4AI2A

Flo5a showing a heptanuclear gadolinium cluster on its surface after 41 min of soaking
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
258
structure length
258
Chain Sequence
GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLOCCULATION PROTEIN FLO5
publication title Complex Gadolinium-Oxo Clusters Formed Along Concave Protein Surfaces.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Sugar binding protein
total genus 56
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4ai2A02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ai2A01
4AFBA 4COVA 4LHLA 4AFAA 4AI0A 2XJTA 2XJUA 4COUA 4CP2A 4COYA 5A3LA 4GQ7A 4AHYA 4ASLA 4AI1A 4COZA 2XJPA 4LHNA 4AF9A 4AI3A 4D3WA 4AHXA 4LHKA 4CP0A 4A3XA 5A3MA 4AI2A 4CP1A 4COWA 4AHWA 2XJRA 2XJSA 4AFCA 2XJVA 4AHZA 2XJQA
chains in the Genus database with same CATH superfamily
1SBDA 4RHV3 5DAWA 1C4RA 1QKQA 1W04A 3GTML 4Y5SA 2VMEA 1COV3 4Q1RA 2D5FA 4XF3A 4DOUA 1UWWA 1RUD3 2OVUA 3HAXC 2XQRA 4GZ9A 3TN92 4XPVA 2ZMLA 5FP4A 3OOXA 3OPTA 2QCSB 3ILNA 3ON7A 5K4LA 1CIWA 4AE2A 3NNJA 3WUCA 4W4ZA 4Y1VA 1RGSA 1RUC3 1AXKA 2OA2A 3ASIA 2DCTA 4Q4W3 5DDJ3 1W0NA 3S5AA 4LJHA 1WD4A 4JDNA 1V00A 5K2ME 4ES8A 2DVAA 3AJZA 4CU7A 2D6MA 5IATA 2Q30A 5KHGA 3ZSJA 4JAGA 1RHI2 2JIGA 2YV8A 4LTAA 1XC6A 5JIAA 1ST8A 1VZHA 1US2A 5D8AA 1CAVB 1GOHA 1PZ7A 2ZMNA 3BB6A 1OLQA 2B39A 2YZ4A 4UFMA 3VKMA 4CP2A 4CXYA 1UOJA 1NA1A 3JU9A 2IXCA 4XEZA 4Z2WA 1ZREA 3LDBA 3OG2A 3VZJA 1YWKA 4AWDA 3CF6E 1R092 1ZRFA 3ZPOA 2ZX0A 5CA6A 4OHVA 1V6OA 4OI1A 2NM1A 1O4TA 5F2SA 2P6HA 2VTFA 4Q0SA 5IYYA 1VBD2 2HWD1 4K8FA 3B69A 4DB5A 2DBNA 2ZAHA 5C3OA 3W20A 1AXZA 1XJAA 4QM9A 2DURA 5GKAC 1QJU3 3ZLIA 8RXNA 3GZEA 4XIKA 4JAFA 2JI1A 5FXVA 4CU9A 3OBZA 1SFNA 2PHDA 1QY4A 3NVCA 5F32A 5CADA 3FWEA 1WW6A 3MBWA 1DZQA 3W59A 1DQ5A 2CKAA 5DM71 3S30A 5IK8A 3H3LA 1GFF2 3T1MA 1POQA 1JBCA 1OC1A 4LO4B 3VZKA 1AYN3 3BTAA 5M3FL 1EAH2 1LEDA 5CNAA 3F2ZA 5A33A 4CDQB 4ZZ5A 3J4UH 2XJPA 5LBBA 1RVF2 4GH4C 1PHMA 5M5WL 4NHMA 1U5ZA 3OCPA 2CU5A 3BIWE 3NAPB 1US3A 1ZX5A 2VH9A 3FHIB 3GGLA 1W2OA 3WNKA 5FK8A 2PXJA 1YXWA 1HB3A 1R1ZA 3WQ7A 3AKTA 3GBFA 4FXKB 2HEYF 1F4LA 4N43B 1H8VA 1ZA4A 3UJOA 4AI8A 5JI7A 2XLGA 1ENRA 2C24A 1BKZA 1CESA 1UAIA 2DVFA 3VHOA 2BW8A 1W6PA 1WMXA 2ES3A 5A3UA 4DQAA 1Y4WA 1UX7A 2Z3QB 5FLML 4XMAA 5BNNC 1OH3A 3GNEA 3WG3A 1Y3TA 2C1FA 1WCQA 4GQ7A 4OMDA 1OD3A 1UN1A 4LNVA 5C5UA 4JCKA 3ZIWA 1DGWX 1FXZA 1SEFA 3IBMA 4N53A 2JA5L 2B45X 5A7NA 3E1F1 4LIUA 2DTYA 1RUE3 4NAOA 3H1WA 4S2DA 3T2TA 2PHRA 1Q8OA 2QE3A 2FQPA 2X5IA 4PBOA 4RYDA 2DTWA 4Z8BA 1TMF2 1UY1A 3MLKA 5I93A 5JOXA 1BJQA 1K5JA 2D6PA 2QQIA 1JYBA 1W9FA 3LZZA 3RZKA 1RUG3 2Y6LA 2D3PA 5FY8A 1HB1A 2DYCA 4IV3C 4M3CE 5EIOC 1TWHL 4HMZA 4Q0QA 1PMIA 1UQXA 1AX2A 3IZOA 4AHYA 1VBB2 2LALA 1S2ZA 3RJ2X 2VULA 1A6CA 1VIWB 4K1YA 5FUIA 4CRQA 1PM7A 3K51A 1N3QA 3ZYPA 2BE5D 4YARA 4K8RB 5FXZA 3FJSA 4QHOA 1TME3 1PO22 1LGBA 1H4GA 1GZWB 1I5PA 2WA4A 3SCHA 1BMV2 4EN7B 1K45A 3MIGA 3WV6A 5IYCL 4YG6A 3PVBB 4Y1UA 1GBGA 1RHI3 1VCXA 3A44A 1MZFA 3ZFGC 1C1LA 3QLQA 3KD4A 1ZZ7A 4A3JL 3NV2A 1RWDA 2XUEA 1BVVA 2K0GA 2V73A 3K4DA 3O14A 4OYUA 3S7EA 3BU0A 3RZ6A 1V9U3 2VQTA 2AR6A 3IKWA 3Q8FA 3R05A 4XFHA 4XDPA 4AEDB 2VBBA 2WT1A 1HRV3 2XJTA 2ZGRA 1RDGA 3IAPA 1XPWA 2BGPA 1Y9GA 1QOTA 3UGFA 3SH4A 4EQVA 5A1LA 1HDKA 2O8QA 2UY8A 5AI2A 3HNYM 4XFIA 1KJLA 4Q4X1 5FZOA 3DN7A 4RQPA 4RN5A 1D2SA 4AF9A 1OI6A 1GP6A 1S1AA 1RUJ2 1SLIA 4NMIA 1VLNA 1FOD1 2A6VA 3MFCA 3O12A 2JD4A 5LA9A 5CAZA 4BOWA 2ADDA 1QH6A 2LW8A 4Q4V2 2ZABA 3M1HA 4XAAA 2W08A 2XPJA 3H9BA 5FREA 5DMYA 4QXBA 3T30A 4EN8B 1XE8A 5JUVA 1YQ6A 4Q5OA 2K46A 3N7LA 3RZLA 4E8CA 3WDYA 4AVVA 5FYIA 2VZSA 1YJKA 1W6OB 4OUSA 2D6NA 2D97A 4LE4A 4YWAA 5JZGC 2VOTA 5A3LA 3MIDA 3WNPA 2UU8A 5IYDL 2PHWA 4HN1A 3DXTA 2VVEA 3FLRA 3MIBA 1IOAA 1GICA 5LY1A 2YMZA 4MX3A 1GWMA 5KC6A 1BRFA 3D8CA 4KH9A 2CV6A 4LO6B 3UETA 4XIOA 2XOMA 4YM1A 2WN3A 4QX7A 3U0ZA 1HB4A 4UW5A 4QQPA 3UV9A 1K5MC 4JKMA 2GN3A 2D7FA 3AYEA 3BGAA 5JXIA 4ZN1B 1B09A 4TYSA 4BM8A 1RITA 4DS0A 1C1FA 3IN9A 2XKPA 3CLPA 3VD4A 5EHDA 4Q0PA 5IFTA 1ZZCA 2A70A 2D43A 1HIXA 1J83A 2VCAA 1LOFC 1QXPA 3MPSA 2R92L 2XQXA 1FPN2 3M7AA 2XGXA 3AYCA 1YNAA 3A0NA 4BXFA 2RS52 1LU1A 2Q8EA 3HR9A 4L9BA 2WZR1 4XTPA 2JDPA 5IP9L 4BY1L 1PGW2 5A7PA 5T5PA 1SHWB 4CXWA 5K0UC 4C3IL 1BBT1 1AR61 1OD5A 3QBQA 4GIQA 5DG1A 3E6BA 1QIQA 4B4PA 2R071 2JDYA 4AZZA 2VZTA 5FY7A 1R0HA 3VBFB 5A80A 3GTKL 1REFA 3PVOA 3N9MA 3B01A 4JAAA 2GMMA 1IRNA 4NWWA 3VBRC 2JE9A 4COWA 4Y5Z0 1H6XA 3ZXAC 2VY0A 1JZ8A 3HN1A 1F8VA 4KWLA 1CAVA 1BVP1 3WW2A 5LA0A 5FDBA 3LE0A 2XDVA 2DVGA 1BE7A 2CHHA 3N7JA 5FOBB 1KS5A 4TZDA 2LM3A 2PTMA 4COVA 1LENA 4GD4A 5AVPA 1XE0A 2XBO2 3NV3A 2IZWA 2DUQA 2WNVA 3OB8A 4RS5C 1G9AA 4XOGA 5CG8A 4LBMA 5FZ4A 3S1NL 2GC1A 3G7DA 2B9UA 1HQWA 3J8F1 5FLHA 5FYCA 3ZYHA 4A45A 4GMP0 3PO2L 1R1A2 2CWSA 2P2KA 4JGZB 4BQWA 4YW7A 2RS32 1EP0A 3POBA 2AZ5A 3ZR6A 1V6LA 1B2JA 4QKNA 4BH9A 1ND2C 3OUJA 4A3ML 2OW4A 1BHGA 4UT5A 4CCJA 5K8SA 3KYWA 2I45A 2D6OX 1AJKA 2HBUA 3OGSA 5CB7A 3VGIA 2IXKA 2QFEA 5EJ1B 1YHFA 3THTA 3SXWA 4CDQA 1DBNA 2L0ZA 3HOZL 5D21A 1OVSA 1NCQC 5KXBA 2E26A 5SV8A 1YLLA 2VMHA 4ZU4A 2XL9A 1C8NA 3W5MA 4DUVA 2R062 5HCAA 3NAPA 1UF2C 2WYFA 5CISA 1W8ZA 3UJQA 3ZX7A 4TPUA 2BEOA 1REEA 2BYVE 1VZGA 2Y0OA 1VP6A 3CZJA 3ECQA 3POSA 4JVAA 4N43A 3BI3A 3PTYA 2ZJCA 3N9NA 3IB3A 1WUVA 4AVCA 4X8NA 5GLZA 4XDOA 2HWC1 4OULA 3C7EA 3ZXJA 3K77A 5L9BA 4OI4A 5FZDA 2WKKA 5C3RA 1U0AA 4LBLA 5DUVA 1AJOA 1RYQA 1W8NA 4HVRA 1LGNA 1UU6A 3T3YA 4AR3A 1HXS3 1OVPA 3VBUB 2JG9B 2QQUA 4ZS2A 1PNFA 2CY6A 4JQRA 4XXAA 3VUOA 2E7TA 5C8WA 2YUEA 1BMV1 3M3IA 2Z2SB 4O61A 3ZSLA 1EPZA 4DPNA 1W28A 1KGYA 1RB9A 3KYUA 2Y60A 5IY0A 1OOPB 5J7MA 3LCPA 3A23A 3B08B 2D93A 1SDDB 1IU6A 2DV9A 5BNOB 3I2OA 2B8MA 2JWPA 1F31A 1QOOA 1RUH1 1S0CA 2DU1A 3RZMA 2XB6C 3O5SA 1YRZA 1W8TA 1W9WA 3H9AA 4LKEA 4NHLA 1J3RA 5A70A 5L7OB 3PZAA 2VMGA 1GOGA 2YBPA 4YG0A 1NXEA 1GU3A 4KL1A 5RXNA 1JMUB 4YYOA 2R0FA 3ILFA 4JRLA 1XOYA 1ACCA 2MEV3 1AYM2 2EALA 4D6RA 5D8AC 3I59B 3PUAA 4GAZA 5FZ6A 1ZNPA 2GP5A 1X9PA 2BP6A 2KXLA 1GZWA 2ZCWA 1NA1C 3AM2A 4PQQA 2R0HA 4B7EA 1YQ8A 2ZS6B 3WD5A 5AC91 4CTEA 2A6HD 3J7Y1 2R32A 3CQZL 4D69A 3IDBB 2PYTA 4Y1YA 1PFYA 2OIIA 4Q0UA 5F3GA 3ZDSA 4C2M1 4NPLA 3HOVL 5E8AA 1ENQA 1IU5A 4CUGA 1O3RA 1LKNA 3W58A 2B7YA 4U36A 4EWEA 1W8HA 4LULA 4DXSA 2A6XA 4AEDA 3GHMA 1VBA3 3ACGA 1WMFA 4CVUA 1D2QA 3FKIL 1BFYA 2VD7A 1J59A 4CDXC 4KU8A 1TE1B 5CEHA 4WVMB 3S14L 4AI0A 3KYVA 5JPNB 4JDOA 4A3LL 4IE5A 4MGSA 5EYYA 4B4QA 4Y20B 2ZGTA 4A3GL 1AL23 3AMPA 2Q0AA 4DIQA 3MICA 2P37A 5GAGc 1YUDA 4XFBA 2HYKA 2QZ2A 1EV11 2QQOA 3M3QA 4A3BL 3H3VM 3IDEA 5HBAA 2A3XA 3GZUC 1OPMA 3WQBA 3AK0A 3WP5A 1W6OA 3OEAA 3S5QA 3W21A 2AACA 4PIZA 3C7OA 1VJ2A 1JYNA 1NY71 1W39A 2WAQP 1H8TB 1LR5A 2WO3A 1N3OA 3ACHA 3USUB 4CEWC 1W03A 1LULA 1L7QA 1S2KA 1FMD3 1HLCA 1UY2A 1C5HA 2BNMA 2K2DA 1AVBA 1NQDA 2Y6JA 3MHZA 2M4VA 3KVBA 2WFF1 4MGYE 3RS6A 5KWRA 4BLIA 1UYZA 1ZBA2 2KM2A 3WNXA 5I0DA 1QQTA 4YW2A 5A3TA 2UYBA 4S2FA 3MIFA 4FVVA 3GJAA 4I0AA 2VC9A 4N53C 2XWJB 4XYXA 3RSJA 4BQ2A 4CXXA 1ZBE1 1BEV2 3GALA 4INDA 3OYWB 1X8MA 1G8WA 4WM7B 4Y22B 5FCCA 3RJRA 4A42A 3FE5A 5IK7A 1RUOA 4LO5B 5C3PA 4S2GA 4D7SA 4IGOA 5IVYA 4D7YA 2VE1A 3FFZA 4G3YC 2D98A 1UZYA 1UYYA 1ZYBA 5IVJA 4B8EA 5IWFA 2JKBA 4YNIA 3ZPYA 1ASJ1 1EAH1 1RC6A 1KD7A 2BNOA 1UKRA 4TXWA 2KA3A 3VBFA 3FMGA 2BRTA 3AKSA 2VNOA 4MH0E 2RG4A 4HT1T 4A3IL 4PDWA 4NWVA 1MS9A 2Y6HA 2YHJA 4AGRA 2JI2A 4Y5TA 3FDJA 2ZX1A 1STMA 5CVRA 5FYYA 2PVEA 4UXAA 2RDSA 3SS2A 1MVEA 4BXSV 3GYDA 4Q0VA 4FP2A 2CGOA 3B3QE 1E5HA 3N35A 4K20A 5JMCA 3VKOA 2I2SA 2JG8C 2OS2A 1A8DA 3PUHA 3RMYA 1O3SA 3AMQA 1T6GC 2WT0A 4I3GA 4XILA 4AFBA 4BE3A 4YFWA 1SMWA 1OFNA 4J25A 3RYKA 3LWOB 2VOWA 1JHJA 3WLUA 1GP4A 3I3EA 1VRH1 5A7OA 1G9CA 4OI0A 3THPA 2QL0A 4ASLA 2OXBA 3K46A 4BIFA 2E51A 2VCMA 2JDNA 3A22A 1APNA 5IAXA 1DU3D 5FY5A 4NIGA 2QQMA 4I2OA 1OPOA 2JB8A 2P1BA 1QJX1 1LOEA 4JGZA 5IAVA 1TMF1 3LIGA 1JYVA 3WCSA 4N9HA 5IVCA 2GZWA 3E97A 2Q1ZB 2XR4A 3NV1A 1RUF2 1GQPA 3VBHB 5GALA 4UI9L 3KHBA 1IGOA 1S55A 1SG3A 2PAEA 3PUSA 3KV5A 3AJYA 4QX8A 2VO5A 3WR0A 4ZPIA 3P1IA 1GWKA 5A3WA 1F15A 1RUI2 5BNPC 4YVWC 5FYHA 4F3JA 4OVEA 4AL9A 2J1RA 4A93L 2RDNA 2W5FA 5F37A 4QXCA 5C3EL 4ME3A 1CONA 2QUOA 2R1BA 4PI0A 4KBBA 5F3EA 3PKIA 1MZ5A 1PO21 2ERFA 4MV2A 2XLAA 4LLOA 4D3WA 5I91A 4YZ3A 1VAVA 1CAWB 5MLC3 1Q5OA 2C4XA 2NMOA 3N9OA 3OSDA 3GBGA 4H7LA 4O9GA 4FAHA 4LK6A 2VVDA 2Q8CA 2WLQA 5C5TA 3L9JT 3CJIC 4KWKA 2VUDA 3O0WA 4CPBA 1X82A 2ZTNA 2QJVA 2C9AA 3SC7X 1QNYA 4FPKA 3JD71 3ETQA 4N9IA 5M3ML 1TWCL 2JG9A 3D6EA 1I50L 1ZZ8A 3AKRA 3VBUA 5JLVA 1XSRA 4CEYA 4CCMA 4L97A 1EUUA 1WKYA 5JOYA 3VBOB 5EINC 4RHV2 1JU3A 4Q4Y1 4HLTA 1IQDC 3NJXA 2E7QA 5FXWA 2ZEZA 2KR2A 5FYUA 3ZYJB 1COV2 4AEMA 1OOPA 4UFHA 5KXCA 1S0IA 2HLEA 4HZFA 4BMEA 2KKDA 1UYXA 4DXTA 1VB2A 4NVPA 5BNOA 3PIGA 2IFRA 2QDNA 5BV6A 1NLQA 4QM8A 3WNNA 4H14A 1Z78A 4YGBA 4DRVA 2VNGA 2NQYA 1W2NA 3Q8CA 4CDUB 5C4WC 2B5HA 1RUC2 4GXLA 5L7OA 4W6YA 3X29B 4IE0A 4NR1A 4Q4W2 4R8HA 5DDJ2 1LB2A 4NPRA 3BCWA 3T4VA 2EA7A 3E5UA 1QGLA 1GZCA 3GTJL 1EY2A 3O0XA 2TNFA 4ONUA 4XZPA 4XC9A 3I59A 3KQ4B 3IDAA 2A73B 4I01A 2R49A 4GMP1 2BWCA 1F35A 3KV4A 3HOUL 3FUQA 4FPJA 4FPLA 4JTOA 3ZXGA 1N1YA 2JDHA 4OFGA 4RGAA 1CPMA 3VDAA 3SEEA 3J26N 3PHMA 4AVSA 2WC2A 4YW6A 1MACA 3WNMA 2QBXA 3BN6A 5BYNA 1DZTA 2VQ0A 2I07B 2WNVC 5FIXA 5FZFA 4GWJA 3QD6A 3LPEB 3IDCB 4L99A 3QOPA 3ZXEA 3BODA 5JDBA 1ONAA 1POV3 1H4HA 2DCKA 2R1DA 1IS6A 2QQLA 1W6MA 4XUPA 5KXDA 4A6SA 4HK9A 2Y6KA 1PIV1 2FHRA 5K9YA 2X29A 4WVMA 3NNFA 1RB8G 1WCUA 2P34A 4ISRA 2IWGB 3UKVA 4K1ZA 2VW2A 1H1MA 1GP5A 2RS51 4MHRA 4A7ZA 3NNMA 1ULEA 2OX0A 3BU7A 4MOAA 5FYMA 2TUNA 4Y20A 1H1AA 2ZHMA 4Z2AA 1PGW1 3ZN4A 3DECA 4CDQC 4AW7A 1GNHA 4IESA 3CDZB 3IMMA 3LPFA 2W87A 4XBNA 4FPOB 4XF4A 4LBQD 1UMHA 5F3IA 1AYN2 2JD9A 4XZUG 2QZ3A 2YBSA 4Y26A 3RZJA 4BCUA 2R7EB 3VLBB 4Q1PA 3O0VA 2V3BB 4IL7A 1CWPA 2AYJA 4TN7A 2NLRA 3ES1A 5A3PA 1LRHA 2A7AA 4N43C 2EICA 1H8TA 3H99A 2M6OA 2EVXA 1VBC3 3GHNA 4A3DL 3USUA 2AYHA 4F83A 2QQJA 2JENA 3GCWA 4WM8C 1ND3B 1JS9A 1XE7A 2R30A 5F5AA 3WP4A 5M0TA 5A6QA 4XJUA 2AEZA 3WWLA 1GOFA 5JMOA 1G9FA 1KDKA 1LODA 1RMU1 4XFAA 1JODA 1Z7S3 2FMYA 3LKJA 4JAEA 1W90A 1SZBA 4GB33 4W50A 4WVWA 4ZZ8A 1C09A 5LW9A 2VZUA 3H7JA 5DUXA 4WZCA 3HEIA 3OYWA 5J48A 2MHFA 1R1A1 4WM7A 4Y22A 3UESA 1HJGA 4CP0A 5IP7L 3WF4A 1RUE2 3MPPG 3VKNA 3C3VA 3CBNA 1EYBA 1GLHA 1T2XA 3A4UA 1BCXA 4IV1B 1TG7A 4PCRA 4PLMA 4QKFA 4HANA 1IG0A 5FTTC 2GN7A 3QACA 4AG4A 4BK5A 2BNNA 2QVSB 5F3CA 5LEKA 1RUG2 4M3CF 4LQRA 3MPBA 2H6CA 2YFUA 1HRI1 3C7HA 1S2BA 1N1VA 1O91A 2WZR3 4OQ8A 4LBQB 3P3PA 4AGGA 3S17L 2DFBA 3UNPA 2R061 3PIJA 1O3TA 2V09A 2CDOA 4AI9A 3ZKUA 4K9FA 2ZGOA 2R073 2ORXA 4P9YA 3ZFEC 5DG2A 2QDRA 1NX9A 3VKFC 3VV1A 1KJRA 1H2KA 1CZVA 3S1RL 1YIPA 3VDCA 1LTEA 4E4DX 2BJSA 3AB0A 4V2WA 4ZU7A 1NG0A 3RI9A 1BLZA 4E4ZA 4LBNA 1TME2 2V5YA 2BOJA 2RFKB 5EWSA 5FZBA 1YK5A 3S7IA 2K2SA 4BJ0A 2QQVA 3K75B 4IETA 1ZRPA 2GDFA 2BPA2 1PGL2 1OKOA 1OF3A 2MNGA 4RR3B 3BOPA 4KG0A 3V0BB 3NMBA 4AEDC 4JTNA 3S0MA 3T1LA 1IS3A 2WNUB 4GS7D 2PFWA 3PKJA 4LORA 5T5OA 3R0RA 4I30A 4NROA 3ZXFA 1V9U2 4XF1A 2WAOA 3PL0A 4HPKB 3EQEA 4AQTA 5CFCB 1K42A 1IPJA 1HRV2 1LNSA 2WFPA 5IJRA 3T2QA 1F5JA 1QJZA 2XH6A 4XETA 3H7YA 4XACA 3J8F3 2WT2A 1WCDJ 1FATA 1XYPA 1LOCA 2J1UA 3VBHA 2IC1A 4RA0A 3EO6A 5HCFA 4O7XA 3A0KA 2YGMA 3CMGA 4DEQA 1ODNA 1SCRA 2C26A 2K9ZA 3OD4A 3I7DA 2RJ2A 2R93L 3MV01 2PHUA 2A6ED 2HWE3 3AL6A 2VL6A 2DFCA 5KHHA 2AENA 1DQ2A 2WR9A 4OMCA 5DAXA 3H8XA 2PQQA 1PVC3 1OMIA 1LTLA 1ZZBA 1PMHX 2VUCA 1R0GA 2PLV3 2AC1A 2XHKA 5FP9A 4RFRB 3WF1A 2ZZJA 4C0HA 2SLIA 1UZZA 2A69D 4EJRA 5T55A 2JA6L 3LQCA 1CAWA 1CD3G 1WLWA 2BU9A 5ABJB 3ZYRA 1OLME 2C6AA 4TSVA 4UW4A 1AR71 5FPBA 4UFJA 4YPJA 1FAYA 2CL2A 3KF5A 1XU2A 2ZHNA 1OQDA 3U11A 5IT6A 3WDWA 2NVQL 4ZS3A 5FZ1A 5G04L 5ACA1 3UL2A 1JUHA 1WW4A 4P9JA 2HWC3 4CU6A 4QGNA 3VHNA 2PYAA 1DG6A 2XJQA 3HNBM 3VBOA 4Y33A 1G9BA 1BZWA 1DGWA 2VMIA 3RYRA 3DPRC 5DAVA 2RR12 1OUSA 1XNAA 3T08A 1DQ4A 2NPIA 3FZ3A 3OGVA 4AXOA 2UWAA 5CIRA 4BQXA 1J1LA 1SLBA 1PO11 2X53S 4I0BA 2RMU2 3SCFA 4EZ4A 1RXGA 1JU4A 1K3IA 1FX5A 3VD7A 1YJLA 5T54A 1WGPA 3KZ4C 4MADA 4PLNA 5LRRA 3VBFC 4CDUA 3MI8A 4LK7A 3WOGA 4BYYA 1D4VB 4XXPA 4PDWC 2H0VA 5C9AA 2LRPA 4Q27A 3RPQA 1NUKA 1F2NA 1DHKB 5FYSA 1SMUA 4EWAA 1O3QA 3KCYA 4NIAA 3MDPA 2HWF1 4AGVA 1FHMA 3E5XA 5IUQA 2XVKA 4TTGA 4OHXA 4XGHA 3TEWA 5CZKA 1W8UA 3ZDVA 2XVLA 1ZBA1 4BHPA 1GUIA 4D94A 2DF7A 5EJZB 1FYUA 5FY0A 3TOJA 5F2WA 2FMDA 1JZ3A 4LO7A 1S4CA 3WDXA 3U14A 5C33A 5J37A 2RS13 1S0GA 4XQDA 1BEV1 1IW7D 2J1EA 4PF5A 3GXUA 5FZ0A 1S30A 3M70A 5FWJA 4JGZC 3NNGA 5F6LB 4FFIA 4C1XA 3OF1A 1UPSA 3VBSC 3WQ0A 5FR3A 3LF7A 5F8PA 4EE2A 3D4KA 4HK8A 1QDCA 4E2SA 4HONA 3RWKX 2R6QA 3VZMA 2R7ZL 5GZFA 3ZVXA 2B46X 2RJKA 1ZM1A 3M3CA 3JB4C 1LKOA 1B71A 4UY81 2CSGA 1ZVFA 1QJY3 4COYA 1X9TA 2P3JA 4MUVA 1ODHA 1QOSA 3MEPA 3J7Z1 4IXLA 4WFN1 2L9LA 1V6NA 4D8MA 2OUJA 3APBA 1B13A 1DP0A 3CZUA 1U12A 3E5QA 4QPIC 4P08A 2YBKA 2J7MA 2BGOA 2WS93 4AI2A 2DCYA 4IERA 4CUBA 4C90A 4QQHA 1FHHA 1DGLA 3O1RA 3GM8A 4E27A 2FD8A 1CQ9A 1CAUB 3OD0A 5GLUA 1ND3A 2W0XA 2RE9A 3SH3A 5C8CC 4QGLA 2WJSA 5JOWA 4JHZA 5T5LA 2WNOA 3AKPA 3HKZP 3C8XA 3WF3A 5LBCA 3VBUC 2RDRA 2WFF3 2WZPP 2WSUA 4H55A 1QH7A 4L92A 3PUQA 4CEYC 2C0ZA 5JPMB 2SBAA 4QQLA 1HXS2 2R041 3NO8A 3RZHA 4LLFA 4MYEA 5T3NA 5FZ9A 1QQP1 2ERJA 3HIFA 1OOPC 3J9SA 3SKJE 2A6WA 4QPGC 5C70A 3H3ZA 4Q8LA 4IV1A 3E6CC 1ZBE3 1V6IA 4LKFA 1RUF1 5H1Sc 2GMPA 3LWRB 3ZM8A 1ULFA 2AUYA 4F7ZA 4MLOA 2VBPA 5JXJA 4XDQA 1Y9QA 4FCAA 2W46A 5A7SA 4D6QA 2O14A 1NCRC 2YFZA 1FNYA 1MVQA 2ZGPA 3AP7A 5T52A 5L7OC 2B4KA 2WNEA 3PURA 3OUHA 5FAXA 3IIIA 1W05A 2RR13 3OGJA 5DUWA 4KGQA 1R081 4TLFA 3DYOA 1Q8SA 3U1XA 1V70A 3DCQA 5DAPA 5FBJA 3ZFFB 2W3JA 2RMU3 1WCSA 4FO9A 5J98B 2ZX2A 2RM21 4P9WA 2E2JL 5FPUA 4B7KA 5JSOA 1F4AA 3BTXA 2MEV2 1GMMA 1MEC3 3W9AA 2Y0SP 4QWNA 2YROA 5FPZA 4CCOA 3RYGA 2JJ6A 1J1TA 4Y7NL 1IPKA 3M4OL 1JH5A 3DXUA 3UK9A 2B42B 4YZ2A 5FZMA 1LJ7A 5LATA 5IK5A 1BK1A 1WA6X 5H9QA 5F1RA 1A3KA 1WLCA 4EV0A 4YW3A 2BQPA 4RR3A 1NE6A 5A7WB 1C8M3 3V0BA 1AX0A 3HBZA 2DDUA 2WIIB 3N9PA 3DV8A 5EYXA 3D5OA 4AHZA 1F9KA 1Q43A 4RHV1 1H1IA 3SLIA 5CFCA 1VBA2 2XHNA 4HPKA 3ZN6B 3ORJA 2VZQA 3BTYA 4K7JA 2YC0A 3SH5A 4LA2A 1COV1 1C57A 2ZX3A 1VZIA 1GV9A 3DUIA 5DUUA 1RUD1 2UY9A 4LXLA 5FYTA 2NVYL 1OQEA 4BBRL 1GQGA 1ENXA 3KB5A 4DY3A 2Q1MA 1JTZX 1RXFA 4DFSA 3WQ1A 4EN0A 3WT3A 2PAKA 3R4DB 2GMGA 3MQKB 1H30A 1AL22 3OGRA 2PN5A 1RUC1 1O5UA 3AZWA 4V2VA 3WDTA 4Q4W1 5FUNA 5B2GB 1W3VA 5DDJ1 3H0GL 4GA9A 2VOVA 1O5LA 3MUZ1 1HW5A 2ZGMA 1WW5A 3ILRA 5LY2A 3I4ML 2HVYC 4P02B 3AX4A 1BQ9A 2FBEA 1BYHA 1XRUA 1H8TC 1JZ7A 3MLLA 2B5ID 1AR81 1UIJA 5FBZA 2EIDA 2HBTA 3DYMA 3JCIA 3M4FA 5T50A 5ABJA 2DWRA 2UWBA 3BKZA 3PVNA 1CR7A 3MF6A 1YYNA 2WRAA 4FFHA 4G4FA 1FMD2 3B9CA 2CR8A 2VTXJ 4IEZA 1GYKA 2DUPA 4U2AA 1O4YA 1I3QL 3K4AA 4GULA 2AQCA 1UU4A 2QQWA 3HJYB 2O8OA 4AQ2A 4BMBA 3PIO1 3S2DL 1IS5A 1UU5A 3JD73 1VE0A 2WABA 4HBNA 2PHTA 4NHXA 4P9IA 5FK7A 5FWEA 3ZFGB 2Z3RB 4AFCA 5JOZA 1QJU1 5F6KA 1UX6A 4FOQA 4JHTA 2ET1A 2J1TA 1HQNA 2A75A 1D4M1 3MIHA 4XBLA 1RINA 2IXHA 2V4AA 3NRUA 2AREA 3UKTA 4HXCA 3M2MA 4Q4Y3 5LRSA 4KNCA 2BFUL 4CP9B 2QKDA 3AMHA 3ITQA 5JR2A 4FTEA 3BVCA 4Z07A 3VZLA 1V6KA 4XW3A 4OHYA 3IWZA 1V6JA 3J7LA 1AYN1 1XNTA 3KHCA 3T2PA 4D7TA 2QNKA 1KFXL 1W2TA 4KWUA 3LEMA 1UOBA 3HMYA 4K40A 1JZ2A 4LBKA 4OZXA 3NFPI 3LA3A 4IDZA 3GZAA 3EXUA 1PX4A 2EXJA 4EZHA 2W95A 1O7FA 2UURA 3JUUA 4B8CD 3ZYIB 1H2NA 3JQWA 1G86A 5L19A 2Z42A 4JRAA 1R64A 4M3CB 4GMP3 1AR93 2D6LX 4HKLA 5EP9A 1CJDA 1UD1A 3PLQA 1KFUL 1QJFA 4XXBB 5ANQA 5JZGB 5LK7B 4H3WA 1KXGA 3AP4A 3JBG3 5JSRA 1WA4A 4QQ2A 2EAAA 4YWLA 1KS4A 3VL9A 3ETPA 4META 3B7MA 1LHOA 1MZ6A 1TQ5A 2WSVA 1LOBA 1RL3A 4H7MA 4YW5A 4K9SA 1WCML 5L9RA 2LROA 1E5RA 3POEA 5C3SA 2FDHA 1MS1A 2VU9A 1K5MB 3KWVA 4PQ9A 2GP3A 3I4NL 2JA8L 4XHBA 2PQSA 2TBVA 1QF3A 5BXXA 1QHDA 1YQ2A 2OUHA 2PHXA 3SHRA 3TB0A 1CX1A 2HKXA 2ZZQA 2VZ3A 3AKQA 3PJQA 3POWA 4AOCA 4D6SA 5AVAA 2BVVA 1JOBA 1YI7A 5A6YA 3AP5A 3D0JA 5FZ3A 2VMDA 3AMMA 3KCCA 3TN91 3PUIA 2EY4E 4GWIA 3VZNA 4YGEA 5K0UB 4LE3A 4CUAA 5IFPA 4ARYA 1VBE3 3ACFA 4W6WA 1GR3A 1UY4A 4XUNA 4JGYB 3LWVB 2A3YA 3I4IA 3VN4A 3EB7A 1CAUA 1LESA 2AEYA 1PGL1 2LS6A 3ATGA 2E2HL 2C5DA 4E6YA 1FNZA 3LA2A 4W6XA 1J58A 1RHI1 2VPVA 3SISA 1OA4A 3HPNA 3INAA 3POYA 1MS4A 1UCXA 2PHLA 1O6UA 2HWB3 1IHMA 5CKMA 2VXJA 2YU9L 1AL0G 4KBZA 3R6SA 4ATFA 5L73A 3O1OA 2VGDA 2YXSA 1V9U1 3DEMA 5DABA 3KS7A 4HFSA 2APOB 1N1SA 1HRV1 1Q3EA 2D3SA 1E8JA 4N90A 2YY1A 1RMU3 4GJYA 3O1PA 1YFYA 2NYYA 4XJAA 4O65A 1R091 1SLCA 4QPWA 4RS5B 3VHPA 2PVXA 1VMHA 2VTXA 3POGA 4P14A 3WSOA 2DU0A 1NNQA 1YIFA 1VBD1 1E57A 1Q8VA 1JZ5A 3P5BA 2HEWF 3BYWA 4PF1A 2Y64A 5FUPA 1W9SA 4A3XA 4CDUC 1Q8PA 3SITA 4W65A 1MS5A 4S2HA 4Y1XA 3PVEA 4P9XA 1JYTA 3KT4A 1CX4A 2X5IC 5C9AC 4QXHA 5JR7B 3PTRB 1ND2B 5GLWA 1IS4A 1CVNA 3ZFFA 3FC0A 3MZHA 5FZGA 1KRIA 3KVAA 3HT2A 3WP6A 1NE4A 4FOVA 1NCQB 1SFPA 1X7NA 3SEPA 2KD7A 3MV11 1H2MA 1RVF1 5FMDA 5A6ZA 3WG1A 2ZGUA 2HR5A 1C28A 3JR7A 3B5LB 3IM0A 2Y26A 3OTFA 1RIRA 3WXPA 4MSVA 3Q8AA 5A7WA 1YEWA 1VPHA 3H1MA 1QXJA 4IQPA 3H8UA 2XMLA 5FZHA 1TNFA 3WNOA 5A6XA 2QQPA 3WG4A 1HV0A 2RDVA 1Y1WL 4QGMA 3V64A 3ZN6A 1I9RA 4DZGA 2JI3A 3B0AB 2JICA 5IVVA 1OA3A 4XQWA 5B4XA 4E4HA 4X6RB 5JIUA 5IVFA 1JYCA 4TVMA 4IEQA 3RGBA 1H0BA 4CCLA 5FKCA 4AFAA 2J1AA 4Z92B 3NQHA 1ALYA 4HKOA 2X05A 5FZCA 3KT1A 3T0AA 3OBRA 4IE6A 1CAAA 3WNLA 1ODMA 4AQSA 3NW4A 3IMNA 5H9PA 4POGA 5J09A 1I3HA 2GAUA 3PMSA 4GKYA 5D1IA 5GLTA 2HWD3 2P17A 1H2LA 1FOD2 4RQPC 5KHIA 4PBPA 1J84A 4Y3OA 1TWGL 2ZMKA 1HQLA 3I2GA 5GADc 3TEZA 3T0DA 4RD7A 1I6HL 4JX0A 5LK5A 4A4AA 3J7NA 1XNDA 2W92A 4BQ1A 4UFLA 2VZVA 5FP3A 4AVTA 3U10A 3I3BA 3LAGA 4DRRA 3J7MA 2ZOEB 3UGHA 1VBC2 1S2EA 4LHSA 3I3MA 4ZXKA 1I6XA 3HD8B 1DF0A 1VBB1 1J3PA 5D8AB 4A44A 3ZYBA 1AR73 3O1MA 5IYBL 2Z79A 3LGRA 3HQUA 5FPXA 1NA1B 4OUEA 1WW7A 2D6KA 4AR6A 1T9QA 3VL8A 5LZ6A 5FO7B 5LEJA 3FHAA 4ASMB 1R0IA 1QDOA 4ASKA 1Z7S2 4GB32 3ZFGA 4R9BA 3WEZA 2Z69A 5ACA3 1QYBA 3NSTA 1OUXA 5B4NA 3HWJA 3K2OA 2IVJA 5I0UA 1S0FA 4BXXL 4JZRA 4IEUA 5JI9A 3BIEA 4RFT0 5CFDA 5BNQA 3DYPA 2ATFA 1LHWA 2CDPA 4N7IA 5BY5A 4CP9A 4V196 1WBLA 1OF4A 2WYSA 4I3PA 2E32A 1BXHA 4ZXEA 4CDXB 4K6BA 2ZGNA 2EXIA 5CBLA 4COUA 3TEYA 5FKBA 5FMOL 4MGZE 1POV0 2WZR2 5BPXA 2PA7A 4P5YA 3ZN5A 4LOTA 4COZA 1RUJ1 4P9LA 1SLTA 1YFWA 2JECA 3IT8A 1AHSA 1L3JA 2Y33A 1H9PA 2R072 2NZ9A 4Q4V1 1N47A 3CNAA 3VD5A 2OQ6A 5M5YL 5G05L 4ZKTB 4UOJA 4M3CA 1DVBA 3B00A 2A1XA 1VMFA 4FAGA 4NE9A 4CCEA 4JADA 1DGRA 5JZGA 1I5ZA 4FQ4A 2FZ1A 5FY4A 1PZ9A 2VR4A 4CEWB 5J36A 4Z82A 3EJKA 3ZG6A 5MFPA 4WVVA 4NN0A 1PK6B 1W99A 3BPZA 1OH4A 3RZOL 4LT5A 1PNGA 1UW8A 2W52A 1PGSA 3G6JB 1XXNA 5EPAA 4Y52L 2V0EA 3U75A 1K5MA 2NMNA 3ST7A 4DINB 5HV0A 3H0OA 1WLDA 3J8F2 1LHUA 3VDDB 5A3MA 3TWIA 4CYDA 1YFXA 2ARAA 4QPYA 2XG3A 1R0JA 3AZVA 1LOFA 3FN9A 4QQOA 5FO8B 1MZEA 2YC4A 3LEGA 4OQ9A 4NIDA 4E8DA 5KXEA 4MVTA 1FPN1 4AYBP 1WJVA 2HWE2 2EAKA 1SLAA 4PT6A 3WF2A 1MPXA 4QIWP 5FRAA 2ZXQA 1TZOA 1UXZA 1KEXA 1PVC2 4L0PA 4UFKA 4FPGA 4RL7A 2MEV1 1DX8A 4L2NA 2PLV2 4X6QB 1GNYA 1N3PA 1J3QA 4Q4X3 4JGYA 2ID4A 2WAAA 1JN2P 4YZ5A 3PO3L 2TEPA 1FOD3 3USSA 1RDVA 2GSYA 2VMFA 3K3OA 3AL5A 3MF9A 3WW4A 1YC61 2ARBA 3A7QA 5F5IA 3D0SA 3NAPC 2YPJA 3PMEA 3OEBA 4N7UA 5FLIA 1JI6A 5BUVA 2XJSA 2EIEA 1PMJX 2JG8B 4FT8A 4OCTA 1B2OA 2B63L 4GALA 1VBA1 2HWC2 3MSUA 3WVJA 5AFEA 3BALA 5IVBA 3GDBA 5J3UA 1NLSA 1B35B 3I2KA 2XBO1 4RS5A 1X50A 2D40A 5DZFA 2R043 2GH8A 3K3NA 3ZSEA 4LOSA 3RYPA 3PIP1 1QQP3 2WZ8A 3KLSA 4P9GA 5KHKA 4YM0A 4XTMA 4AI3A 2O1QA 3KYYA 4IGQA 3BOWA 4NIIA 2RS31 1CIYA 1ND2A 1RTVA 1RUNA 3KV6A 1CAXB 2ZPXA 5A3OA 4Q8KA 2WQ8A 1MQTB 1YFUA 3ZKYA 1WZXA 3RG0A 1R083 2WINB 3AFGA 4NRQA 4ZU5A 5EQUA 3WDVA 1NCQA 1W0OA 1XYOA 3QH7A 2OKXA 4MGKE 3AC0A 4QT6A 5BNPB 4YVWB 2X10A 1LU2A 2BBAA 2BWAA 2W9XA 2ZACA 3EYPA 3E6DA 2MS3A 4QB2A 4R9CA 1JUIA 5F5CA 5I8YA 1SPPB 2MPFA 1IQAA 4AI1A 3DGTA 3ZO0B 1BBT3 2PELA 1AR63 4B4RA 2VAUA 2BVBA 4BA6A 2ILMA 1AZDA 4RGKA 1YUXA 1ZZ9A 2WO2A 3ZYGA 2A68D 1SBEA 1UIKA 3CJIB 2ZGKA 3SMHA 2RS12 4ITCA 1KITA 2WA3A 2HEVF 3RMXA 1O8SA 5F5QA 2DUOA 3PNAA 3I2FA 2BFUS 3B9IA 3MYXA 3S2HL 3ME2A 3URFA 4AAPA 3C2UA 4LA3A 2GNMA 4LUKA 4UW3A 5LWBA 2JXAA 2GNTA 4QDRA 2GNDA 3MUY1 4DUWA 1NLRA 3L2YA 4YW4A 2VZ1A 3QQCE 2J9UB 1FI2A 3PDQA 3ABZA 3F95A 1LOGA 2JEMA 2WO1A 2Z5WA 2VZPA 4AFMA 5C6CA 5HXMA 4CCNA 2A71A 1UY3A 5GM0A 4PI2A 2PAMA 1SQ4A 2VM9A 2ZEYA 1QJY2 1O59A 1GWLA 4J6GA 2FDFA 4YVSB 1URXA 2YC2A 1N1TA 3LD8A 4JDMA 4FPFA 4QKDA 1Y43B 5C4WB 1EV12 1SFOL 7RXNA 3ZOIA 2WS92 2DCZA 4G9SB 5FJHA 2BBVA 1U5YA 2O5JD 4HSJA 4IUGA 2IXLA 3ZMNA 5HI0A 2B9VA 1AR83 1SACA 1OQ1A 2P6CA 4QHZA 4RGGA 2ZAAA 4WVZA 5LB6A 3AFKA 4AR2A 4E2GA 3MIEA 5F7UA 1NY72 3RNSA 1AYM1 3FBMA 1U5XA 1W9TA 3KMHA 5FP7A 5FYBA 1OA2A 2XL7A 3S1ML 2WFF2 5GAEc 2RJLA 3T0BA 1SLLA 3WW3A 3WY6A 2VNRA 5LBFA 2WNVB 5GZGA 2FZ2A 1NKGA 5MGNA 3CKHA 2I74A 2Q5TA 2Q8DA 1OURA 3N7MA 4LHKA 2YU1A 3FBYA 5T5JA 1PFVA 2RHPA 3NKGA 4FFFA 3H9CA 1NOVA 1ZBE2 3KM5A 3CO2A 4YRDA 1NZIA 2BOIA 2RDQA 3N7KA 3RQ0A 2G9FA 5FPLA 4CDXA 1CZSA 1D4M3 2D44A 3GTQL 3D82A 4I09A 4MG2A 4A7YA 4M4RA 3LFIA 2CNAA 2ET7A 4HG6B 2FDIA 1YK4A 3GTPL 2HH9A 2N7GA 2H0BA 2VXRA 4YZ1A 3ZFFC 5DM61 4ZY9A 5JVVA 1XQNA 1UZVA 2WLPA 1ASJ2 1KQRA 1OWCA 3D3AA 4CDWB 1OHFA 4BZ4A 4BIOA 1KDMA 4E9KA 2ETEA 4DXRA 3NJZA 2VG9A 4QU2A 1MEC2 3OPZA 1PM4A 3SCGA 2GC2A 4XVHA 5JCTA 5FY9A 1DYOA 1RUH3 1ULGA 2VOKA 1DFQA 3QCWA 1Z92B 1SDWA 2OPKA 3BPSA 2VOXA 4CEWA 2IUWA 1JZ4A 3O1TA 4OHWA 5CFDB 1C8M2 4WM8B 3I2DA 4I0WB 1L7LA 1PK6A 2OZ6A 2VL4A 3NWKA 4HN0A 4QU1A 4G6BA 5FP8A 3S6PA 3FUOA 2VCCA 1AX1A 2F17A 3THDA 1LEMA 2W94A 4RXNA 3MW4A 4JV4A 1VRH2 4AYUA 2VZOA 3MO4A 5DXDA 5FZLA 2XUMA 5MF6A 2D3RA 3GTLL 4AQ6A 1DLLA 2BV4A 2XVGA 4W8JA 3VDDA 4YFZA 1DQ1A 4JQTA 4Q29A 3N3HA 5AC93 2Y0IA 3WW1A 2KN9A 1BQPA 2PMWB 1QJX2 4QD2A 5FLJA 3CL1A 3JZVA 2WB1P 3IAQA 3GTGL 1QEXA 5FYZA 1CN1A 4XE9A 2XJRA 1VAKA 1WWYA 5CYYA 1TVGA 3POFA 3ZSKA 2ZBJA 1O8PA 4XHXA 4BLJA 2V72A 2W1SA 2CAUA 2P4EA 3ZSMA 3I49A 2EF6A 2VMCA 3VDBA 4I02A 4A3FL 1W0PA 2XWBB 3TN93 5M5XL 1DGRN 5GAHc 3DKWA 1IROA 2P5BA 2XONA 3HQRA 4A2UA 2EIBA 4CE8A 4E2QA 1S0JA 1DCSA 4ORFA 3SKVA 4R4XA 5FOJB 4UAPA 3U78A 4PIXA 4M4PA 3ZFEB 4MGTA 4C91A 4UW6A 3PL5A 4LKSA 4UFIA 2VBDA 2F4LA 3S15L 2BUKA 3AYDA 4Y4YA 5FJKA 1EV13 4OLLA 2JG8A 5GJ6A 1XNKA 1POV1 4NHKA 2JIJA 3WDUA 3IPVB 2YB7A 3L2HA 1CGPA 1B35A 1D0GA 4FXGB 5FPVA 4DNYA 3JD72 5CFDC 2FDKA 1H9WA 1NXMA 2F4PA 4PJYA 2G9GA 5FZAA 2NYDA 1PZ8A 1W6QB 2JG9C 1F4HA 1U5IA 1R093 2VVFA 4FPYA 4Q4Y2 4QX3A 1R0FA 1W8OA 5A32B 4B1LA 4DXZA 4XFGA 3RWNA 1V0AA 1VBD3 5DN2A 3RFRA 5LASA 3N4MA 2EXHA 5CG9A 1VRBA 2OT7A 4R9DA 1CAXA 1HJFA 1NT0A 2VECA 4QX0A 1MQTA 4H2AA 1E5SA 3ACLA 5BNOC 1OT5A 4XJZA 4AVAA 3P8BA 4C3HL 2BTVC 3P2AA 1GANA 2ZGQA 4A41A 4GJZA 2RV9A 5BNPA 3O1UA 4YVWA 1VBC1 4FPEA 4YG3A 3N9QA 1OKQA 1RUI1 4LBQA 1SPPA 4ZN3B 4PIYA 1ASJ3 4XABA 3H3UA 4CCKA 5FJ8L 1EAH3 2CWMA 1AR92 1LAJA 1Y7BA 1RVF3 1PVXA 2J1SA 3RVHA 3VB9A 1UYPA 5GZCA 3JBG2 2IXIA 3ZXDA 3CJIA 1Z7S1 4GB31 5FV3A 2YPDA 3TAYA 3H42B 4JKKA 5HCBA 2W2IA 2NP0A 4YSFA 4NRPA 5JXHA 3WHTA 4DEVA 1AXYA 4GH4B 1ZRRA 3LIHA 5D2AA 3GJBA 5JWPA 2WWJA 1DIWA 2WWUA 3VHRA 3KGLA 2P3KA 4ATEA 2JB4A 4KI5M 3ACIA 3CJXA 2XJVA 2JDAA 1PIV2 2WNUA 4M0NA 2M4YA 3HBKA 5FMOS 1UNBA 1YCIA 1YQCA 3DPRB 1W9YA 3HAGA 4IE7A 1Q8QA 2YG0A 6RXNA 4YGDA 4D0QA 1VRH3 3PU8A 1AUYA 5I8SA 2Y34A 2Q1FA 5BNNB 1G9DA 4YVSA 1OSGA 3NV4A 1CJPA 4XFFA 2EXKA 4L11A 1YV1A 4FFGA 1QJX3 4SBVA 5IVEA 4JGYC 4K3UA 5SV5A 5HPOA 1TMF3 5C4WA 4KG8A 3GCXA 2C9KA 1WLTA 4QAWA 1VBE2 3WG2A 4M01A 4JC1A 2V4VA 1HKDA 4PDWB 3AZYA 5DAQA 1HN1A 3KQRA 2WQZC 1YQ5A 3AVSA 1SFYA 4XCBA 2E53A 3UKNA 4HVQA 1LKMA 5JVG1 4F8AA 5JSPA 2JX9A 2CYFA 4BQ3A 1MR5A 3CQOA 2YDEA 4KWJA 3PJYA 1JYIA 5C4JL 1W2AX 3LOIA 3I8TA 3R4SA 4CPBD 2FDGA 1XYNA 3LDKA 4KMQA 1VBB3 4HVOA 4IV3B 2HWB2 1IZ3A 3WP3A 3OPWA 4R52A 3WINE 2WUHA 2IFWA 4J1XA 2WWSA 4CZSA 1PO23 1ENSA 1E5IA 5JXGA 3HOBA 1RMU2 2UYAA 1DQ6A 2GC0A 3RDIA 2JDZA 4C1WA 2A6ZA 1YUZA 3RZDL 2C6SA 2ADEA 3NJYA 3MLJA 4CCCA 2RVAA 1JOPA 1K12A 4NO4A 4CP1A 1UZ0A 3VBSB 4AHWA 4ES9A 3H50A 5FXXA 4WM7C 3V65A 3AP9A 5I8TA 3V0AB 5K7PA 2HWE1 3CHXA 4NHYA 4IGPA 1JXNA 3WX5A 4IW3A 4NAMA 4WV8A 5FFOC 1PVC1 5FPAA 4CDWA 2ARXA 1QNWA 2PLV1 3VD3A 3ZIXA 1HRI2 1UO9A 1XNCA 5LA2A 2G4IA 1LHVA 1P8JA 2H6BA 1GNZA 3UT0A 2PPTA 3HOXL 3ZYFA 5HV4A 1RUJ3 3N36A 5KBFA 3NKTA 5EFUA 2PHFA 1UMIA 4Z1VA 4Q4V3 1PZXA 3FL7A 4A6OA 1IKPA 4A3KL 3B94A 4QPIB 2NVXL 4KU7A 4MXWB 4TLGA 4BISA 1F5FA 2UWCA 5FZIA 3NNLA 3FHQA 4AEKA 2YGLA 3POJA 3AZXA 1TEIA 1AF9A 4WM8A 5CKNA 3H8OA 2ARCA 1SCSA 3ENRA 3KF3A 4QDQA 5C8CB 2M6PA 3S16L 4DUXA 1HB2A 3AYAA 3K7AL 3OJBA 1ZRIA 5A7QA 2VUAA 4C8DA 5AN9H 1GKBA 1CADA 4NIHA 5AFBA 4CEYB 1V6MA 4X6AL 2X09A 1LECA 1X33A 4URTA 3IU3I 1JOJA 2ZHLA 1VAMA 1DYKA 4HSLA 2E9QA 2XKOA 2W1WA 3KSCA 1DDLA 3B93A 3BUCA 4GWNA 4QPGB 2X8KA 1NAEA 2CAVA 4QXKA 4XMIA 5F39A 4E4SA 1H6YA 5H9RA 2BDRA 1RUE1 2DSXA 4CCDA 1ZRCA 1BK0A 3POIA 2W1QA 3DF0A 2G1MA 4TWTA 4YM2A 4AEJA 3ZXKA 1GZ9A 2W1UA 2HWD2 4EWDA 4KGGA 4R9AA 5E88A 3VBHC 5IW0A 4ET7A 3CIHA 3VPBE 4A3CL 1NCRB 1PIV3 2DVBA 1OXCA 5FY1A 4LBOA 1T9PA 1FPN3 3HJRA 4UWDA 1JYWA 1LOAA 1RUG1 3OUIA 2RS53 2FDJA 2ZX4A 3J7HA 4L8QA 3U4XA 4N8MA 1W6NB 3AMNA 1IG3A 4RSUA 5C7GA 4LHLA 1OLRA 3KT7A 4Q26A 1WMDA 3ZFEA 1TNRA 5I0TA 4PHZA 2VQUA 4B3NA 2VUML 3QVDA 5KC5A 1SBFA 1FV2A 4UF0B 4LIVA 2W68A 1AR72 2VQAA 4QX5A 3GF6A 5ANNA 2LTNA 5GLVA 2RS11 1W06A 3UGGA 3LWQB 2VW0A 5A1AA 1TME1 1UKGA 3IPVA 2OZJA 4GWMA 1NXD1 4M00A 3ZMOA 4MGQA 2Y6GA 4XCAA 4XUTA 5DZEA 4XURA 4BBSL 3VBRB 5ACA2 4FPCA 1S24A 1UL9A 1ULCA 4QMAA 1W3XA 4C0BA 1W6MB 1W6QA 2XBO3 3CEWA 3M8LA 3MW2A 2LUWA 3P6BA 4P5HA 4QB1A 5FO9B 3H97A 2FCTA 5A32A 2CGNA 1WBFA 3LOBA 3VBOC 1RYTA 4SLIA 1XB9A 3TNQA 3CU7A 5FQ0B 3DL3A 5TSWA 1JZ6A 1QJY1 4IEYA 4YZ4A 3Q8BA 2VZRA 1LHNA 1PO12 1FV3A 2WO7A 4MXVA 4UYBA 1XBFA 4ZONA 4EROA 1S0BA 2QQKA 4DY5A 3LNLA 3S1QL 1G7YA 4FOYA 3ALQA 5LBEA 1R1A3 3M3YL 2IVIB 2RS33 2GMEA 1OBNA 2J1VA 4AAXA 2CKCA 3A21A 4BWOA 5EJ3A 3AXEA 3ES4A 2WS91 4LUMA 2VW1A 3EHKA 2E2IL 3WZ1A 4CA9A 5DQ0A 2DBIA 5EZWA 5ERLA 2NVTL 2XXZA 4P00B 3KYXA 1C5IA 2HWF2 4WZFA 5EV7A 4BQ4A 1VMJA 1HRI3 2VUJA 1MS0A 1XU1A 3M3OA 1PK6C 2ZIXA 2R063 1ULOA 5L9VA 4OUMA 1A8MA 2JKXA 3KV9A 4LHNA 2ZEXA 4GH4A 5APAA 1T9OA 5GZEA 5J96B 2VNVA 2QTWB 1JHNA 5I0RA 3AP6A 3GZTB 3HJWB 2E31A 3VDDC 3JB8A 5DPNA 4UBGA 1UMZA 3I54A 4HETA 2E6VA 4QDSA 3LPGA 2OYZA 3K35A 2ENRA 1TWAL 4LR4A 3DPRA 1QXRA 2JE8A 1M4WA 1IKQA 3OY8B 4BQYA 5BNNA 3TNPB 2RR11 3WHUA 1DZRA 1QJEA 3JQXA 4LPLA 2V5DA 2WDBA 4AR5A 1SMMA 3DKQA 3KGZA 4LBJA 5FYVA 3NL1A 4LEJA 4OHZA 3WUDA 4URAA 2RMU1 4R4ZA 4YGCA 2PMZP 1CZTA 1MEC1 3TRSB 1LGCA 5C4XL 3HNMA 3Q9OA 4Q4X2 1Y1VL 2LCQA 1LKPA 5JVH1 3I97A 2G9ZA 1XSQA 4YWMA 1T6BX 3FX3A 1LCLA 1WD3A 1NZCA 3JXSA 4MHUA 5MFZA 2QQNA 1L7RA 1RJ7A 3LFMA 4Y1ZA 2JE7A 1MS8A 4LKDA 5E89A 3U07A 2FCVA 3AXDA 5IK4A 1C8M1 2Y38A 3U37A 5IHRA 5J1XA 4IV3A 3EBRA 4QHBA 4FQZA 4QB6A 1AYM3 1B35C 3EMRA 3H1YA 3OGGA 4AFDA 1JYXA 1ND3C 1OLMA 3LWCA 2GH2A 5FMCA 2A3WA 3I2HA 4QX2A 3WCRA 4BK4A 1GSLA 4FOWA 3LA7A 4YW1A 1JW6A 2ORZA 2R042 3MGUA 2WN2A 4BY7L 2WZEA 1QQP2 1Q56A 3VBSA 2PSMC 1NXGA 2ZHKA 5C3QA 1P7PA 1ULPA 1I1EA 2F6BA 1M06G 3TBDA 3O1SA 3V0AA 4BQ5A 4FTBA 2WL1A 4IV1C 3LB9A 3IIAA 2P3IA 1MQTC 2Z4FA 1C3HA 3U4SA 1RYYA 2YYOA 1S0DA 2DVDA 2VCBA 4QX1A 4LITA 4NJ4A 2YU2A 3RZZA 3R4UA 1UOGA 4ARXA 3FLPA 1R082 4XUOA 4BU2A 3VD9A 2Q4SA 2VJXA 5E1RA 2OPWA 2JA7L 4PLOA 2GALA 4IEOA 3MW3A 1PO13 1SMVA 2G19A 4POFA 2ZGLA 4QKBA 2RM22 3VZOA 3NJVA 4BDVB 4QPIA 4MXWA 1MS3A 5HCHA 3MFAA 1K83L 1PFWA 1OFSA 4B29A 2WQ4A 4GKXA 4Y24A 1BBT2 5A33B 1AR62 3BTZA 3Q8EA 4Q2FA 4XF9A 3P3NA 5FZ8A 4EYUA 4NPMA 4DO0A 5I0SA 1Y9MA 3LSDA 4A7KA 3O1VA 5C8CA 3HVDA 5AI3A 1X36A 1ZZ6A 2ZA9A 4BB3A 5L36A 2FCUA 4FBFA 1REDA 1HX6A 2BGCA 3K4ZA 4FSJA 2HWF3 2ZGSA 4V1PA 3S57A 3RZTA 2J22A 2W91A 3LEIA 4IEVA 4HKWA 1XNBA 2O0OA 2P3YA 4RR3C 4XF0A 4EN9B 3QH6A 4XJ8A 5KR7A 1Z0HA 5EIYB 2WNUC 4AR4A 4LMFA 4DMIA 1QMJA 1YI9A 4MGIE 1O4ZA 3HOWL 1IPSA 1HXS1 1UY0A 1ZBA3 3THCA 1DQ0A 1W6PB 4QPGA 5CFCC 4B1MA 1OWBA 1RUD2 1PFUA 1D0HA 4FP3A 4YVSC 2JDUA 3RI8A 3TEXA 5KHJA 1BEV3 4OI2A 4MZUA 4ISQA 3WWNB 1A78A 1D7PM 2E7AA 4XJ9A 1A34A 2AH2A 4N53B 1NCRA 1ZRDA 2DCJA 2IXJA 4KQ7A 4FI9A 1YO8A 3SQOA 3I3QA 4X8PA 3V56A 2W47A 3GTOL 5C44L 1W6NA 2X5IB 5C71A 5DZGA 3HN3A 3M3EA 5H9SA 2E33A 1GZTA 5C9AB 3H8RA 1NQJA 1AR91 2AGSA 4OZOA 1AR82 1VR3A 2ZKNA 3C7GA 4HL0A 3WF0A 2HYXA 5E16A 4UF0A 5K0UA 4YLZA 4UBHA 2BZDA 3JBG1 3HQXA 2CGPA 5ABJC 3SNMA 5A1FA 1ULDA 5FZ7A 3PWFA 3LWPB 1X8EA 2NN8A 3GBWA 2AUSB 3O7OA 4IE4A 5FZKA 1W8WA 4BPZA 3HT1A 1S0EA 2J42A 3RRDA 5LA1A 3VBRA 2D5HA 1R9TL 2GU9A 3HOYL 4O9EA 1CPNA 3W5NA 3OBAA 3B02A 3RZGA 2WBKA 1EPWA 3VKLA 4AVBA 4NRMA 4XFCA 1QJU2 2Y8KA 3I2IA 1QU0A 4LO8A 4C3JL 2Y6FA 5FQ0A 2OQ7A 1D4M2 2JDKA 3FLTA 5FMBA 2R16A 5CKQA 4A3EL 5LCWL 5A3NA 2ERSA 3LDRA 4AK3A 1H7VA 2E63A 3T09A 4CDWC 2H12A 4IEPA 3ZXLA 1NYWA 3C7FA 4HOOA 4IEXA 3T4HB 4XQ4A 3ELNA 4CU8A 2BERA 3FFQA 2ZKLA 4M0HA 2C6BA 1VBE1 1DLCA 3LSEA 4IEWA 1AL21 1FT9A 1W2UA 2JDMA 4MO3M 5CU1A 3ROUA 1RUF3 5FZOB 2A6YA 3OBTA 4CUCA 4NOTA 4RQPB 3I2JA 4Y4RA 3T2OA 4FPHA 5HXVA 1HV1A 5JAXA 2ZEWA 5E6HA 1UOFA 1UXXX 2V0FA 2XLFA 1QWRA 4XAEA 5EXOA 3AZZA 1RUH2 1G6NA 1RUI3 4XJWA 5GZDA 2GNBA 4ZHNA 4A3ZA 3KCXA 2HWB1 3TYJA 4FTSA 2A5ZA 1VB4A 1QCVA 1HN0A 1W8FA 5FZEA 3LEKA 2XJUA 1UZWA 4J1WA 2HJIA 1GQHA 2RM23 3ZR5A 1FMD1 2W39A 2Q8OA 3UYJA 3PU3A 2GC3A 4XBQA 4AHXA 1RJ8A 4CSWA 4NUBA 4JKLA 5F9TA 2CTVA 2EIGA 1PX3A 3N9LA 3K48A 1ZA7A 5AC92 1UPIA 3AVRA 1EUTA 1VALA 1TWFL 1WMEA 4U671 4WBBA 3OY8A 1WCKA 4YM3A 5ISLA 1DYPA 4XUQA 1BQ8A 4EN6B 4K21A 3I3DA
chains in the Genus database with same CATH topology
1SBDA 4RHV3 1C4RA 1QKQA 1COV3 4Q1RA 2D5FA 4XF3A 4DOUA 1RUD3 2OVUA 3TN92 4XPVA 2ZMLA 2QCSB 3ILNA 1CIWA 4AE2A 3WUCA 4Y1VA 1RGSA 1RUC3 1AXKA 2OA2A 3ASIA 2DCTA 4Q4W3 5DDJ3 1WD4A 4JDNA 1V00A 5K2ME 4ES8A 2DVAA 3AJZA 2D6MA 2Q30A 5KHGA 3ZSJA 4JAGA 1RHI2 2YV8A 4LTAA 5JIAA 1VZHA 5D8AA 1CAVB 1PZ7A 2ZMNA 3BB6A 1OLQA 2B39A 2YZ4A 3VKMA 4CP2A 1NA1A 3JU9A 2IXCA 4XEZA 4Z2WA 1ZREA 3VZJA 4AWDA 1YWKA 3CF6E 1R092 1ZRFA 2ZX0A 5CA6A 4OHVA 1V6OA 4OI1A 2NM1A 1O4TA 4Q0SA 1VBD2 2HWD1 4K8FA 3B69A 4DB5A 2ZAHA 1AXZA 4QM9A 2DURA 5GKAC 1QJU3 8RXNA 4XIKA 4JAFA 2JI1A 1SFNA 2PHDA 1QY4A 3NVCA 5CADA 3FWEA 1WW6A 3W59A 1DZQA 1DQ5A 2CKAA 5DM71 3S30A 5IK8A 1GFF2 3T1MA 1JBCA 4LO4B 3VZKA 1AYN3 3BTAA 1EAH2 1LEDA 5CNAA 5A33A 4CDQB 3J4UH 2XJPA 1RVF2 4GH4C 1PHMA 4NHMA 1U5ZA 3OCPA 3BIWE 3NAPB 2VH9A 1ZX5A 3FHIB 1YXWA 1R1ZA 3WQ7A 3AKTA 3GBFA 4FXKB 2HEYF 4N43B 1H8VA 1ZA4A 3UJOA 4AI8A 5JI7A 2XLGA 1ENRA 1BKZA 1CESA 1UAIA 2DVFA 3VHOA 2BW8A 1W6PA 2ES3A 4DQAA 2Z3QB 4XMAA 5BNNC 3WG3A 3GNEA 1Y3TA 2C1FA 4GQ7A 1UN1A 4LNVA 4JCKA 3ZIWA 1DGWX 1FXZA 1SEFA 3IBMA 4N53A 2B45X 2DTYA 1RUE3 3H1WA 4S2DA 3T2TA 2PHRA 1Q8OA 2QE3A 2FQPA 2X5IA 4PBOA 2DTWA 4Z8BA 1TMF2 3MLKA 5JOXA 5I93A 1BJQA 2D6PA 1JYBA 3LZZA 1RUG3 2D3PA 2DYCA 4IV3C 4M3CE 5EIOC 4HMZA 4Q0QA 1PMIA 1AX2A 4AHYA 1VBB2 2LALA 1S2ZA 3RJ2X 2VULA 1A6CA 1VIWB 4K1YA 4CRQA 1PM7A 3K51A 1N3QA 3ZYPA 2BE5D 4YARA 3FJSA 1TME3 1PO22 1LGBA 1H4GA 1GZWB 2WA4A 3SCHA 4EN7B 3MIGA 3WV6A 4YG6A 3PVBB 4Y1UA 1GBGA 1RHI3 1VCXA 3A44A 1MZFA 3ZFGC 1C1LA 3QLQA 3KD4A 1ZZ7A 3NV2A 1RWDA 1BVVA 2K0GA 2V73A 3O14A 3S7EA 3RZ6A 1V9U3 3IKWA 2AR6A 4AEDB 4XFHA 3R05A 2WT1A 2ZGRA 1HRV3 2XJTA 4OULA 1RDGA 1QOTA 3SH4A 1HDKA 2O8QA 2UY8A 5AI2A 4XFIA 1KJLA 4Q4X1 3DN7A 4RQPA 4AF9A 1D2SA 1OI6A 1S1AA 1RUJ2 1SLIA 1VLNA 1FOD1 2A6VA 3MFCA 3O12A 2JD4A 5CAZA 4BOWA 1QH6A 4Q4V2 2ZABA 3M1HA 2W08A 2XPJA 5FREA 4EN8B 1XE8A 3N7LA 3WDYA 4AVVA 1YJKA 1W6OB 4OUSA 2D6NA 2D97A 4LE4A 5JZGC 5A3LA 3MIDA 2UU8A 2PHWA 4HN1A 2VVEA 3FLRA 3MIBA 1IOAA 1GICA 2YMZA 4MX3A 5KC6A 1BRFA 3D8CA 4KH9A 2CV6A 4LO6B 4XIOA 4YM1A 3U0ZA 4UW5A 4QQPA 3UV9A 1K5MC 2GN3A 2D7FA 3AYEA 4ZN1B 1B09A 4TYSA 4BM8A 1RITA 4DS0A 1C1FA 3IN9A 2XKPA 3CLPA 4Q0PA 2D43A 1ZZCA 2A70A 1HIXA 1LOFC 1QXPA 3MPSA 1FPN2 3M7AA 2XGXA 3AYCA 1YNAA 3A0NA 2RS52 1LU1A 3HR9A 4L9BA 2WZR1 4XTPA 1PGW2 5T5PA 5K0UC 1BBT1 4B4PA 1AR61 1OD5A 3QBQA 4GIQA 5DG1A 3E6BA 2R071 1R0HA 3VBFB 3PVOA 1REFA 3B01A 4JAAA 2GMMA 1IRNA 4NWWA 3VBRC 2JE9A 4COWA 4Y5Z0 3ZXAC 2VY0A 3HN1A 1F8VA 4KWLA 1CAVA 1BVP1 3WW2A 5FDBA 2DVGA 1BE7A 3N7JA 5FOBB 1KS5A 4TZDA 2LM3A 2PTMA 4COVA 1LENA 5AVPA 2XBO2 3NV3A 2IZWA 2DUQA 2WNVA 4RS5C 1G9AA 5CG8A 4LBMA 3J8F1 2GC1A 3G7DA 2B9UA 1HQWA 5FLHA 4GMP0 1R1A2 2CWSA 2P2KA 4JGZB 2RS32 1EP0A 2AZ5A 1V6LA 1B2JA 4BH9A 1ND2C 2OW4A 5K8SA 3KYWA 2I45A 2D6OX 1AJKA 5CB7A 3VGIA 2IXKA 2QFEA 1YHFA 3THTA 3SXWA 4CDQA 1DBNA 2L0ZA 1NCQC 5KXBA 5SV8A 1YLLA 2VMHA 4ZU4A 2XL9A 1C8NA 5HCAA 2R062 3NAPA 1UF2C 3UJQA 3ZX7A 4TPUA 2BEOA 1REEA 2BYVE 1VZGA 2Y0OA 1VP6A 3ECQA 3POSA 4XOGA 4JVAA 4N43A 3PTYA 2ZJCA 1WUVA 4AVCA 4X8NA 5GLZA 2HWC1 3ZXJA 4OI4A 2WKKA 1U0AA 4LBLA 5DUVA 1AJOA 1RYQA 4HVRA 1LGNA 1UU6A 4AR3A 1HXS3 3VBUB 2JG9B 1PNFA 2CY6A 4JQRA 4XXAA 3VUOA 2E7TA 5C8WA 2YUEA 1BMV1 3M3IA 2Z2SB 3ZSLA 1EPZA 4DPNA 1RB9A 3KYUA 5IY0A 1OOPB 5J7MA 3LCPA 3B08B 2D93A 2DV9A 1IU6A 5BNOB 2B8MA 1F31A 1QOOA 1RUH1 1S0CA 2DU1A 2XB6C 3O5SA 1YRZA 4NHLA 3H9AA 1J3RA 5L7OB 3PZAA 2VMGA 4YG0A 1NXEA 4KL1A 5RXNA 4YYOA 2R0FA 3ILFA 4JRLA 2MEV3 1AYM2 2EALA 5D8AC 3I59B 1ZNPA 2KXLA 1GZWA 2ZCWA 1NA1C 3AM2A 2R0HA 4B7EA 2ZS6B 3WD5A 5AC91 4CTEA 2A6HD 3J7Y1 2R32A 4D69A 3IDBB 2PYTA 4Y1YA 2OIIA 4Q0UA 3ZDSA 5E8AA 1O3RA 1ENQA 1IU5A 1LKNA 3W58A 2B7YA 4U36A 4EWEA 4LULA 2A6XA 4AEDA 3GHMA 1VBA3 1WMFA 1D2QA 1BFYA 1J59A 4CDXC 4KU8A 1TE1B 4WVMB 4AI0A 3KYVA 5JPNB 4JDOA 5EYYA 4B4QA 4Y20B 2ZGTA 1AL23 3AMPA 2Q0AA 3MICA 2P37A 5GAGc 1YUDA 4XFBA 2HYKA 2QZ2A 1EV11 3M3QA 3IDEA 5HBAA 2A3XA 3GZUC 1OPMA 3AK0A 3WP5A 1W6OA 4PIZA 1VJ2A 1NY71 1W39A 1H8TB 1LR5A 3USUB 1N3OA 4CEWC 1LULA 2BNMA 1S2KA 1FMD3 1HLCA 4AQTA 1C5HA 2K2DA 1AVBA 1NQDA 4MGYE 2M4VA 5KWRA 2WFF1 3RS6A 4BLIA 1ZBA2 2KM2A 3WNXA 4YW2A 2UYBA 4S2FA 3MIFA 4FVVA 4I0AA 4N53C 2XWJB 4XYXA 3RSJA 1ZBE1 1BEV2 3GALA 4INDA 3OYWB 1X8MA 1G8WA 4WM7B 4Y22B 5FCCA 3RJRA 1RUOA 3FE5A 5IK7A 4LO5B 4S2GA 4D7SA 4D7YA 3FFZA 4G3YC 2D98A 1UZYA 1ZYBA 4B8EA 2JKBA 4YNIA 1ASJ1 1EAH1 1RC6A 1KD7A 2BNOA 1UKRA 2KA3A 3VBFA 3FMGA 3AKSA 2VNOA 4MH0E 4HT1T 4PDWA 4NWVA 1MS9A 2YHJA 4AGRA 2JI2A 2ZX1A 5CVRA 2PVEA 4UXAA 3SS2A 1MVEA 3GYDA 4Q0VA 4FP2A 2CGOA 3B3QE 3N35A 4K20A 5JMCA 3VKOA 2I2SA 2JG8C 1A8DA 1O3SA 3RMYA 3AMQA 1T6GC 2WT0A 4I3GA 4XILA 4AFBA 4BE3A 4YFWA 1SMWA 1OFNA 3RYKA 2VOWA 3WLUA 1G9CA 1VRH1 4OI0A 3THPA 2QL0A 4ASLA 4BIFA 2E51A 1APNA 1DU3D 4I2OA 1OPOA 1QJX1 1LOEA 4JGZA 1TMF1 3WCSA 4N9HA 2GZWA 3E97A 2Q1ZB 3NV1A 1RUF2 3VBHB 5GALA 1IGOA 1S55A 2PAEA 3AJYA 3WR0A 1RUI2 5BNPC 4YVWC 4F3JA 4OVEA 4ME3A 1CONA 2QUOA 2R1BA 4KBBA 3PKIA 1MZ5A 1PO21 2ERFA 4MV2A 2XLAA 4LLOA 4D3WA 5I91A 4YZ3A 1VAVA 1CAWB 5MLC3 1Q5OA 2NMOA 4H7LA 4O9GA 4FAHA 3GBGA 2VVDA 2WLQA 3L9JT 3CJIC 4KWKA 3O0WA 1X82A 2ZTNA 2QJVA 2C9AA 1QNYA 4FPKA 3JD71 3ETQA 4N9IA 3VBUA 2JG9A 3D6EA 3AKRA 1ZZ8A 5JLVA 4CEYA 4L97A 5JOYA 3VBOB 5EINC 4RHV2 4Q4Y1 4HLTA 2E7QA 5KXCA 3ZYJB 1COV2 4AEMA 1OOPA 1S0IA 4HZFA 4BMEA 2KKDA 1VB2A 4NVPA 5BNOA 5BV6A 2IFRA 2QDNA 4QM8A 4H14A 1Z78A 4YGBA 4DRVA 2VNGA 2NQYA 4CDUB 5C4WC 2B5HA 1RUC2 4GXLA 5L7OA 4W6YA 3X29B 4NR1A 4Q4W2 1LB2A 4R8HA 5DDJ2 4NPRA 3BCWA 2EA7A 3E5UA 1QGLA 1GZCA 3O0XA 1EY2A 4ONUA 2TNFA 4XZPA 3I59A 2A73B 4I01A 2R49A 4GMP1 2BWCA 4FPJA 3FUQA 4FPLA 4JTOA 3ZXGA 1N1YA 4RGAA 4OFGA 1CPMA 4AVSA 3J26N 3PHMA 5BYNA 2WC2A 1MACA 1DZTA 2VQ0A 2I07B 2WNVC 3QD6A 3LPEB 3IDCB 4L99A 3QOPA 3ZXEA 3BODA 5JDBA 1ONAA 1POV3 1H4HA 2DCKA 2R1DA 1IS6A 1W6MA 5KXDA 4HK9A 1PIV1 2FHRA 5K9YA 2X29A 4WVMA 1RB8G 2P34A 4ISRA 2IWGB 3UKVA 4K1ZA 2VW2A 1H1MA 2RS51 4A7ZA 1ULEA 3BU7A 2TUNA 4Y20A 1H1AA 2ZHMA 1PGW1 3ZN4A 4CDQC 4AW7A 1GNHA 4IESA 4XBNA 4FPOB 4XF4A 4LBQD 1AYN2 2QZ3A 4Y26A 4BCUA 3VLBB 4Q1PA 3O0VA 2V3BB 4IL7A 2AYJA 2NLRA 3ES1A 1LRHA 2A7AA 4N43C 1H8TA 2M6OA 2EVXA 1VBC3 3GHNA 3USUA 4F83A 2AYHA 2JENA 4WM8C 1ND3B 1XE7A 2R30A 3WP4A 4XJUA 3WWLA 1G9FA 1KDKA 1LODA 1RMU1 4XFAA 2FMYA 1Z7S3 3LKJA 4GB33 4JAEA 4WVWA 1C09A 3H7JA 5DUXA 4WZCA 3OYWA 5J48A 2MHFA 1R1A1 4WM7A 4Y22A 4CP0A 1RUE2 3MPPG 3VKNA 3C3VA 1EYBA 1GLHA 3A4UA 4IV1B 1BCXA 4PLMA 4PCRA 4HANA 5FTTC 2GN7A 3QACA 4AG4A 2BNNA 2QVSB 5LEKA 1RUG2 4M3CF 3MPBA 2H6CA 1HRI1 1S2BA 1N1VA 1O91A 2WZR3 4LBQB 3P3PA 4AGGA 2DFBA 2R061 1O3TA 2V09A 4K9FA 2ZGOA 2R073 4P9YA 3ZFEC 5DG2A 2QDRA 3VV1A 3VKFC 1KJRA 1H2KA 1YIPA 4E4DX 1LTEA 3AB0A 4ZU7A 1NG0A 3RI9A 4E4ZA 4LBNA 1TME2 2V5YA 5EWSA 1YK5A 3S7IA 2K2SA 1PGL2 4IETA 2BPA2 1ZRPA 2GDFA 2MNGA 4RR3B 3BOPA 4KG0A 3V0BB 4AEDC 4JTNA 3S0MA 3T1LA 1IS3A 2WNUB 4GS7D 2PFWA 3PKJA 5T5OA 3R0RA 4I30A 3ZXFA 1V9U2 4XF1A 5CFCB 4HPKB 3EQEA 1IPJA 1HRV2 2WFPA 1F5JA 1QJZA 2XH6A 4XETA 3H7YA 3J8F3 2WT2A 1WCDJ 1FATA 1XYPA 1LOCA 3VBHA 2IC1A 4RA0A 3EO6A 5HCFA 3A0KA 2YGMA 1SCRA 2K9ZA 3OD4A 3I7DA 2PHUA 2A6ED 2HWE3 2VL6A 2DFCA 5KHHA 2AENA 1DQ2A 2PQQA 1PVC3 1OMIA 1LTLA 1ZZBA 1R0GA 2PLV3 2XHKA 4C0HA 2ZZJA 2SLIA 1UZZA 2A69D 4EJRA 5T55A 1CAWA 1CD3G 1WLWA 5ABJB 3ZYRA 2C6AA 4TSVA 4UW4A 1AR71 1FAYA 2CL2A 1XU2A 2ZHNA 1OQDA 3U11A 5IT6A 3WDWA 5ACA1 3UL2A 1JUHA 1WW4A 4P9JA 2HWC3 4QGNA 3VHNA 2PYAA 1DG6A 2XJQA 3VBOA 1BZWA 1DGWA 2VMIA 3RYRA 3DPRC 2RR12 1DQ4A 2NPIA 3FZ3A 4AXOA 2UWAA 5CIRA 1J1LA 1SLBA 1PO11 2X53S 4I0BA 2RMU2 3SCFA 1FX5A 1YJLA 5T54A 1WGPA 3KZ4C 4PLNA 5LRRA 3VBFC 4CDUA 3MI8A 3WOGA 4BYYA 1D4VB 4XXPA 4PDWC 2H0VA 5C9AA 4Q27A 3RPQA 1F2NA 1DHKB 1SMUA 4EWAA 1O3QA 3KCYA 3MDPA 2HWF1 4AGVA 1FHMA 3E5XA 5IUQA 2XVKA 4OHXA 4XGHA 2XVLA 1ZBA1 4BHPA 4D94A 2DF7A 1FYUA 3TOJA 2FMDA 4LO7A 3WDXA 5C33A 5J37A 2RS13 1S0GA 4XQDA 1BEV1 1IW7D 4PF5A 1S30A 3M70A 4JGZC 4C1XA 5F6LB 3OF1A 1UPSA 3VBSC 3WQ0A 3D4KA 4HK8A 1QDCA 4E2SA 2R6QA 3VZMA 5GZFA 3ZVXA 2B46X 2RJKA 1ZM1A 3M3CA 3JB4C 1LKOA 1B71A 4UY81 4COYA 1ZVFA 1QJY3 2P3JA 4MUVA 1ODHA 1QOSA 3MEPA 3J7Z1 4IXLA 4WFN1 1V6NA 2OUJA 3APBA 1B13A 1U12A 3E5QA 4QPIC 2WS93 4AI2A 2DCYA 4IERA 4C90A 4QQHA 1FHHA 1DGLA 4E27A 1CQ9A 1CAUB 3OD0A 5GLUA 1ND3A 2W0XA 2RE9A 3SH3A 5C8CC 4QGLA 2WJSA 5JOWA 5T5LA 3AKPA 3VBUC 2WZPP 2WFF3 2WSUA 4H55A 1QH7A 4L92A 4CEYC 2C0ZA 5JPMB 2SBAA 4QQLA 1HXS2 2R041 3NO8A 4LLFA 4MYEA 5T3NA 1QQP1 2ERJA 3HIFA 1OOPC 3J9SA 2A6WA 4QPGC 3H3ZA 4Q8LA 4IV1A 3E6CC 1ZBE3 1V6IA 1RUF1 5H1Sc 2GMPA 4F7ZA 1ULFA 2AUYA 4MLOA 4XDQA 1Y9QA 4FCAA 1NCRC 1FNYA 1MVQA 2ZGPA 3AP7A 5T52A 5L7OC 2WNEA 5FAXA 2RR13 3OGJA 5DUWA 4KGQA 1R081 4TLFA 1Q8SA 1V70A 3ZFFB 2RMU3 1WCSA 4FO9A 5J98B 2ZX2A 2RM21 4P9WA 5JSOA 4B7KA 2MEV2 3W9AA 1MEC3 2YROA 5FPZA 3RYGA 2JJ6A 1J1TA 1IPKA 1JH5A 4YZ2A 3UK9A 2B42B 1LJ7A 1BK1A 5H9QA 5F1RA 1A3KA 1WLCA 4EV0A 4YW3A 2BQPA 4RR3A 1NE6A 3V0BA 1C8M3 1AX0A 3HBZA 2WIIB 3DV8A 5EYXA 3D5OA 4AHZA 1F9KA 1Q43A 4RHV1 1H1IA 3SLIA 5CFCA 1VBA2 4HPKA 3ZN6B 4K7JA 2YC0A 3SH5A 4LA2A 1COV1 1C57A 2ZX3A 1VZIA 1GV9A 3DUIA 5DUUA 1RUD1 2UY9A 1OQEA 1GQGA 1ENXA 3KB5A 4DY3A 2Q1MA 1JTZX 4DFSA 3WQ1A 4EN0A 3WT3A 2PAKA 3R4DB 2GMGA 1H30A 1AL22 2PN5A 1RUC1 1O5UA 3AZWA 3WDTA 5B2GB 4Q4W1 5DDJ1 4GA9A 2VOVA 1O5LA 1HW5A 2ZGMA 1WW5A 3ILRA 3AX4A 1BQ9A 2FBEA 1BYHA 1XRUA 1H8TC 3MLLA 2B5ID 1AR81 1UIJA 5FBZA 5ABJA 3JCIA 3M4FA 5T50A 2DWRA 2UWBA 3PVNA 1CR7A 3MF6A 1YYNA 4G4FA 1FMD2 3B9CA 2CR8A 4IEZA 1GYKA 2DUPA 4U2AA 1O4YA 4GULA 1UU4A 2O8OA 4AQ2A 4BMBA 3PIO1 1IS5A 1UU5A 3JD73 4P9IA 3ZFGB 4HBNA 2PHTA 4AFCA 5JOZA 2Z3RB 1QJU1 5F6KA 1UX6A 4FOQA 2ET1A 1HQNA 2A75A 1D4M1 3MIHA 4XBLA 1RINA 2IXHA 3UKTA 5CFDB 2AREA 3M2MA 4Q4Y3 5LRSA 4KNCA 2BFUL 2QKDA 3AMHA 4FTEA 4Z07A 3VZLA 1V6KA 4XW3A 4OHYA 3IWZA 1V6JA 1AYN1 4D7TA 2QNKA 1KFXL 3HMYA 4K40A 4LBKA 4OZXA 3NFPI 3LA3A 3GZAA 3EXUA 2EXJA 1O7FA 2UURA 3JUUA 4B8CD 3ZYIB 1H2NA 3JQWA 1G86A 5L19A 2Z42A 4JRAA 4M3CB 4GMP3 1AR93 2D6LX 4HKLA 1CJDA 1UD1A 3PLQA 1KFUL 5LK7B 4XXBB 5JZGB 4H3WA 1KXGA 3AP4A 3JBG3 5JSRA 1WA4A 4QQ2A 2EAAA 4YWLA 1KS4A 3VL9A 4META 3B7MA 1LHOA 1MZ6A 1TQ5A 2WSVA 1LOBA 1RL3A 4H7MA 4YW5A 4K9SA 1MS1A 2VU9A 1K5MB 4PQ9A 4XHBA 5BXXA 5IK5A 2TBVA 1QF3A 1QHDA 2OUHA 2PHXA 3SHRA 3TB0A 2HKXA 2ZZQA 3AKQA 3PJQA 3POWA 5AVAA 2BVVA 1YI7A 3AP5A 3D0JA 3AMMA 3KCCA 3TN91 3VZNA 4YGEA 5K0UB 4LE3A 1VBE3 4W6WA 1GR3A 4JGYB 2A3YA 3I4IA 3VN4A 1CAUA 1LESA 1PGL1 3LA2A 3ATGA 2C5DA 4E6YA 1FNZA 4W6XA 1J58A 1RHI1 2VPVA 3SISA 1OA4A 3INAA 3POYA 1MS4A 1UCXA 2PHLA 2HWB3 1IHMA 1AL0G 3R6SA 4ATFA 5L73A 2VGDA 2YXSA 1V9U1 3KS7A 4HFSA 1N1SA 1HRV1 1Q3EA 2D3SA 1E8JA 4N90A 2YY1A 1RMU3 1YFYA 2NYYA 4XJAA 1R091 1SLCA 4RS5B 3VHPA 2PVXA 4P14A 2DU0A 1NNQA 1YIFA 1VBD1 1E57A 1Q8VA 2HEWF 4A3XA 4CDUC 1Q8PA 3SITA 4W65A 1MS5A 4S2HA 4Y1XA 3PVEA 4P9XA 3KT4A 1CX4A 2X5IC 5C9AC 5JR7B 1ND2B 5GLWA 1IS4A 1CVNA 3ZFFA 3FC0A 3MZHA 1KRIA 3HT2A 3WP6A 1NE4A 4FOVA 1NCQB 1X7NA 1H2MA 1RVF1 3WG1A 2ZGUA 2HR5A 1C28A 3B5LB 3IM0A 3OTFA 2Y26A 3WXPA 1RIRA 4MSVA 3H1MA 1QXJA 4IQPA 3H8UA 1TNFA 2QQPA 3WG4A 1HV0A 2RDVA 4QGMA 3V64A 3ZN6A 4DZGA 1I9RA 2JI3A 3B0AB 2JICA 1OA3A 4XQWA 4X6RB 5JIUA 1JYCA 4TVMA 4IEQA 1H0BA 4AFAA 4Z92B 1ALYA 4HKOA 3KT1A 3OBRA 1CAAA 4AQSA 3NW4A 3IMNA 5H9PA 4POGA 5J09A 1I3HA 2GAUA 3PMSA 4GKYA 5D1IA 5GLTA 2HWD3 2P17A 1H2LA 1FOD2 4RQPC 5KHIA 4PBPA 2ZMKA 1HQLA 5GADc 4RD7A 5LK5A 1XNDA 4BQ1A 4AVTA 3U10A 4DRRA 3LAGA 2ZOEB 1VBC2 4ZXKA 1I6XA 3HD8B 1DF0A 1VBB1 1J3PA 5D8AB 1AR73 3LGRA 2Z79A