4AI1A

Flo5a showing a heptanuclear gadolinium cluster on its surface after 19 min of soaking
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
258
structure length
258
Chain Sequence
GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLOCCULATION PROTEIN FLO5
publication title Complex Gadolinium-Oxo Clusters Formed Along Concave Protein Surfaces.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell adhesion
total genus 56
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4ai1A02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ai1A01
2XJQA 4AI0A 2XJRA 4AFCA 4AI2A 4AFBA 2XJPA 5A3MA 4CP2A 4COZA 2XJUA 4AHYA 4D3WA 4CP0A 4COVA 4LHLA 4AI3A 4COUA 5A3LA 4CP1A 4AHWA 4A3XA 4ASLA 4AFAA 4AI1A 4AF9A 2XJTA 4AHXA 2XJSA 4LHNA 4GQ7A 4LHKA 4COWA 4COYA 2XJVA 4AHZA
chains in the Genus database with same CATH superfamily
4HK8A 5F2SA 5BUVA 2NMNA 1GZCA 1A6CA 3I2IA 5EQUA 4GB31 3JU9A 3BU7A 3CU7A 5IUQA 5M5YL 3HAXC 1GWMA 2DDUA 3USUB 5FDBA 3C8XA 2KKDA 3Q8BA 2A75A 4ZS3A 1W6MB 2D6PA 2K9ZA 3P1IA 3PIJA 1JUHA 4CVUA 2WJSA 3WVJA 5FO7B 3NKGA 2VOVA 3M3QA 3QD6A 4N53C 4TZDA 3GYDA 3LWPB 3POEA 4AWDA 2AZ5A 3MW3A 2A7AA 1CPMA 1G9BA 3DUIA 3VGIA 5C3OA 3NNLA 4EWEA 3S0MA 4UOJA 3LDRA 4FTEA 2PHRA 1WW7A 5I0TA 1GWLA 3UGFA 3KF3A 3A0KA 4X6QB 1B35A 1OLMA 3URFA 1ULCA 4QQHA 4CCEA 4CU8A 2GP5A 1SG3A 3O1SA 4R8HA 2AQCA 4HKOA 1VPHA 1VBD1 3MYXA 3WZ1A 2PYAA 2OX0A 5CISA 1AF9A 4NE9A 2ZHMA 4IEQA 3AMPA 4Q27A 4FFGA 3P3PA 5F9TA 5AI2A 4L2NA 5FZ0A 1CAUA 3IMNA 1ND3C 5FPLA 1NQJA 3D0JA 5FZMA 3IDCB 3GF6A 4GD4A 4IEVA 3MFAA 3H97A 2X10A 2HWD3 4OQ9A 2C1FA 4M3CA 1SBFA 2ARXA 3QBQA 2VZ3A 1SCRA 4QX0A 1MEC3 1N1TA 2D6OX 2VNVA 2YBSA 1YEWA 4P5YA 1KJRA 3ST7A 4Z8BA 2OW4A 5FIXA 1YFUA 2DFBA 2R042 1EV13 2RJKA 2YC4A 2WR9A 2VNGA 2Z3QB 4QU1A 1XNKA 4CDWB 1AX0A 2XGXA 4Q0UA 4KWUA 3ABZA 4X8NA 2E33A 1ND2B 2WA4A 3JQWA 3TNPB 3ZYFA 5LRRA 3H8RA 3RZLA 1K5JA 3FLRA 1NY71 1OXCA 3S5AA 1UIKA 2RS51 2PYTA 3WUCA 3IIAA 4D6RA 5K7PA 3S2HL 2PHUA 4BQ3A 4Y1YA 1AL21 5T52A 4WVMB 3RZKA 1F9KA 1NCRC 2EXKA 2PSMC 4MGSA 2WFF3 4TN7A 3OGRA 2H12A 1V6LA 4S2HA 4YM1A 4K1YA 4K1ZA 1SFYA 3HN1A 4FPFA 4YW1A 3WNLA 2AEYA 2V5YA 3AX4A 2CGPA 1PVC3 4EZ4A 3T0AA 3OY8A 1FNZA 3PO2L 4XDPA 2V4AA 1HRI2 3I54A 3W20A 1DFQA 1BRFA 2G9GA 5C4WB 5HV4A 3HJWB 2D3SA 2ZGTA 4UYBA 1R083 3OF1A 4LBLA 4PDWB 1FMD2 4PI2A 1RUJ2 2RMU3 1NZCA 3SNMA 3N35A 1QQP1 2XUEA 1VCXA 1X7NA 1C3HA 5E8AA 1H2LA 2A71A 4LKSA 1QNWA 3ZR6A 5L9BA 2YHJA 3CZUA 3WD5A 4CXWA 4EE2A 5BY5A 4A3FL 3PIGA 5FUNA 4J25A 2YBPA 3O1PA 3QCWA 1J3PA 3AP7A 2R16A 5DM61 2Q8CA 5C9AB 1D4M1 2I74A 4COWA 3WW2A 1QOSA 1F8VA 3BVCA 1TMF1 3K4ZA 4XFGA 1PNFA 2ZMLA 5FZGA 3S17L 4ES9A 5FZOB 3S1QL 2BFUS 4FPHA 5CKNA 2W0XA 4ZXKA 5FY4A 3CIHA 3T1MA 2VUJA 1BVVA 2JXAA 1NG0A 4JADA 1O3RA 2PAEA 4W6WA 1UYXA 3NV2A 4CUGA 3MIEA 2JIJA 1JYTA 1CADA 1H6XA 1H2MA 1YO8A 2Y6JA 1Y1VL 4QQLA 4QGNA 3TEXA 1G9FA 1IS3A 2HH9A 1MACA 2JA6L 2FCUA 3KV4A 4QXHA 1TEIA 1W0NA 1ZZ9A 3MDPA 4M01A 4RD7A 4XBQA 4FPEA 3OPWA 2RR12 3I59B 2ZCWA 1NYWA 4CYDA 1TE1B 5HCBA 1UW8A 2E7AA 3CF6E 5A7PA 4DZGA 2X29A 2XWJB 3AZYA 1LOBA 5JSPA 2B46X 1W6OB 2RS32 4WZFA 3GCXA 5IVFA 4RQPB 1ENXA 5ACA2 4IETA 2B8MA 3SITA 3HKZP 2EXHA 4HBNA 1RUOA 1GZWB 1GQHA 4JRAA 5DG2A 4NR1A 4AAPA 1LOFC 2VM9A 4OI0A 2Y64A 3B93A 4R9CA 4CDUB 2C9AA 4G9SB 4IE0A 3NO8A 4JVAA 4BQ5A 1DGWA 3A0NA 4XGHA 1UZ0A 3CHXA 3QOPA 3A23A 3B00A 1CZVA 4K40A 3UT0A 4YM0A 3GJBA 2R062 4JTOA 2BGPA 4Y22B 5G05L 5FMOL 3DPRA 5EFUA 4ZS2A 3BOWA 4CPBD 5A6YA 3MICA 1W6QB 2JG8C 3U75A 4WFN1 1TWAL 1S30A 4Y5SA 2WB1P 4TXWA 3G6JB 4Y20A 1BEV2 2O5JD 4Y5TA 4IW3A 4A3LL 1I9RA 3B01A 1V6IA 3WNPA 3BALA 5EZWA 5T5LA 3VN4A 3ZYPA 2PAMA 4AHYA 4Z92B 4EYUA 3HBZA 1UOGA 3J8F3 4A3IL 1SFPA 1F5JA 4META 5IWFA 2K2DA 2EIBA 2CL2A 2H0VA 2JA8L 1DQ1A 1K5MB 1VMFA 3I4IA 4XMIA 1K45A 1NX9A 1MZ6A 1YI9A 3MLLA 4JAAA 5I0UA 3WG1A 2J1VA 3OD4A 2ZAHA 4GZ9A 4OHZA 5FCCA 4YW6A 2XDVA 3PNAA 3VBHB 4DPNA 2JDNA 3GXUA 1JOPA 2HKXA 1I6HL 3ATGA 4CUBA 2WL1A 2J7MA 5F3EA 2DWRA 4LT5A 2YU9L 2WN3A 3KLSA 2JDPA 4CU9A 2GDFA 2FDFA 1PO12 4FAHA 1VBC3 3OBRA 2M4YA 2VQ0A 3RWKX 2W91A 1YXWA 3ZFEC 4CE8A 4YVWA 2ADDA 1H30A 2RM23 2Z42A 4KU7A 3SQOA 3ZYIB 1LOEA 3P3NA 2GN7A 3RZGA 3LF7A 4XQDA 1CJDA 1GKBA 3GTQL 1SLTA 1J58A 3AMHA 2HWD1 2VQTA 3H99A 4NVPA 1K3IA 1YLLA 4QPYA 2Y0SP 5GADc 4WVWA 1UF2C 4AFDA 5JPMB 3AMQA 2CR8A 4YWLA 1RJ8A 2VW1A 1MEC1 2W9XA 2QCSB 2ZS6B 3BCWA 1HJFA 4MSVA 4P9IA 3RFRA 2MHFA 3LEIA 5BYNA 4AHZA 2ZX4A 2XG3A 1EV11 3NAPB 5IAXA 1LKNA 1IROA 4AOCA 4RSUA 4LE4A 3SEPA 5F5AA 1RUE2 2XKOA 2M6PA 3M3EA 4IERA 1TME3 1IW7D 4PLMA 4YSFA 4A3EL 1FOD2 1CIYA 1RUC2 1VAMA 4PIZA 3VBFC 4DY3A 4IEYA 2W47A 1Z7S3 1H8TB 2CWSA 1YV1A 2XVGA 3L2HA 5IY0A 2PLV3 2PHDA 3AJZA 5A3WA 4D3WA 3AMNA 2ZX0A 5A3OA 1RUH3 3SLIA 5DUWA 5MFPA 1CX1A 4RYDA 4IGPA 1KS4A 1UD1A 2WFF1 4LO7A 2JDAA 1NAEA 2DCYA 2XH6A 4AXOA 1H7VA 1TVGA 3AP6A 4QPGB 3W5MA 2DFCA 4O9GA 4OQ8A 1PVC1 5GJ6A 5IK5A 2V72A 3LWRB 3KV6A 2WT1A 2OKXA 4C0HA 1R1A1 1T2XA 5GAEc 4JCKA 1HDKA 2VR4A 4UBHA 5APAA 5JR7B 3FUQA 4NHXA 5HCAA 1COV1 3E5XA 3THCA 4CDXC 2HWB3 1R081 4UBGA 5AC91 2HWC2 3LPEB 4SLIA 2RMU1 3OTFA 3VBUC 1RUD3 4TLFA 3MZHA 4ZU5A 2ZGRA 3P6BA 4INDA 3AKSA 3VZNA 4A93L 4DO0A 5L7OB 2YMZA 1AYN2 4QX2A 1ZBE2 3NL1A 5LW9A 4HETA 1OMIA 3I3EA 3OB8A 5AN9H 2D3PA 3S1ML 3KMHA 4AR4A 5DDJ3 4XFAA 3POJA 1C4RA 3ZYGA 3PTRB 5F7UA 4Y4YA 4CCOA 5ERLA 1ODHA 5C3SA 4WZCA 3ZFFB 3T30A 1N3OA 1W6PA 1S0IA 3EQEA 3DXUA 3WR0A 1ZZCA 2DVAA 3I2JA 4D7SA 1VBA2 1Y9MA 5I0RA 4BQ2A 5LA1A 3K7AL 1AYM3 2VZTA 2JDZA 4JGZC 1Z0HA 1S2EA 1YWKA 2WUHA 4P9WA 2QDRA 5JMOA 4PHZA 2LTNA 2R1BA 4RL7A 3KT7A 4CRQA 5FYTA 3T0BA 2HWF3 4I0AA 3VHNA 1O4YA 1D0HA 1OKQA 5FY8A 5FZ6A 5LY1A 1VAVA 1GV9A 3ZFGC 4QDRA 5FLHA 3WDWA 1RB8G 3H0OA 3IDBB 4G6BA 1SQ4A 1IS5A 3E97A 4YZ2A 4MVTA 4C90A 2K2SA 4QDQA 1F5FA 1SBEA 3H1YA 1ENRA 2B9VA 2Z2SB 4LK7A 4O7XA 5KXBA 3GBWA 2UY9A 1TG7A 2ORXA 2WNUC 4WM7C 1E5IA 1ZBA2 4RHV2 4AFBA 2P5BA 3ITQA 3KYXA 4HKLA 2X5IA 3GHMA 4LEJA 1POV3 1QU0A 4P9XA 1VE0A 3WDTA 3UNPA 2HR5A 2R073 2ZKNA 1C8M3 4W6XA 1RYYA 2XL7A 1MS4A 2WZEA 3OEBA 1GZ9A 2V73A 4CP0A 2YZ4A 5IVCA 4D0QA 2D43A 1AR82 4XUQA 3V64A 5JOZA 2RS12 4HVQA 5FOBB 2GC1A 1LGBA 4QGMA 4YM2A 4YZ1A 4QXKA 2J1AA 2EA7A 4K6BA 3N9LA 4BDVB 4XCAA 3RZMA 2BZDA 1DYOA 2JICA 5FZ4A 5LB6A 2Z5WA 3D4KA 1XBFA 3JR7A 3USUA 4Q4W2 2A68D 1IQDC 5FYBA 1APNA 2OZJA 4C8DA 1GU3A 1CGPA 3LSEA 3NV4A 5C7GA 5JZGB 1RC6A 5C3EL 2VUML 2ET7A 3CDZB 4FO9A 4YW5A 2JDMA 5JI9A 1QJY3 1RVF3 1TZOA 3HNYM 1PK6C 3KCYA 4H3WA 3J8F1 3VD3A 4COVA 2JJ6A 4Z2AA 3B9IA 1ALYA 2P1BA 1YK5A 2E7QA 4AFMA 4AEDB 5F3CA 1MPXA 5BPXA 2DVGA 3PKIA 5IK7A 1W9TA 1QOTA 4UW4A 1LKPA 2E53A 2GN3A 3MV01 3U37A 3PL5A 4Q4V2 5FP3A 4IESA 1I1EA 1UU4A 5FZFA 3GHNA 2OT7A 4NPLA 4AGRA 5JWPA 5J36A 3MIBA 2CDPA 1M06G 1S0BA 3B7MA 2WS93 1XYPA 3T2OA 1QXRA 1YJLA 1UNBA 3HN3A 1UX6A 3CQOA 4UAPA 3NSTA 1WJVA 4XUOA 2ZMNA 3BTAA 3LIGA 4GWIA 3ZSMA 4B8EA 1PO21 5RXNA 1PMHX 2O1QA 5L73A 3NJZA 4BA6A 1ZRDA 2WYSA 3ZPYA 2VJXA 3WW3A 4BBSL 2QQLA 1HRV3 1IU6A 4BK5A 1BQPA 4M0HA 1VLNA 4GH4B 3KHBA 3ES1A 1DX8A 5K2ME 4Q0VA 2OPWA 3VBSC 3AMMA 1QKQA 1W8UA 5CG8A 3IN9A 3T2TA 1IQAA 3UKVA 4AK3A 4EROA 1R093 2D97A 5JPNB 2D6MA 2QQKA 1ND2A 3J4UH 4LLOA 4AI2A 2QUOA 3ZR5A 1GLHA 3D8CA 4JDNA 3AFGA 2VECA 1RMU3 1OH4A 1GP5A 5K4LA 4DMIA 2VUAA 1TME1 3N36A 3O0VA 4JTNA 4A7ZA 3EYPA 4LK6A 4OFGA 1S0GA 2IZWA 1IG3A 4GMP3 1GBGA 1RWDA 2PLV1 4WVMA 4FTSA 2Y33A 5FY5A 3ZXLA 2ERJA 3JBG3 4LIUA 4WM8A 3Q8AA 1V9U3 1ZZ8A 4KGGA 4I01A 5FPAA 1RHI1 1VBE1 1Y9GA 5M5XL 4CZSA 2Q8EA 5BV6A 3ILRA 4DFSA 2QJVA 4QKFA 3VDAA 1UIJA 4LPLA 1LU1A 3DEMA 5LK7B 2WNVA 1H1AA 2A3XA 1NOVA 2MNGA 5EYXA 3FE5A 5C4WA 1GOGA 4A3CL 3I49A 3NRUA 1JXNA 1JYCA 1KFXL 1QJFA 2WLPA 4MH0E 2HWB1 1C57A 4GB33 1X33A 5FJKA 2BEOA 3MO4A 4Y20B 1RUI2 3SC7X 3MFCA 5EJ3A 5FZ3A 5JCTA 4I02A 1O8SA 1QYBA 2A6HD 2OIIA 4E6YA 2NYYA 3AYEA 1SFNA 2FZ2A 2DCTA 4CUAA 5GLVA 3R4UA 2HVYC 4QHOA 4E2SA 4XAAA 4XJAA 4PQ9A 4I2OA 2DUOA 4XPVA 4RS5B 3WDYA 5M0TA 2FDKA 1S2BA 3RYKA 1YUXA 3HJYB 4MHRA 5JXGA 1Y43B 2ZZQA 4RXNA 3AC0A 3AVRA 3LD8A 1HXS3 4OCTA 3GZAA 3C7OA 4YGCA 3VBOA 5DDJ1 5FZEA 5JOYA 5I8SA 1PM4A 4R4XA 3WQ0A 1XYOA 5FZOA 3RPQA 2XJVA 4Q4X1 2B42B 4Y1VA 2BFUL 3F95A 2VTXA 5DAXA 3U07A 1ULDA 4XJWA 4NIIA 2JB4A 4DQAA 3HOVL 4LR4A 1ZM1A 2I45A 3AL6A 1QDCA 2YGMA 3PUIA 4LA3A 4Q0SA 4XTMA 4ZU4A 5FO9B 1JZ6A 3MPSA 1VBD3 3AM2A 5DM71 3ELNA 4LTAA 2FCVA 4RGKA 4JRLA 2UURA 4GWJA 1DHKB 5K0UB 4YGDA 4D6QA 1I3QL 3P8BA 4IV3B 5C33A 2XPJA 1UMHA 1XXNA 2E2HL 1BFYA 1W99A 5LRSA 3JD72 3I59A 2PQQA 5LBBA 4OUMA 5BNPC 5IVJA 2A6ED 3T2QA 5KC6A 2LW8A 4NPRA 2LM3A 2DVFA 4OHWA 2QBXA 3I3QA 3U10A 1JMUB 1W6NA 2ARCA 1W6OA 2Z3RB 3GTML 1GQPA 3LB9A 5F39A 1EAH1 2VW0A 2XONA 3OBTA 3TRSB 3UKTA 4EN0A 1FPN2 2VZSA 2NM1A 5A32B 1V6JA 1HV0A 1Y4WA 2PQSA 2VPVA 2WO3A 3PURA 4GWMA 4KWKA 2R071 4ZONA 1LAJA 2IC1A 4HN0A 2BWAA 2XUMA 2DU1A 4QPIC 1BYHA 1C8M1 3WF0A 4CDUA 4YFZA 5LEKA 2CDOA 1VAKA 2ES3A 1STMA 2VOKA 2Y6FA 3ILFA 2A3YA 1JYNA 2PFWA 1KDKA 2RS53 1AR91 4Y22A 5EJ1B 4PDWC 1CIWA 1KITA 2VUDA 3IDAA 3R4SA 1AL23 1OVSA 4R9BA 2WNOA 2M4VA 3GDBA 4XFCA 1LHUA 4Z82A 4FAGA 5FO8B 3O1RA 2XJTA 1T6GC 1W6QA 1PGL1 3ZSEA 2GH8A 4PLNA 3WEZA 1XSRA 3IAPA 2VXJA 2BGOA 4TPUA 2NN8A 1OUSA 1HQNA 1WCML 4EWDA 1J83A 3BYWA 3ZIXA 5C9AC 4XF9A 5H9RA 3GNEA 4Y52L 4UI9L 4R52A 2YY1A 4BQWA 4QD2A 3HAGA 4PT6A 3ZDSA 4UW6A 2XJUA 2PVEA 3IM0A 1QQP3 4JGYA 1K5MA 4POFA 4Q1RA 1DDLA 2DUQA 1A3KA 2RDQA 4E4DX 3FFQA 3DYMA 1R64A 3O0WA 1U5XA 3VV1A 2JG9C 4V196 2GC3A 2ILMA 3HEIA 3VBHA 3RRDA 1ULGA 4E4ZA 5FPXA 3TEYA 4FI9A 2J1RA 3K4DA 3AKPA 3N7LA 1OSGA 2Q1MA 1D0GA 3POWA 3S15L 1I6XA 3BTZA 5DN2A 3WF2A 1TMF3 3N7KA 4IEWA 1IKPA 3UL2A 1QXPA 2WS91 2C6BA 2VMCA 4N9HA 3AXEA 2A6WA 1O3TA 2ZIXA 4ITCA 4LO8A 3O1TA 1E5HA 4Y1XA 5MFZA 1MS9A 1BE7A 2XWBB 1UYZA 4D7TA 4Q29A 1NA1A 4RQPC 3V56A 2QNKA 5C8CC 1UL9A 2D6LX 2WABA 1MQTC 3LFMA 4QQPA 3POIA 1OHFA 3WT3A 1HRV1 5BNOC 3NW4A 1PFYA 5C70A 2J22A 4LKDA 3ROUA 1CQ9A 1D4M2 4NN0A 3OD0A 4C3JL 1DGRA 1Q8VA 3AP4A 2YFUA 2F17A 2JDUA 3J7MA 4JV4A 3OBZA 4DNYA 5DG1A 1OQDA 1XNBA 3RDIA 3ZYJB 2ZGNA 4KWJA 2W95A 1YQ2A 1QGLA 3ZYRA 1RMU1 4CCNA 4GS7D 1X50A 1AR62 1H8TA 2GH2A 4PBPA 1ULEA 4Z2WA 4COZA 1WMXA 4LBNA 5FREA 4E2GA 3W21A 2GNTA 4A7KA 1XPWA 4AQ6A 1L7RA 5BNNB 2A1XA 3RSJA 3JBG1 2R7EB 1AHSA 1QIQA 4HMZA 1YUDA 4QPGA 4CP9B 3DGTA 3FBMA 2UWBA 3NWKA 5T50A 2H6CA 4AYUA 5HI0A 4J1XA 1CZTA 1WUVA 3CZJA 4JKKA 5FBJA 4QXBA 4Q2FA 1GFF2 1GNZA 5JUVA 2VZ1A 2FDGA 4E4HA 1MS3A 5A6XA 1PGW1 4N7UA 3KQ4B 4LQRA 1PMJX 4IV1C 4K7JA 4XUNA 5FZCA 1F4HA 4ME3A 4N43B 3EJKA 4XIKA 2IVIB 3DXTA 4MXVA 5FY9A 4ASMB 1GR3A 5FOJB 4FPCA 1JZ2A 1AUYA 1LRHA 1PZ9A 3PDQA 3VD5A 5LZ6A 2QQNA 1J1TA 3VZLA 1L7LA 1VMHA 5L7OA 3WSOA 3K46A 2H0BA 3ZXAC 4XBLA 4ARXA 2AEZA 1SHWB 4NRMA 5T5JA 4XMAA 2D5FA 2Q1ZB 1ENSA 5LBEA 2C4XA 1RUG1 2E7TA 1NXD1 2VZVA 3POFA 4U2AA 4Z07A 5FYMA 1G9CA 3SCHA 4OI4A 4LKFA 1HXS1 3MBWA 4A3BL 3MUZ1 4CEYA 4LXLA 1HKDA 2YBKA 2UY8A 3LAGA 4P00B 3ZFFA 2VG9A 2XOMA 5EPAA 4YVSB 3M4OL 2JKBA 3PJQA 4FFIA 2QL0A 1NCRA 3TN93 3ZXJA 4A3KL 5FP9A 2YG0A 4N90A 3WWLA 4IGOA 3WF1A 1OOPC 1DQ0A 3H3ZA 3EMRA 3IAQA 3WW4A 2EF6A 4E8CA 5EIYB 2OXBA 1HB1A 1SPPB 3NAPC 2DSXA 1GZTA 4FOYA 1PX3A 4AVTA 4B4PA 3RZHA 2ZXQA 1BK1A 2JEMA 1BQ8A 3LWCA 3VLBB 3MPPG 1H4GA 1SLBA 5JVVA 3KT4A 4R9AA 4EN8B 1PGSA 5FWJA 4QM9A 5A1AA 2N7GA 4TYSA 2XXZA 3FJSA 4CUCA 3WNKA 4ZZ8A 2VVEA 1DQ6A 4XDQA 3NV3A 2Z79A 2O14A 5FYHA 3M4FA 3ON7A 1QOOA 2GU9A 4LORA 3L2YA 1UMIA 4B7EA 1JN2P 3EXUA 1MZEA 4UW3A 2Q8DA 2AH2A 5CFCB 4GKXA 1IS4A 1PVXA 3BPSA 1I5ZA 3K3OA 3RMYA 3HVDA 4YYOA 1YQ8A 2Y0OA 4QKDA 3DN7A 3PMEA 5M5WL 5E89A 2VY0A 3PVNA 4P9JA 1QH6A 5LBCA 2EAKA 4AEJA 4CEWB 5JAXA 1ZZ6A 4CCJA 3W5NA 4NIDA 5IFTA 3RZ6A 2ZMKA 4OI1A 1OFNA 2WZR3 2HWD2 1AR73 1ZRCA 1W8NA 3D82A 4BH9A 4PQQA 1PM7A 2E51A 4WM8B 4ZU7A 5FRAA 1OLRA 3CJXA 1MEC2 2Q30A 1QJU1 4R4ZA 5FMCA 4A45A 4FPOB 4AGGA 3GM8A 4KG0A 1LOCA 3WUDA 1EV12 1R1A3 1CAVA 3KGZA 1AL0G 5JZGA 2WNVB 2ZX2A 1C1LA 3GCWA 3LEMA 4NO4A 1FHHA 5FXZA 1COV3 2O0OA 3FHIB 2ID4A 1DZRA 5A6ZA 5AC93 5DAWA 5CKQA 5B4XA 5FTTC 3B69A 3ETPA 4ZN3B 4XZUG 4AEDA 1B35C 2DUPA 3ZYBA 4S2GA 1S0DA 1YI7A 1MS8A 1BCXA 4CDQC 3HD8B 5H9QA 3P5BA 2WFF2 4A3XA 5LWBA 4XQWA 4F83A 1NCQB 2J1EA 4XJ9A 2Q5TA 5FLML 3LPGA 2DCKA 4KI5M 3A22A 1GP6A 3L9JT 2L9LA 5TSWA 2RHPA 4QPWA 2JDHA 2G1MA 1PVC2 3RZJA 3OUJA 5F32A 5A33A 1W3XA 1PMIA 3O1OA 5JDBA 2XLFA 2FZ1A 1VJ2A 3MLKA 3VBOB 4XW3A 1BLZA 4BMEA 3HOBA 3U4SA 1RUF1 1R082 2VO5A 4C3HL 1LHNA 1H1IA 1LKOA 2RMU2 3GTGL 1LULA 3VDDB 3D6EA 3RZTA 2CNAA 1IS6A 4GA9A 4GH4A 5F3GA 4QX5A 4CP1A 3E6CC 1AX1A 2JDYA 1LODA 3FMGA 3ZMNA 5CU1A 2QQWA 5ISLA 2TUNA 1BK0A 1QXJA 1LOGA 1UO9A 3PIP1 1UZVA 3DV8A 5HPOA 5CFDA 4XQ4A 2PHWA 4CCDA 2NPIA 3VBRB 1OPOA 1W2TA 4PIYA 5L9VA 2ZTNA 3TB0A 3F2ZA 1W6NB 3AZXA 1WMEA 1KJLA 3LZZA 4IE4A 5DXDA 4LJHA 2ZEWA 2QZ3A 2K0GA 3NNJA 5ABJB 1GANA 1O3SA 1REFA 3HT2A 1O5UA 3UYJA 4C0BA 1GICA 3MV11 2R92L 5FBZA 1CN1A 3FHAA 4AE2A 3GZEA 2H6BA 4GALA 1JU3A 2PTMA 2W1SA 1I5PA 1JHNA 1LEMA 1Q8QA 2WQ4A 4KBZA 4XVHA 1OPMA 3MLJA 2VE1A 2BOIA 2B39A 2Y26A 3AKRA 3CJIB 4LE3A 1HV1A 5C3QA 3ZFEA 1F31A 3QH6A 2CWMA 3N9OA 5L19A 1RIRA 1ZZ7A 3HQXA 5K9YA 1ZRPA 3GZUC 1A34A 1JHJA 5A7OA 1WCQA 3I4ML 1S0JA 2UWAA 4DIQA 2G9FA 1NLRA 4M0NA 4QHZA 4HVRA 4XXAA 1NKGA 4A3GL 5F6KA 3VD7A 4B29A 2A70A 2B5HA 2BVBA 2NVQL 5L36A 4L11A 5DPNA 1KXGA 1ZA7A 3VDBA 1N1YA 3LSDA 2RFKB 4FVVA 4QU2A 4C2M1 4RS5A 4UXAA 4O61A 4W6YA 3CEWA 3OUIA 4JGYB 1UY0A 1XNCA 2VOXA 1RJ7A 5D21A 4LBJA 3DKQA 2NZ9A 3GJAA 4AF9A 4HOOA 1XYNA 3HT1A 5EXOA 4XTPA 4XF3A 4TTGA 2CAVA 4GQ7A 3WCSA 1C5HA 4XYXA 4E27A 1UZYA 4JAFA 3C7FA 4JX0A 4LA2A 1EPZA 1QWRA 1VMJA 3TN91 2HWE3 3H8XA 1T9OA 1VRH3 1BVP1 4A3ML 1UAIA 1RXGA 1BQ9A 5K0UA 4YZ3A 2B63L 2WAAA 4IV3A 3OGGA 4BQ1A 3OUHA 1C1FA 4DB5A 4B1MA 1UYPA 3J8F2 3J9SA 3SS2A 2JIGA 1PO23 2WQ8A 2ZEYA 3HWJA 4HPKB 4OHVA 4HZFA 2X09A 3AKQA 3PTYA 1YCIA 3PU8A 1JU4A 2GMEA 4HKWA 3TYJA 3I7DA 4AHWA 1NA1B 2QQVA 2Y38A 1OWBA 2APOB 1QHDA 2ZGSA 3KWVA 4RR3A 5FAXA 5EINC 3HQRA 2ET1A 3H50A 5SV5A 2EVXA 1HN0A 3O12A 3N7MA 3VKFC 5A32A 2DU0A 1YIPA 2R041 4QQ2A 5BNQA 2DBNA 3BOPA 4N53B 1XU2A 1V00A 1HN1A 3POSA 3DPRC 3FKIL 1VBC2 2BTVC 4MGTA 4HFSA 4KNCA 1GOFA 4QXCA 4AQ2A 2RG4A 1V6OA 1QF3A 2RM22 1WCSA 2XVKA 1V6MA 2NVTL 2R32A 2PHLA 3LA3A 1DGLA 1W9SA 3FZ3A 2WZR1 4O65A 2MS3A 1AR71 2VTXJ 2NLRA 4DY5A 1OVPA 1RHI3 1VBE3 2J1UA 4MHUA 4EN7B 3WDUA 2VZRA 1ULPA 2IXCA 1EP0A 2G4IA 2MEV3 1FHMA 3POGA 4JQRA 3S30A 3RYGA 3DECA 1HRI1 1TNFA 4AI0A 1ND3B 2B45X 2ZHKA 3K75B 4JDMA 1SEFA 3WG2A 5I93A 3O5SA 1TME2 1HJGA 1FMD1 1OA3A 2YC0A 4H55A 4I3GA 1RUJ1 1DU3D 3LKJA 4DS0A 3S7EA 5DUXA 1I3HA 1MVEA 1UCXA 1Z7S2 2QDNA 4FFHA 5E16A 5F5CA 2PLV2 2WNUA 1WKYA 1WGPA 2W5FA 4GXLA 1RUH2 4KU8A 2X53S 1SLCA 2JECA 2ZX3A 3A7QA 4IEPA 5FWEA 2D44A 3ZXKA 3LWQB 3THTA 4AR2A 1GMMA 3WHTA 3I2KA 4H2AA 2FMDA 4LBOA 2W92A 3LE0A 2AUYA 2CU5A 4XFBA 1KFUL 2Y0IA 3NNFA 3WQ7A 2WYFA 3ZG6A 4YVWC 1H0BA 3PZAA 4OLLA 3KYUA 5CADA 2VH9A 4Q4X3 1FX5A 4CEYB 2Y6KA 3Q9OA 3GTLL 2CHHA 3S1NL 5FZDA 3N3HA 2PHTA 2HWB2 4P08A 5MLC3 1Q8SA 5IW0A 4HXCA 1V0AA 3HPNA 1NCRB 2ADEA 2BNMA 3AYDA 5IVYA 4CCLA 1SCSA 5A3MA 3AZZA 1RUD2 5HXVA 1KGYA 3I3DA 4OMDA 3VHOA 4F7ZA 4L97A 4MOAA 5I0SA 4JZRA 1PZXA 4COUA 1J3RA 3QLQA 4KQ7A 4TSVA 3LDKA 4FQZA 2JE7A 5SV8A 1FATA 2RR11 3B0AB 1UU6A 3FDJA 3DCQA 3D5OA 5DDJ2 4LO6B 1NXEA 2XBO3 2D5HA 5FK8A 2VMIA 5JIUA 1W28A 3O7OA 1L7QA 5JI7A 4XAEA 1O4ZA 2W46A 3GBFA 2PN5A 1XNTA 1EAH3 2RS31 3KB5A 1CZSA 5ACA1 1AYM2 5DUUA 4A42A 2EIDA 3OGVA 5GLUA 5BNNA 2WWUA 2GZWA 1D7PM 1SMWA 1XQNA 2HWF2 5FY7A 4ASKA 2BU9A 1GYKA 3K51A 3PL0A 3FLTA 4CP9A 3NKTA 4UY81 3ASIA 5LATA 1AR93 1RDVA 4JDOA 1SZBA 2M6OA 5G04L 3BIEA 2A6XA 1F2NA 5C44L 3I2FA 3VL8A 2WWJA 1POV0 1K12A 3RYRA 3C7GA 3FHQA 3M7AA 4BPZA 2BOJA 4A3DL 3B02A 1N47A 4N43A 3JB8A 1NQDA 1OA2A 2UYBA 4B4QA 1P7PA 2AC1A 1B2JA 2CGNA 1PFWA 1XSQA 2BJSA 1NZIA 2ETEA 2GP3A 3HOZL 2OPKA 2FHRA 2R072 4LUKA 3BKZA 1GP4A 1VZHA 1C8M2 1CAVB 3BPZA 4QX3A 5DAPA 4AVVA 3VBSA 1JZ3A 4LITA 3WDXA 1X8EA 3FN9A 3IWZA 2R0FA 4W8JA 3GTOL 4XJ8A 5FZ7A 4XDOA 4X6AL 3U0ZA 4XEZA 4HVOA 2W08A 3E5UA 5HBAA 3FX3A 2P2KA 3B94A 3DKWA 5FMBA 4ZXEA 5FJ8L 3WLUA 1PGL2 4UFIA 1CAWB 3AKTA 2ZEZA 4YVSA 1OT5A 1AXYA 3N7JA 3PUQA 4BMBA 5CVRA 5C4JL 2EIEA 2FD8A 3KD4A 2R6QA 1RYTA 3OGSA 1YJKA 5C5TA 4YNIA 2IXIA 1CESA 2HWE1 4FQ4A 3RS6A 3UJOA 1VRH1 5A33B 2E32A 2VBBA 4Y7NL 1SPPA 2PMZP 3MQKB 1PO11 2HJIA 1N1VA 2IXJA 1XRUA 3LFIA 5EYYA 4MLOA 3THPA 4BJ0A 3MEPA 5FPVA 5I0DA 1QJY2 1RVF2 1J84A 2J42A 2GSYA 2JI1A 3CBNA 4E8DA 2JE8A 2PAKA 5A7WB 1LB2A 2JG8B 3FC0A 4W50A 1OQEA 3QH7A 4P9YA 3MGUA 2JI3A 2X5IC 4KBBA 4NRQA 1CJPA 3NJXA 5ANNA 4DOUA 2VNRA 2Q4SA 1QJX3 3LDBA 3N9MA 2GC0A 1AJKA 4K8RB 1F4LA 1EUTA 1ST8A 3WV6A 3ZSKA 4AVBA 3KYVA 1UU5A 3QVDA 4ET7A 4FXKB 4CCKA 3ZN5A 5CFCA 2WS92 3KQRA 5CFDB 4B1LA 1RUE1 4TLGA 5M3FL 1GQGA 2VMGA 3CO2A 1JOBA 4ISQA 4CEWA 3NVCA 3MW4A 4BE3A 2PELA 3KVBA 3O14A 3OCPA 1H2KA 4QB1A 4Q1PA 4YZ4A 2BP6A 2KR2A 3JXSA 3V0AB 3NJVA 1J59A 3I3BA 2F4PA 1HRV2 3J7LA 3E6BA 5FZ1A 2R93L 2XR4A 4ATFA 2V3BB 3Q8EA 2RVAA 4G4FA 1U12A 1DQ5A 5JVG1 3D0SA 3RZOL 4XF4A 3M3OA 1PIV3 3H42B 2AR6A 1MR5A 3AP9A 4LHNA 2LALA 4GIQA 1V6NA 2MEV1 1O4TA 2R30A 4GMP0 2RV9A 1O5LA 1DGWX 4YW2A 1R092 4LBQB 4AVSA 3ZFEB 5FZ8A 5F2WA 1KQRA 3ZLIA 2BPA2 1Q3EA 1RMU2 3IU3I 3FWEA 3DYOA 1TWGL 2WO1A 2A3WA 4BK4A 2HWC1 4HN1A 4D69A 3IDEA 1O3QA 3MSUA 3BODA 4MZUA 3CQZL 5AVAA 4Q4Y3 4QAWA 2WWSA 3HR9A 6RXNA 2C9KA 2BUKA 3JBG2 1UPIA 3CLPA 1YRZA 3UV9A 5FMDA 2IFWA 1X9TA 1NCQA 1V9U2 2BVVA 1HB2A 2EXIA 2AUSB 3P2AA 1RUG3 1VBB3 3HOXL 4UWDA 1J3QA 5CA6A 1W9YA 1E5RA 5FXVA 1WW5A 2JB8A 2I07B 2VMEA 3WOGA 2YB7A 4BQXA 3VKLA 1LHVA 2D93A 1PGW2 5D8AA 1BZWA 3VBFB 4BXSV 1QJEA 2PHXA 5KR7A 4IXLA 4CU7A 2JA5L 2FDIA 3AP5A 3JZVA 2YXSA 4NMIA 2VCBA 2WZPP 4A7YA 4GB32 3VDDA 3ZN6B 5CAZA 2OQ7A 3NV1A 5CNAA 3K77A 4QHBA 5C3RA 2B9UA 5F5QA 4XZPA 3KSCA 3N4MA 1S55A 2WDBA 3KYWA 4YGBA 4CDWC 4YZ5A 2EXJA 3W59A 1XNDA 5J09A 4R9DA 3DL3A 2XMLA 1ND2C 1UQXA 4JHZA 2R7ZL 4J1WA 1HXS2 2WAOA 4CDXB 5FKCA 3ZOIA 2XBO1 5EV7A 1DIWA 4I0BA 3VBRA 1ASJ3 4AEMA 1K83L 2WO7A 1H6YA 2OUHA 3C3VA 1AXKA 4RR3B 3VBUB 1P8JA 4CA9A 4CU6A 3TBDA 2JG9A 3PO3L 2V5DA 4XIOA 3RI9A 3UESA 1WW4A 5ABJA 3T0DA 1VBD2 3KM5A 3T3YA 2Z4FA 3ZKYA 2WQZC 5GZEA 3LWOB 2VZQA 3ACIA 2F4LA 2XB6C 2QZ2A 3LOBA 3BI3A 2WNVC 4M4PA 1AR81 4O9EA 5C4WC 2YU2A 4Q0QA 2JD4A 1ULFA 1S2KA 1YHFA 2P17A 2VULA 3C7EA 3CJIA 1SBDA 3OG2A 3APBA 4P5HA 3UGGA 2ARBA 3LWVB 3MPBA 4CTEA 3RGBA 5KHGA 1WBLA 3LA7A 4K20A 2AYJA 1BMV1 2Q0AA 3LPFA 4JGZB 4FPKA 4M00A 3TNQA 1QJU3 3TWIA 2WN2A 1MQTA 1UWWA 1VRBA 2QQIA 4AR6A 4NAMA 5GZFA 5I8TA 1LENA 5GZGA 4AFCA 5LEJA 3OGJA 3VKMA 3ZFGB 1XB9A 4ATEA 1B71A 4QT6A 2OZ6A 1MZFA 2X05A 2FCTA 5IT6A 3S7IA 1VB2A 5FXWA 4ZZ5A 2LUWA 3OEAA 4IE5A 1UY2A 1NY72 4ORFA 1WCKA 4LBMA 2J9UB 2RS52 4XOGA 4H7LA 4NHLA 2BERA 3V65A 3KVAA 1UYYA 3RWNA 5FZ9A 1AL22 2O8QA 4FT8A 1ZREA 2WNUB 1O7FA 2AGSA 1PFUA 4J6GA 1WLTA 4WM7B 4LBKA 3U11A 3OPTA 3KV9A 3NNGA 1ZRFA 3VPBE 5JSRA 5A1LA 1LHWA 2D6NA 2RE9A 3LGRA 4NHMA 4Q4V1 3VL9A 1QH7A 3WY6A 3WNNA 4QKNA 2ZAAA 4LHSA 1W05A 5FP4A 3GZTB 5IYYA 5KC5A 2ZGOA 4BB3A 4XJZA 1NLQA 5GLZA 4UT5A 1MS5A 1HQWA 1B2OA 1RUF3 3UJQA 3HNMA 1NXMA 1MS1A 1W8ZA 4Q8LA 4RA0A 4K8FA 4V2WA 4K3UA 3H7JA 4HPKA 4DEVA 3EHKA 2VVDA 1H1MA 1QQP2 1WW6A 4BIFA 5FYZA 1OLQA 2R0HA 3S1RL 2E2JL 5HV0A 2YYOA 5AFBA 1IOAA 3M3IA 4QIWP 1JW6A 2OA2A 3FLPA 1BXHA 4AI8A 4AYBP 4DINB 1QJX1 3PMSA 5CB7A 4CDUC 1W90A 1PNGA 4NWVA 5FXXA 4N53A 3FFZA 1TMF2 1Y9QA 2B5ID 1SDDB 3IPVB 1Y1WL 1PK6B 5AFEA 2IUWA 3H8OA 4Q0PA 3WP4A 5IYDL 5T5OA 5FUPA 1Y3TA 4PBOA 1BBT3 1R0IA 4DRRA 3WP3A 1KEXA 1W9FA 3SH5A 4BYYA 1LJ7A 4C3IL 2V4VA 2YC2A 1AVBA 2A6VA 4EV0A 2XHNA 2OUJA 4I30A 5DZFA 1OOPA 4FPLA 4ZY9A 4HL0A 5A3UA 1WD3A 5FZBA 3MUY1 4IQPA 2ZEXA 4KL1A 3M8LA 1PIV1 1DBNA 2BQPA 1OWCA 2RDRA 4AGVA 4EWAA 4DRVA 1ND3A 1NLSA 4QB6A 5AVPA 1K5MC 1XE8A 3U14A 4URTA 1VALA 2YFZA 4NRPA 4DUVA 4XF1A 1DLLA 2RDSA 2ZPXA 1RL3A 2WKKA 3GBGA 3ZXFA 2IVJA 2KD7A 2VCCA 3VBHC 1QDOA 1RUI1 1SLAA 1UY3A 4I0WB 3T4VA 4A2UA 4OVEA 2VCMA 3ZDVA 1TQ5A 5FYCA 4Q4Y1 1YFYA 3ZM8A 3KS7A 5JXIA 1MZ5A 1N3QA 2A73B 2J1TA 1N1SA 3RJRA 3VBSB 4OZOA 4XXPA 1CAXB 1GWKA 3VKOA 3C2UA 2VMFA 2ZBJA 4N9IA 4YW4A 1VBB1 3OPZA 2LCQA 5JMCA 3ETQA 2NQYA 4BY7L 2ATFA 5FFOC 4BHPA 4DUWA 2VL4A 5HCHA 3IZOA 3WNOA 1OC1A 3KYYA 3NFPI 1NA1C 1TNRA 3BB6A 5LBFA 3RQ0A 3RMXA 3J7NA 2AREA 3H1MA 4BQ4A 4OULA 5KHIA 4ARYA 4F3JA 3ZYHA 3AXDA 2A6YA 2VOWA 2JE9A 2QQUA 1HX6A 4ONUA 4CCMA 4FXGB 5J3UA 5FZHA 4Q26A 3SMHA 2VAUA 4A6OA 3GTJL 1EY2A 5FYYA 2EAAA 2ZA9A 3B08B 4IEZA 4S2FA 1NXGA 1O8PA 3PWFA 1W8HA 4IEUA 2NVXL 1WWYA 2BV4A 2JA7L 5A80A 2WNEA 3JD71 2P3JA 1OUXA 1RYQA 2SBAA 4AR5A 1FV2A 2VZPA 2UU8A 2BRTA 4BU2A 4NIHA 4FBFA 3BIWE 5AI3A 1W06A 4LO5B 3H7YA 1H8TC 1V70A 2MPFA 3ZXDA 2HYXA 2D7FA 3KZ4C 1ASJ1 3LOIA 4E4SA 3O0XA 2QQMA 4WV8A 5DUVA 1NUKA 2V0EA 2TEPA 2DV9A 3M70A 5IATA 3TN92 3I4NL 2BGCA 4A6SA 1FPN1 5IJRA 4CDQA 2R043 5EHDA 3I2GA 4QPGC 1LGCA 3PUAA 2ARAA 1W0OA 2JKXA 1IZ3A 2YPJA 3WNXA 1OLME 4BWOA 4RGAA 1S2ZA 4UFJA 2GMPA 3BTXA 5M3ML 1H9WA 1JTZX 4LHLA 5F5IA 3R6SA 2P3YA 2PMWB 4LNVA 1US2A 4UW5A 4MYEA 3WF4A 2QKDA 4NWWA 5IFPA 1HW5A 2Y34A 1G86A 4Y33A 5LA0A 5KXEA 4YW3A 4XETA 3KT1A 2D40A 1UOJA 5J48A 2FDJA 2C0ZA 5L7OC 4WBBA 1IPKA 2TNFA 1WD4A 2A5ZA 4M3CE 1C5IA 4YGEA 3T09A 3BN6A 3AYAA 3RI8A 2P3IA 5FYSA 1HRI3 3TAYA 5JLVA 2F6BA 1Q8OA 1W8TA 4LOTA 1X82A 1OH3A 4SBVA 1FMD3 4CP2A 2QVSB 5GAHc 1OD5A 1RUJ3 2P6HA 1YUZA 4CEYC 5BNPB 1G9DA 1HB3A 3ZFFC 4JAGA 4Y26A 5T3NA 3AVSA 3WINE 5FYVA 3WQ1A 4FFFA 5A7SA 4MGYE 5KXCA 1J1LA 3B5LB 2WZR2 3G7DA 1XE7A 1ZNPA 4MXWB 1AR72 3SCFA 3HNBM 4XHXA 1CAWA 1SMUA 2CSGA 2C5DA 5FV3A 3WNMA 1JH5A 4H7MA 1W8FA 1R0JA 2LS6A 2VOTA 3M3CA 3PLQA 4AHXA 3SISA 2I2SA 3K48A 3VKNA 5DABA 1LOFA 3PVOA 2W39A 3POBA 4QPIB 4XACA 2JX9A 1WCDJ 1DQ4A 1C28A 5C3PA 1NE6A 1IPJA 1D4VB 4XE9A 3RG0A 1BHGA 1R1A2 1WA4A 1ZA4A 3SHRA 1CX4A 2Y8KA 2B4KA 5C71A 5D8AB 4AG4A 1COV2 4POGA 4NJ4A 5EJZB 2RJ2A 3D3AA 3TOJA 4MADA 3EO6A 1IU5A 3ZSLA 4AAXA 5AC92 1OF3A 4NIGA 5A7WA 5F8PA 1JYVA 1Q43A 1HQLA 2JG8A 3M3YL 1CPNA 5FZLA 4XXBB 1UOFA 3OYWB 2IXHA 4BLIA 1HIXA 4FOVA 5LCWL 5H9PA 1JYWA 5MF6A 4BCUA 2VL6A 3LIHA 5J98B 1LNSA 2K46A 2R1DA 3KHCA 1AX2A 2DVBA 2RR13 2VGDA 4XBNA 4Q8KA 1E57A 1GUIA 1OI6A 2FQPA 1YFXA 2XKPA 3VUOA 1FAYA 3K3NA 2DCZA 1R0GA 1QCVA 2EY4E 2RS33 4HK9A 4K9SA 5FZIA 3HOWL 1IGOA 4BY1L 5ACA3 1AR61 2JG9B 4ZPIA 2NP0A 1BBT1 1JYIA 2VTFA 3RJ2X 1W0PA 3V0AA 3HOYL 4EN9B 5KWRA 3N9QA 4M4RA 8RXNA 4UFLA 1W04A 4YLZA 5JZGC 1TWCL 2R063 2YPDA 4K21A 5J96B 1SMMA 3KF5A 2NYDA 2Q8OA 5A3PA 1LESA 1PHMA 4AW7A 4KH9A 2E2IL 2VU9A 4LBQA 2VUCA 2PA7A 1O59A 2NVYL 3CL1A 4FSJA 4AR3A 1RITA 5JXJA 3B9CA 4AEDC 5DAVA 3W9AA 4GKYA 5EWSA 3PUSA 2ZACA 4N7IA 2PXJA 2CYFA 1BEV3 1G8WA 4XUPA 5C8CB 3SKJE 1W03A 4XUTA 1MQTB 3QACA 3DF0A 1O91A 3QQCE 5KHKA 4IE7A 2DURA 4FPJA 4UF0B 5BNOB 2YV8A 3TEWA 5J1XA 1PZ7A 1XE0A 1DG6A 2WRAA 4OUSA 1T9PA 1KDMA 2TBVA 4AQTA 4QX1A 4F8AA 5A7NA 5I8YA 1W2NA 5LK5A 5A70A 4X6RB 2L0ZA 1L3JA 2DBIA 4IUGA 1SDWA 3N9PA 5GLTA 4AFAA 2WINB 1LOAA 1W8WA 5JR2A 1W2AX 3GTKL 2D6KA 3GGLA 3VBFA 4B3NA 1GNYA 2BBVA 2UWCA 1QY4A 3VB9A 1NT0A 4CSWA 1R1ZA 4B4RA 4OMCA 2VMHA 5CBLA 4DEQA 4HT1T 3ZN6A 4GH4C 4C91A 4QM8A 1ENQA 2ZGPA 4AZZA 4ZKTB 4W4ZA 2HYKA 3KGLA 1PO13 2ZJCA 5CIRA 3U1XA 5CFDC 1R0HA 5FJHA 4XHBA 1YK4A 3VZKA 1EYBA 5FP7A 1G6NA 1XNAA 1YFWA 1ZYBA 3J7HA 1W2OA 4IV1B 4PIXA 4S2DA 4CDXA 4A4AA 4D94A 5CEHA 1S24A 1RINA 4D7YA 3VBUA 1JODA 3H1WA 4FOWA 4XURA 2OYZA 3HQUA 3RVHA 4FPGA 2ZKLA 3MW2A 2VC9A 5DAQA 1LCLA 1ZVFA 1DF0A 4A41A 2HWE2 3I97A 2XLAA 1LGNA 1VRH2 2DTWA 2VNOA 1OFSA 3VHPA 5A1FA 2GAUA 5IYCL 1RUE3 2LRPA 2XVLA 4XJUA 1WCUA 4AVCA 2E31A 2FMYA 4L8QA 5GZDA 3BTYA 2YROA 1FOD3 1RUC3 2YU1A 3CKHA 3THDA 4YM3A 2KN9A 3H3UA 1DZQA 1PO22 3WX5A 2OQ6A 4HSLA 5T5PA 1JBCA 3SCGA 5F1RA 3R4DB 3ZIWA 2HEWF 3B3QE 2ZGLA 5FR3A 1ULOA 2B7YA 4IDZA 5JVH1 2GNBA 4QGLA 4BXXL 1WZXA 3T2PA 5I91A 4JGZA 2WFPA 2XL9A 1JYBA 1QNYA 5DMYA 1JI6A 1OOPB 1FV3A 1U0AA 4C1XA 3ZVXA 1U5YA 5FZKA 2VMDA 3VZOA 5CG9A 4RS5C 3AB0A 3OSDA 5LA2A 3ZFGA 1JYXA 3BUCA 1JZ7A 3V0BB 4FP2A 5KHJA 3GALA 4GWNA 1JZ8A 3M1HA 5GKAC 1DLCA 3PHMA 2VVFA 4X8PA 1O6UA 1YIFA 2HWC3 4I09A 3AFKA 4V1PA 5FPBA 5LY2A 4EQVA 5FQ0B 1Y7BA 4YG0A 3H8UA 2QQOA 3VD4A 4L92A 5CKMA 4MGIE 4WM7A 2VBDA 1LU2A 2V0FA 1QJZA 3VD9A 2HBUA 4HLTA 4XABA 1AYN3 3ORJA 4A3JL 4MGKE 1ZBE3 1JOJA 1XU1A 1RHI2 1ODNA 1VBE2 2HLEA 5FK7A 2ZABA 4AI1A 1S0CA 2WSUA 3IT8A 3T1LA 5K0UC 1B13A 3S57A 4IV3C 1DZTA 3EB7A 5JXHA 4ZHNA 1A78A 2MEV2 1RDGA 3PIO1 2QQJA 1S0FA 1XC6A 2WBKA 4L9BA 4QX7A 3NJYA 2P34A 4GJZA 3JUUA 2VCAA 5C8WA 2AENA 1PZ8A 1JZ4A 1T9QA 4GULA 4NPMA 2OS2A 1NNQA 2BDRA 1UXZA 5E1RA 1GSLA 1VBA3 3BGAA 3IBMA 3SKVA 1Q8PA 5C4XL 1W9WA 2EIGA 4WVZA 3VHRA 3TEZA 4RR3C 2WZ8A 4BLJA 1I50L 5FP8A 3HJRA 5FY0A 3ES4A 4XF0A 1EPWA 3HIFA 3A44A 3ACHA 1YQ6A 1OKOA 4ASLA 4OI2A 2C26A 4QDSA 4UFKA 2KM2A 3NNMA 4FPYA 4EN6B 1UKGA 4ES8A 3PUHA 5IK8A 2V09A 3IPVA 4YG3A 4COYA 1PK6A 4LLFA 4XCBA 3ALQA 4IEXA 4Q4X2 2X8KA 4XFFA 3S6PA 3C7HA 1VZGA 3R05A 3S14L 1VIWB 1ZBA3 4RHV3 4UFMA 1B35B 4JQTA 5L9RA 2GC2A 1UZZA 3ENRA 4PJYA 4CDQB 1UX7A 4LOSA 3IB3A 4KWLA 4B8CD 1T6BX 5MGNA 3PJYA 1LECA 3I2DA 2HEVF 5T54A 1H4HA 1AR83 1CAUB 2VBPA 4AI3A 2W1QA 3RYPA 2RS13 5K8SA 4P9GA 2AYHA 2DF7A 2R061 3WWNB 4V2VA 1CR7A 2ENRA 4BOWA 4W65A 5IP9L 2XBO2 3FUOA 4M3CB 2R49A 1JZ5A 3S5QA 1OF4A 2E63A 5DZEA 4YWAA 3O1UA 4C1WA 3LQCA 3VZJA 3IMMA 1ACCA 1EAH2 4N8MA 4RGGA 4XFIA 4B7KA 4NAOA 3H3LA 1BEV1 2P37A 1S0EA 4Q4W3 2ZOEB 4QX8A 5FY1A 2KA3A 4D8MA 1SLIA 2IWGB 5F6LB 1HB4A 4U36A 3K35A 5KXDA 4GJYA 4MV2A 4P14A 4D6SA 1W2UA 1CAXA 1SLLA 2P4EA 3WDVA 5GZCA 1AR92 2Z69A 4AQSA 5IYBL 4MUVA 5A3LA 2XLGA 1IHMA 1M4WA 3PVEA 5LA9A 4AEKA 1CD3G 7RXNA 1X36A 3OJBA 4MGZE 4G3YC 2BNOA 2GNDA 2XHKA 3RZZA 5KBFA 1BMV2 1FI2A 3MI8A 4LUMA 1R0FA 4YG6A 1WA6X 2YDEA 4YWMA 4Q4V3 1MVQA 2AACA 4I3PA 5GALA 1AXZA 1MS0A 3PVBB 2XJQA 3VZMA 1S1AA 3J26N 3OY8B 1CWPA 5F3IA 1W6MA 1WLWA 4OHYA 2PVXA 2XJPA 4QB2A 4H14A 3WF3A 4RFRB 2NMOA 3LNLA 3JCIA 4OUEA 3AL5A 4PCRA 3INAA 1REDA 3PKJA 1X8MA 4URAA 4IEOA 4YPJA 3ILNA 1U5IA 1IG0A 3CNAA 1RGSA 2DTYA 5C6CA 3I2OA 1CONA 3U78A 4AI9A 4MG2A 5IVVA 5BNNC 4DXZA 2GMGA 1X9PA 2W94A 2ERSA 5CZKA 2GMMA 3JB4C 1CAAA 1UOBA 5E88A 1FXZA 2BBAA 2XQXA 3MHZA 2Q1FA 4IL7A 3UETA 4Z1VA 1K42A 2DCJA 2WT2A 1QMJA 3Q8CA 4LIVA 3IIIA 3HOUL 1DYPA 1QEXA 4PF5A 4PI0A 4JKLA 1VBC1 2ORZA 3WW1A 4LBQD 4OZXA 5FPUA 1Q5OA 3RZDL 1UKRA 1FOD1 1RUC1 2E9QA 2Y6GA 2Y60A 2D3RA 4BBRL 2RM21 3DYPA 4MX3A 4N43C 1GOHA 3SH3A 4HSJA 4JC1A 1SFOL 2W1UA 5ANQA 1REEA 2SLIA 2C24A 5GM0A 5J37A 1YQ5A 4BIOA 1IKQA 5FYIA 2VXRA 3JQXA 1BJQA 1RUNA 4E2QA 3I2HA 1QJX2 3W58A 1VP6A 4L0PA 2J1SA 1RB9A 3MIFA 3PU3A 5FPZA 4LHKA 4CDWA 3ECQA 1H8VA 1KD7A 1OA4A 1YNAA 2QTWB 2BE5D 3KCXA 4NHKA 4UFHA 4DUXA 5A7QA 3S16L 4AL9A 3T08A 4QMAA 3Q8FA 4ZN1B 1Q56A 1Z92B 1AZDA 1Z78A 2RJLA 4NHYA 5FZAA 5KHHA 5BNPA 4EJRA 3A21A 3LEKA 1RUI3 4BZ4A 4YVSC 2JI2A 2LROA 1Z7S1 2WC2A 4P9LA 3LEGA 1WLDA 4IGQA 4MXWA 1RUH1 3ACLA 4WVVA 2VQUA 4OHXA 2ERFA 2G9ZA 1AYN1 1KS5A 1ZBE1 1F4AA 1UZWA 3E6DA 2CTVA 2WIIB 4KMQA 5CYYA 3KV5A 3K4AA 4LKEA 4QPIA 4MO3M 5FMOS 5JSOA 1PIV2 2ZHLA 4NIAA 4LULA 3SEEA 3DPRB 3IKWA 1XOYA 5A3TA 3U4XA 1UY1A 1UXXX 4YRDA 1ODMA 1DVBA 4FCAA 3SXWA 1LKMA 4XILA 4PDWA 1N3PA 2Y6HA 2QE3A 2EICA 2RDNA 1W8OA 1VBA1 1W3VA 3R0RA 2DVDA 3AZVA 1TWFL 1RUD1 1WBFA 3AK0A 2IXLA 2C6AA 2ZGQA 3AYCA 1BKZA 3OYWA 4LMFA 4Q4Y2 4Y3OA 3I3MA 2FDHA 1KRIA 1LHOA 5J7MA 1S4CA 2P6CA 4DXSA 3MIDA 5CFCC 4YW7A 3JD73 5C9AA 4HG6B 2CKAA 1RUG2 1VBB2 2BW8A 2BYVE 3MF9A 3MIGA 1A8DA 3ZN4A 4E9KA 2VW2A 1POQA 1OBNA 4CEWC 2WT0A 4AVAA 4JHTA 1TWHL 4NROA 1DQ2A 1JUIA 1NE4A 1HLCA 1H2NA 4LO4B 4OYUA 3UK9A 2VD7A 1ZBA1 4RHV1 3WG3A 1FPN3 2O8OA 4WM8C 1US3A 1G9AA 1DYKA 3H3VM 1AYM1 4DXTA 3WP6A 2QQPA 3ZMOA 2UYAA 2HWF1 3J7Z1 4QQOA 4YARA 3OOXA 2E26A 3WCRA 3ZX7A 1OD3A 1OQ1A 2DYCA 2RS11 3ACFA 4YVWB 1OURA 5H1Sc 5IK4A 4L99A 5HCFA 2WSVA 2FBEA 1XJAA 2EALA 3AJYA 1CVNA 2VZUA 3I8TA 2XJSA 3MF6A 5A6QA 1RXFA 5EP9A 1ASJ2 4EZHA 4Y1UA 5A3NA 4RQPA 4IE6A 2CY6A 5C8CA 1WLCA 1FNYA 1GZWA 1R9TL 1NCQC 1POV1 1YQCA 2XQRA 4Q4W1 4UF0A 3SH4A 5BNOA 2PHFA 3FL7A 2ZGUA 2JWPA 5JIAA 2ZX1A 1EUUA 5JOWA 3O1VA 1W39A 4HANA 2QFEA 3VBOC 3WP5A 2A69D 5D8AC 4TVMA 2CKCA 1QQTA 1DGRN 1F15A 2W2IA 5DZGA 3ZXEA 1E5SA 4TWTA 1A8MA 4PF1A 3VDDC 3WG4A 3N9NA 3POYA 1LTEA 2Y6LA 2BWCA 2C6SA 5FKBA 1ZZBA 3VDCA 1QJU2 3T4HB 4CXXA 3ZO0B 1WMDA 2KXLA 2CGOA 2IFRA 2W68A 4M3CF 4MGQA 5IVBA 4JAEA 1C8NA 3NQHA 2XJRA 1UMZA 4QKBA 2D98A 1IRNA 2JENA 2GALA 3ME2A 1VB4A 5BXXA 1UN1A 1UPSA 2CV6A 1QJY1 1D2SA 1RVF1 1SMVA 2JDKA 2WO2A 3ACGA 4HONA 4K9FA 4YFWA 3USSA 3VBRC 4BISA 4CPBA 2A6ZA 4Y1ZA 1FYUA 4IV1A 5FLJA 5D2AA 3H9BA 3ZKUA 3ZPOA 3M2MA 5ABJC 4XC9A 5B4NA 5IVEA 4NUBA 2HBTA 3HBKA 4RN5A 4CXYA 1B09A 1D4M3 2BNNA 4Y5Z0 3UGHA 3X29B 2WAQP 1U5ZA 2W52A 3EBRA 2YGLA 5IP7L 2W3JA 2JD9A 1ZRIA 2WLQA 2E6VA 3CJIC 2W87A 1RUF2 1W6PB 1VR3A 1JS9A 5FYUA 5GLWA 4RFT0 4BXFA 3BU0A 4GAZA 3UKNA 1AR63 3OBAA 4Y4RA 4KGQA 2OVUA 2GNMA 5JOXA 4JKMA 1PX4A 3LA2A 5DQ0A 5E6HA 2RDVA 2W1WA 1F35A 4XFHA 1D2QA 5FUIA 2G19A 3WXPA 3CMGA 5GAGc 1ONAA 4BQYA 3GTPL 1LEDA 4Q5OA 4A44A 5C5UA 1G7YA 1GNHA 3HMYA 1LTLA 2HEYF 3S2DL 3LCPA 2ZGMA 3NAPA 4FOQA 5FLIA 2VQAA 3ZSJA 3J7Y1 3H0GL 2ZGKA 3V0BA 5EIOC 1RTVA 1R091 1URXA 4JGYC 2IXKA 2PPTA 3ZXGA 3K2OA 3WQBA 5F37A 4PLOA 2WA3A 1DCSA 5T55A 3E5QA 4FP3A 1C09A 3H9AA 5FQ0A 1VZIA 3AZWA 5H9SA 2ZHNA 4ISRA 1BBT2 2X5IB 5IAVA 1IPSA 3MIHA 2P3KA 1E8JA 1AJOA 1SACA 1UY4A 3KCCA 1ZRRA 1YYNA 1PFVA 4GMP1 5D1IA 5B2GB 4QWNA 2CAUA 4CCCA 4A3ZA 4U671 1ZX5A 4NOTA 1DP0A 4P02B 4BM8A 1V9U1 1FT9A 2ZZJA 3A4UA 3NMBA 3O1MA 2VZOA 4KG8A 4DXRA 4FTBA 5IHRA 3RNSA 5LASA 3FBYA 1V6KA 1YC61 1H9PA 3H9CA 4Y24A 3E1F1 3WHUA 1LR5A 2YUEA 1WMFA 5HXMA
chains in the Genus database with same CATH topology
4HK8A 5BUVA 2NMNA 1GZCA 1A6CA 4GB31 3JU9A 3BU7A 3CU7A 5IUQA 3USUB 5FDBA 2KKDA 2A75A 1W6MB 2D6PA 2K9ZA 1JUHA 2WJSA 3WVJA 5FO7B 3NKGA 2VOVA 3M3QA 3QD6A 4N53C 4TZDA 3GYDA 4AWDA 2AZ5A 3MW3A 2A7AA 1CPMA 1G9BA 3DUIA 3VGIA 4EWEA 3S0MA 4FTEA 2PHRA 1WW7A 5I0TA 3A0KA 4X6QB 1B35A 3URFA 1ULCA 4QQHA 4R8HA 4HKOA 1VBD1 3MYXA 3WZ1A 2PYAA 1AF9A 2ZHMA 4IEQA 3AMPA 4Q27A 3P3PA 5F9TA 5AI2A 4L2NA 1CAUA 3IMNA 1ND3C 1NQJA 3D0JA 3IDCB 3GF6A 4IEVA 3MFAA 2HWD3 2C1FA 4M3CA 1SBFA 2ARXA 3QBQA 1SCRA 1MEC3 1N1TA 2D6OX 3ST7A 1KJRA 4Z8BA 2OW4A 1YFUA 2DFBA 2R042 1EV13 2RJKA 2VNGA 2Z3QB 4CDWB 1XNKA 1AX0A 2XGXA 4Q0UA 4X8NA 3TNPB 1ND2B 2WA4A 3JQWA 5LRRA 3FLRA 1NY71 1UIKA 2RS51 2PYTA 3WUCA 3IIAA 2PHUA 4Y1YA 1AL21 5T52A 4WVMB 1F9KA 1NCRC 2EXKA 2PSMC 2WFF3 4S2HA 2H12A 1V6LA 4YM1A 4K1YA 4K1ZA 1SFYA 3HN1A 4FPFA 4YW1A 2V5YA 3AX4A 2CGPA 1PVC3 3OY8A 1FNZA 1HRI2 3I54A 1DFQA 1BRFA 2G9GA 5C4WB 2D3SA 2ZGTA 1R083 3OF1A 4LBLA 4PDWB 1FMD2 1RUJ2 2RMU3 1NZCA 3SNMA 3N35A 1QQP1 1VCXA 1X7NA 1C3HA 5E8AA 1H2LA 2A71A 1QNWA 3WD5A 2YHJA 5BY5A 3QCWA 1J3PA 3AP7A 2R16A 5DM61 5C9AB 2I74A 1D4M1 4COWA 3WW2A 1QOSA 1F8VA 1TMF1 4XFGA 1PNFA 2ZMLA 4ES9A 2BFUS 4FPHA 2W0XA 4ZXKA 3T1MA 2VUJA 1BVVA 2JXAA 1NG0A 4JADA 1O3RA 2PAEA 4W6WA 3NV2A 3MIEA 1CADA 1H2MA 1YO8A 4QQLA 4QGNA 1G9FA 1IS3A 1MACA 1TEIA 1ZZ9A 3MDPA 4M01A 4RD7A 4XBQA 4FPEA 2RR12 3I59B 2ZCWA 1NYWA 4CYDA 1TE1B 5HCBA 1UW8A 2E7AA 3CF6E 4DZGA 2X29A 2XWJB 3AZYA 1LOBA 5JSPA 2B46X 1W6OB 2RS32 4WZFA 4RQPB 1ENXA 5ACA2 4IETA 2B8MA 3SITA 4HBNA 2EXHA 1RUOA 1GZWB 1GQHA 4JRAA 5DG2A 4NR1A 1LOFC 4OI0A 3B93A 4CDUB 4R9CA 2C9AA 4G9SB 3NO8A 4JVAA 1DGWA 3A0NA 4XGHA 4YLZA 3QOPA 4K40A 3B00A 4YM0A 2R062 4JTOA 4Y22B 5FMOL 3DPRA 5EFUA 3BOWA 3MICA 1W6QB 2JG8C 4WFN1 1S30A 3G6JB 4Y20A 1BEV2 2O5JD 1I9RA 3B01A 1V6IA 3BALA 5EZWA 5T5LA 3VN4A 3ZYPA 2PAMA 4AHYA 4Z92B 3HBZA 3J8F3 1F5JA 4META 2K2DA 2CL2A 2H0VA 1K5MB 1DQ1A 3I4IA 4XMIA 1MZ6A 1YI9A 3MLLA 4JAAA 5I0UA 3WG1A 3OD4A 2ZAHA 4OHZA 5FCCA 3PNAA 3VBHB 4DPNA 2HKXA 3ATGA 2WL1A 2DWRA 4LT5A 3KLSA 2GDFA 1PO12 4FAHA 1VBC3 3OBRA 2M4YA 2VQ0A 1YXWA 3ZFEC 4YVWA 2Z42A 1H30A 2RM23 4KU7A 3ZYIB 1LOEA 3P3NA 2GN7A 4XQDA 1CJDA 1GKBA 1SLTA 1J58A 3AMHA 2HWD1 4QPYA 4NVPA 1YLLA 5GADc 4WVWA 1UF2C 4AFDA 5JPMB 3AMQA 2CR8A 4YWLA 1RJ8A 2VW1A 1MEC1 2ZS6B 2QCSB 3BCWA 4MSVA 4P9IA 5CIRA 2MHFA 5BYNA 4AHZA 2ZX4A 2XG3A 1EV11 3NAPB 1LKNA 1IROA 4RSUA 4LE4A 1RUE2 2XKOA 2M6PA 3M3EA 4IERA 1TME3 1IW7D 4PLMA 4YSFA 4DY3A 1FOD2 1RUC2 1VAMA 4PIZA 3VBFC 4IEYA 2XVGA 1Z7S3 1H8TB 2CWSA 1YV1A 3L2HA 4D3WA 5IY0A 2PLV3 2PHDA 3AJZA 3AMNA 2ZX0A 3SLIA 1RUH3 5DUWA 5MFPA 1KS4A 1UD1A 2WFF1 4LO7A 2XH6A 2DCYA 4AXOA 1H7VA 3AP6A 4QPGB 2DFCA 4O9GA 1PVC1 5GJ6A 5IK5A 2WT1A 4C0HA 1R1A1 4JCKA 5GAEc 1HDKA 4UBHA 5JR7B 3FUQA 5HCAA 1COV1 3E5XA 4CDXC 2HWB3 1R081 4UBGA 5AC91 2HWC2 3LPEB 4SLIA 2RMU1 3OTFA 3VBUC 1RUD3 4TLFA 3MZHA 4ZU5A 2ZGRA 4INDA 3AKSA 3VZNA 5L7OB 2YMZA 1AYN2 1ZBE2 3NL1A 4HETA 1OMIA 5AN9H 2D3PA 3KMHA 4AR4A 5DDJ3 4XFAA 1C4RA 3ZYGA 4Y4YA 1ODHA 4WZCA 3ZFFB 1N3OA 1W6PA 1S0IA 3EQEA 3WR0A 1ZZCA 2DVAA 4D7SA 1VBA2 5I0RA 1AYM3 4JGZC 4P9WA 2JDZA 1Z0HA 1YWKA 2QDRA 2LTNA 2R1BA 4RL7A 3KT7A 4CRQA 2HWF3 4I0AA 3VHNA 1O4YA 1D0HA 1OKQA 1VAVA 1GV9A 3ZFGC 3WDWA 5FLHA 1RB8G 3H0OA 3IDBB 4G6BA 1SQ4A 1IS5A 3E97A 4YZ2A 4MVTA 4C90A 2K2SA 1F5FA 1SBEA 3H1YA 1ENRA 2Z2SB 5KXBA 3GBWA 2UY9A 2WNUC 4WM7C 1ZBA2 4RHV2 4AFBA 3KYXA 4HKLA 2X5IA 3GHMA 4LEJA 1POV3 1QU0A 4P9XA 3WDTA 2HR5A 2R073 2ZKNA 1C8M3 4W6XA 2XL7A 1MS4A 1GZ9A 2V73A 4CP0A 2YZ4A 5JOZA 2D43A 1AR82 3V64A 2RS12 4HVQA 5FOBB 2GC1A 1LGBA 4QGMA 4YM2A 4YZ1A 4QXKA 2EA7A 4K6BA 2JICA 2Z5WA 3D4KA 3USUA 4Q4W2 2A68D 1APNA 2OZJA 1CGPA 3LSEA 3NV4A 5JZGB 1RC6A 2ET7A 4FO9A 4YW5A 5JI9A 1QJY3 1RVF3 3KCYA 4H3WA 1PK6C 4COVA 3J8F1 2JJ6A 3B9IA 1ALYA 1YK5A 2E7QA 4AFMA 4AEDB 5BPXA 2DVGA 3PKIA 5IK7A 1QOTA 4UW4A 1LKPA 2E53A 2GN3A 4Q4V2 4IESA 1I1EA 1UU4A 3GHNA 4AGRA 5JWPA 5J36A 3MIBA 1M06G 1S0BA 3B7MA 2WS93 1XYPA 1QXRA 1YJLA 1UX6A 3NSTA 1WJVA 2ZMNA 3BTAA 3ZSMA 4B8EA 1PO21 5RXNA 5L73A 2O1QA 4BA6A 3NJZA 3ZPYA 3WW3A 1HRV3 1IU6A 1BQPA 4M0HA 1VLNA 4GH4B 3ES1A 1DX8A 5K2ME 4Q0VA 3VBSC 3AMMA 1QKQA 5CG8A 3IN9A 3T2TA 1IQAA 3UKVA 4AK3A 4EROA 1R093 2D97A 5JPNB 2D6MA 1ND2A 3J4UH 4LLOA 4AI2A 2QUOA 1GLHA 3D8CA 4JDNA 3AFGA 2VECA 1RMU3 4DMIA 2VUAA 1TME1 3N36A 3O0VA 4JTNA 4A7ZA 4OFGA 1S0GA 2IZWA 4GMP3 1GBGA 1RWDA 2PLV1 4WVMA 4FTSA 3ZXLA 2ERJA 3JBG3 4WM8A 1V9U3 1ZZ8A 4KGGA 4I01A 1RHI1 1VBE1 4CZSA 5BV6A 3ILRA 4DFSA 2QJVA 1UIJA 1LU1A 5LK7B 2WNVA 2MNGA 2A3XA 1H1AA 1NOVA 5EYXA 3FE5A 5C4WA 1JXNA 1JYCA 1KFXL 2WLPA 4MH0E 2HWB1 1C57A 4GB33 1X33A 2BEOA 4Y20B 1RUI2 3MFCA 5EJ3A 5JCTA 4I02A 1QYBA 2A6HD 2OIIA 4E6YA 2NYYA 3AYEA 1SFNA 2FZ2A 2DCTA 5GLVA 3R4UA 4E2SA 4XJAA 4I2OA 4PQ9A 2DUOA 4XPVA 4RS5B 3WDYA 1S2BA 3RYKA 1YUXA 1Y43B 2ZZQA 4RXNA 1HXS3 3GZAA 4YGCA 3VBOA 5DDJ1 5JOYA 5I8SA 4R4XA 3WQ0A 1XYOA 3RPQA 2XJVA 4Q4X1 2B42B 4Y1VA 2BFUL 3U07A 1ULDA 4XJWA 4DQAA 4LR4A 1ZM1A 2I45A 1QDCA 2YGMA 4LA3A 4Q0SA 4XTMA 4ZU4A 5FO9B 3MPSA 1VBD3 3AM2A 5DM71 3ELNA 4LTAA 4JRLA 2UURA 5K0UB 1DHKB 4YGDA 3P8BA 4IV3B 5C33A 2XPJA 1XXNA 1BFYA 5LRSA 3JD72 3I59A 2PQQA 4OUMA 5BNPC 2A6ED 5KC6A 4NPRA 2LM3A 2DVFA 4OHWA 3U10A 1W6NA 1W6OA 2Z3RB 3LB9A 1EAH1 2VW0A 3OBTA 3TRSB 4EN0A 3UKTA 1FPN2 2NM1A 5A32B 1V6JA 1HV0A 2VPVA 4GWMA 4KWKA 2R071 2IC1A 4HN0A 2BWAA 2XUMA 2DU1A 4QPIC 1BYHA 1C8M1 4CDUA 4YFZA 5LEKA 2ES3A 1VAKA 3ILFA 2VOKA 2A3YA 2PFWA 1KDKA 2RS53 1AR91 4Y22A 4PDWC 1CIWA 1KITA 3R4SA 1AL23 4R9BA 2M4VA 4Z82A 4XFCA 1LHUA 4FAGA 5FO8B 2XJTA 1T6GC 1W6QA 1PGL1 3ZSEA 2GH8A 4PLNA 4TPUA 2NN8A 1HQNA 4EWDA 3ZIXA 5C9AC 4XF9A 5H9RA 3GNEA 4R52A 2YY1A 4QD2A 3HAGA 3ZDSA 4UW6A 2XJUA 2PVEA 3IM0A 1QQP3 4JGYA 1K5MA 4POFA 4Q1RA 1DDLA 2DUQA 1A3KA 4E4DX 3FFQA 3O0WA 1U5XA 3VV1A 2JG9C 4V196 2GC3A 2ILMA 3VBHA 4E4ZA 3RRDA 1ULGA 5FPXA 3AKPA 3N7LA 1OSGA 2Q1MA 1D0GA 3POWA 1I6XA 1TMF3 3N7KA 4IEWA 1IKPA 3UL2A 1QXPA 2WS91 2C6BA 4N9HA 3AXEA 2A6WA 1O3TA 2ZIXA 4ITCA 4LO8A 4Y1XA 5MFZA 1MS9A 1BE7A 2XWBB 4D7TA 4Q29A 1NA1A 4RQPC 3V56A 2QNKA 5C8CC 1UL9A 2D6LX 1MQTC 4QQPA 1OHFA 3WT3A 1HRV1 5BNOC 3NW4A 3ROUA 1CQ9A 1D4M2 4NN0A 3OD0A 1Q8VA 1DGRA 3AP4A 4JV4A 4DNYA 5DG1A 1OQDA 1XNBA 3RDIA 3ZYJB 2ZGNA 4KWJA 1QGLA 3ZYRA 1RMU1 4GS7D 1X50A 1AR62 1H8TA 2GH2A 4PBPA 1ULEA 4Z2WA 4COZA 4LBNA 5FREA 4E2GA 2GNTA 4A7KA 4AQ6A 5BNNB 3RSJA 3JBG1 1AHSA 4HMZA 1YUDA 4QPGA 3DGTA 3FBMA 2UWBA 3NWKA 5T50A 2H6CA 4AYUA 5HI0A 4J1XA 1WUVA 4Q2FA 1GFF2 1GNZA 1MS3A 1PGW1 4N7UA 4IV1C 4K7JA 4N43B 4ME3A 4XIKA 3EJKA 4ASMB 4MXVA 1GR3A 5FOJB 4FPCA 1AUYA 1LRHA 1PZ9A 1J1TA 3VZLA 5L7OA 2H0BA 3ZXAC 4XBLA 5T5JA 4XMAA 2D5FA 2Q1ZB 1ENSA 2E7TA 1RUG1 1G9CA 1NXD1 4U2AA 4Z07A 3SCHA 4OI4A 1HXS1 4CEYA 1HKDA 3LAGA 2UY8A 3ZFFA 2VG9A 4YVSB 4E9KA 2JKBA 3PJQA 3TN93 2QL0A 1NCRA 3ZXJA 4N90A 3WWLA 1OOPC 1DQ0A 3H3ZA 3WW4A 2EF6A 3NAPC 2DSXA 4FOYA 4AVTA 4B4PA 1BK1A 2JEMA 1BQ8A 3LWCA 3VLBB 3MPPG 1H4GA 1SLBA 5JVVA 3KT4A 4R9AA 4EN8B 1PGSA 4QM9A 2N7GA 4TYSA 3FJSA 2VVEA 1DQ6A 4XDQA 3NV3A 2Z79A 3M4FA 1QOOA 2GU9A 3L2YA 4B7EA 1JN2P 3EXUA 1MZEA 4UW3A 2AH2A 5CFCB 4GKXA 1IS4A 1PVXA 1I5ZA 3RMYA 4YYOA 2Y0OA 3DN7A 3PMEA 5E89A 4CEWB 2VY0A 3PVNA 4P9JA 1QH6A 5JAXA 2EAKA 4AEJA 1ZZ6A 3RZ6A 2ZMKA 4OI1A 1OFNA 2WZR3 2HWD2 1AR73 1ZRCA 3D82A 4BH9A 4WM8B 1PM7A 2E51A 4ZU7A 5FRAA 1OLRA 3CJXA 1MEC2 2Q30A 1QJU1 4R4ZA 4AGGA 4FPOB 4KG0A 1LOCA 3WUDA 1EV12 1R1A3 1CAVA 3KGZA 1AL0G 5JZGA 2WNVB 2ZX2A 1C1LA 4NO4A 1FHHA 1COV3 2O0OA 3FHIB 5AC93 1DZRA 5FTTC 3B69A 4ZN3B 4AEDA 1B35C 2DUPA 4S2GA 1S0DA 1YI7A 1MS8A 1BCXA 4CDQC 3HD8B 5H9QA 2WFF2 4A3XA 4XQWA 4F83A 1NCQB 4XJ9A 2Q5TA 2DCKA 3L9JT 5TSWA 2RHPA 1PVC2 5A33A 1PMIA 2XLFA 2FZ1A 1VJ2A 3MLKA 3VBOB 4XW3A 4BMEA 1RUF1 1R082 1LHNA 1H1IA 1LKOA 2RMU2 1LULA 3VDDB 3D6EA 3RZTA 2CNAA 1IS6A 4GA9A 4GH4A 4QX5A 4CP1A 3E6CC 1AX1A 1LODA 3FMGA 3ZMNA 5CU1A 2TUNA 1QXJA 1LOGA 3PIP1 3DV8A 5CFDA 4XQ4A 2PHWA 2NPIA 3VBRB 1OPOA 4PIYA 2ZTNA 3TB0A 1W6NB 3AZXA 1WMEA 1KJLA 3LZZA 5DXDA 2QZ3A 2K0GA 5ABJB 1GANA 1O3SA 1REFA 3HT2A 1O5UA 4C0BA 1GICA 5FBZA 1CN1A 4AE2A 2H6BA 4GALA 2PTMA 2WQ4A 1JHNA 1LEMA 1Q8QA 1OPMA 3MLJA 2B39A 2Y26A 3AKRA 3CJIB 4LE3A 1HV1A 3ZFEA 1F31A 3QH6A 2CWMA 5L19A 1RIRA 1ZZ7A 3HQXA 5K9YA 1ZRPA 3GZUC 1S0JA 2UWAA 2G9FA 1NLRA 4M0NA 5F6KA 4XXAA 4B29A 2A70A 2B5HA 2BVBA 5L36A 4L11A 1KXGA 1N1YA 3LSDA 4FVVA 4QU2A 4RS5A 4UXAA 4W6YA 3CEWA 4JGYB 1XNCA 2VOXA 1RJ7A 4LBJA 2NZ9A 4AF9A 1XYNA 3HT1A 5EXOA 4XTPA 4XF3A 2CAVA 4GQ7A 3WCSA 1C5HA 4XYXA 4E27A 1UZYA 4JAFA 4LA2A 1EPZA 1QWRA 3TN91 2HWE3 1T9OA 1VRH3 1BVP1 1UAIA 1BQ9A 5K0UA 4YZ3A 4IV3A 3OGGA 4BQ1A 1C1FA 4DB5A 4HPKB 3J8F2 3J9SA 3SS2A 4OHVA 1PO23 3HWJA 4HZFA 3PTYA 3AKQA 1YCIA 2GMEA 4HKWA 3TYJA 3I7DA 4AHWA 1NA1B 2Y38A 1OWBA 1QHDA 2ZGSA 4RR3A 5FAXA 5EINC 2ET1A 3H50A 5SV5A 2EVXA 3O12A 3N7MA 3VKFC 5A32A 2DU0A 1YIPA 2R041 4QQ2A 5BNQA 3BOPA 4N53B 1XU2A 1V00A 3POSA 3DPRC 1VBC2 2BTVC 4HFSA 4KNCA 4AQ2A 1V6OA 1QF3A 2RM22 1WCSA 2XVKA 1V6MA 2R32A 2PHLA 3LA3A 1DGLA 3FZ3A 2WZR1 2MS3A 1AR71 2NLRA 4DY5A 1RHI3 1VBE3 3WDUA 2IXCA 1EP0A 2G4IA 2MEV3 1FHMA 4JQRA 3S30A 3RYGA 1HRI1 1TNFA 4AI0A 1ND3B 2B45X 2ZHKA 4JDMA 3WG2A 1SEFA 5I93A 3O5SA 1TME2 1FMD1 1OA3A 2YC0A 4H55A 4I3GA 1RUJ1 1DU3D 3LKJA 4DS0A 3S7EA 5DUXA 1I3HA 1MVEA 1UCXA 1Z7S2 2QDNA 5E16A 2PLV2 2WNUA 1WGPA 4GXLA 1RUH2 4KU8A 2X53S 1SLCA 2JECA 2ZX3A 4IEPA 3ZXKA 2D44A 3THTA 3WHTA 2FMDA 4LBOA 2AUYA 4XFBA 1KFUL 2Y0IA 3WQ7A 3ZG6A 4YVWC 1H0BA 3PZAA 4OLLA 3KYUA 5CADA 2VH9A 4Q4X3 1FX5A 4CEYB 3Q9OA 3N3HA 2PHTA 2HWB2 5MLC3 1Q8SA 1NCRB 5A3MA 2BNMA 3AYDA 1SCSA 3AZZA 1RUD2 5HXVA 3VHOA 4F7ZA 4L97A 5I0SA 4COUA 1J3RA 3QLQA 4KQ7A 4TSVA 4FQZA 2JE7A 5SV8A 1FATA 2RR11 3B0AB 1UU6A 3D5OA 5DDJ2 4LO6B 1NXEA 2XBO3 2D5HA 2VMIA 5JIUA 3O7OA 5JI7A 1O4ZA 3GBFA 2PN5A 1EAH3 2RS31 3KB5A 5ACA1 1AYM2 5DUUA 5GLUA 5BNNA 2GZWA 1SMWA 1XQNA 2HWF2 1GYKA 3K51A 3FLTA 3NKTA 4UY81 3ASIA 1AR93 1RDVA 4JDOA 2M6OA 2A6XA 1F2NA 3VL8A 1POV0 3RYRA 3M7AA 4BPZA 3B02A 1N47A 4N43A 3JB8A 1NQDA 1OA2A 2UYBA 4B4QA 2ZGQA 2CGNA 1B2JA 5JOWA 2ETEA 2OPKA 2FHRA 2R072 4LUKA 1VZHA 1C8M2 1CAVB 3BPZA 4AVVA 3VBSA 3WDXA 1X8EA 3IWZA 2R0FA 4XJ8A 3U0ZA 4XEZA 4HVOA 2W08A 3E5UA 5HBAA 3FX3A 2P2KA 3B94A 3DKWA 3WLUA 1PGL2 1CAWB 3AKTA 4YVSA 1AXYA 3N7JA 4BMBA 5CVRA 3KD4A 2R6QA 1RYTA 1YJKA 4YNIA 2IXIA 1CESA 2HWE1 4FQ4A 3RS6A 3UJOA 1VRH1 5A33B 2HJIA 1PO11 2IXJA 1N1VA 1XRUA 5EYYA 4MLOA 3THPA 3MEPA 1QJY2 1RVF2 2GSYA 2JI1A 2PAKA 1LB2A 2JG8B 3FC0A 1OQEA 3QH7A 4P9YA 3MGUA 2JI3A 2X5IC 4KBBA 1CJPA 2VNRA 2Q4SA 1QJX3 2GC0A 1AJKA 3WV6A 4AVBA 1ZRDA 3ZSKA 3KYVA 1UU5A 3QVDA 4FXKB 3ZN5A 5CFCA 2WS92 3KQRA 5CFDB 1RUE1 1GQGA 2VMGA 3CO2A 4ISQA 4CEWA 3NVCA 3MW4A 4BE3A 2PELA 3OCPA 3O14A 4YZ4A 1H2KA 4Q1PA 3V0AB 1J59A 2F4PA 1HRV2 3E6BA 4ATFA 2V3BB 4G4FA 1U12A 1DQ5A 5JVG1 3D0SA 4XF4A 3M3OA 1PIV3 2AR6A 1MR5A 3AP9A 4LHNA 2LALA 4GIQA 1V6NA 2MEV1 1O4TA 2R30A 4GMP0 1O5LA 1DGWX 4YW2A 1R092 4LBQB 4AVSA 3ZFEB 1KQRA 2BPA2 1Q3EA 1RMU2 3IU3I 3FWEA 2A3WA 2HWC1 4HN1A 4D69A 3IDEA 1O3QA 3MSUA 3BODA 4MZUA 5AVAA 4Q4Y3 2WWSA 3HR9A 6RXNA 2BUKA 3JBG2 1UPIA 3CLPA 1YRZA 3UV9A 2IFWA 1NCQA 1V9U2 2BVVA 2EXIA 3P2AA 1RUG3 1VBB3 5CA6A 1J3QA 1WW5A 2I07B 3WOGA 3VKLA 1LHVA 2D93A 1PGW2 5D8AA 1BZWA 3VBFB 2PHXA 4IXLA 3AP5A 3JZVA 2YXSA 4A7YA 2WZPP 4GB32 3VDDA 3ZN6B 5CAZA 3NV1A 5CNAA 4QHBA 2B9UA 5F5QA 4XZPA 3KSCA 3N4MA 1S55A 4YGBA 3KYWA 4YZ5A 4CDWC 2EXJA 3W59A 1XNDA 5J09A 4R9DA 3DL3A 1ND2C 4J1WA 1HXS2 4CDXB 2XBO1 5EV7A 1DIWA 4I0BA 3VBRA 1ASJ3 4AEMA 3VBUB 2OUHA 3C3VA 4RR3B 1AXKA 3TBDA 2JG9A 4XIOA 3RI9A