4AI1A

Flo5a showing a heptanuclear gadolinium cluster on its surface after 19 min of soaking
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
258
structure length
258
Chain Sequence
b'GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLOCCULATION PROTEIN FLO5
publication title Complex Gadolinium-Oxo Clusters Formed Along Concave Protein Surfaces.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell adhesion
total genus 56
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4ai1A02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ai1A01
4GQ7A 4LHLA 4AFAA 2XJVA 4AI3A 2XJSA 4LHNA 5A3MA 4D3WA 4CP1A 4AHWA 4COYA 4COZA 2XJTA 4COVA 2XJUA 4AI2A 4A3XA 2XJRA 4CP0A 4AHYA 4COUA 4AHXA 4AFCA 4COWA 2XJQA 4AFBA 4LHKA 4ASLA 5A3LA 4AHZA 4AF9A 4AI0A 4AI1A 4CP2A 2XJPA
chains in the Genus database with same CATH superfamily
2XVLA 1R0HA 3V0AB 3HNMA 1YQ5A 4LBQA 2JG8A 4KWJA 3LIGA 4E4HA 4DY5A 1H1AA 1WMXA 2RR11 3S16L 1ONAA 3A7QA 3CIHA 4UW4A 4XFHA 3LD8A 4NHMA 4Y5SA 5BNPA 1HJFA 3SCFA 5MGNA 2A73B 5CFCB 1W0OA 1SLLA 4IEXA 4HXCA 4IE4A 4META 1BBT3 1IU6A 2BGPA 2NVXL 3HOXL 2OXBA 2WAAA 3I97A 1ST8A 4AK3A 1OKOA 4AQ2A 1Y3TA 1YFYA 3BI3A 5IYCL 4A3FL 5F3GA 1UQXA 3KYXA 5K0UB 1SFPA 1SLTA 1WZXA 3GCXA 1OOPC 4NHXA 2E2HL 4NWVA 3SHRA 1R082 1IZ3A 3ZFEC 3KHCA 4YVSC 3ACFA 4AVAA 1JBCA 1BZWA 4V196 1VBD2 4UBHA 1F9KA 4Q4V3 5H9SA 5IK5A 3B93A 4OQ8A 3WF4A 4WFN1 5E8AA 1G9DA 1GZ9A 2VVFA 4B29A 1N1YA 5T55A 3W5NA 2VUDA 4QKBA 1JZ2A 5FUIA 4UBGA 1VBB3 3MGUA 3VDCA 2AUSB 1JTZX 2WBKA 1AR82 4FTSA 4PF1A 2C24A 3UETA 1UYYA 2J22A 1OBNA 1WLTA 5FZIA 1U12A 1UU5A 1J59A 5EHDA 1S4CA 4HMZA 3S15L 1ND2B 4WVVA 5EIOC 3BTZA 1H8TB 1S2ZA 5JI9A 1XSQA 3PUSA 5H9PA 1ASJ1 1EV12 3ZR5A 3I4NL 2WFF3 2ZMKA 1UMIA 4LE4A 5A3TA 3SH3A 1EYBA 3WINE 2V3BB 2EXJA 3PU8A 2ET7A 2XBO1 4ZXEA 4XOGA 3CMGA 3TN91 3VDDB 4Q8LA 4Y4RA 5D2AA 3WOGA 3HVDA 4HKLA 1OXCA 2VW2A 2W1WA 1XE0A 3VD9A 4U2AA 3CHXA 1H7VA 1UZVA 2VQAA 1CAWA 1RVF3 1OURA 3N7KA 4YWLA 4UI9L 5F37A 5IK4A 1FHHA 5DUWA 1CZVA 2D97A 1GYKA 2VMEA 4FPOB 5F3IA 3PO2L 1K3IA 3DXUA 4OZOA 4IEWA 1R0FA 3AMNA 4I3PA 1PO23 1W6MA 3WW3A 3DKWA 4LKEA 1AL22 4RD7A 3E5XA 4EZHA 3QH6A 2OKXA 4CU9A 4XILA 2O0OA 2PPTA 2EALA 1T6BX 1F5JA 1F4LA 4AG4A 1LKPA 5EPAA 3AK0A 1O4TA 3QOPA 1O5UA 3AKPA 3ZN5A 1ZA7A 3BYWA 1RXFA 3UKNA 5JSOA 4GB33 1W9WA 1QJY3 1R1ZA 3QH7A 2Y6HA 4M4PA 3WF3A 2PHFA 5K7PA 4MGZE 5F6LB 1MEC2 2QTWB 3I3DA 3ENRA 3OD4A 5CFDB 1YJKA 5I0TA 4N7UA 1MZ6A 4X8PA 4YW1A 3UKVA 1FI2A 4NPLA 4BDVB 4BQ3A 2GC1A 1C8NA 3MIEA 4LT5A 4AHXA 4YFZA 2VNVA 4FI9A 5GLZA 1DGRA 1MS3A 2BFUS 3SCHA 3WW1A 1AR62 3BIEA 2FDIA 4AFBA 5FRAA 3NKTA 4D6SA 1HQWA 4EN8B 4AWDA 3VPBE 1YUDA 2QQNA 4NR1A 5FYUA 5A3LA 2WNUC 1W0PA 4R4ZA 4QGLA 1GOHA 4OI0A 4Y7NL 2L0ZA 2ZGUA 2VZUA 3HN1A 4BIOA 2P3KA 3AMHA 1A34A 3LWPB 4A3IL 4DY3A 2A71A 3ILFA 5F39A 2UURA 5ABJA 1O4ZA 2X09A 2W08A 4KGGA 2K2DA 1C4RA 3MPBA 5F1RA 3U0ZA 3T3YA 5A1LA 1T6GC 2AREA 4MH0E 1MS9A 3WG2A 1COV2 4TVMA 2NYDA 2VG9A 3N9QA 4E2SA 3MW4A 1HV1A 3POWA 1OFNA 2QQIA 3J8F1 5HCBA 1U5YA 3GZTB 1H2KA 5F9TA 1ALYA 5DUVA 1SFNA 4DB5A 1REDA 3E6DA 4QPWA 5A80A 1RB9A 1RHI1 3CDZB 3MFCA 3MIBA 2JDHA 2QNKA 3NNFA 1AXYA 2D40A 4CU8A 3FL7A 3S1RL 4LA2A 5CYYA 2GNBA 3WG4A 5A70A 4A6OA 2JA5L 4BE3A 4YGBA 3TEYA 3O1OA 5FZ1A 3MBWA 4XMAA 3K51A 4KU7A 3M2MA 4UY81 1QOTA 2WN2A 3QD6A 5MLC3 2X5IC 2BFUL 3AP9A 1WLDA 1ZZCA 2GN3A 1JN2P 3W21A 4CDUB 2XJRA 1OD3A 4AVBA 5BNNA 4XXPA 2PVEA 1QMJA 1O8PA 1UL9A 2PQQA 2WA3A 3GZUC 4Q0SA 1K12A 1US3A 1ZRIA 5BNOA 2WINB 4QXCA 2XJQA 2PLV2 4UFIA 4W6XA 3UL2A 4AI8A 1ULOA 3H3ZA 2ZEXA 1LCLA 3ELNA 4AGVA 1G9CA 1O3SA 4CEWC 2X05A 3M7AA 2F4LA 2VW1A 2ILMA 4S2HA 4CCOA 1CAVA 1CVNA 4WVMA 1UX6A 5HI0A 1DQ1A 2K9ZA 4C8DA 2GMEA 1N3OA 3FBMA 1SLAA 5GZGA 3R6SA 5C8CC 1AYN3 5C7GA 1PM4A 5FZAA 1RUNA 1Z92B 2R061 2J1VA 1JYCA 1RUJ2 3NJYA 3R4DB 1CESA 4ET7A 3WP5A 4RGAA 2B63L 4XAEA 2WR9A 4K1ZA 4AFDA 1HRV1 3E5UA 4IERA 3J7Z1 4OUSA 5BNNC 1V6LA 1QJEA 3ACLA 3PVEA 4J1XA 1U5IA 2IWGB 2YB7A 4AEDC 4DXZA 5C3QA 2YU1A 5J1XA 2VQ0A 3TEZA 5F5IA 3ZYRA 1MPXA 2BNOA 1HB3A 5MFPA 3H1MA 5E6HA 4C3IL 2AQCA 1PMIA 1QJU3 2IXKA 2QJVA 4UWDA 2QE3A 4YLZA 2XWJB 2XVKA 2BE5D 2GC3A 2WNOA 2XHKA 5LY2A 4RSUA 1DGWA 4QPIC 4BWOA 3LDRA 4YGDA 1X9TA 1PFWA 3SH4A 5GLWA 1JW6A 2BERA 1W6QB 3VZNA 2WWSA 1WW5A 2NYYA 3DUIA 4IL7A 4K7JA 3CKHA 4BQ1A 1UZZA 1ODNA 2QZ2A 4QU1A 3WNKA 2AEYA 3ZFEB 5T5LA 4PF5A 1POQA 4XTPA 4CDWB 2VOVA 5FZEA 1CONA 1SFYA 1UY4A 2RDQA 3AVSA 4UOJA 4A2UA 4AI9A 2DTWA 2E26A 3CL1A 3CQOA 2M4VA 1I6HL 1ZNPA 3KQ4B 2H6CA 3I49A 3AP4A 3LWOB 3IWZA 4P9LA 2VZTA 1Z78A 2P6HA 4AR3A 1MS1A 1R092 4Q4Y2 2EXHA 3B7MA 5IATA 2WLPA 3VBHA 1RJ8A 1FMD3 1S0CA 2RR12 1GU3A 4GMP3 4BMBA 2XGXA 2PXJA 3O14A 4FXKB 3OPTA 4MXVA 2VCCA 1BQ9A 3WSOA 2HYXA 4WM7B 2DCYA 3WV6A 3FDJA 4OI2A 5KHJA 1JZ5A 3PUQA 5JR2A 5L9VA 2DVAA 4IEUA 1POV0 2HVYC 3AMPA 1SLIA 4SBVA 4Z82A 3SKVA 3CEWA 3DEMA 2GNMA 2V5DA 2VPVA 5GLUA 1RUE1 5KXEA 4QX8A 1H2LA 2HEWF 2WNVA 3I2HA 3L2YA 5GLTA 2DCKA 2D3SA 3S1QL 2A68D 1GOFA 3KF5A 4FPYA 4C90A 3VDBA 4D94A 3RNSA 3ZPOA 3NAPC 1K5MC 3OEAA 2CSGA 2RS53 4QQHA 3WD5A 1ULPA 5C3SA 1ENRA 3BIWE 3WDWA 2GDFA 2WWUA 4BU2A 2VU9A 5LRSA 2A6XA 4JGZC 1FPN1 3GHNA 3USUA 2SBAA 3H0OA 4JX0A 3W58A 4CDXA 4L97A 5C9AB 4CXYA 3VBRC 4PDWB 1PK6B 3KGLA 2D93A 3AFGA 5FZKA 2UY9A 5KBFA 4BH9A 4E8DA 2R041 2GMMA 2XBO2 4HKWA 4H14A 4M3CE 3ZDVA 3OBRA 3HAXC 1TMF2 3TN92 2DSXA 5GZCA 3F95A 1RXGA 3VBFC 2PTMA 3DF0A 4XJ9A 1HLCA 1H30A 1UAIA 3O7OA 3JBG2 4Q4W1 1HXS1 1KITA 1AR71 2Z2SB 2W39A 4JV4A 4XACA 1DZTA 2LCQA 1FAYA 4N9IA 1PVC1 1H6XA 2WO1A 1P8JA 1QH6A 4HK9A 4YW5A 1Z7S3 1DVBA 3OOXA 2WRAA 3AYEA 4TLGA 1Q8QA 4Y4YA 5FMOS 5C3EL 1OWBA 4G3YC 4CXWA 2YV8A 4FPJA 2D98A 1RDGA 2ZS6B 2ZX1A 1TG7A 4P9XA 2YBSA 5IFTA 3K4ZA 4M3CA 2JG9B 1SMWA 1ZBA2 1S0GA 5BUVA 4QPGC 2XONA 1VJ2A 5CB7A 3MPPG 1QCVA 2DWRA 4UF0B 1O3QA 3U07A 3ZO0B 5FJKA 1YIPA 1MZFA 2DFBA 3EQEA 3POEA 2JIJA 5FY1A 3VBUC 3QVDA 2P3YA 3O1VA 1ODHA 4RHV2 3VZOA 4JAEA 1S0EA 1G9FA 3FWEA 5IVVA 2D44A 3VKFC 1WKYA 3X29B 3HNBM 1CJDA 4EN7B 2AYJA 4RQPC 4RS5B 2R93L 4NO4A 3RZHA 3PUAA 2DU0A 1RUC3 2Y26A 3N9MA 5FREA 4DS0A 1W2TA 5JUVA 4XFIA 3GTOL 2IXCA 3PMSA 4XAAA 3PL0A 4Y20B 1GSLA 5IYYA 1AL0G 4ITCA 5EZWA 2B42B 4TSVA 5C3RA 1JZ7A 1DDLA 2YC4A 5JXHA 2WUHA 5FY0A 4F83A 2ARAA 5DAWA 1QDCA 3T4VA 1VBC1 1CJPA 1LOBA 3CJIC 3LGRA 1WD3A 4W65A 2EA7A 4GH4C 2YY1A 3O0VA 3PU3A 2R92L 1MZEA 3CJXA 3GXUA 5FMOL 4LLFA 3DGTA 1TE1B 5EQUA 3E1F1 1SFOL 4BQ5A 5GZEA 3MFAA 3PTYA 2W87A 3MYXA 3MQKB 1VRBA 3OY8A 1E57A 2XJUA 4QHZA 4A6SA 5B2GB 2F6BA 5FZ4A 1IHMA 2WT0A 3KM5A 1WD4A 1DQ4A 2C4XA 4PIXA 1HB4A 2A6WA 2B39A 4RR3A 4AAXA 4XABA 1CPNA 2WA4A 4O7XA 4P9WA 5FLIA 5BYNA 2MS3A 2RJLA 3VKMA 4LLOA 5FY8A 5EV7A 1R1A1 1ZA4A 2YZ4A 3DPRA 4L2NA 4PQQA 2PAEA 4H3WA 3PNAA 4TLFA 4AVSA 2A3WA 2Q4SA 2VVEA 3KT7A 4ZU4A 5IVFA 4XE9A 5CIRA 5JOZA 5L7OA 4LO4B 2JECA 4YZ4A 3VHPA 3C7EA 1Z0HA 4QT6A 5F5AA 2A6HD 5FYBA 4AE2A 4OHYA 4XQ4A 4WM8A 2QKDA 2WABA 2YC0A 1JYXA 2WZR2 4LO5B 3DV8A 4C0BA 5HCHA 4HN0A 3S7IA 1N1TA 2E33A 2JX9A 4BYYA 1JODA 5LRRA 3ZXKA 4DNYA 5DABA 3K48A 5FUNA 3ILRA 5JMCA 4QX7A 1NKGA 3ZYIB 5KHKA 3M3OA 3VBOB 4GQ7A 5JDBA 1KXGA 3AX4A 1WW6A 1KRIA 2J9UB 4M3CF 1NXD1 1F4AA 4P9YA 3UGGA 3PIGA 4IV1C 2EAKA 1JYVA 1UXXX 1JMUB 1R081 5FO8B 5BXXA 3ZYHA 1DLLA 4LK6A 2GC2A 4MV2A 5FPBA 4B4QA 2GP3A 2RS11 2XVGA 1AX1A 1VBD1 2HWC2 2MPFA 3CZUA 4IV3C 4KNCA 1RYQA 3N35A 2WO7A 3LA2A 4XURA 4COZA 5TSWA 1IG0A 2WAQP 2ZGSA 4QWNA 5B4NA 5A3NA 1BYHA 5F3EA 1VP6A 3VBSA 4LUKA 1A3KA 5FZOA 3N7LA 2ERSA 5A1AA 3OYWA 2WSUA 3AP6A 1NAEA 3ACIA 4FCAA 2PHXA 4TYSA 1BCXA 5C4WA 2QQWA 2RJKA 4CUBA 2Y6JA 5B4XA 4DRRA 1Q8OA 1NLRA 3M1HA 5LA9A 2D6PA 5CFCC 4NUBA 1B35B 2OT7A 3D3AA 4CCCA 3K3NA 4LOSA 2HWE3 1NCQA 2APOB 5A7WA 4BY7L 3Q8EA 1ZRFA 1IGOA 4XBNA 4OFGA 5F5QA 4XJAA 5K0UC 4QX2A 4ORFA 5FYIA 5ANNA 2IVIB 4FPKA 3WUCA 4COYA 1CAAA 1XC6A 4QU2A 5I0RA 2J1UA 4UW5A 5C3PA 1OC1A 3LPFA 4ATEA 2F17A 4Q0UA 1AXKA 5DZFA 5HV4A 1W6MB 5ACA3 4QXHA 4A4AA 2RMU2 2E32A 4P9IA 4DPNA 3DYMA 5FYHA 2OQ6A 1OLME 3M8LA 5AVAA 3LEGA 4AR2A 2VL6A 1ZRDA 2WS91 4MHUA 3WNXA 1JYBA 3AZXA 5C6CA 2ID4A 1HDKA 3NL1A 3J8F3 4MSVA 1SBFA 3T30A 4YGEA 1EPWA 4ISRA 4YW2A 1RUI3 1RWDA 1XE7A 1OOPA 4Y1XA 4DMIA 2MEV3 1ND2C 1YQ2A 1OHFA 1DYOA 4YVSA 3W20A 1H8TC 2A3YA 3HD8B 5HPOA 3MEPA 2G9FA 4AEJA 2O8QA 1OLQA 3VDDC 1W6OB 1MEC1 1UYZA 1MS8A 4R9BA 3C8XA 2W1QA 1OLMA 4ZZ8A 5T54A 1DQ0A 4QHOA 1HKDA 3ZMNA 1UWWA 2IVJA 2V4AA 3AP7A 4JDOA 5FK8A 3TNQA 2P34A 4NVPA 1L7QA 1AR61 1F35A 4LOTA 3K35A 4MHRA 2YC2A 4Q0PA 4CSWA 1WUVA 2OZ6A 2LALA 3HQUA 2ATFA 1AYM2 1LEMA 2WFPA 5AC93 5A33A 3T0DA 1NE6A 2R042 4QKNA 4Q4X2 4OI4A 4ME3A 3SMHA 3T09A 3LSEA 4HN1A 4DO0A 2JIGA 3T4HB 2OX0A 1QNYA 4PQ9A 5JOXA 1YUZA 1IPSA 4HETA 1HXS2 1HV0A 2JEMA 1DP0A 1AR72 3OF1A 2WQ8A 1JOBA 3NKGA 1CAXA 4EWEA 2FDFA 3N9PA 1QJX3 1PVC2 1POV1 3AYAA 4NWWA 1GLHA 4XUOA 5CFDC 4AFAA 4BBRL 1OMIA 5FQ0A 2RV9A 5H9QA 2O8OA 5C8WA 5GAEc 2WQZC 1NLSA 3TYJA 2BRTA 1W6PA 3WW4A 3ZMOA 5EYXA 1D2QA 1ULCA 2IXLA 2IZWA 4IE0A 4CP1A 4XIKA 3WR0A 2TUNA 5KC6A 2XLFA 4TN7A 1JZ6A 4Y22B 7RXNA 1F2NA 3M3QA 2BBAA 4HPKA 1B2JA 1J1TA 1MQTB 1V6KA 4NAOA 4IE5A 3RZOL 3S17L 1H4HA 2ZPXA 1OI6A 3ZYPA 5FIXA 5K9YA 3U4SA 1OF4A 3GTJL 1W03A 4HONA 5FP3A 2VUCA 1U0AA 3IIAA 3OSDA 4HVRA 4ONUA 3TAYA 3HOYL 3NNMA 5HXVA 4L92A 5F3CA 1MS0A 1RMU1 1VALA 4MO3M 4ASKA 5FLJA 2BYVE 4LUMA 4AL9A 5C5UA 1KQRA 3K4DA 1CIYA 3U37A 4A45A 1UN1A 1TWHL 1IPKA 1HB1A 2PLV1 2YYOA 1PX3A 1ZBE3 4ZN1B 5GLVA 4Q4V2 2R7ZL 2WNUA 2EIDA 2ZX3A 3U75A 3W59A 3I8TA 2LW8A 1SBDA 1UF2C 4LORA 4JGYB 4BHPA 1VBE3 5MFZA 1RJ7A 4FPGA 2ETEA 5CVRA 3VGIA 3W9AA 4Y26A 4AHYA 3LSDA 2ZX4A 4TWTA 4NRPA 5BY5A 4E6YA 1IRNA 2ZGTA 3JXSA 3BU7A 1RC6A 1VBC2 1LOGA 4LIVA 5F5CA 4OQ9A 1RUJ1 2WO3A 3FHQA 3SCGA 5JXIA 1VBA2 1UOFA 2XL9A 4D7SA 1D4M2 1NXEA 3GTKL 2CWMA 2RS31 3LWRB 4C91A 1LU2A 4WV8A 3ASIA 3INAA 4HBNA 4OI1A 3RWNA 4XXBB 3PIP1 1GZTA 4GWMA 4MADA 5L19A 3U4XA 1DG6A 1LOEA 3RWKX 3RYGA 4A3BL 1NY72 1OPOA 2WFF2 5LA2A 2GNDA 4CDUC 4MGTA 1BFYA 1IS6A 4AR6A 2FZ1A 4D6QA 5IWFA 2R072 5L9BA 5JWPA 4Y5Z0 3N9LA 2VL4A 3LKJA 2DBIA 5KHGA 1OUXA 2CGPA 1KJLA 1WGPA 4EN9B 1YQ8A 4YM2A 1PFYA 2WB1P 2VZOA 4XW3A 1LOFC 4K6BA 4JKLA 1YXWA 5C44L 2D6OX 4KU8A 5A7OA 5C4XL 1RUH3 3CF6E 3CU7A 1WCDJ 5IW0A 1FYUA 3ZN6B 1EPZA 2ZHNA 2WYFA 2ZA9A 1ENSA 1GNZA 1QJFA 2UU8A 2EICA 2X5IA 1PNFA 4MGSA 4YFWA 3MF6A 3D6EA 5IJRA 2JE7A 2ERFA 5KXBA 5JCTA 2DUPA 1PZ8A 2BU9A 5FZ0A 5CISA 3FE5A 2CV6A 2E51A 3HR9A 4Q4Y1 3OPWA 3S5AA 1R091 2CDOA 3VHOA 4CEWA 2B8MA 1JYIA 2IC1A 2YHJA 1VCXA 4V1PA 1V70A 3SS2A 1QGLA 1QOOA 4EWAA 4Q4W3 2R1DA 1MACA 1UZ0A 1EUUA 1OH4A 3H8RA 1LESA 1GP6A 2Y0SP 2VUML 1QQP1 4HSLA 5CKMA 2QQJA 4AEKA 3WQ1A 5FUPA 2NMNA 3H7JA 3WNLA 4L99A 3AZWA 2YU2A 2XR4A 4L9BA 2H6BA 1LU1A 4LBJA 4RGKA 1VAMA 5A1FA 2X8KA 5F6KA 1W06A 1OF3A 4QQLA 4AEDA 1UO9A 1VRH2 4CDWC 5K8SA 3D0SA 2RS12 1N47A 1VAVA 1YI7A 2W9XA 3SC7X 4FPLA 3ZFFB 2JWPA 5JVG1 5DDJ3 5A3MA 3AKRA 3IPVA 3GHMA 4QXKA 2Q5TA 1NE4A 3OCPA 1F5FA 2TBVA 5FMCA 2RDNA 1WA4A 3B01A 4QPIA 2XHNA 1V6IA 5M3ML 1CN1A 3ME2A 3MIGA 3ZSLA 3S1ML 4E4ZA 1ULGA 2QDRA 2VH9A 1E8JA 1WLCA 1DF0A 2ZEYA 4WM7C 1WW4A 2UWAA 3ITQA 5LY1A 3ETQA 1HW5A 1OQEA 1IS5A 4LK7A 1REEA 1HN0A 2GSYA 5M0TA 3K75B 4IESA 4KGQA 1E5HA 1KJRA 4FFGA 4POFA 1G7YA 2PHLA 3OBZA 4SLIA 5FZ9A 4GWNA 1TMF1 1H6YA 2OZJA 3PL5A 2UYAA 3UGFA 4BISA 3MLKA 3IAPA 4XQDA 1OUSA 3ES4A 4JCKA 1QYBA 3H99A 3JBG1 1LULA 3DECA 4ZPIA 4HT1T 5FZFA 3N4MA 1DCSA 5E89A 4M3CB 2DVBA 2WS92 2A3XA 4QHBA 3WEZA 3F2ZA 4Q26A 1APNA 2D43A 3KZ4C 5FZLA 3O1PA 2LS6A 2HJIA 1OA2A 4EWDA 1CIWA 5I8YA 1UIKA 1QIQA 4YG0A 5EWSA 2VMCA 1RUF3 2DVGA 5LBEA 5IYBL 3ES1A 5SV8A 5C9AC 2CWSA 4XXAA 5FY9A 4PDWC 1A8DA 1I6XA 1ZBA1 1PK6C 3P2AA 4CCKA 4Q8KA 5H1Sc 5A6XA 4NPRA 1FXZA 1V6NA 5JOYA 2FDKA 3J4UH 1LGNA 1W99A 3E97A 4JRLA 1S2BA 1AJOA 1H2NA 2WT1A 3DXTA 4OHXA 2OA2A 3M4OL 2VBDA 3ZXDA 5IFPA 5J36A 1H0BA 5EINC 5KXDA 4RHV1 1BXHA 1X33A 2QVSB 5EIYB 2DTYA 1OVSA 3NAPA 1K5MA 3FLPA 3JZVA 5FDBA 5FYSA 3S2HL 3I2OA 1LKMA 3WDYA 4N43B 3H3UA 1JHJA 4A3CL 5EFUA 4MLOA 4JGZA 5FO7B 5FOJB 2ZXQA 1PGSA 2E6VA 5CKQA 4AR4A 4A3XA 2AGSA 1SMUA 2OS2A 1VPHA 3UYJA 1QJU2 2RM21 4L8QA 1SCRA 2UY8A 2C0ZA 2ZGLA 1UU6A 3WY6A 2JG9C 4ZONA 3RMYA 5LK7B 1FOD1 1UW8A 3VZLA 2W47A 3HKZP 3J7NA 3VBFA 3S6PA 1A8MA 4CEYB 4CDQB 3V0BB 4P9GA 3WG3A 1TWGL 1PMHX 1V9U1 2CGNA 3OY8B 2BZDA 2PHWA 2FCUA 2K46A 3MUZ1 2RDSA 3WLUA 4B4PA 4DRVA 4RR3B 4QB1A 4LHKA 2W0XA 5FPZA 2R6QA 4HK8A 2VOKA 2DCZA 5JSRA 1HRI3 4RS5C 2PAMA 2AC1A 2M4YA 3DPRB 4U36A 5AI3A 1SEFA 4I0WB 5FPVA 4AI3A 1KGYA 5C3OA 5JZGB 3MIDA 1FMD2 3RZLA 5C33A 5DQ0A 1ND3B 2KXLA 2EXIA 3NNGA 1W8WA 4QPGA 1AR83 4LKDA 4PLMA 3FBYA 3ZFGB 4HVQA 4UFMA 2O14A 1W6NB 3ZYJB 5T52A 4AHWA 2B9VA 4QDRA 3WCSA 3O1SA 1WMEA 2WT2A 1QXRA 2QL0A 3LFIA 1GMMA 2UWBA 4XFBA 4AI2A 1FHMA 4A44A 3D5OA 4V2WA 4A41A 1CQ9A 1RMU2 3WDUA 3HWJA 4CPBA 1EV13 4Y3OA 4KWLA 4Z07A 4RQPA 1ULEA 3OGGA 1PHMA 8RXNA 3OGRA 4JHTA 5IHRA 3TBDA 3T1LA 1PZXA 2XQXA 4XEZA 4CP9B 5IK8A 2WZR1 1I3QL 4HZFA 4V2VA 2ORXA 1GZWA 3ZXJA 4IEPA 3WHTA 2Z3QB 3DYOA 4XZPA 4Q0QA 5IYDL 1VLNA 4K21A 1GICA 4AQSA 1EUTA 4UFHA 2EY4E 2XJSA 3PKJA 4XJUA 4CE8A 4EJRA 5FWJA 4RXNA 3KVAA 3S5QA 1W39A 3OBTA 1DYPA 2JB4A 4K9FA 4CVUA 4IW3A 5IP9L 2CKAA 3ZIWA 4D8MA 3CJIA 4XC9A 5F32A 3WQBA 2RS32 1UX7A 2CU5A 1ZRCA 1AL23 4GH4A 1RGSA 3G7DA 3OJBA 2JDKA 3K7AL 5DAQA 1B13A 5IK7A 4EZ4A 3ZOIA 5FZ6A 2HWD3 2W3JA 5FP4A 5LK5A 4PJYA 5KWRA 3I4ML 4HSJA 3LZZA 4ZS2A 2HWC1 1PZ9A 4FAHA 1SBEA 1RUD3 2Z3RB 2M6OA 5CNAA 4TXWA 4FPCA 4UT5A 2NLRA 2PMWB 1PZ7A 4HOOA 1ODMA 4MXWA 5DZEA 1DGLA 1MEC3 2VAUA 4O9GA 2QCSB 4B1LA 2RG4A 3H50A 4H7LA 2VECA 1W8TA 5D8AB 3K4AA 4Y52L 5FMBA 4O61A 1LOCA 4Z2AA 3KV6A 4BOWA 5T50A 3JB8A 4IEYA 1Z7S2 4MGQA 3VBOC 4UFKA 2RDRA 1VMHA 3O0XA 3LQCA 3I59A 2VZVA 2W94A 3CO2A 3RJRA 1HB2A 5FZGA 4FOWA 4BQXA 1UCXA 2YFZA 1ZZ6A 4AI1A 3GBFA 5H9RA 1E5SA 2C26A 1SMMA 1LAJA 1CGPA 4OUMA 2VMGA 1I5PA 1GV9A 1QQTA 2RMU1 2VUJA 3FC0A 1A78A 1I1EA 2PSMC 3CLPA 3I2JA 4RFRB 3PMEA 4IEZA 1POV3 2BGCA 4RYDA 1QWRA 1FATA 2NVYL 3ILNA 1GFF2 5A32B 1QQP2 2UWCA 2DU1A 1COV3 1ZVFA 5DG2A 2ZKLA 3HQXA 3C7HA 5FZ8A 1IS4A 4IEQA 3WX5A 3J26N 3ZN4A 2DV9A 4FSJA 4IV1A 1RUC2 3FHIB 1IPJA 1B35C 3JD71 1LR5A 3FLTA 3RS6A 3NJVA 1FNZA 1RUG3 4IV3A 4XBQA 4DEVA 1TWCL 1C8M3 1DGRN 4YW7A 3T2TA 4QB2A 4CCJA 1Y1WL 1JU4A 1UNBA 3AP5A 4R4XA 3WCRA 4XBLA 3BUCA 3S30A 1W3VA 1W8OA 2FD8A 2PN5A 4CUCA 3RZDL 1WA6X 2VE1A 3RPQA 1RITA 4LO6B 5A33B 4BA6A 1GZCA 3PUIA 1C1LA 2BNMA 3KT4A 4JTOA 3KYYA 1W3XA 1S0FA 2IFWA 3N9OA 2P6CA 3SH5A 2DBNA 1PO13 4Y1UA 4CTEA 5CFCA 2QQMA 3LPEB 2EIEA 4XCAA 2JA6L 1RB8G 2PVXA 1AYM1 1CZTA 4LBMA 5D21A 3WHUA 5K0UA 3IB3A 4Q4X1 5FKBA 3WF1A 3WUDA 3C7GA 5IVYA 1L7RA 2GH8A 2KA3A 1VB2A 3KF3A 4N53B 5KR7A 2FZ2A 2B45X 4URAA 2HWF2 1IOAA 4JDNA 2EIGA 4XDPA 2LUWA 2R1BA 1J3QA 3THDA 1RUJ3 2G4IA 4YVWB 1H2MA 4Y1YA 1S1AA 1BJQA 2Q30A 1AR91 2ADEA 3LWCA 3P5BA 5I8SA 2DCTA 5GAHc 1XOYA 3QLQA 1O91A 1OVPA 4QX3A 4CU7A 3A21A 3DYPA 1W9SA 2QQKA 1ND2A 2GMPA 3WXPA 4BMEA 2J1EA 4CUAA 5LW9A 2HWB3 1YYNA 1PIV2 1TME3 4LBQD 3RMXA 2VZQA 4LNVA 3M3IA 4BLIA 1IQAA 5I91A 4P9JA 2QQVA 5L73A 1XU2A 1ZYBA 3VDDA 3BVCA 5BNQA 2GN7A 1BBT1 2GALA 1WWYA 5LA1A 1PNGA 2NMOA 1GUIA 2W91A 4L0PA 5KHHA 4BB3A 2BDRA 2ZEZA 4JAAA 4LXLA 4X8NA 2NP0A 4XETA 2P1BA 1JOJA 1HN1A 1R093 3R0RA 2QDNA 4Q4V1 1YLLA 2B5HA 4QKFA 1C57A 5ANQA 4FAGA 2RM22 2ZX2A 2R0HA 2RR13 1STMA 1W8ZA 5F7UA 2A70A 4JAFA 4H55A 5A3OA 4NE9A 2JKXA 3O5SA 4JQRA 3ZXEA 4QQ2A 2DYCA 1VBB1 3E6BA 1FOD2 1XJAA 3THPA 2Q8OA 1XXNA 3AMMA 2AH2A 3NV1A 4I02A 1QHDA 1MQTC 1V9U2 1VBA1 1LHVA 3C7OA 4JRAA 3PKIA 1D4M1 2A6ED 6RXNA 1BQPA 3AMQA 4M4RA 1NA1B 4HFSA 3RJ2X 4JKMA 4BK4A 3GJAA 1OH3A 2C1FA 4LEJA 4DUVA 2JDAA 2ZIXA 4YWMA 2B4KA 2XQRA 5CFDA 2W1UA 3LIHA 3URFA 3RZMA 2YGLA 2WFF1 1NY71 3NNJA 2AR6A 2I74A 1R0IA 3S14L 2EF6A 1LENA 2N7GA 3ORJA 1NCRB 2J1RA 5T3NA 2R071 5C70A 2XPJA 3DKQA 4GKYA 3ROUA 1N1VA 2ZHMA 2ZGRA 3V64A 1NXMA 3BN6A 4LITA 2YU9L 3B3QE 1L3JA 1LKOA 3FFZA 2OYZA 4JC1A 1XNBA 1Y7BA 2BEOA 2OQ7A 3B94A 4ASMB 2GU9A 3K46A 1OKQA 2VOWA 1XNDA 2ZHKA 4JGYC 1D0HA 4XJZA 3G6JB 3CNAA 2ZJCA 2OW4A 1SPPA 4LBQB 2JG8B 3S1NL 1PO21 4X6AL 4MYEA 4M00A 2CYFA 4ARXA 1ASJ3 3POGA 1T9PA 2V4VA 4E4SA 2ZAAA 4R52A 2AZ5A 4UYBA 1XQNA 2MEV2 3Q8BA 2JI1A 3HBZA 4IUGA 4C2M1 2WIIB 2XBO3 3J9SA 1V0AA 1D2SA 2IUWA 3KCXA 3OUHA 5FLHA 3TN93 1TMF3 5DXDA 2ES3A 3V56A 1SACA 3APBA 3O1TA 2HKXA 1HX6A 2Y6LA 4BJ0A 1EAH2 4GB31 3POSA 2MNGA 5HCFA 1KDMA 3I3QA 1ACCA 4J6GA 1ULFA 4IEOA 4A3LL 3ALQA 3GBGA 5I0SA 2QQOA 1W05A 4FFHA 4G6BA 4LHNA 1DX8A 2BVVA 2ZGKA 2YROA 2W92A 4RGGA 1WBFA 2BV4A 2NPIA 3L2HA 5DAVA 2IFRA 5C5TA 1JU3A 1YI9A 2BNNA 4DFSA 3ZSEA 3RYPA 3HQRA 1VRH1 3I4IA 2JENA 3WW2A 3EB7A 5AC92 5J37A 1ZBA3 2GZWA 2OUHA 3I2DA 5HXMA 1DHKB 1LJ7A 4YW4A 1VZGA 3ZKYA 3C2UA 2FCTA 4IGQA 4MGKE 2WAOA 4KMQA 1J83A 4NIIA 3WF2A 3MICA 2VCBA 4Z1VA 2ENRA 3IAQA 5DAPA 4B7EA 3BOPA 1UZWA 1LOFA 1D0GA 4I0AA 2VMDA 3IBMA 4PI2A 3P6BA 4LHLA 3ECQA 1BEV2 5LBBA 4A3ZA 1OWCA 3QACA 4BQ2A 4A3EL 1NT0A 2B46X 5CAZA 3BTYA 3ZSMA 1YQ6A 2CGOA 2Y6GA 4GZ9A 4OMCA 1YFXA 2BPA2 3N7JA 4X6RB 3LDBA 3B69A 4YGCA 1SDDB 1JHNA 1CAWB 4KWUA 4Y24A 3NJZA 3VB9A 2QQLA 1C09A 2WNVC 5L9RA 1YUXA 2H12A 1PGL1 3ZPYA 1T9QA 3KHBA 2IXJA 4CP0A 4XUTA 1J58A 1NQJA 3B5LB 3MHZA 3ETPA 4Q1RA 1S0JA 2UYBA 4AQTA 3ZFFC 3BOWA 4LBKA 1W9YA 1ZX5A 2ARXA 4EROA 1U5ZA 3QCWA 2D6NA 4LA3A 2VY0A 2NVQL 4DIQA 3GTML 3AKSA 3ST7A 3WG1A 2BWAA 1N1SA 4O65A 2BWCA 3Q8AA 2JE9A 4YM3A 2AUYA 5I93A 3LAGA 1W6QA 4XVHA 2WKKA 4ARYA 1RINA 1GR3A 3HOZL 1ZBE2 4QQPA 3R4UA 3JD72 3S7EA 3ZFEA 3VLBB 1RHI3 5EJ1B 4CZSA 4CDWA 5A6ZA 5A3WA 3FFQA 5A7QA 1O4YA 1R9TL 1OQ1A 1XNCA 3BPSA 2XB6C 3FUOA 1H4GA 3GNEA 5LB6A 3SISA 1KFUL 2Q1ZB 1C5IA 3N3HA 1AF9A 4NHLA 2GH2A 5E1RA 4AGRA 1JYTA 4TTGA 4UFJA 4AR5A 1G9BA 2G9GA 3THCA 4ES8A 3MW2A 3JCIA 1TQ5A 1YHFA 2PHDA 4G4FA 2ERJA 4JADA 1REFA 3TOJA 2KN9A 3AXEA 3OB8A 3R4SA 4QXBA 4CU6A 3PURA 4HG6B 4WM7A 2JDUA 5CZKA 1KD7A 2Q0AA 1UPSA 1W90A 2P2KA 1UMZA 4K40A 2C6AA 4XJWA 5ABJB 1QJU1 4PCRA 3T08A 1H9WA 2VOXA 3O12A 1RTVA 2WC2A 1RDVA 3WDVA 3VD3A 4BM8A 1V6OA 3GM8A 3JQWA 4CCEA 3WNNA 2R063 2HBTA 2A1XA 3ZSKA 4WVZA 2D6MA 1R0GA 4E4DX 3LF7A 4QPYA 5K4LA 1LGBA 1VAKA 1HRV3 3H0GL 2WZEA 1AR92 1UIJA 5K2ME 1UOJA 2WYSA 3M3CA 1QF3A 4XMIA 4WZFA 5FP7A 5FZ3A 1YK4A 4PIZA 4YPJA 2PA7A 1RUOA 3D8CA 1WCQA 3OEBA 3ZKUA 2Z69A 1CD3G 3MIFA 2A5ZA 4XPVA 3NFPI 1AUYA 2HWC3 2VBPA 3I3BA 2XUEA 1GP5A 3KS7A 1V00A 2B7YA 4BXXL 4FPEA 4N43C 4R9DA 5FPXA 1VIWB 4FTEA 3KMHA 2D6KA 3NO8A 3LOIA 4WVWA 1QH7A 4M0NA 1FMD1 2ZBJA 5C9AA 1M06G 2PYTA 4PDWA 3GTQL 4P08A 1PK6A 1Q3EA 2VD7A 4KG0A 4NJ4A 3TEXA 5BNNB 3RZKA 2NQYA 4HKOA 2Y6FA 3MLLA 3SEEA 5BNOB 3POYA 1LECA 3IN9A 1FV3A 1YRZA 4PT6A 1BBT2 2CAUA 4CDQC 1AJKA 4AI0A 4CEYC 2BGOA 1CAVB 1GZWB 1S0DA 4WVMB 3VZKA 1OQDA 1IQDC 5LATA 5JVVA 4BQYA 4JDMA 2VTXA 5JPNB 3POIA 2FDJA 4NOTA 4UW6A 4W8JA 3UGHA 2YG0A 2LRPA 4XUPA 3ON7A 4RR3C 3PJYA 5FBZA 3DL3A 4QX0A 4K9SA 3SKJE 5DDJ2 3BTXA 1K45A 4D0QA 1CWPA 1W2NA 1MZ5A 1B2OA 3PZAA 3LWQB 1JXNA 4FVVA 1GWKA 3M4FA 1XYOA 2Z5WA 2OIIA 1AXZA 3DPRC 3NJXA 2NVTL 3BCWA 4NRQA 1SZBA 5J48A 1VBB2 5JZGC 2E2IL 4YZ1A 2AYHA 3AYDA 4IE7A 1ND3C 1PMJX 1ZRPA 2RS51 1YNAA 2VGDA 1L7LA 1YEWA 2QFEA 1Y9QA 1BK0A 4UF0A 3ZFGC 1K42A 4AVCA 3FHAA 3AJYA 4A7YA 2XWBB 4YZ5A 2V0EA 2VMIA 2D5FA 5DMYA 3OD0A 1MVEA 5GADc 2LTNA 5L36A 1LODA 2HR5A 2EAAA 4YZ2A 5RXNA 4B8CD 1LOAA 1UY0A 2CNAA 4FP3A 1RUE3 1UU4A 3Q8CA 4FOYA 3U1XA 3ZX7A 2YPDA 2DUOA 3POBA 2ZMNA 2PHUA 4RS5A 2ZABA 4MGYE 1T2XA 1VR3A 1LTEA 2BJSA 5F8PA 4A7ZA 3B0AB 4COVA 2PMZP 3RZ6A 1RVF2 2WSVA 2WLQA 4DXTA 1NZCA 4ZHNA 3SXWA 4F3JA 5JXJA 5FYTA 4Y20A 4M01A 3EBRA 2YMZA 4Q0VA 2ZGPA 5FYMA 2HEYF 1W0NA 2XLAA 3H1WA 3CQZL 3VZJA 5M3FL 1GP4A 1PO22 1FPN3 1Z7S1 1UPIA 2W46A 3VBHB 2ZGNA 3RDIA 4XCBA 3ABZA 2HLEA 4FO9A 3GZAA 4NIDA 3HOUL 3KB5A 3RG0A 1LB2A 3AM2A 3VKOA 2R043 3AC0A 4HLTA 5JR7B 2JI2A 3SNMA 4K8FA 2RDVA 4OYUA 2DF7A 4GWJA 4GB32 5GM0A 1QJY2 3VL9A 1F8VA 3K2OA 4QB6A 3IU3I 1GKBA 4Y5TA 1HQNA 1HXS3 4A7KA 1AR73 1TNRA 2VJXA 4GULA 2QBXA 5C8CA 4NROA 3RZTA 1WMFA 5FYYA 1PVC3 4LBOA 1W2UA 5FZCA 3U10A 3RFRA 3NMBA 5EYYA 1US2A 3DN7A 5D8AC 4B3NA 4A42A 5LA0A 1YIFA 1VZHA 1DZRA 2WNVB 2ZCWA 3Q8FA 4CCLA 3FUQA 3S57A 1UOGA 3RSJA 2BUKA 1RUC1 5FY5A 3RI9A 5DZGA 2DDUA 3N9NA 1BQ8A 3BODA 3T1MA 2GNTA 1SLBA 2VZ3A 4W6YA 2V5YA 2VOTA 4AAPA 1Q8PA 1VE0A 2JJ6A 1GNHA 4DQAA 2DVFA 1RIRA 3GDBA 3IDAA 1O3RA 5HV0A 2WJSA 3USUB 4CDXB 4EV0A 4AYBP 2I2SA 2X53S 4LMFA 3VL8A 5DPNA 4AZZA 3H9BA 5JSPA 4NN0A 1V6MA 3MV01 1F15A 3QQCE 4GA9A 4KL1A 3GALA 1WBLA 2XUMA 4G9SB 2B5ID 5LBFA 1JZ4A 1HJGA 2WWJA 4YW6A 4IDZA 2JD9A 2L9LA 3EYPA 2VZRA 4BBSL 3NV2A 3VBOA 3C7FA 3WP4A 2X29A 1SG3A 2Z4FA 1X36A 3FN9A 4TPUA 3S0MA 5FZ7A 1HRI2 3UJQA 5J7MA 5EJZB 3T0AA 2OVUA 1PGL2 4QGMA 5E16A 2VTXJ 4QDQA 2R7EB 2ARBA 1H1IA 5FAXA 3OGJA 2Z42A 4P00B 4PI0A 2DFCA 1CPMA 2FCVA 1IKPA 1H9PA 4BPZA 2HWF1 4OHZA 1VB4A 3FJSA 4FTBA 5C4JL 1VBC3 5EP9A 4BZ4A 4WZCA 4YARA 4AQ6A 1VBA3 2R49A 1SCSA 3HT1A 5AI2A 1D4M3 2JDNA 4YSFA 2CTVA 5GZDA 1NYWA 2SLIA 3RZZA 2CHHA 2E53A 1X8EA 5CADA 4W50A 1JH5A 4UAPA 5FYZA 1CX1A 2GC0A 2J1AA 4KBBA 2J7MA 3KLSA 4AYUA 4DXRA 4FPHA 4KI5M 3IM0A 1TWFL 3WZ1A 1WCSA 3EHKA 4PBOA 1GWLA 3CBNA 3S2DL 2R073 5GALA 1B35A 1QKQA 1UY1A 3ATGA 2M6PA 3H1YA 3WVJA 3J7MA 2DURA 1PIV1 4GS7D 4I09A 3PVBB 4CRQA 2HYKA 1W2OA 2ARCA 3HPNA 2YUEA 1I9RA 3ACHA 3UJOA 1AYN2 4ZXKA 1Y43B 4B4RA 4BCUA 3RRDA 1R1A3 5A3UA 4N53C 2JDZA 4JHZA 5JXGA 3A0NA 4AVTA 1PM7A 1WCUA 2G9ZA 3OPZA 4FXGB 3PJQA 4MUVA 1DFQA 5FBJA 3AZYA 1KFXL 4QX5A 4YVWC 3N36A 4DEQA 1C5HA 2HWD2 4FBFA 3GYDA 3KYVA 2ZOEB 2RJ2A 4EN0A 1IKQA 2YBPA 4OUEA 4NMIA 5LZ6A 1NLQA 5I8TA 3VBRA 1RUD2 1NXGA 1YV1A 2C5DA 1VZIA 2VQTA 1CR7A 1T9OA 3JR7A 1XPWA 5DG1A 3RQ0A 5JAXA 5JIUA 3BGAA 4FT8A 3O1RA 3WDTA 3R05A 2AENA 2JI3A 5T5PA 4DUWA 2E63A 3FZ3A 3HAGA 2ZGQA 4LQRA 4RA0A 5M5WL 3RZJA 1WJVA 2K0GA 4C3JL 3L9JT 1SHWB 1W6OA 1BE7A 2XKPA 4DINB 1NX9A 1D4VB 1R083 4QAWA 2HWE1 4PBPA 1QOSA 3EJKA 4W4ZA 2BP6A 1VRH3 2C6SA 2XH6A 1ENXA 4GIQA 2RS13 1VBD3 1X50A 4XF0A 4K20A 3UK9A 1G6NA 1BRFA 1QXPA 4E9KA 1DZQA 3H8XA 1SPPB 3VKNA 1K83L 4XGHA 2JKBA 4LIUA 5ACA1 3BU0A 4YRDA 4D3WA 5L7OB 4D7TA 1CAUA 1WW7A 2WZ8A 1ENQA 4KG8A 3TEWA 1URXA 4LULA 4N8MA 4OCTA 1DIWA 1ULDA 2BOJA 3MIHA 4O9EA 4WM8B 4XF1A 2Y6KA 4XIOA 3UV9A 5IY0A 1NNQA 5FJHA 3VBUA 2RVAA 1BMV1 2Y38A 5KC5A 4P5HA 4C1WA 5FPLA 1IU5A 4XYXA 1RUI1 3PUHA 4MX3A 5E88A 3ZR6A 1NA1C 1Y9GA 3KQRA 1B71A 2MEV1 2ZACA 2WNEA 1R64A 4IXLA 3PIJA 3LA7A 4HANA 5FR3A 1AHSA 1RUG2 4IE6A 4INDA 3H8UA 3JB4C 3MF9A 1EAH1 2HBUA 1C8M2 2CKCA 1YQCA 4A3JL 1NCRC 1VMJA 4FQ4A 2K2SA 2LROA 3HOWL 3ZIXA 2NN8A 1MR5A 3EO6A 3ZXGA 2YXSA 2BQPA 1UKGA 4ZU7A 2RS52 2WS93 1YC61 4Y22A 3LEKA 2VVDA 1MQTA 1MS5A 4BIFA 3TRSB 5J3UA 4CCDA 1FV2A 3LOBA 4TZDA 4A93L 1PO12 4MZUA 4NIAA 1LEDA 2A7AA 2DVDA 4PIYA 3VBSB 2JG8C 5F2SA 2D3PA 5GJ6A 5FZOB 3H3VM 3NVCA 4X6QB 5AC91 4NIGA 1W8NA 3OYWB 5C4WB 1K5JA 2VULA 3FKIL 4M0HA 2YGMA 4FP2A 3GTGL 4JZRA 1NUKA 5BNPC 2GAUA 1UMHA 5A7NA 3WNMA 3IT8A 1AVBA 3SLIA 1NCQB 5A7WB 5LEKA 3SITA 4XJ8A 3KV5A 2G19A 1DQ2A 1XRUA 2R30A 4XDOA 4BQ4A 1U5XA 1BEV1 4JGYA 4XUNA 1QJX1 4C3HL 4LJHA 3NW4A 3HOVL 2Q8DA 3AL5A 2E7AA 2D5HA 1AR63 5FY7A 1YFUA 3LDKA 1Q8SA 2ZZQA 4C0HA 1O7FA 4MGIE 5M5YL 2PFWA 3GCWA 3VUOA 5FKCA 3GF6A 4AHZA 1JUHA 3K77A 3VN4A 4FFIA 2HWB2 1DGWX 1VMFA 4QMAA 4D6RA 1TME2 1UYXA 3HBKA 4QX1A 3AVRA 3VD5A 1S0IA 2Q8CA 4HVOA 4NIHA 2Y34A 4A3DL 1GWMA 3DCQA 3M70A 4IGOA 4RN5A 2Q8EA 1QXJA 1JUIA 1JS9A 3OBAA 4BY1L 1Q43A 4R9CA 3I2GA 4I01A 4YG3A 4NPMA 1OOPB 2XDVA 3MI8A 3H8OA 1N3QA 5SV5A 3HT2A 3TNPB 3KV4A 2P4EA 4YVSB 1PGW2 3O1UA 4E2QA 4XF3A 3B02A 1DBNA 1NOVA 2VNOA 1YWKA 3GZEA 4LBNA 4XHXA 5FXVA 5FP9A 1TVGA 4P14A 5A7SA 1D7PM 1ZZBA 1GOGA 5GZFA 3UKTA 2A6ZA 1X82A 1FX5A 1ZBE1 5DN2A 4IQPA 5FXWA 3ZN6A 4AGGA 3J7Y1 3M3YL 2E7TA 2XLGA 1DYKA 4Z2WA 2VO5A 5JMOA 3H9CA 1LHNA 4DUXA 1XNTA 2PHRA 1IW7D 2OPWA 1O5LA 2Y8KA 4HL0A 2EXKA 1VBE1 2PAKA 1Q56A 3I3EA 3PHMA 4OULA 3IDBB 1PFVA 3BB6A 3WQ7A 5I0DA 2WO2A 3V0AA 1G86A 5KHIA 2W5FA 4GMP0 5CKNA 2O1QA 3MW3A 2H0BA 1XB9A 4N9HA 1W9FA 1NZIA 4GXLA 1RMU3 5FYVA 5T5OA 4UW3A 4D69A 5A3PA 1UYPA 2P5BA 3BTAA 3B00A 5JIAA 4LKFA 3MUY1 4XZUG 4B7KA 4QDSA 3MLJA 2P3JA 1MVQA 2PLV3 3HJWB 3VD7A 3A44A 1Q8VA 1XSRA 2GP5A 3OUJA 2I45A 2A6VA 4KBZA 3WF0A 1XU1A 4Z92B 3RVHA 1H8VA 3NSTA 1UOBA 2FMYA 1Y1VL 1LTLA 3JU9A 2RFKB 2WN3A 3AFKA 3D82A 1QU0A 3VZMA 3LB9A 3VDAA 4E2GA 2VNGA 1CAXB 2WZPP 4R9AA 2XJPA 1C3HA 4DOUA 3ZVXA 4AVVA 3KD4A 2WQ4A 4YM1A 5JLVA 2CAVA 4YG6A 2E31A 3KT1A 2GMGA 5ERLA 5FQ0B 3GTPL 3WT3A 1KS5A 3ZFFA 3LCPA 1UZYA 4ES9A 1SDWA 1W6PB 3NV3A 1RUH1 5GAGc 1W04A 5G05L 4DZGA 1RYYA 4CXXA 2RS33 2Q1MA 3LNLA 2F4PA 3AYCA 4L11A 1TEIA 1ZZ8A 4KWKA 4LR4A 4EYUA 4Z8BA 2JDPA 2RE9A 1HIXA 1S55A 1XBFA 4LPLA 1ASJ2 1FNYA 2VQUA 2KD7A 4S2DA 5FMDA 5HCAA 1YO8A 4HPKB 3KV9A 4PLNA 4S2FA 3PLQA 3EMRA 3M3EA 4OZXA 1Q5OA 4COWA 2CL2A 4PHZA 1O6UA 3NRUA 1TZOA 1OA4A 2P17A 1H8TA 5ABJC 3HEIA 2CY6A 5FZHA 1M4WA 5JOWA 4YZ3A 3ZXLA 3I3MA 3I54A 2OUJA 2XMLA 3AJZA 3EXUA 1C1FA 5FXZA 3T2QA 4XFCA 3CZJA 1O3TA 2WNUB 3PTRB 3TWIA 2D6LX 3RYKA 2ET1A 4BLJA 3H7YA 1UD1A 4LTAA 3WNOA 4B1MA 3B9CA 3P1IA 3WWNB 4GALA 5EJ3A 1XNKA 1I5ZA 4Q29A 2Q1FA 2V0FA 4Q4Y3 2BW8A 3E5QA 1H1MA 3AXDA 1SLCA 5DDJ1 3FMGA 4R8HA 4C1XA 3A0KA 1E5IA 3I7DA 1W8UA 3WP3A 4XDQA 2FBEA 3KYWA 1KDKA 3HNYM 3ZSJA 1CX4A 1UY2A 1NG0A 1X8MA 3J7LA 5IAXA 3I2FA 2VW0A 1LHOA 2FMDA 1X7NA 4Q5OA 1ZRRA 4GD4A 5A6QA 1QQP3 2DCJA 5DAXA 2VZ1A 4POGA 2TNFA 3I2IA 4K8RB 4BXFA 2QQPA 5BNOC 4XF4A 3AL6A 5FYCA 3HJRA 2W95A 1RYTA 5AVPA 5MF6A 2HWE2 3IMMA 2ORZA 5CBLA 1PX4A 2CR8A 4GAZA 4BXSV 4IEVA 4S2GA 2VXRA 3VKLA 3B9IA 1DU3D 1OPMA 4ZY9A 2PHTA 3QBQA 3U78A 1HQLA 4LE3A 5M5XL 4N43A 4QQOA 3ZDSA 4AF9A 1CZSA 1AX0A 2X5IB 2NZ9A 4QKDA 5IUQA 5ACA2 1QJZA 1RVF1 2V09A 3ZYBA 4JVAA 5FZMA 5FO9B 2A75A 4UFLA 5FTTC 2XJVA 1F31A 2KM2A 2ZKNA 5DM61 4PLOA 3PDQA 2ZAHA 3KCYA 2DUQA 3KSCA 2VMFA 2W1SA 4XQWA 1BMV2 4D7YA 4CEWB 4CDQA 5IVJA 3P8BA 4CEYA 4LKSA 3V0BA 1W2AX 3J8F2 2YBKA 4MG2A 1RUI2 4LBLA 5IAVA 4EN6B 2Y0IA 3Q9OA 2XJTA 1RUF1 2ZHLA 2G1MA 2VTFA 5KXCA 5FFOC 1RHI2 2MHFA 1OD5A 5C8CB 5IVCA 2EIBA 4LO8A 4AFCA 1S30A 4N90A 4FOQA 2A69D 4P5YA 2HWF3 1QJY1 1JZ8A 5IVEA 3PO3L 1ZM1A 3LWVB 1DQ5A 2WL1A 3JBG3 2XXZA 3A23A 3POJA 1LHUA 1GQGA 3USSA 3O1MA 5JZGA 2PQSA 1WMDA 3HJYB 1Y4WA 4AEDB 1ND3A 4CA9A 1OSGA 3OGSA 2EVXA 3A4UA 3JUUA 2BOIA 3ZFGA 3IPVB 2FQPA 2VZPA 1QNWA 2ZGOA 1W6NA 3D0JA 4KQ7A 4QIWP 4OHWA 4Y1VA 4RFT0 2A6YA 3VV1A 4E8CA 2FHRA 1GNYA 4QPIB 3VBHC 4A3ML 1TNFA 2YDEA 4MVTA 4CDUA 3UNPA 1PIV3 1PFUA 2JXAA 4FOVA 2J1SA 5T5JA 3V65A 1R0JA 5ISLA 1F4HA 3OTFA 4H7MA 2XL7A 1AZDA 3ZXAC 5G04L 4CP9A 2R062 3HIFA 5F2WA 1NQDA 1O59A 3PIO1 2AACA 4JQTA 4RHV3 4Q1PA 2E2JL 5CU1A 3GTLL 3A22A 1GQHA 3KVBA 4CCMA 3OUIA 1HRV2 1QJX2 2VNRA 2ZTNA 5GKAC 4K1YA 1W28A 3WWLA 1IG3A 4OHVA 1LGCA 3J7HA 4YW3A 1C28A 1V6JA 3BKZA 1HRI1 1S2KA 4NHKA 2C6BA 1JZ3A 1I50L 1UKRA 2RM23 2XOMA 2H0VA 4LHSA 4NRMA 5LWBA 2D3RA 3D4KA 3H97A 4ZU5A 5DM71 1BK1A 2FDHA 4NAMA 1FOD3 1LHWA 2ZEWA 1KEXA 2J1TA 1AR81 2R0FA 4ZS3A 1XYPA 5LBCA 5AFEA 4EE2A 1V9U3 2VMHA 2E9QA 4WBBA 3JQXA 3I2KA 2IXIA 2QUOA 2VUAA 4CDXC 4N7IA 3LEMA 1ZZ7A 3HN3A 3AB0A 3IDCB 2AEZA 5EXOA 1EV11 1OT5A 3FX3A 5D8AA 5FV3A 5J98B 4ZZ5A 1J3RA 1WCML 4CPBD 3KCCA 4AW7A 1WCKA 4GJZA 3OGVA 3WNPA 5J09A 3N7MA 5LCWL 4AOCA 3ZXFA 2I07B 3NAPB 5HBAA 1K5MB 4JKKA 1JI6A 2HH9A 5JI7A 5A6YA 1YFWA 1VBE2 1WLWA 2QZ3A 3PVOA 2W52A 2JICA 5FLML 1AYN1 3FLRA 2WDBA 2W2IA 5BPXA 4JGZB 4W6WA 1ZZ9A 3U14A 3E6CC 1EY2A 4YNIA 2Z79A 1XYNA 3LE0A 3VBRB 3OG2A 1S24A 2VCMA 2B9UA 4URTA 4Y33A 1AL21 3GJBA 4ZKTB 1GANA 2HWD1 4I30A 1S2EA 3THTA 5J96B 3O0WA 5A32A 3U11A 1UY3A 1YCIA 1CADA 2JA8L 4IETA 4P02B 5I0UA 2WZR3 1X9PA 2YFUA 1RUE2 4NHYA 3VBFB 5IT6A 4I2OA 1RUD1 4B8EA 3AKQA 2IXHA 1EAH3 4EQVA 3HOBA 3ZLIA 3IMNA 2JDMA 3WP6A 1J84A 3RZGA 1B09A 1BKZA 4XFAA 4YM0A 4YYOA 4AXOA 2D7FA 4F7ZA 5CG9A 3RYRA 4LO7A 3MPSA 2JA7L 3NV4A 3ZM8A 3LEIA 4E27A 4FPFA 3MO4A 3P3NA 1MS4A 4QD2A 4XUQA 5BNPB 1RUH2 5DUUA 2C9AA 4XHBA 1W8FA 1LNSA 2XG3A 3H9AA 1FPN2 1RL3A 5JVH1 5FWEA 1SMVA 2VZSA 3MZHA 1JOPA 4QPGB 3RI8A 2BVBA 5IP7L 2NM1A 1CAUB 3K3OA 5AFBA 4GWIA 4Q2FA 2YPJA 5FP8A 3UT0A 2FDGA 1P7PA 1N3PA 3VBUB 2R32A 3LFMA 3NNLA 5FPAA 4COUA 4GJYA 4IGPA 4ASLA 4GMP1 3GGLA 3GBWA 1IROA 3LA3A 2VM9A 2PYAA 4Q4W2 3MV11 5LASA 1EP0A 1I3HA 1KS4A 2P37A 4RL7A 4RQPB 1BEV3 1W8HA 2V72A 3PVNA 4FQZA 4N53A 3WQ0A 1YK5A 5DUXA 4DXSA 1COV1 5A7PA 2BTVC 3SEPA 3H42B 3KGZA 3AZVA 1IS3A 4K3UA 1QEXA 2P3IA 3KWVA 5AN9H 2KR2A 3POFA 4YVWA 4Q27A 4GKXA 1JYWA 1O8SA 1RUG1 1Y9MA 2RHPA 1ZREA 5FXXA 1AX2A 2ZMLA 5D1IA 2XKOA 3CJIB 5BV6A 1C8M1 1J1LA 1A6CA 2V73A 3P3PA 4F8AA 4J25A 2VC9A 4JTNA 4BQWA 1GQPA 2PELA 4GH4B 2RMU3 1E5RA 1YJLA 2JG9A 4QM8A 3TB0A 5FY4A 4A3GL 1BVVA 2Y0OA 2ZGMA 1G9AA 3VD4A 3AZZA 2HEVF 5L7OC 2O5JD 1S0BA 2CDPA 1LKNA 5FOBB 4CP2A 3IIIA 2Y60A 3B08B 1BVP1 4WM8C 1PO11 1XE8A 1SQ4A 1QY4A 4QGNA 4U671 2Y64A 4MXWB 1XNAA 4OLLA 3JD73 1FT9A 3C3VA 4MOAA 4CCNA 5C71A 2JD4A 5LEJA 3W5MA 5JPMB 4I3GA 3BPZA 3ZYFA 2LM3A 4J1WA 4AFMA 4KH9A 1JYNA 4Y1ZA 4CUGA 4XFFA 3NQHA 4XF9A 3BALA 5CG8A 4JAGA 3LPGA 4QM9A 3T0BA 2ADDA 3HMYA 3UESA 2ZX0A 3KYUA 4XFGA 2KKDA 3PWFA 1QDOA 2JE8A 2VXJA 3I59B 5IVBA 2VR4A 2BBVA 3H3LA 5FCCA 4XTMA 5FZBA 3ZG6A 3MSUA 3WDXA 4AEMA 1BLZA 3VHNA 1OA3A 2E7QA 2QQUA 4ZN3B 1UXZA 2JDYA 4OMDA 2TEPA 2X10A 1AYM3 2ZZJA 1LRHA 4UXAA 1DLCA 4CYDA 1RUF2 1PVXA 1NA1A 2VCAA 1GBGA 1OFSA 2Y33A 3VHRA 3AKTA 3SQOA 5CA6A 4Q4X3 2VBBA 2C9KA 3IKWA 2HWB1 2J42A 3VBSC 4ISQA 1TME1 3MDPA 2OPKA 2R16A 3IDEA 4I0BA 5C4WC 4BK5A 4A3KL 3NWKA 3RGBA 1NCRA 1OLRA 4ATFA 1J3PA 1R1A2 4IV1B 2W68A 1W9TA 4YWAA 5APAA 3ACGA 5FZDA 1AR93 5FK7A 1G8WA 1PGW1 1BHGA 1NCQC 3IZOA 4FFFA 1TWAL 3T2PA 4IV3B 3ZYGA 5FJ8L 5FPUA 4OVEA 5CEHA 1DQ6A 4H2AA 2JB8A 3T2OA
chains in the Genus database with same CATH topology
2XVLA 1R0HA 3V0AB 4LBQA 2JG8A 4KWJA 4DY5A 1H1AA 2RR11 1ONAA 4UW4A 4XFHA 4NHMA 5BNPA 3SCFA 5MGNA 2A73B 5CFCB 1W0OA 1SLLA 4IEXA 4META 1BBT3 1IU6A 4AK3A 4AQ2A 4LT5A 1Y3TA 1YFYA 5K0UB 3KYXA 1SLTA 4NWVA 3SHRA 1OOPC 1R082 1IZ3A 3ZFEC 4YVSC 4AVAA 1JBCA 1BZWA 4V196 1VBD2 4UBHA 1F9KA 4Q4V3 5H9SA 5IK5A 3B93A 1G9DA 4WFN1 5E8AA 1GZ9A 2VVFA 4B29A 1N1YA 5T55A 4UBGA 1VBB3 3MGUA 1JTZX 1AR82 4FTSA 1WLTA 1U12A 1UU5A 1J59A 4HMZA 1ND2B 4WVVA 5EIOC 1H8TB 1S2ZA 5JI9A 5H9PA 1ASJ1 1EV12 2WFF3 2ZMKA 4LE4A 3SH3A 1EYBA 3WINE 2V3BB 2EXJA 2ET7A 2XBO1 4XOGA 3TN91 3VDDB 4Q8LA 3WOGA 4HKLA 2VW2A 4U2AA 1H7VA 2VQAA 1CAWA 1RVF3 3N7KA 5IK4A 4YWLA 1FHHA 5DUWA 2D97A 1GYKA 4FPOB 4IEWA 1R0FA 3AMNA 4I3PA 1PO23 1W6MA 3WW3A 3DKWA 1AL22 4RD7A 3E5XA 3QH6A 4XILA 2O0OA 2PPTA 2EALA 1F5JA 4AG4A 1LKPA 3AK0A 1O4TA 3QOPA 1O5UA 3AKPA 3ZN5A 3UKNA 5JSOA 4GB33 1QJY3 1R1ZA 3QH7A 2PHFA 5K7PA 4MGZE 5F6LB 1MEC2 3ENRA 3OD4A 5CFDB 1YJKA 5I0TA 4N7UA 1MZ6A 4X8PA 4YW1A 3UKVA 1FI2A 2GC1A 1C8NA 3MIEA 4AHXA 4YFZA 5GLZA 1DGRA 1MS3A 2BFUS 3SCHA 1AR62 4AFBA 5FRAA 3NKTA 4EN8B 1HQWA 4AWDA 3VPBE 1YUDA 5A3LA 4NR1A 2WNUC 1W0PA 4R4ZA 4QGLA 4OI0A 2L0ZA 2ZGUA 3HN1A 4BIOA 2P3KA 3AMHA 4DY3A 2A71A 3ILFA 2UURA 5ABJA 1O4ZA 2W08A 4KGGA 2K2DA 1C4RA 3MPBA 5F1RA 3U0ZA 1T6GC 2AREA 4MH0E 1MS9A 3WG2A 1COV2 4TVMA 2NYDA 2VG9A 4E2SA 3MW4A 1HV1A 3POWA 1OFNA 3J8F1 5HCBA 1U5YA 3GZTB 1H2KA 5F9TA 1ALYA 5DUVA 1SFNA 4DB5A 1REDA 3E6DA 1RB9A 1RHI1 3MFCA 3MIBA 2QNKA 1AXYA 2D40A 4LA2A 2GNBA 3WG4A 4BE3A 4YGBA 4XMAA 3K51A 4KU7A 3M2MA 4UY81 1QOTA 3QD6A 5MLC3 2X5IC 2BFUL 3AP9A 1WLDA 1ZZCA 2GN3A 1JN2P 4CDUB 2XJRA 4AVBA 5BNNA 4XXPA 2PVEA 1QMJA 1UL9A 2PQQA 2WA3A 3GZUC 4Q0SA 5BNOA 2WINB 2XJQA 2PLV2 4W6XA 3UL2A 4AI8A 3H3ZA 4AGVA 1LCLA 3ELNA 1G9CA 1O3SA 4CEWC 3M7AA 2VW1A 2ILMA 4S2HA 1CAVA 1CVNA 4WVMA 1UX6A 5HI0A 1DQ1A 2K9ZA 2GMEA 1N3OA 3FBMA 1SLAA 5GZGA 3R6SA 5C8CC 1AYN3 1RUNA 1Z92B 2R061 1JYCA 1RUJ2 3R4DB 1CESA 3WP5A 4RGAA 4K1ZA 4AFDA 1HRV1 3E5UA 4IERA 3J7Z1 4OUSA 1V6LA 3ACLA 3PVEA 4J1XA 1U5IA 2IWGB 4AEDC 4DXZA 2VQ0A 3ZYRA 2BNOA 5MFPA 3H1MA 2QJVA 2IXKA 1PMIA 1QJU3 4YLZA 2QE3A 2XWJB 2XVKA 2BE5D 2GC3A 2XHKA 4BWOA 4RSUA 1DGWA 4QPIC 4YGDA 3SH4A 5GLWA 1JW6A 1W6QB 3VZNA 2WWSA 1WW5A 2NYYA 3DUIA 4IL7A 4K7JA 4BQ1A 1UZZA 2QZ2A 3ZFEB 5T5LA 4PF5A 4XTPA 4CDWB 2VOVA 1CONA 1SFYA 4A2UA 2DTWA 3CL1A 2M4VA 1ZNPA 2H6CA 3AP4A 3IWZA 4P9LA 4Q4Y2 1Z78A 4AR3A 1MS1A 1R092 2EXHA 3B7MA 2WLPA 3VBHA 1RJ8A 1FMD3 1S0CA 2RR12 4GMP3 4BMBA 2XGXA 3O14A 4FXKB 4MXVA 1BQ9A 4WM7B 2DCYA 3WV6A 4OI2A 5KHJA 2DVAA 4IEUA 1POV0 3AMPA 1SLIA 4SBVA 4Z82A 3CEWA 2GNMA 2VPVA 5GLUA 5KXEA 1RUE1 1H2LA 2HEWF 2WNVA 3L2YA 5GLTA 2DCKA 2D3SA 2A68D 4FPYA 4C90A 4D94A 3RNSA 3NAPC 1K5MC 4QQHA 2RS53 3WD5A 1ENRA 3BIWE 3WDWA 2GDFA 2VU9A 5LRSA 2A6XA 4JGZC 1FPN1 3GHNA 3USUA 2SBAA 3H0OA 3W58A 4CDXA 4L97A 5C9AB 3VBRC 4PDWB 1PK6B 3KGLA 2D93A 3AFGA 5KBFA 2UY9A 4BH9A 2R041 2GMMA 2XBO2 4HKWA 4H14A 4M3CE 3OBRA 3TN92 1TMF2 2DSXA 3VBFC 2PTMA 3DF0A 4XJ9A 1HLCA 1H30A 1UAIA 3JBG2 4Q4W1 1HXS1 1KITA 1AR71 2Z2SB 2W39A 4JV4A 1DZTA 2LCQA 1FAYA 4N9IA 1PVC1 1QH6A 4HK9A 4YW5A 1Z7S3 1DVBA 3AYEA 4Y4YA 1Q8QA 5FMOS 1OWBA 4G3YC 2YV8A 4FPJA 2D98A 1RDGA 2ZS6B 2ZX1A 4P9XA 4M3CA 2JG9B 1SMWA 1ZBA2 1S0GA 5BUVA 4QPGC 1VJ2A 5CB7A 3MPPG 1QCVA 2DWRA 1O3QA 3U07A 3ZO0B 1YIPA 1MZFA 2DFBA 3EQEA 3VBUC 3QVDA 1ODHA 4RHV2 3VZOA 4JAEA 1S0EA 1G9FA 3FWEA 2D44A 3VKFC 3X29B 1CJDA 4EN7B 2AYJA 4RQPC 4RS5B 4NO4A 2DU0A 1RUC3 2Y26A 5FREA 4DS0A 4XFIA 2IXCA 3PMSA 4Y20B 1GSLA 1AL0G 4ITCA 5EZWA 2B42B 4TSVA 1DDLA 4F83A 1QDCA 1VBC1 1CJPA 1LOBA 3CJIC 3LGRA 1WD3A 4W65A 2EA7A 4GH4C 2YY1A 3O0VA 1MZEA 3CJXA 5FMOL 4LLFA 3DGTA 1TE1B 5GZEA 3MFAA 3PTYA 3MYXA 5B2GB 3OY8A 1E57A 2XJUA 2F6BA 1IHMA 2WT0A 3KM5A 1WD4A 1DQ4A 4PIXA 2A6WA 2B39A 4RR3A 1CPNA 2WA4A 4P9WA 5FLIA 5BYNA 2MS3A 2RJLA 3VKMA 4LLOA 5EV7A 1R1A1 1ZA4A 2YZ4A 3DPRA 4L2NA 4TLFA 2PAEA 4H3WA 3PNAA 3WW1A 4AVSA 2A3WA 2Q4SA 2VVEA 3KT7A 4ZU4A 4XE9A 5CIRA 5JOZA 5L7OA 4LO4B 2JECA 4YZ4A 3VHPA 4QT6A 1Z0HA 4AE2A 4OHYA 2A6HD 4XQ4A 4WM8A 2QKDA 2YC0A 2WZR2 4LO5B 3DV8A 4C0BA 4HN0A 3S7IA 1N1TA 2JX9A 4BYYA 5LRRA 3ZXKA 4DNYA 5JMCA 3K48A 3ILRA 3ZYIB 5KHKA 3M3OA 3VBOB 4GQ7A 5JDBA 1KXGA 3AX4A 1WW6A 1KRIA 2J9UB 4M3CF 1NXD1 4P9YA 4IV1C 2EAKA 1R081 5FO8B 5BXXA 1DLLA 2GC2A 4MV2A 4B4QA 2RS11 2XVGA 1AX1A 1VBD1 2HWC2 2MPFA 4IV3C 4KNCA 4COZA 1RYQA 3N35A 3LA2A 5TSWA 2ZGSA 1BYHA 1VP6A 3VBSA 4LUKA 1A3KA 3N7LA 2ERSA 3OYWA 2WSUA 3AP6A 4FCAA 4TYSA 5C4WA 2PHXA 1BCXA 2RJKA 4DRRA 1Q8OA 1NLRA 3M1HA 2D6PA 5CFCC 1B35B 2HWE3 1NCQA 1ZRFA 1IGOA 4XBNA 4OFGA 5F5QA 4XJAA 5K0UC 4ORFA 4FPKA 3WUCA 4COYA 1CAAA 4QU2A 5I0RA 4UW5A 4ATEA 4Q0UA 1AXKA 5DZFA 1W6MB 5ACA3 2RMU2 4P9IA 4DPNA 3M8LA 5AVAA 1ZRDA 2VL6A 2WS91 3WNXA 1JYBA 3AZXA 5C6CA 1HDKA 3NL1A 3J8F3 4MSVA 1SBFA 4YGEA 1EPWA 4ISRA 4YW2A 1RUI3 1RWDA 1XE7A 1OOPA 4Y1XA 4DMIA 2MEV3 1ND2C 1OHFA 4YVSA 1H8TC 2A3YA 3HD8B 3MEPA 2G9FA 4AEJA 2O8QA 1OLQA 3VDDC 1W6OB 1MEC1 1MS8A 4R9BA 5T54A 1DQ0A 1HKDA 3ZMNA 3AP7A 4JDOA 3TNQA 2P34A 4NVPA 1AR61 3K35A 4Q0PA 1WUVA 2OZ6A 2LALA 2ATFA 1AYM2 1LEMA 2WFPA 5AC93 5A33A 1NE6A 2R042 4Q4X2 4OI4A 4ME3A 3SMHA 3LSEA 4HN1A 1QNYA 4PQ9A 5JOXA 1YUZA 4HETA 1HXS2 1HV0A 2JEMA 1AR72 3OF1A 1CAXA 4EWEA 1QJX3 1PVC2 1POV1 3AYAA 4NWWA 1GLHA 5CFDC 4AFAA 1OMIA 5FQ0A 5H9QA 2O8OA 5C8WA 5GAEc 2WQZC 1NLSA 3TYJA 3WW4A 1W6PA 3ZMOA 5EYXA 1D2QA 1ULCA 2IXLA 2IZWA 4CP1A 4XIKA 3WR0A 2TUNA 5KC6A 2XLFA 4Y22B 7RXNA 1F2NA 3M3QA 4HPKA 1B2JA 1J1TA 1MQTB 1V6KA 1H4HA 2ZPXA 1OI6A 5K9YA 3IIAA 1U0AA 4HVRA 4ONUA 3TAYA 5HXVA 4L92A 1MS0A 1RMU1 1VALA 5FLJA 2BYVE 4LUMA 1KQRA 1UN1A 1IPKA 2PLV1 2YYOA 1ZBE3 4ZN1B 5GLVA 4Q4V2 2WNUA 2ZX3A 3W59A 3I8TA 1SBDA 1UF2C 4JGYB 4BHPA 1VBE3 5MFZA 1RJ7A 4FPGA 2ETEA 5CVRA 3VGIA 3W9AA 4Y26A 4AHYA 3LSDA 2ZX4A 4TWTA 5BY5A 4E6YA 1IRNA 2ZGTA 3BU7A 1RC6A 1VBC2 1LOGA 1RUJ1 3SCGA 1VBA2 2XL9A 4D7SA 1D4M2 1NXEA 2CWMA 2RS31 4C91A 1LU2A 4WV8A 3ASIA 3INAA 4HBNA 4OI1A 3RWNA 4XXBB 3PIP1 5L19A 4GWMA 3U4XA 1DG6A 1LOEA 3RYGA 1NY72 2WFF2 1OPOA 4CDUC 2GNDA 1BFYA 1IS6A 4AR6A 2FZ1A 2R072 5JWPA 4Y5Z0 3LKJA 5KHGA 2CGPA 1KJLA 1WGPA 4EN9B 4YM2A 4XW3A 1LOFC 4K6BA 1YXWA 2D6OX 4KU8A 1RUH3 3CF6E 3CU7A 1WCDJ 3ZN6B 1FYUA 1EPZA 2ZHNA 2ZA9A 1ENSA 1GNZA 2UU8A 2X5IA 4YFWA 1PNFA 3MF6A 3D6EA 2JE7A 2ERFA 5KXBA 5JCTA 2DUPA 1PZ8A 3FE5A 2CV6A 2E51A 3HR9A 4Q4Y1 1R091 3VHOA 4CEWA 2B8MA 1JYIA 2IC1A 2YHJA 1VCXA 4V1PA 1V70A 3SS2A 1QGLA 1QOOA 4EWAA 4Q4W3 2R1DA 1MACA 1LESA 4HSLA 1QQP1 4AEKA 3WQ1A 2NMNA 3H7JA 4L99A 3AZWA 4L9BA 2H6BA 1LU1A 4LBJA 1VAMA 2X8KA 5F6KA 4QQLA 4AEDA 1VRH2 4CDWC 5K8SA 3D0SA 2RS12 1N47A 1VAVA 1YI7A 4FPLA 3ZFFB 5JVG1 5DDJ3 5A3MA 3AKRA 3IPVA 3GHMA 4QXKA 2Q5TA 1NE4A 3OCPA 1F5FA 2TBVA 3B01A 1WA4A 4QPIA 1V6IA 1CN1A 3ME2A 3MIGA 3ZSLA 4E4ZA 1ULGA 2QDRA 2VH9A 1E8JA 1WLCA 1DF0A 4WM7C 1WW4A 2UWAA 3ETQA 1HW5A 1OQEA 1IS5A 1REEA 2GSYA 4IESA 4KGQA 1KJRA 4POFA 1G7YA 2PHLA 4SLIA 4GWNA 1TMF1 2OZJA 2UYAA 3MLKA 4XQDA 3ES4A 4JCKA 1QYBA 3JBG1 1LULA 4HT1T 3N4MA 5E89A 4M3CB 2DVBA 2WS92 2A3XA 4QHBA 4Q26A 1APNA 2D43A 3KZ4C 2HJIA 1OA2A 4EWDA 1CIWA 5I8YA 1UIKA 4YG0A 5EWSA 1RUF3 2DVGA 3ES1A 5SV8A 5C9AC 2CWSA 4XXAA 4PDWC 1A8DA 1I6XA 1ZBA1 1PK6C 3P2AA 4Q8KA 5JOYA 5H1Sc 4NPRA 1FXZA 1V6NA 3J4UH 1LGNA 3E97A 4JRLA 1S2BA 1AJOA 1H2NA 2WT1A 4OHXA 2OA2A 3ZXDA 5J36A 1H0BA 5EINC 5KXDA 4RHV1 1BXHA 1X33A 2QVSB 2DTYA 3NAPA 1K5MA 3FLPA 3JZVA 5FDBA 1LKMA 3WDYA 4N43B 3H3UA 5EFUA 4MLOA 4JGZA 5FO7B 5FOJB 1PGSA 2E6VA 4AR4A 4A3XA 2AGSA 1SMUA 1QJU2 2RM21 4L8QA 1SCRA 2UY8A 2C0ZA 2ZGLA 1UU6A 3WY6A 2JG9C 3RMYA 5LK7B 1FOD1 1UW8A 3VZLA 3VBFA 4CDQB 4CEYB 3S6PA 1A8MA 3V0BB 4P9GA 3WG3A 1V9U1 2CGNA 3OY8B 2PHWA 3WLUA 4B4PA 4DRVA 4RR3B 4LHKA 2W0XA 5FPZA 2R6QA 4HK8A 2VOKA 2DCZA 5JSRA 1HRI3 4RS5C 2PAMA 2M4YA 3DPRB 4U36A 5AI3A 1SEFA 4I0WB 5JZGB 4AI3A 3MIDA 1FMD2 5C33A 1ND3B 2KXLA 2EXIA 4QPGA 1AR83 4PLMA 3FBYA 3ZFGB 4HVQA 1W6NB 5T52A 4AHWA 3WCSA 1WMEA 2WT2A 1QXRA 2QL0A 2UWBA 4XFBA 4AI2A 1FHMA 3D5OA 1CQ9A 1RMU2 3WDUA 3HWJA 1EV13 4KWLA 4Z07A 4RQPA 1ULEA 3OGGA 1PHMA 8RXNA 3TBDA 3T1LA 5IK8A 4XEZA 2WZR1 4HZFA 1GZWA 3ZXJA 4IEPA 3WHTA 2Z3QB 4XZPA 4Q0QA 1VLNA 4K21A 1GICA 4AQSA 4XJUA 2XJSA 3PKJA 4EJRA 4RXNA 1W39A 3OBTA 1DYPA 4K9FA 2CKAA 3ZIWA 3CJIA 2RS32 1ZRCA 1AL23 4GH4A 1RGSA 3G7DA 3OJBA 5IK7A 1B13A 2HWD3 5LK5A 4PJYA 5KWRA 4HSJA 3LZZA 2HWC1 1PZ9A 4FAHA 1SBEA 1RUD3 2Z3RB 2M6OA 5CNAA 4FPCA 2NLRA 1PZ7A 4MXWA 5DZEA 1DGLA 1MEC3 4O9GA 2QCSB 3H50A 4H7LA 2VECA 5D8AB 1LOCA 4BOWA 5T50A 3JB8A 4IEYA 1Z7S2 3VBOC 3O0XA 3I59A 3CO2A 3RJRA 4FOWA 1UCXA 1ZZ6A 4AI1A 3GBFA 5H9RA 1SMMA 1CGPA 4OUMA 2VMGA 1GV9A 2VUJA 2RMU1 3FC0A 1A78A 1I1EA 2PSMC 3CLPA 3PMEA 4IEZA 1POV3 2BGCA 5A32B 1QWRA 1FATA 3ILNA 1GFF2 1QQP2 2UWCA 2DU1A 1COV3 1ZVFA 5DG2A 2ZKLA 3HQXA 1IS4A 4IEQA 3WX5A 3J26N 3ZN4A 2DV9A 4FSJA 4IV1A 1RUC2 3FHIB 1IPJA 1B35C 3JD71 1LR5A 3FLTA 3RS6A 1FNZA 1RUG3 4IV3A 4XBQA 1C8M3 1DGRN 3T2TA 3AP5A 4R4XA 3WCRA 4XBLA 3S30A 2PN5A 3RPQA 1RITA 4LO6B 5A33B 4BA6A 1GZCA 1C1LA 2BNMA 3KT4A 4JTOA 3KYYA 2IFWA 1S0FA 5IT6A 3SH5A 4CTEA 1PO13 4Y1UA 5CFCA 3LPEB 1RB8G 2PVXA 1AYM1 4LBMA 3WHUA 5K0UA 4Q4X1 3WUDA 2GH8A 2KA3A 1VB2A 4N53B 2FZ2A 2B45X 2HWF2 1IOAA 4JDNA 2EIGA 2LUWA 2R1BA 1J3QA 1RUJ3 2G4IA 4YVWB 1H2MA 4Y1YA 1S1AA 1BJQA 2Q30A 1AR91 3LWCA 5I8SA 2DCTA 5GAHc 3QLQA 1O91A 1ND2A 2GMPA 3WXPA 4BMEA 2HWB3 1YYNA 1PIV2 1TME3 4LBQD 3RMXA 4LNVA 3M3IA 4BLIA 1IQAA 5I91A 4P9JA 5L73A 1XU2A 1ZYBA 3VDDA 5BNQA 2GN7A 1BBT1 2GALA 1PNGA 2NMOA 5KHHA 4JAAA 4X8NA 2NP0A 4XETA 1JOJA 4Q4V1 1R093 3R0RA 2QDNA 1YLLA 2B5HA 1C57A 4FAGA 2RM22 2ZX2A 2R0HA 2RR13 2A70A 4JAFA 4H55A 3O5SA 4JQRA 3ZXEA 4QQ2A 2DYCA 1VBB1 3E6BA 1FOD2 3THPA 2Q8OA 1XXNA 3AMMA 2AH2A 3NV1A 4I02A 1QHDA 1MQTC 1V9U2 1VBA1 1LHVA 4JRAA 3PKIA 1D4M1 2A6ED 6RXNA 1BQPA 3AMQA 1NA1B 4HFSA 3RJ2X 2C1FA 4LEJA 2ZIXA 4YWMA 5CFDA 3URFA 2YGLA 2WFF1 1NY71 2AR6A 2I74A 1R0IA 2EF6A 1LENA 2N7GA 1NCRB 5T3NA 2R071 2XPJA 4GKYA 3ROUA 1N1VA 2ZHMA 2ZGRA 3V64A 1NXMA 3ZYJB 3B3QE 3FFZA 1L3JA 1LKOA 2OYZA 4JC1A 1XNBA 1Y7BA 2BEOA 4ASMB 3B94A 2GU9A 4JGYC 1OKQA 2VOWA 1XNDA 2ZHKA 4XJZA 1D0HA 3G6JB 3CNAA 2ZJCA 2OW4A 4LBQB 2JG8B 1PO21 4MYEA 4M00A 2CYFA 1ASJ3 1T9PA 4E4SA 2ZAAA 4R52A 2AZ5A 1XQNA 2MEV2 2JI1A 3HBZA 2WIIB 2XBO3 3J9SA 5BNPB 1D2SA 3KCXA 5FLHA 5GZCA 3TN93 1TMF3 5DXDA 2ES3A 3V56A 1SACA 3APBA 2HKXA 1HX6A 1EAH2 4GB31 3POSA 2MNGA 5HCFA 1KDMA 4J6GA 1ULFA 4IEOA 3ALQA 3GBGA 5I0SA 4G6BA 4LHNA 1DX8A 2BVVA 2ZGKA 2YROA 4RGGA 1WBFA 2NPIA 3L2HA 2IFRA 1YI9A 2BNNA 4DFSA 3ZSEA 3RYPA 3I4IA 1VRH1 2JENA 3WW2A 5AC92 5J37A 1ZBA3 2GZWA 2OUHA 3I2DA 1DHKB 1LJ7A 4YW4A 1VZGA 3C2UA 4MGKE 3MICA 4Z1VA 2ENRA 4B7EA 3BOPA 1LOFA 1D0GA 4I0AA 3IBMA 4LHLA 3ECQA 1BEV2 1OWCA 2B46X 5CAZA 3ZSMA 2CGOA 1YFXA 2BPA2 3N7JA 4X6RB 4YGCA 3B69A 1JHNA 1CAWB 4Y24A 3NJZA 1C09A 2WNVC 1YUXA 2H12A 1PGL1 3ZPYA 1T9QA 2IXJA 4CP0A 1J58A 1NQJA 3B5LB 4Q1RA 1S0JA 2UYBA 4AQTA 3ZFFC 3BOWA 4LBKA 2ARXA 1ZX5A 4EROA 1U5ZA 3QCWA 2D6NA 4LA3A 2VY0A 3AKSA 3ST7A 3WG1A 2BWAA 1N1SA 2BWCA 2JE9A 4YM3A 2AUYA 5I93A 3LAGA 1W6QA 2WKKA 1RINA 1GR3A 1ZBE2 4QQPA 3R4UA 3JD72 3S7EA 3ZFEA 3VLBB 1RHI3 4CZSA 4CDWA 3FFQA 1O4YA 1OQ1A 1XNCA 3FUOA 2XB6C 3GNEA 1H4GA 3SISA 1KFUL 2Q1ZB 1C5IA 3N3HA 1AF9A 4NHLA 2GH2A 5E1RA 4AGRA 4AR5A 1G9BA 2G9GA 4ES8A 3MW2A 3JCIA 1TQ5A 1YHFA 2PHDA 4G4FA 2ERJA 4JADA 1REFA 3TOJA 2KN9A 3AXEA 3R4SA 4WM7A 1KD7A 2Q0AA 1UPSA 4K40A 2P2KA 1UMZA 2C6AA 4XJWA 5ABJB 1QJU1 4PCRA 1H9WA 2VOXA 3O12A 1RTVA 2WC2A 1RDVA 3WDVA 4BM8A 1V6OA 3JQWA 2R063 3ZSKA 4WVZA 2D6MA 1R0GA 4E4DX 4QPYA 1LGBA