO2A 3I4IA 2VOWA 5FUNA 4YPJA 2K2DA 1SCRA 2DCZA 5DUUA 4BQ3A 4LT5A 4M3CF 3RZJA 1TQ5A 4BA6A 4W4ZA 2LALA 3U14A 3HR9A 4RA0A 4CPBA 3VKLA 1TG7A 5B4NA 2WZEA 5KR7A 4Y52L 3SLIA 4AEDA 1AR62 3CIHA 4XOGA 1WCDJ 2ZGNA 5JXHA 4F83A 4PJYA 5D2AA 3WNLA 5M5YL 4H55A 5HXVA 3VBSA 4AEKA 2VBDA 1CPNA 1TE1B 2VZSA 5DZEA 1UY3A 1OLRA 4OZOA 4YGEA 2GH2A 2ZOEB 2SLIA 3I3BA 3DEMA 3LIHA 3I2FA 3WDUA 4UBHA 3CKHA 4N43B 1OUXA 1EV11 3ZXDA 4BH9A 2IVJA 2IZWA 4MADA 1ND2C 1VR3A 1OQEA 1R091 4B4PA 4K3UA 4CXWA 3T1MA 5C9AC 2PHFA 1B09A 5T52A 5JWPA 4GB32 3SS2A 1OH3A 1JHJA 2R1BA 3B01A 1AR83 2P17A 4IGQA 4LMFA 2VJXA 1QJX1 4LHSA 3WVJA 2HYKA 2R30A 3CNAA 1NA1B 4BHPA 5IUQA 1I3QL 2XJVA 1UW8A 2GNBA 4MGZE 2WZPP 4LK6A 3RG0A 4ZN3B 1UNBA 4Y3OA 4Q4W1 4BYYA 3QACA 2FDFA 1B2OA 3HNYM 1QDCA 3N9OA 2CWMA 4UFIA 3SH4A 2DUPA 2AYHA 4IXLA 3H7JA 3ABZA 1SFNA 3BPZA 3MEPA 2GC1A 3A4UA 4CUAA 1GU3A 4OQ9A 5GZGA 1ZRRA 1NCRC 3ITQA 1W6OA 2W9XA 2YGLA 1KXGA 5JOXA 3ZR5A 1YFXA 3BGAA 4W6XA 1S4CA 3OUIA 1KS4A 2QUOA 2OPWA 3K7AL 2NMNA 3OUJA 1ULGA 3J7NA 1PIV3 3WV6A 3FLTA 1K83L 2ZJCA 1DQ4A 2BEOA 4FPGA 2JI2A 1NZCA 4ZS2A 2DCKA 4FPKA 2RS13 4BK4A 4FBFA 1UQXA 5I0DA 4CEWA 1W2TA 1DHKB 2E32A 3D8CA 3W9AA 3DPRB 1FT9A 4RGKA 3LSDA 4YRDA 1NYWA 2Y0SP 1XSQA 5FZKA 1X36A 3Q8FA 1DBNA 1GKBA 4XMIA 3ZIXA 5J37A 4QM8A 2DCTA 2WRAA 2ZGQA 5F5IA 3H8RA 3NNMA 2R071 2ZZJA 1XE8A 3ZYHA 4KWKA 3PUQA 3ACGA 5FZOA 4AOCA 3LSEA 1UZWA 3UT0A 4XURA 3VBUC 3PVEA 3HNBM 3LD8A 4NJ4A 3LE0A 4OHXA 1SG3A 4XQDA 2WIIB 3IPVB 3L2HA 3PU3A 4HG6B 1ZZ6A 1BBT1 1V6LA 1MS9A 2ET7A 5CG8A 4Y4RA 4CDXB 1VBE3 1G9BA 3P1IA 2JIGA 1T9QA 3PUSA 2ZXQA 2WNEA 4CCDA 1WW7A 1OVSA 1YUZA 3OEAA 1XSRA 3IT8A 3GTPL 1FYUA 1QJY3 2C6AA 1WJVA 2PQSA 1XQNA 1VBC2 1EV13 3J8F1 4FXGB 4P02B 5T3NA 3RDIA 1MVQA 4QIWP 2NYDA 1VRH1 3KT4A 4AAPA 3ZIWA 2XHNA 2YY1A 2WO7A 3MGUA 4MOAA 3I2KA 3RYPA 1TME3 3DN7A 3DGTA 5DM71 4IERA 5FYBA 1WLDA 5DXDA 4P9IA 4A6OA 1FHHA 1Y1WL 1HJFA 3C3VA 5CU1A 1EAH2 1GBGA 1JODA 1X9PA 3HVDA 3VBOA 2DSXA 2GNTA 3RZGA 2BBAA 5L9RA 5GZCA 3HBKA 1W8WA 1VB4A 5SV5A 1LRHA 1GOGA 1C09A 3LWVB 1AX2A 1LJ7A 1LOBA 4M3CE 3DUIA 1W9FA 2ETEA 4LKFA 2NQYA 2WN3A 1Y3TA 4LQRA 3R05A 3GTQL 1TWHL 2PMZP 4QDSA 2ZGMA 4QPGC 4XMAA 3OGJA 1L3JA 4R52A 2E53A 3RNSA 4UFJA 4QKBA 1OQDA 3APBA 3BTZA 1XU1A 5LA2A 3QCWA 5DDJ1 5JUVA 2IFWA 2R7ZL 1J58A 1SPPA 1V9U1 4M00A 4MH0E 2HWC2 5C9AA 1RVF3 4OUEA 1O3SA 4XUNA 3I2GA 4BU2A 4JAEA 5M5XL 2QQKA 2JG9C 2WAOA 2AQCA 2WAQP 1W9YA 2YXSA 4XIOA 4P9WA 2C5DA 4I3GA 4PF1A 4K1ZA 1LHNA 1RUNA 3S7EA 1W90A 2C9AA 3AB0A 4WFN1 3LF7A 1OF4A 4LLOA 3HOUL 1RJ8A 2O8QA 4XAEA 1YLLA 4RFT0 1PZXA 1DZRA 3N9LA 4WM7A 3ZG6A 1OD5A 3OCPA 4ZHNA 3NV4A 1RB9A 4D7YA 2ADEA 3VD5A 5I8SA 3WG2A 4MGTA 1LCLA 3E5UA 1ENRA 3THCA 2QCSB 4PQQA 1S2ZA 4YARA 3I54A 2WSUA 3WP4A 2D40A 5FTTC 3D5OA 3NJZA 3M4FA 2CNAA 2RVAA 1YO8A 4POGA 1OA3A 1REDA 3H9AA 3RYRA 2PYAA 3O7OA 3WF0A 2HWD1 2ZHNA 1POQA 5HCBA 1UOFA 5IVFA 2I2SA 5FYVA 3CHXA 5CBLA 1EAH1 4QXKA 2WR9A 3WUCA 4ZPIA 2Z4FA 2CV6A 1R1A1 3FLPA 1YC61 1KGYA 2BGPA 1GFF2 4NRPA 3S1NL 3VZNA 3QH7A 4FSJA 3QVDA 1OMIA 4JCKA 4U2AA 4LBMA 3VBUB 2GC3A 2HWB1 1OQ1A 1TMF1 2YFUA 2AREA 5C3OA 1AL22 2FCUA 3FBMA 3H3UA 4A7YA 3IIIA 5LY2A 1QGLA 2P3YA 1LEMA 1ND2A 4YG0A 2B42B 5KWRA 3DYMA 1AXZA 2VUML 3S14L 5FY8A 1DIWA 3ZFEC 1MZFA 1BMV1 2LCQA 2WQZC 5TSWA 5A6QA 3BTXA 4NWWA 2GMEA 5AI2A 1XJAA 3FMGA 4C3HL 2YUEA 5C4WA 4EN8B 2ZMKA 5CFCC 2HEVF 5LA1A 5FYTA 3OOXA 4RGGA 5JI9A 2GC0A 2VBBA 4CEWB 1X8MA 2R062 5DUVA 2QNKA 3NJVA 1ST8A 5FYMA 2RS31 2TEPA 4TWTA 4CDXC 2R32A 2VMIA 1WCUA 2MPFA 1UXZA 5JMOA 3OSDA 5KC6A 4XETA 1NNQA 2ZACA 3FJSA 3E6DA 3NV1A 2FD8A 4GH4B 2Q1ZB 5GLZA 1PGW1 5A7OA 3VBRB 3BI3A 1N47A 3BVCA 1R0FA 5KHHA 3J9SA 2PYTA 3AP6A 5DG2A 2V72A 4FAGA 3BKZA 3AXDA 3NAPA 4LO8A 3VBRC 2I74A 2Q30A 1SMVA 5GALA 5G04L 3AVSA 1K5MA 4MGSA 5FPBA 2Y6LA 1B35A 4Y20B 4Y4YA 5KXCA 4N8MA 2OZ6A 4L0PA 5J7MA 4ZS3A 1RXGA 1HDKA 4B7KA 2G9FA 1YWKA 5A3UA 3U78A 4CEWC 1TWFL 3RGBA 3PMSA 1W6NA 5LZ6A 1AUYA 1YI7A 4Y1VA 4DXZA 3SC7X 4FCAA 2RG4A 3PIGA 4AI2A 2YB7A 3EYPA 3ZSEA 2PA7A 3V0AA 1SLBA 2QQUA 3D3AA 4BY1L 4AEDC 3VBOB 2ZX2A 3ZOIA 2K0GA 1WWYA 3EO6A 1AYN1 4NVPA 2L0ZA 1KFXL 1V6JA 1OLME 2GN7A 3DL3A 3PUIA 4GZ9A 1UN1A 2CSGA 3SISA 3TBDA 3W5MA 4DB5A 3PZAA 1BJQA 1RHI3 5FYHA 2JIJA 2VZ1A 3AMPA 3PMEA 2A73B 4GJYA 3Q8AA 1DYOA 3MV01 2Y26A 3CEWA 4IV1A 1ULCA 4X8NA 5FPZA 1W28A 4CU6A 1M06G 2QQMA 1U5IA 3HEIA 2BE5D 4M0NA 2M6OA 3RMYA 4TSVA 2VNGA 1IROA 3OBAA 4AFCA 4G9SB 1IRNA 1IU5A 2A6WA 2BUKA 4QU1A 4AHWA 5APAA 4CTEA 3I4NL 1CR7A 4BY7L 4XFFA 5CFCB 5IK5A 1DGRA 4AYBP 3POIA 4LBQA 1H4HA 1B2JA 4BQ2A 4YSFA 3MIBA 3RZKA 1HXS2 2TUNA 1UYXA 3LPFA 3LOBA 4LBOA 3U0ZA 1F35A 4WVMB 2HR5A 1IHMA 5EINC 4OFGA 3H97A 1JYCA 1H1IA 3M3EA 3ACFA 5F7UA 5EYYA 4AI0A 1QOOA 2BWAA 2E2IL 1ZZ7A 3T0BA 4BQYA 1F8VA 1HB4A 1D4M1 1PO11 1U5XA 4AAXA 2ORXA 2R042 3MUY1 4O7XA 2XH6A 1QJFA 1CAXA 2RV9A 1XBFA 1S2KA 1WD4A 2XUMA 1AX0A 1KS5A 1OT5A 1RC6A 5FFOC 4HFSA 3VBHA 1JMUB 1P8JA 2XVLA 3JZVA 4YGBA 3H9BA 3A0KA 4AR5A 4XJUA 5FMBA 2HWF2 3ZYGA 4OUSA 4YWMA 2XL9A 2D6OX 5A7QA 2RFKB 2P34A 5JXJA 1AYN2 3VN4A 1E8JA 5CISA 2C6SA 4P9GA 4WV8A 3DF0A 2X53S 4QXCA 4FPFA 1U5YA 2ZAAA 4LBQB 1AR81 5JPMB 3BUCA 1JYBA 1RUC2 4I02A 4NROA 3N4MA 1VPHA 1LULA 3VHRA 4BXFA 1QCVA 1RYYA 1UU6A 3N7KA 1R092 3JD73 3U4XA 4LJHA 3VBUA 2W46A 4K21A 4A3BL 5LBCA 2LRPA 2QVSB 4J6GA 4WVZA 5FO7B 2OIIA 1HN1A 7RXNA 4YZ2A 1CAXB 3UJQA 5IK8A 5H9SA 3HOVL 4FFHA 4XDOA 2W95A 3SEPA 2ZGTA 2W1WA 1NUKA 2ZS6B 1MEC3 3PIO1 2OX0A 3KVBA 4FPEA 5IVCA 1SEFA 2CU5A 3AYAA 1G9AA 1B35C 3S6PA 4WM7C 3UJOA 4AGVA 4COWA 3OEBA 5FZIA 5D8AC 5IAVA 2MEV2 3LA2A 1F9KA 4CDQC 1JUHA 1US2A 2W2IA 3ME2A 5ABJB 1SDDB 3PJYA 5A1LA 3WF2A 3A23A 3BALA 2GMMA 4JC1A 4D8MA 3FDJA 4B7EA 1Q8SA 3LDBA 3VUOA 1H8TB 2LW8A 4I0WB 4AVVA 3O1RA 3BIWE 3GTKL 1QF3A 3GTGL 3GZTB 1ODHA 4JQTA 1PM4A 1UKRA 4PHZA 5L73A 5FO9B 3ZN6B 1BEV1 1LKOA 1J84A 2VZOA 1OSGA 2P37A 3CZJA 4XF0A 5FXXA 1ZBE1 4XFGA 5FPAA 2W52A 4D0QA 3VDCA 4UOJA 1OFSA 2GNDA 1MEC1 3VBFA 3OBZA 3ZM8A 4DRVA 3T1LA 4CCCA 4P9JA 3GCWA 4DRRA 3PHMA 4NN0A 1C5HA 3CDZB 3UGHA 4IV1C 4KGGA 4ARYA 1BBT3 1PZ7A 2PHRA 1H9WA 4XXPA 1BK0A 4OULA 4Y5SA 2QZ3A 2XJTA 4H3WA 2IXKA 3AJZA 1J1TA 2JDNA 2XKOA 2QQOA 4Y22B 3M3YL 4FXKB 1D0GA 1WMXA 3GDBA 5FY1A 1UOJA 4BIOA 1NOVA 1PNFA 2ZHKA 5GZDA 5JCTA 2H0BA 4IW3A 4Z2AA 2GP5A 1MVEA 3KWVA 4A3ZA 4C1XA 1ZNPA 3A21A 5IVJA 3ZR6A 5T5JA 2JG9A 4W6WA 4GKYA 1OH4A 4PDWA 3S30A 1Q8OA 1VBA1 2E33A 3TYJA 3EBRA 3ZPOA 5BNOA 3I2OA 1T2XA 3ZXFA 3FHIB 4PCRA 4NHXA 1O8PA 2MEV3 2AZ5A 4GJZA 4GALA 3NKGA 2ARBA 2WSVA 1C8M2 1KJLA 4L8QA 4QPWA 1WW6A 3O1UA 1DCSA 1REFA 1O7FA 3GZAA 3POYA 1W6MA 4XCBA 4JGYA 5FZ7A 3VHPA 4DEQA 1GNHA 2QQWA 3NO8A 5F37A 1S0GA 3H8XA 1FMD2 5FOBB 5K2ME 1JBCA 2W0XA 3PJQA 1CD3G 2XBO2 3WG1A 1VRH2 2YC2A 4QX7A 2Y34A 3GJBA 4MO3M 2WZ8A 2UWCA 4RHV1 2PQQA 4HKWA 4LIVA 4XFIA 4C3JL 4C1WA 4CUCA 1G9FA 2PAKA 1MZ5A 2G4IA 1UZ0A 1HIXA 4I30A 3WF3A 4DS0A 1RYQA 1G6NA 1F4HA 2G9ZA 2YROA 4RYDA 5G05L 2K9ZA 5AC93 5JAXA 4LKSA 1LR5A 3VD7A 3VDDA 1B71A 2A68D 5FZ9A 3HKZP 4F8AA 3WNPA 5C3EL 3VBSB 4IL7A 1R082 4FTEA 4CCOA 4A42A 3I3MA 1UU4A 1W0NA 2R061 4ZXEA 3S5QA 2R1DA 1W2OA 4UFKA 5CYYA 5C4WC 5FZ3A 5FP4A 4EWDA 1O3TA 2ES3A 3CJXA 1LNSA 1QMJA 4QU2A 4DY3A 4B8CD 3NNLA 3OPZA 5EHDA 2Q0AA 3WNKA 3PKIA 4B29A 3ZPYA 1MPXA 2VC9A 4A3EL 2E31A 4YM2A 4CP9A 4MZUA 2YC0A 3WDWA 2ZX0A 1SPPB 2C6BA 3LWCA 3HWJA 3KCCA 4LLFA 2FQPA 4M4RA 4AQTA 2VCBA 4IEYA 4S2GA 1LGBA 2JDAA 5ANQA 5JDBA 4CEYB 4L11A 2WA4A 1F5JA 1GP4A 4HPKB 5EXOA 1OOPB 4V2WA 3V56A 2K46A 1LGCA 2XWJB 4K1YA 2YG0A 4QPIB 3RWKX 3VGIA 3ZKUA 3SITA 4JDMA 5FZGA 1BVVA 4DXSA 5MFZA 4AR6A 4BISA 4MG2A 4XZPA 1TNRA 3VKFC 1ALYA 2UYAA 4E27A 5B4XA 5FWEA 4MGYE 4Y33A 4IV3B 1XYNA 4XAAA 4XFAA 5E6HA 2QQIA 2CGOA 3PTYA 1WGPA 1DQ0A 2V73A 1YQ5A 5EYXA 1FPN3 1BK1A 2DVFA 3FZ3A 4PLMA 5DABA 3DECA 3KYWA 3WF1A 4BLJA 4CYDA 1RITA 1W8UA 1UZZA 2WQ4A 3OPTA 1T9PA 5FAXA 1R083 1UCXA 2B9VA 1TVGA 1AJKA 2OQ7A 2W1UA 4K9SA 2CGPA 2WNUB 3V0BB 1NZIA 4NHKA 1UY0A 3LPGA 4NIGA 4QB6A 3ZYBA 1LKNA 5A1AA 2DBNA 4ZZ5A 1DVBA 5FWJA 2NVXL 2VMFA 4QPIA 3FL7A 4PLOA 4CA9A 1Z7S2 1JUIA 1CONA 4INDA 3U11A 4FFIA 3WINE 3J7Z1 1STMA 3IWZA 2HVYC 5JR7B 4COVA 4CCLA 4N43A 3I97A 1IU6A 1AYM1 1VBA2 3JU9A 4FI9A 1VIWB 4A3GL 1SBFA 3JB8A 2BZDA 5LK7B 3OJBA 2VOTA 3P3PA 1VZIA 4W65A 2ZGKA 4XVHA 4ZONA 1Z92B 4JRLA 5T54A 1JW6A 1DYPA 3OPWA 5FXZA 2D98A 3ES1A 3KD4A 5IK4A 4HZFA 1W8FA 3WY6A 1WMFA 4BJ0A 3T2QA 3U4SA 5KBFA 1OOPC 1ENQA 3ZN5A 4JQRA 2VZRA 3NJYA 4OZXA 5FCCA 4XQ4A 1UMIA 4ZU4A 5C3SA 2GALA 3VDDC 1M4WA 4P5HA 5HBAA 2JA5L 4N53C 4LO7A 4GH4A 4A93L 2UY9A 2JXAA 3CJIC 2BRTA 4LULA 4GB33 1C3HA 4GH4C 2R93L 3CQOA 2VTXJ 4FAHA 4OI0A 1DGWA 1GLHA 4XBLA 1IPJA 3PDQA 3O5SA 2X5IB 2H12A 2IXHA 4DY5A 1V00A 1JYNA 1CAUB 4JHTA 5FZEA 4RGAA 4Q4Y3 4LUMA 3B3QE 1URXA 3GALA 1GQPA 3HMYA 4L92A 2E2JL 5BNPC 3MPSA 3HAXC 2IXLA 1Z7S3 1JZ2A 1H6YA 1H0BA 3MZHA 3RMXA 3POFA 2CAVA 3MFAA 5A3OA 1YFWA 2PXJA 2EIDA 3ST7A 4LO5B 2M4VA 4COYA 2Y33A 3O1SA 3GGLA 1POV3 4A3CL 4DNYA 5T55A 2JD9A 3K46A 1W03A 2Q1MA 4H14A 2BJSA 1FOD1 2HWE1 1ZBE3 4OHYA 4GWIA 3ZMOA 3ECQA 3S1QL 2NM1A 2WNOA 2ERSA 2R7EB 1RUI1 3NAPC 3ZFFA 3I49A 2RM23 4HKLA 1CAWA 1PX4A 2VY0A 4AFMA 1WBFA 1S0BA 5CFDC 1OFNA 4QX1A 3ZYRA 2WNVB 1ENXA 4KI5M 1V6KA 3FN9A 5A33B 1AXYA 3N7LA 4XIKA 1GUIA 2Z5WA 5FZFA 4Y1ZA 1IS3A 2XVKA 4B8EA 1ZREA 3PO3L 1K45A 2D97A 2RM22 4CUBA 3H0GL 1WCSA 3FLRA 4CDQA 1W9WA 1CJPA 2NMOA 4JGZB 3KF5A 1UMZA 4QGNA 4AF9A 3F2ZA 1CAVB 1GANA 2DU1A 1YRZA 3D0SA 2W68A 1Y9MA 3CQZL 1RXFA 4HSJA 5FP9A 3R4DB 1OVPA 3WEZA 4HANA 4ZKTB 2BNMA 4QQHA 1ND3B 3HJYB 1MQTC 3DV8A 2APOB 2BU9A 4L9BA 4NAOA 3BN6A 1RUH2 1JOPA 2VL4A 3HAGA 2PHDA 3O1PA 4YZ3A 4LOTA 5KHGA 5BNPA 1RWDA 5C8CB 2P6CA 2X5IC 4LE3A 1COV1 1ZZ8A 1QQP2 3I2HA 4N90A 5CZKA 5ANNA 3UETA 2Q5TA 2Y64A 4A44A 3LIGA 1SBDA 1D2QA 3PIJA 2BPA2 3BOWA 4EN0A 4UW5A 1NKGA 4MXWA 2WNUA 3V0BA 3P3NA 3PL0A 4ZY9A 3S2HL 3V64A 5FZ4A 2PHXA 1UX6A 2PAMA 1DLLA 3MBWA 4Q0VA 3GTJL 3T4VA 1W39A 2Y60A 2WFF3 5C44L 3N7JA 1PGSA 4FPHA 4UAPA 3E6CC 1PGL1 1Z0HA 3CBNA 4IESA 5F9TA 5L9VA 4ARXA 2GDFA 3I3QA 3ZXKA 2V0FA 1VBE1 5KHIA 2VW0A 3KQRA 2P5BA 1PFYA 2DCYA 3I59B 1FAYA 1KEXA 3LA3A 2VL6A 1LHUA 1PO22 2W87A 4QXBA 5BY5A 5IW0A 4K9FA 3OY8A 3WQ1A 1C5IA 1ULDA 5KHJA 3USSA 4GA9A 2JECA 1LTEA 1B35B 3IM0A 1RUI3 4QX5A 1GICA 3ZVXA 2W1SA 4ASKA 2R073 2Y6HA 2RM21 4AI1A 2HWE3 2PELA 3IDCB 5L19A 5LBEA 2V4AA 1VRBA 1L7RA 3IBMA 2V5YA 4XBQA 4P00B 4Q26A 2C9KA 5HV4A 2I45A 4TLGA 3T0DA 2JKBA 5DDJ2 3B5LB 2XJRA 1SCSA 5SV8A 1BEV2 2A3YA 3ZO0B 2W47A 4AK3A 3O0VA 4Q29A 4LITA 1AJOA 4FT8A 1HN0A 4B4QA 1ZBA2 1N3QA 2ZMLA 1KD7A 3KGLA 4LK7A 3DCQA 3ZXGA 1LOAA 2V5DA 2ARXA 4ASLA 3ORJA 3PVBB 3KYUA 1PX3A 2ZA9A 2WO1A 3E6BA 1NY71 4HN1A 1SMUA 1UU5A 5MFPA 2QKDA 1TME1 4K40A 4BMBA 1W8OA 1Y9QA 4IDZA 4UW6A 4K20A 5FKBA 1PGL2 3N3HA 4IV3C 3VBFB 3ETQA 2TNFA 2W5FA 4XF4A 2J1SA 2E63A 5C8CC 4V196 3T30A 3OBTA 3VLBB 1JHNA 4CZSA 4UY81 1Y9GA 4A7KA 4E2QA 4NOTA 1DQ1A 1CIWA 1SLCA 1LEDA 1AL23 4LNVA 1XE7A 5KXDA 2RHPA 3KCYA 5D8AA 3JXSA 2EY4E 2C24A 1HB2A 4FFFA 1S55A 4TZDA 1VLNA 1DFQA 4AI3A 2J1AA 2QL0A 5D21A 5I8YA 3K35A 4S2HA 5KXBA 2WT0A 4AEJA 5ACA2 4Q0SA 3ILRA 1W6PA 3R4UA 4IEVA 2W1QA 2BBVA 1PO21 1WW4A 4EN7B 5DZFA 1RUC1 4C2M1 2IWGB 1SZBA 1ZZ9A 2WBKA 4UFHA 3ZXEA 2VH9A 4XF3A 1XU2A 1UY2A 4AGRA 2J7MA 3AK0A 4D7SA 5IT6A 1L7LA 3T4HB 2LTNA 3PIP1 2WL1A 3AYCA 3P8BA 2HWC1 2WNVC 4I01A 1ZBA3 1W2AX 3EHKA 2NVTL 5LRRA 3VBFC 5FR3A 3QD6A 4YYOA 5JZGB 2JI3A 5FZDA 5C9AB 4PIYA 4QX8A 4CU9A 5IAXA 2B63L 2B39A 3IMMA 3LZZA 4JGZA 3WP6A 4DQAA 4N53B 4HETA 3L2YA 4RR3A 5JOZA 3V0AB 4ZXKA 5FZLA 2CR8A 3AZZA 2ZGOA 4OMDA 2UWBA 4DUWA 5E1RA 5F32A 3NNJA 3DYPA 3S57A 5LRSA 2VAUA 1W6PB 2XUEA 1PO23 1JN2P 3BTYA 1ULFA 2XWBB 5F5QA 4OHWA 3M4OL 1B13A 1UYZA 3W20A 5IYYA 1U5ZA 3KHCA 2VUJA 4V1PA 3WZ1A 2FZ2A 5BNPB 2JDKA 2XLFA 4XFBA 2QQLA 4C90A 2A1XA 4P9YA 2WLQA 1X50A 2DTYA 5K7PA 2XJQA 1J59A 2O1QA 1VBC1 1DLCA 3J8F2 3KVAA 3KT1A 1MS3A 3HOZL 2Z79A 1ZM1A 5EP9A 3TOJA 4AFAA 4CCNA 5F3EA 3FFZA 5AC92 5E88A 4JDOA 2RDRA 1C28A 3VKMA 2OKXA 4LHLA 3QQCE 2VVFA 3I3EA 3ZKYA 2WZR1 1SMWA 3JQWA 5F2WA 1TWAL 3M3OA 3VPBE 4ZN1B 1UPSA 2VW2A 3D6EA 4N53A 2B46X 5LCWL 1JOJA 2A3WA 4XDQA 5IP9L 3EQEA 4KG0A 5JMCA 2QDNA 5FUIA 2ZKLA 3ZSMA 4CDWA 1YK5A 3H99A 2BDRA 4YW7A 3TN91 1D2SA 3AMQA 1EV12 2WZR2 3KM5A 2YBKA 4YWAA 3LOIA 3RQ0A 3NMBA 2ZBJA 4A7ZA 4E6YA 4X8PA 2EAAA 1HB1A 4AFDA 5BUVA 2GAUA 1AL21 2BFUL 4TPUA 3SQOA 3HD8B 4LPLA 1K3IA 5FUPA 1WLCA 5C4XL 1GMMA 4SBVA 3U75A 4YW1A 4RL7A 3I2IA 2B9UA 3VDBA 1AR71 2L9LA 1FOD2 4IV3A 2E51A 3H3ZA 1RUF1 2LM3A 3GM8A 3MHZA 4CUGA 4N9IA 1GZCA 1NLRA 1VMFA 2I07B 4KU8A 1VE0A 4Q27A 1RUJ1 4E4DX 4HK8A 2WQ8A 1PK6B 1WCML 4BQ4A 1JYIA 4LBQD 4NIDA 4CP2A 5A6ZA 4YVWC 3GTOL 4RS5C 3P6BA 2D3RA 1FMD3 3SMHA 1H8VA 1H8TC 1V6NA 1PIV1 1EYBA 5H1Sc 3H42B 1XE0A 2VVDA 3F95A 2YV8A 2VOKA 3OYWB 1C8M1 1BBT2 2HWC3 3KLSA 2HWD2 4AEMA 3AKTA 1ONAA 3GXUA 4Q4X1 4XJZA 2VTXA 2XR4A 3CL1A 3IAPA 3NV3A 4LO4B 1K42A 3CJIA 2D6NA 4NRMA 4E8CA 5IVVA 2VNRA 4UW4A 3NSTA 1JZ7A 1DYKA 2P3KA 4YNIA 1VBD2 3UNPA 4YFWA 5A70A 3S5AA 2ZGLA 3LA7A 3Q8EA 3KZ4C 2ZMNA 4W50A 2A6HD 1GWMA 4EYUA 1XYOA 1VZGA 4IEPA 1H6XA 1IG3A 2D44A 4H2AA 5C3QA 2X29A 4XF9A 2ZHLA 2HLEA 2Z3QB 1W0OA 4BQWA 1W6NB 3M8LA 1WBLA 2DTWA 1CADA 1OWCA 1Z78A 1XB9A 1OPMA 4EN6B 3RFRA 1FMD1 2IVIB 4FFGA 4XZUG 3LKJA 2UU8A 5ISLA 4LKEA 4AVSA 4RHV3 4WBBA 3FKIL 1QOTA 2Y6FA 5EPAA 1VBA3 1MEC2 1WZXA 4JKMA 3JR7A 1QJY1 4OCTA 2CKCA 3WNOA 1VJ2A 3KT7A 3HBZA 1CZVA 1FATA 3VDDB 3ZN6A 2R92L 2JE7A 2PPTA 1VAMA 3DXTA 2VECA 4I0AA 4QMAA 2V0EA 2EIBA 4YGDA 1HV0A 5FZ8A 4CCMA 4E8DA 1N1SA 4JADA 3ILNA 1COV2 4WVVA 4RSUA 3SNMA 3C7HA 3HOXL 2O5JD 2XQXA 5GLVA 3FBYA 2BYVE 1NXD1 2FCVA 2X5IA 2KA3A 2H0VA 3IDEA 1CAUA 1PVC2 4K8RB 2E7TA 4UF0B 4ORFA 2BV4A 2EXKA 1PNGA 2F4PA 3KF3A 3VL9A 3VZMA 3AP5A 4IE0A 2BW8A 5M5WL 3UKNA 1W8TA 5AFBA 5I91A 3S1RL 1H2MA 1VBB1 1FPN2 2RJ2A 2VZPA 2WUHA 3D0JA 3R0RA 1QKQA 3E97A 4GS7D 1ASJ2 4R9CA 4A2UA 2JB8A 3SCHA 5J36A 3U07A 3J26N 4AEDB 1AR73 2D6MA 1YUDA 1LHOA 2QTWB 2ET1A 2RS52 1UO9A 3HJWB 1JS9A 4YW2A 2D3SA 2D5FA 2X10A 4CE8A 4JKLA 1CQ9A 3WDXA 1MQTA 1JU3A 2JD4A 4W8JA 1K12A 4TN7A 4Z1VA 3AXEA 1VMJA 2CAUA 1V9U2 5FBJA 1IS6A 3POSA 4KH9A 4Q4V2 5A6YA 1QY4A 3ELNA 3PWFA 1VB2A 4UYBA 1OURA 2RDVA 3B02A 2WNVA 2FMDA 4FP2A 4PLNA 1HRI3 4LE4A 2JDHA 3ATGA 3K77A 1W9SA 3I7DA 4QWNA 3M3CA 1MS4A 4FQZA 5DAPA 2B8MA 2EAKA 4BXSV 4HVRA 3ZN4A 2WLPA 3PUAA 3FUOA 3AP7A 3GNEA 3RS6A 3S7IA 2EALA 2MNGA 2XLAA 3KV9A 3EB7A 1OC1A 3Q8CA 1JTZX 1VAVA 3UK9A 5FZ1A 1RUI2 4FPLA 1TZOA 1A34A 2VQTA 3IAQA 1PVC1 2Y8KA 2JWPA 1GZTA 1LGNA 3T2TA 1FV2A 5GADc 2ZX4A 3HPNA 1W05A 3N9NA 3MW2A 1ZA4A 1I5PA 5DAVA 1W0PA 4YM0A 4H7LA 4BB3A 3WHTA 4D7TA 1PGW2 3BYWA 2VE1A 3KSCA 5GJ6A 5BPXA 2ZPXA 4CP0A 4Q1RA 2FHRA 5EZWA 3VKNA 3W59A 1Z7S1 2OZJA 3UGGA 5C5UA 4X6AL 4QQPA 4UBGA 4HBNA 1YNAA 2OW4A 1HXS1 1MZ6A 1DGRN 1YXWA 2JA6L 5LY1A 1JYXA 1NCRA 1H1AA 1BRFA 4NIIA 3N9PA 3S0MA 1XNTA 1PK6A 2BTVC 2WWJA 2WWUA 2WA3A 4S2FA 3URFA 5CEHA 2LROA 1W04A 4AR4A 3OGVA 1I1EA 3PL5A 4N9HA 2NYYA 3LFIA 5A3TA 3RZLA 3RZDL 4AWDA 5FY9A
chains in the Genus database with same CATH topology
4NWVA 3D82A 1VBE2 1G9DA 1O3RA 1QXPA 1AZDA 3AFKA 4BIFA 1S0JA 5FMOS 4R4ZA 1V6MA 4GXLA 3MDPA 4D3WA 1S0DA 1MZEA 1NQJA 2ZZQA 4MXVA 1SBEA 2Q8OA 3MIFA 1ZBE2 1YCIA 2DVAA 1AYM3 2DFBA 2RMU1 3MPBA 1ND2B 3ENRA 1CAAA 4HSLA 5FRAA 1QXRA 3VDDC 1EPWA 1YFYA 4LR4A 3MICA 2MHFA 4AQ6A 4E2SA 5CADA 3AX4A 3IDBB 4FVVA 3I2DA 5JVH1 1QNYA 4QD2A 1FI2A 4AQSA 1H2KA 2D7FA 3WD5A 3GBWA 5HCAA 3MLJA 1AR72 2IXJA 2UWAA 4CEYC 3NV2A 5AVPA 2UURA 1LOFC 1YJLA 2IFRA 4N7IA 3O14A 6RXNA 2OA2A 3TRSB 2GMGA 4HL0A 4Y5Z0 4XQWA 4YW5A 2W39A 1YYNA 2DFCA 3IIAA 1KDKA 1RUD1 1R0JA 2WFF2 3VBRA 1J3RA 1BFYA 2UYBA 4GWNA 2ZTNA 1OLQA 2DVBA 4IETA 4KGQA 1ZRCA 3KGZA 5JSRA 1IKPA 3GHMA 3GBGA 2Z3RB 1HW5A 4Q0PA 4Q4V1 3LAGA 1BMV1 1AR82 1CVNA 3I8TA 3M7AA 5A33A 1A6CA 3MF9A 4Y20A 4WM8A 4D69A 1MS8A 3RYGA 1FXZA 3ES4A 4PBPA 4YG6A 2Y0IA 3WG3A 4B4RA 2PLV2 1AHSA 4Q8LA 3BU7A 4R9DA 1UIKA 3J8F3 1KJRA 3VHOA 3DPRA 3IMNA 3VZOA 5I0SA 2BNOA 5K0UC 4LTAA 4RQPB 2Z2SB 3PVNA 2PLV1 2FMYA 2QJVA 2HWE2 3AJYA 4KWLA 5KXEA 3TB0A 1QHDA 2DCJA 1R1ZA 4BCUA 4XPVA 4NO4A 2Q4SA 3THPA 4IV1B 4ATEA 2XLGA 5K9YA 2P2KA 4MGIE 4JAAA 2WKKA 5DDJ3 1AYM2 3ZDSA 4FTBA 5JZGA 1X7NA 4XFHA 3USUB 4BE3A 1UD1A 2WINB 1UIJA 2EVXA 4YM3A 5L7OB 1ASJ1 3VBOC 1BMV2 1QYBA 1I5ZA 1F2NA 1RB8G 1GZWB 1OOPA 2PHWA 1DQ5A 1EPZA 5GAEc 4HN0A 1GNZA 1ZYBA 5A32B 4Y1UA 1FHMA 1SLIA 1RL3A 4BLIA 3B00A 1RUE1 1Q43A 2RJKA 4G4FA 3B69A 2JENA 3JQXA 2A69D 1YFUA 5GKAC 3L9JT 4NPRA 1AVBA 3ZFEA 1G8WA 2R16A 3A0NA 2KN9A 2EA7A 2M4YA 1AR91 5L7OC 1OA4A 4IEQA 4EWEA 2ZGRA 1HQLA 1U12A 5L7OA 1NA1A 4NHMA 5H9RA 3SXWA 3MF6A 4YW3A 1CAVA 3IU3I 1O3QA 5DUXA 3WNXA 2IXIA 1R0IA 3WR0A 2A3XA 1HQNA 3KCXA 2ZGUA 4XW3A 5EWSA 1YJKA 3PNAA 2O8OA 3H1MA 1QQP1 3GYDA 4JDNA 3LCPA 3O0WA 4XHBA 1S0FA 1NA1C 3AZXA 5J96B 5CFDA 5A32A 1S24A 4WM7B 3ZFFC 2RJLA 1ULEA 2WJSA 3AMNA 5EIOC 3M3QA 1W6OB 1N1YA 2VOXA 2WS93 5ACA1 3QOPA 4RXNA 2DUOA 3ZFEB 2DYCA 2OUHA 5JIUA 2PLV3 2JJ6A 1S0CA 2HKXA 2WC2A 3WW2A 4AGGA 2KM2A 1SDWA 4MXWB 4BM8A 1IS5A 5AI3A 2B45X 1V6OA 2JDZA 3TN92 2R0FA 2BVBA 3H0OA 4QQLA 2PHUA 4Y26A 3NKTA 2HEWF 5MLC3 1F5FA 1QQP3 2B5ID 3JBG3 2XPJA 3HN1A 4M3CA 4PIZA 3KYVA 3OYWA 3AYDA 3RI9A 4AXOA 4C0BA 4Z92B 2VMGA 1N3OA 3PKJA 2V09A 1UKGA 3ZSJA 3W58A 2ZKNA 3VZJA 2R6QA 2WZR3 3G7DA 1VP6A 4GIQA 1A3KA 5T50A 2YZ4A 1IKQA 4QPGB 1BYHA 1NY72 5C4WB 1LB2A 4AE2A 5FO8B 2GN3A 1HRV3 5JSOA 2A6XA 2D6KA 3V65A 2ZAHA 2YHJA 4QT6A 3WCRA 4CP1A 5FDBA 4S2DA 1H4GA 1KRIA 3JBG1 3FWEA 2W08A 3LGRA 1DGWX 2CTVA 3ZFGA 1O4TA 5LK5A 3ZFFB 2BFUS 1WLTA 2NP0A 1V70A 2JEMA 1HLCA 1HRV2 5EV7A 2DVGA 2ZABA 1C57A 1MS1A 5AC91 3R6SA 2JE9A 1N1VA 1MS5A 2WFF1 4QPGA 1DF0A 1RINA 2CL2A 2R063 2HJIA 4JGYB 1F31A 3QLQA 4L97A 1HRV1 4JVAA 1XNCA 1TMF2 2TBVA 1APNA 3GF6A 1G7YA 4YM1A 3ZMNA 3WW4A 1BVP1 2RMU2 3GHNA 2KKDA 1X33A 3U10A 5F6KA 4ISRA 3DPRC 4XF1A 3CLPA 1RUOA 4HT1T 2EF6A 4IEWA 1UAIA 4HLTA 1PVC3 1RUJ2 2XJPA 3TN93 2VGDA 4AHXA 4M0HA 4ONUA 1ZRDA 2R0HA 5J98B 3GBFA 4EV0A 1ENSA 3ZYIB 1MQTB 1ND3C 1QJY2 3MFCA 5BNNA 4FOVA 4KNCA 4YGCA 1RDGA 1VZHA 2BVVA 1TME2 1TEIA 5HCFA 2QDRA 4AQ2A 2ZX1A 3OD0A 4XTPA 1QOSA 3BOPA 2XL7A 3OF1A 1I9RA 1UL9A 4XE9A 3FC0A 3P2AA 2WWSA 4XXBB 4X6QB 3JBG2 4WZCA 4BOWA 2VOVA 3AZWA 1T9OA 1W6QA 1H8TA 1C8NA 5BNOB 2PAEA 1T6GC 3Q9OA 3WWNB 1QDOA 3VBHC 2QQPA 4KU7A 3KS7A 2PTMA 2Y0OA 3I59A 2RS33 3B94A 4BQ1A 1NQDA 1UZYA 3OY8B 2RS53 2JI1A 1FV3A 2EXIA 1QJZA 1C1LA 3UKTA 3LB9A 1I6XA 1O91A 4FO9A 4Z82A 5JVVA 2HWD3 1UF2C 4OHVA 2XKPA 5I0TA 4Q4V3 3B08B 4AW7A 5JIAA 1I3HA 1YV1A 1H9PA 1KITA 1OHFA 1RUG1 4M01A 3WX5A 2AENA 1RUF2 1VALA 1PMIA 4GMP0 3WWLA 5FOJB 2P3IA 1TMF3 4CDWB 3FFQA 2CWSA 4M3CB 3JB4C 1ZBA1 2HWB3 1RUD3 5LEKA 4YFZA 4RQPC 1HRI1 4PF5A 5CA6A 1CN1A 3EXUA 1D4VB 5RXNA 1RMU3 1EY2A 4UXAA 3N36A 4DINB 5BYNA 5D1IA 1AR93 3B9IA 1FNZA 1QJX3 2JG8A 2VVEA 3NL1A 5AFEA 3HT1A 1RUC3 4CDUA 1R0HA 2HWB2 3ALQA 4FP3A 1CESA 2XBO1 3ZXAC 3JCIA 4ME3A 3N35A 5ABJA 1PK6C 4META 4HVQA 4JRAA 3B0AB 2AH2A 1OA2A 4ATFA 3B7MA 4B3NA 1IOAA 3HQXA 1QU0A 4I0BA 2ZCWA 3WDTA 3WXPA 5MF6A 4YVSB 4GMP3 1FOD3 3M2MA 1W2UA 5GZFA 4WZFA 1POV1 1RIRA 1RMU1 1ZX5A 1SLLA 4E4SA 2IXCA 1NE6A 5DZGA 1QNWA 3MI8A 4MUVA 2JG8B 4P9XA 1RUH1 2A70A 3WW1A 5I93A 2CYFA 3M70A 2DU0A 4TLFA 4JAGA 4Y22A 1CX4A 3MW4A 4AVBA 1YI9A 4OVEA 3R4SA 2NPIA 4RS5A 2WNUC 3HT2A 1GQGA 5FBZA 1NXMA 3ZFGC 3VZLA 3ZYJB 2GNMA 4HKOA 5JVG1 4YVSA 3A44A 3RZTA 5AVAA 1QJX2 4PDWB 4DPNA 1O4ZA 4CEYA 1HX6A 5L36A 1RUF3 4YZ1A 5CIRA 1AYN3 5DG1A 5GM0A 4KL1A 1PZ9A 4E2GA 5E8AA 3VBHB 1GZ9A 1LESA 2RR13 1S2BA 3MYXA 2GU9A 4AVCA 2QFEA 4MVTA 4CDUC 1Q8VA 1RUD2 1S1AA 4ITCA 2C0ZA 4OLLA 3O0XA 1QJU1 4KBBA 2C1FA 1LKPA 4Q4X3 1KFUL 2FBEA 3WDYA 1AF9A 2RR12 1R1A2 1XNBA 3LNLA 3KYYA 1REEA 4LBNA 4XJ9A 3SH3A 2HWF1 1LTLA 2A6YA 4XBNA 4U671 1W6QB 5BNOA 1QH6A 3OD4A 4FPCA 1WUVA 2XJUA 4OI2A 4TYSA 5K0UA 1C4RA 1DGLA 1RYTA 5IK7A 1RMU2 5GLWA 5LEJA 2VULA 4QPYA 3ZSLA 1GYKA 3TNPB 2QZ2A 3BCWA 1VRH3 4WVWA 1EP0A 4EN9B 2XJSA 3ZXLA 4Q4W2 5A3LA 1NXGA 3BB6A 5C8CA 3O12A 1WA4A 4N43C 1N3PA 4C91A 1RHI2 3WQ7A 3MLKA 1LECA 1FPN1 3TWIA 2YMZA 4MSVA 5CG9A 1MR5A 3H50A 4Q4Y2 2AYJA 1BXHA 1LKMA 2A5ZA 4K6BA 1LHWA 5GLUA 1V6IA 3WP3A 3QH6A 1OPOA 2NLRA 1X8EA 4IEZA 4HPKA 1LOFA 2R041 5F6LB 4PBOA 2X8KA 3N7MA 2PHLA 2VPVA 4Q4X2 2VNOA 4MGKE 4XGHA 4UW3A 2OPKA 5KC5A 2ILMA 4E9KA 1FX5A 3IPVA 1R093 3JD72 5BV6A 3GZUC 4RD7A 1CJDA 2O0OA 4WM8B 3FX3A 4AYUA 2DV9A 1DX8A 3WUDA 3SH5A 4N7UA 1SFYA 5T5LA 2AR6A 1C8M3 3WQ0A 3FE5A 2GMPA 3UL2A 5DM61 2FZ1A 4IEXA 2JG9B 1SLTA 4QHBA 1J3PA 1RUE3 3AP4A 3K48A 3AKQA 4K8FA 4Q4W3 3WG4A 3G6JB 4RR3C 3KMHA 2D6LX 5GLTA 2DF7A 4RQPA 2J9UB 4Y24A 3DKWA 3WDVA 4YWLA 2ZX3A 1NXEA 2JX9A 4GB31 1GR3A 3BODA 4FPOB 4NR1A 5A3MA 5GAHc 3CO2A 2DUQA 2ENRA 2GSYA 4XTMA 4RS5B 4OI1A 1R0GA 1XRUA 1C1FA 4LBLA 5ABJC 1JXNA 4R9AA 2EXJA 1NCQC 4EJRA 3VL8A 2A71A 2D43A 3RYKA 1S0IA 1GZWA 2VQAA 3WLUA 1PHMA 4QQ2A 2WS91 1VCXA 4DMIA 3RI8A 5GAGc 4JTNA 4MV2A 4Y1XA 1G86A 4P14A 2PVXA 1LU1A 3CU7A 3PLQA 2BQPA 1RDVA 4SLIA 1YIPA 3WW3A 2RS12 1D0HA 4CDXA 2GH8A 1MACA 3NVCA 1VBD3 4ES9A 5CAZA 3AZVA 3B9CA 4JGZC 5DUWA 2RS32 1LHVA 5JPNB 1H2LA 3H1YA 2H6CA 1U0AA 4Q0UA 2LUWA 2R072 4YW4A 4YG3A 3POWA 2Z42A 3LPEB 1HKDA 4YVSC 2VG9A 1QWRA 3SCFA 4TVMA 1IPKA 2E7QA 5FLIA 1CAWB 1Q8PA 2M6PA 2AGSA 2D5HA 3M3IA 4DFSA 5FLHA 3ASIA 5J48A 1QXJA 1J1LA 1OKQA 4WM8C 1NCRB 4O9EA 5BNNB 1DU3D 1AL0G 1VBD1 1K5MC 4XJAA 4LHKA 1COV3 4PQ9A 4R9BA 4BWOA 5BNQA 1RVF1 5F1RA 2WT1A 1HQWA 1SLAA 1BQ8A 1AX1A 1ZVFA 4FPJA 2ERJA 5BXXA 3FUQA 2WT2A 4ZU7A 2XBO3 5JSPA 1AR92 2WS92 3QBQA 4PIXA 1X82A 4MX3A 1OI6A 2RR11 4JV4A 4AHZA 1VBC3 1RUG2 1ND3A 2ZGPA 2VQ0A 4GULA 1YK4A 4C0HA 3ACLA 4Z8BA 5FMOL 4U36A 1PM7A 3B93A 5CVRA 4JTOA 2N7GA 2B7YA 5BNNC 1S30A 1AR63 4I3PA 1LENA 3VHNA 5JLVA 1ZZBA 3WT3A 4LHNA 1E57A 1LODA 2CY6A 1KDMA 1D4M3 1PO13 2PVEA 1IS4A 3MIEA 2DWRA 3UV9A 5JZGC 1DDLA 4LBJA 2P3JA 1BZWA 5FLJA 1EAH3 2XGXA 2PHTA 2AUYA 2NZ9A 5JI7A 4COUA 4F7ZA 4AR3A 2PSMC 4GMP1 1V9U3 4G6BA 4YZ4A 2RMU3 4OI4A 4AI8A 1XNKA 3TNQA 3CJIB 5KHKA 4AG4A 3AKPA 4XHXA 4Z2WA 1RUJ3 1GV9A 4NHLA 1ASJ3 2PN5A 5C6CA 5T5OA 3H1WA 3RPQA 1RVF2 2XB6C 1Y43B 3BTAA 1NE4A 2A6VA 1G9CA 4YVWB 3OBRA 4CDUB 3ROUA 3SCGA 3CF6E 4LEJA 1SACA 5CFCA 1CGPA 1AXKA 4GKXA 8RXNA 2V3BB 4F3JA 1PZ8A 4BZ4A 4XJ8A 4IQPA 2XVGA 4I09A 3M1HA 4HK9A 4XEZA 4I2OA 1NCQB 4COZA 1JH5A 1A78A 2D93A 4QQOA 5I8TA 3SHRA 4Q4Y1 5B2GB 4QM9A 1XNDA 2Z69A 1DG6A 4QGMA 1KQRA 1UPIA 4AHYA 1BCXA 3AFGA 4QPIC 3E5QA 1RUG3 3VZKA 1ZRPA 4E4ZA 4YLZA 2E9QA 1RHI1 4JGYC 3RZ6A 2VUAA 3NW4A 2UY8A 4AVAA 2OYZA 1A8DA 4ZU5A 2K2SA 1BEV3 4K7JA 3USUA 4CDQB 4DZGA 4XJWA 1YUXA 3VV1A 1IGOA 4L99A 2A75A 5HI0A 3MLLA 5D8AB 2ATFA 1VAKA 1LU2A 1YIFA 1D4M2 1PO12 4BMEA 5JOYA 4Q8KA 3ZFGB 1WD3A 1AR61 2VXRA 4OUMA 4H7MA 1NCQA 2BWCA 2DVDA 4J1XA 4FOQA 3PVOA 4LO6B 4DOUA 1BKZA 3RWNA 4FOWA 5AN9H 4YZ5A 3IKWA 3VBSC 3MIDA 3WP5A 1GQHA 4L2NA 5C8WA 1SQ4A 2IC1A 2WFPA 1RTVA 1DQ2A 3NWKA 3RZZA 1WW5A 2E7AA 3J7Y1 3D4KA 3HIFA 3OTFA 1BE7A 4JAFA 1H2NA 2XHKA 5K8SA 2YYOA 1S0EA 4XYXA 3MW3A 2H6BA 5ACA3 4RR3B 5CNAA 3AMHA 5H9QA 1WMDA 1N1TA 3WHUA 2ZIXA 4HVOA 1XYPA 4ISQA 3THTA 5FREA 1NG0A 4Q1PA 5CFDB 3AZYA 4MLOA 1LOEA 5E89A 5IY0A 1WMEA 3AKRA 4A3XA 1LOGA 4OHZA 2RS51 2GZWA 5J09A 2D3PA 2BGCA 1H30A 1XXNA 5JOWA 2GC2A 3MSUA 2VU9A 1HV1A 2F6BA 3IN9A 2QE3A 5EFUA 4XILA 3RSJA 4AFBA 1H7VA 2KXLA 3MIGA 4GQ7A 4QGLA 1Q8QA 3INAA 3J4UH 1BQ9A 4Q0QA 4KQ7A 3H7YA 4Z07A 4CRQA 3ILFA 3MPPG 3K51A 2PFWA 4FTSA 4X6RB 4HMZA 2A6ZA 1WLWA 3VKOA 1GSLA 2OUJA 4LUKA 3X29B 1IZ3A 4CDWC 5T5PA 4POFA 1R1A3 2CKAA 5BNOC 2A7AA 3E5XA 3NFPI 2CGNA 1HXS3 2DURA 2ZGSA 4XFCA 4XXAA 2SBAA 3NAPB 1QJU3 1H1MA 5C33A 5EJ3A 1K5MB 5GZEA 3ZX7A 3AP9A 3KYXA 1FNYA 1R081 2NN8A 1SMMA 5E16A 1LOCA 4BPZA 2E6VA 4D94A 4Y1YA 1PVXA 4ES8A 2A6ED 2D6PA 2VMHA 1RUH3 4MYEA 4YVWA 5I0RA 4R8HA 1IQAA 1POV0 1O5LA 1Q56A 2B5HA 5FQ0A 3RJRA 3JUUA 3RRDA 1BQPA 1HRI2 2ZHMA 3MIHA 1J3QA 1WCKA 4AVTA 4G3YC 1OWBA 5J3UA 4Q2FA 1Q5OA 1ZZCA 2BNNA 2YDEA 2OVUA 4LBKA 3AKSA 1DZQA 1MS0A 4O9GA 5I0UA 3ZSKA 4ASMB 3JD71 2MEV1 2YGMA 3ZXJA 3H8UA 2ERFA 2JICA 1Q3EA 1CPMA 4R4XA 4KG8A 4KWJA 5FPXA 1QH7A 1RUE2 2Y38A 3TAYA 1NLSA 4EROA 2RE9A 3EJKA 1DZTA 4FPYA 4LA2A 5FQ0B 3RJ2X 3UKVA 2R043 4J1WA 1QJU2 1O4YA 4EWAA 2MS3A 4GWMA 1IW7D 2VW1A 4FOYA 4WVMA 5CB7A 4PDWC 1A8MA 1VBB3 2HWF3 3OGGA 3ZYPA 3AMMA 5MGNA 5K0UB 5H9PA 1Y7BA 2HEYF 2EIGA 1DQ6A 1RJ7A 1O5UA 2G9GA 2XG3A 3WCSA 1ZRFA 2RS11 4IEUA 3AYEA 1TNFA 3KB5A 4LA3A 1PIV2 1W6MB 3AM2A 4FQ4A 1VBB2 4IEOA 2JG8C 2YPJA 3C2UA 1RGSA 2R49A 2EXHA 1YHFA 4RHV2 3WOGA 4W6YA 3I4IA 2VOWA 2K2DA 1SCRA 2DCZA 5DUUA 4LT5A 4M3CF 1TQ5A 4BA6A 2LALA 3HR9A 4RA0A 3SLIA 4AEDA 1AR62 4XOGA 1WCDJ 2ZGNA 4F83A 4PJYA 4AEKA 5HXVA 4H55A 3VBSA 1CPNA 1TE1B 5DZEA 1OLRA 4YGEA 2GH2A 2ZOEB 2SLIA 3WDUA 4UBHA 4N43B 1EV11 3ZXDA 4BH9A 2IZWA 1ND2C 1VR3A 1OQEA 1R091 4B4PA 4K3UA 3T1MA 5C9AC 2PHFA 1B09A 5T52A 5JWPA 4GB32 3SS2A 2R1BA 3B01A 1AR83 2P17A 3WVJA 1QJX1 2R30A 2HYKA 3CNAA 1NA1B 4BHPA 5IUQA 2XJVA 2GNBA 1UW8A 4MGZE 2WZPP 3RG0A 4ZN3B 4Q4W1 4BYYA 3QACA 1B2OA 1QDCA 2CWMA 3SH4A 2DUPA 2AYHA 4IXLA 3H7JA 1SFNA 3BPZA 3MEPA 2GC1A 3A4UA 5GZGA 1ZRRA 1NCRC 1W6OA 2YGLA 5JOXA 1KXGA 1YFXA 4W6XA 1KS4A 2QUOA 2NMNA 1ULGA 1PIV3 3WV6A 3FLTA 2ZJCA 1DQ4A 2BEOA 4FPGA 2JI2A 1NZCA 2DCKA 4FPKA 2RS13 4FBFA 4CEWA 1DHKB 3D8CA 3W9AA 3DPRB 1FT9A 3LSDA 4YRDA 1NYWA 1X36A 1DBNA 1GKBA 4XMIA 3ZIXA 5J37A 4QM8A 2DCTA 2ZGQA 2R071 2ZZJA 1XE8A 4KWKA 3LSEA 3VBUC 3PVEA 4OHXA 4XQDA 2WIIB 3IPVB 3L2HA 1ZZ6A 1BBT1 1V6LA 1MS9A 2ET7A 5CG8A 4CDXB 1VBE3 1G9BA 1T9QA 2WNEA 1WW7A 1YUZA 3IT8A 1FYUA 1QJY3 2C6AA 1WJVA 4FXGB 1XQNA 1VBC2 1EV13 3J8F1 3RDIA 5T3NA 1MVQA 3KT4A 2NYDA 1VRH1 3ZIWA 2YY1A 3MGUA 3RYPA 1TME3 3DN7A 3DGTA 5DM71 4IERA 1WLDA 5DXDA 4P9IA 1FHHA 3C3VA 5CU1A 1EAH2 1GBGA 3VBOA 2DSXA 2GNTA 5GZCA 1VB4A 5SV5A 1LRHA 1C09A 1AX2A 1LJ7A 1LOBA 4M3CE 3DUIA 2ETEA 2NQYA 1Y3TA 4QPGC 3R05A 3WUCA 4XMAA 2ZGMA 3OGJA 1L3JA 4R52A 2E53A 3RNSA 1OQDA 3APBA 1XU1A 3QCWA 5DDJ1 2IFWA 1J58A 1V9U1 5C9AA 4M00A 4MH0E 2HWC2 1RVF3 1O3SA 4JAEA 2JG9C 2YXSA 4XIOA 4P9WA 2C5DA 4I3GA 4K1ZA 1LHNA 1RUNA 3S7EA 2C9AA 3AB0A 4WFN1 4LLOA 2O8QA 1RJ8A 1YLLA 4RFT0 1DZRA 4WM7A 3ZG6A 1OD5A 3OCPA 3NV4A 1RB9A 4D7YA 5I8SA 3WG2A 1LCLA 3E5UA 1ENRA 2QCSB 1S2ZA 4YARA 3I54A 2WSUA 3WP4A 2D40A 5FTTC 3D5OA 3NJZA 3M4FA 2CNAA 1YO8A 4POGA 1OA3A 1REDA 3H9AA 3RYRA 2PYAA 3O7OA 2HWD1 2ZHNA 5HCBA 2I2SA 5CBLA 1EAH1 4QXKA 2CV6A 1R1A1 3FLPA 1GFF2 3VZNA 3QH7A 4FSJA 3QVDA 1OMIA 4JCKA 4U2AA 4LBMA 3VBUB 2GC3A 2HWB1 1OQ1A 1TMF1 2AREA 1AL22 3H3UA 3FBMA 4A7YA 1QGLA 1LEMA 1ND2A 4YG0A 2B42B 5KWRA 1AXZA 3ZFEC 1DIWA 1MZFA 2LCQA 2WQZC 5TSWA 4NWWA 2GMEA 5AI2A 3FMG